3FOFC

Structural insight into the quinolone-dna cleavage complex of type iia topoisomerases
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
220
structure length
196
Chain Sequence
b'TPAQSNPAKNELYLVEGDSAGGSAKQDRKFILPLRGKVINTAKAKMADILKNEEINTMIYTIGAGVGKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKMSKGKGKKEEVAAWTDGELEELKGATLQRYKGLGEMDQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA topoisomerase 4 subunit A
publication title Structural insight into the quinolone-DNA cleavage complex of type IIA topoisomerases
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Isomerase/dna
total genus 19
structure length 196
sequence length 220
chains with identical sequence D
ec nomenclature ec 5.99.1.-:
pdb deposition date 2008-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
C PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fofC00
2RGRA 4J3NA 4G0WA 3QX3A 2XCSB 3KSBC 4Z3OA 4FM9A 3K9FC 4Z53A 4G0VA 1BJTA 2XKJE 2XCQA 2XCOA 1BGWA 4KPEC 3RADC 2XCRB 3RAEC 3LTNC 4KOEC 4I3HA 3KSAC 3L4JA 3FOEC 4G0UA 4KPFC 3L4KA 4Z4QA 3RAFC 2XCTB 3FOFC 2XKKA 5EIXA
chains in the Genus database with same CATH superfamily
3SVLA 5C4IA 2HMAA 1ZN9A 3TDMA 1DHRA 3U3JA 4G41A 3DBRA 4P9NA 3U1BA 2YS7A 4GBED 1Z07A 4FM9A 3QA3E 4A6XA 5EC8A 1QFYA 3LC7O 3WJ2A 3HBJA 1G4UR 3VFDA 1QRUA 4NQRA 3A27A 1FS4A 4KQEA 4TKZA 1E18A 10MHA 1U94A 3OPNA 4JYZA 2BONA 1ZUNA 2JAXA 1B8PA 2QTAA 3WQRA 1BN7A 3D2CA 4N8DA 4FDAA 2I9PA 4YA6A 4AJ4A 1OLSB 1YGPA 1U1FA 5GM2A 5AUPB 3N2IA 3L0YA 3AETB 1MDFA 4IVQA 3K5PA 1T4GA 2Z5GA 2P9BA 4EMSA 5IT0A 2UYCA 2K2WA 5FBZA 3FTNA 3M5WA 4BU1A 2FN9A 5JY6A 1ZA2A 1ZVJA 4P4SB 2ZYTX 3F7TA 4DQ0A 4PRLA 3AU8A 1LPBB 1FNNA 1K68A 1UM9B 3C5EA 5DWQA 1AO0A 4RL6A 2HMWA 4EZIA 4R1NA 3HUTA 2Y0EA 3M83A 3TBFA 3ONFA 3DPIA 1GO2A 4IRUB 3IQWA 5AOCA 2R1TB 3LGSA 1C8LA 2ZB8A 3FOBA 4YMVA 1PUIA 4BFLA 4LSMA 2OECA 1E9CA 1W0JD 4D6XA 4A7PA 5E3HA 2LTAA 3UBTA 3QUQA 4RLQA 5KYXA 5BWCA 4I4LA 3QVWA 3FI9A 5EGNA 1J23A 2AF3C 5EA2A 4QYMA 2ADMA 4KHZA 3EF3A 4BTVA 2H54A 3AERB 3KSDO 4HQLA 2BFMA 3NJRA 3SLRA 3U5ZB 1GGHA 4Y0NA 4FFMA 1AIPA 3H3FA 4AZ0A 3P4YA 3MSXA 1R6XA 2P7IA 2R8PA 1EWKA 3IEIA 4FNOA 4AJ2A 2R8YA 2O0MA 2FPGA 4I4TF 3RAPR 1YWGO 4CW7A 4H6VA 4B4UA 1CC1S 3OJEA 4TQUS 3A3PA 3AU9A 4CKCB 3IBSA 1FVXA 1Y3HA 3LW8A 1W85B 1JAYA 3ILSA 4F1JA 3I0ZA 3KALA 4DMFA 4E2FA 1QM5A 3HDGA 1VIDA 3GLGA 3IVMA 4G4GA 3TLJA 1PQ4A 4LXTA 3VR4D 3FHTA 5SZJA 3U3MA 1JQBA 2I22A 3TLKA 5FX2A 3F73A 1WEKA 2ZSFA 1T13A 1QHIA 1WULS 4KSBA 4Q02A 4HADA 2H0AA 5F2EA 1EKXA 4ENWA 3PF8A 2G5GX 4QJ4A 4UUOA 1FFWA 5AI9A 1JPJA 3WLTA 4A2WA 4A0HA 4D8TA 5EJEA 3DGFC 3LH5A 2AD1A 2QTGA 3M6UA 3OTQA 5CLLA 3EFEA 1U3VA 2RHGB 1OAOC 4PIVA 4NAUA 5JYEA 2R87A 1T8WA 2YW9A 3F6EX 2P2LA 3F98A 1P3Y1 3L43A 3UFXB 4C87A 1IN7A 2YXBA 1C4KA 2FF5A 1R8JA 4CE6A 1L7AA 2H7XA 3A1FA 3M4ZA 5ALEA 3KJQA 1DKOA 3UUEA 3CLUC 4B83A 1TF5A 2A0YA 1ONOA 3W4JA 3CB2A 3R6LA 3FYTA 1QRAA 3GP5A 2MU1A 3MTDA 1FFXA 4I4NA 2ARKA 2Q4TA 3QWHA 2ZJFA 4BQRA 4KITB 1IN1A 5BSMA 2QM0A 4HAWA 1S2OA 3HKBB 3MTGA 5G0VA 5IZCA 1PZXA 3P52A 1OXXK 3H9CA 5DIZA 5FWNA 3U0BA 5JSYA 4QELA 5CXQA 4NDZA 3S29A 5JQGA 2X8BA 1O97D 3BWMA 1XQ1A 5EKDA 4AJ9A 3THWA 3HPQA 1KWGA 4BXOB 3G02A 4Y6PA 3V42A 4R8MA 3ZWKA 2ON6A 2NXCA 2PCLA 2PUDA 4OK5A 3PDUA 4PWZA 1NP7A 4YT4A 2OXTA 1GRRA 1OX4A 1VLZA 1VL8A 2HJHA 3HLYA 1R5NA 2V6FA 4GPZA 2GA9A 5C0OE 2JD1A 3MTAA 3TLYA 4DUYB 2PO7A 2OL4A 3RVBA 2VDNB 1FYXA 4CKZA 8ATCA 1C2YA 3LWZA 4FX2A 1T36A 3TE6A 5KOJA 1Z5GA 1ULSA 4FSDA 2RGGA 1W0JA 3PQ3A 2BSAA 3PYLA 4GGMX 4ZVNA 4CU5A 1JN0A 4M6WA 2X4LA 4K0RA 3BWBA 2ZJYA 2Q5LA 1DIGA 4PG8A 6CHYA 3JQRA 2Q4DA 4F7DA 1M2FA 1EM8B 2XJ9A 1QF7A 2Y71A 1FA9A 2JVIA 2MTBA 2Y77A 3DWIA 3IKMB 5GJWC 3FMFA 5KWIA 3GNQA 4HS4A 3UJPA 1CUAA 1JA9A 1QTQA 3WG9A 2D54A 2FR0A 2ONKA 2ZROA 3HB0A 2GTPA 4RJ2A 4HD8A 2VHUA 3LPLA 3U09A 1DC4A 3OA0A 4A36A 1L5MA 3VI4B 2Q6TA 1Z26A 4TKVB 5AW6A 3JV7A 5JTUA 4LOJA 3E2PA 5EWMA 4W5OA 1MOPA 1X9IA 3A58B 7MDHA 1FQWA 4WK6A 5KNBH 3R7AA 3WDLA 4XVCA 1Y34E 3LBNA 4PSAA 5INTA 4G6ZA 2OORC 1KI9A 4ZEOA 4DUZB 3H5WA 2PMFA 4G5RA 1SQ5A 1JEYA 3EASA 1DIRA 3SICE 5MF6A 4FYJA 5FBVB 1KEUA 4QREA 3KLOA 4EW1A 5F1OA 3N2YA 4MEAA 2OZEA 2PRJA 1M6WA 2QD5A 1H66A 3GVIA 4IHJB 2Z43A 1FSGA 2NWQA 4NZNA 4XI9A 1ZH6A 3PGVA 4KCGA 4CN9A 1SKYE 1ZK3A 2FX3A 1QDUA 2QJRA 3TLZA 2W0MA 2VT2A 1OOEA 2BJWA 1Q12A 1ISMA 2FHSA 3Q10A 2GZAA 2CJPA 3RKRA 3WBJA 4HUTA 4P08A 3A6EA 1EUQA 3BIOA 4M53A 4BLRA 1E4EA 2DECA 5H70A 5IZ4A 2CL7X 3ABIA 1HLPA 4KEAA 1SC4A 4WCFB 3ICQB 1X1RA 2Y67A 3K70C 2FLKA 3TTTA 3ZNQA 3OQOA 3R24A 2CV0A 2QJFA 4N41A 1QRDA 2VJAA 1VZ3A 1K7FB 3Q3VA 4YY3B 1GU7A 4XDHA 4JLKA 4JK3A 1IBRA 3D02A 2XMRA 4Y2UA 1J2TA 3T5DA 1Y42X 4M46A 2I7VA 3FTQA 4DABA 2IU4A 1O3YA 1RACA 1NYQA 2WV7A 2XNHA 3P0JA 3CZRA 4X1YB 4XPIA 1XZBA 3ZDFA 1KP2A 4F3RA 4WXEA 1DAKA 1RWQA 2JIQA 1W88A 4KWCA 4ZK6A 2C7PA 5IAKA 3O2QB 1FTNA 1JKJB 1YJ5A 2HK7A 2XMSA 2OHFA 3B82A 4G5SA 4PHGA 4Y2TA 3TLCA 3USZA 5JHHB 2ZB4A 1YMVA 4X7RA 1M9NA 4J6EA 3EC1A 1NBME 1C8VB 4IV5A 2OYCA 3SEAA 4C3ZA 3OFKA 1N0IA 5E1OA 4BFTA 3H5IA 3LDAA 4D4HA 1DUVG 1EVKA 3ESZA 5FKJA 4N47A 2KB0A 1E2PA 4M7WA 1N5LA 3HSYA 1TPZA 4OEHA 2PL3A 3IL2A 5AJHA 5G4KB 1AKNA 2VDRB 1V16B 3VR5H 1ZNZA 2EYQA 2IWRA 2ID8A 4UHKA 2NZJA 1N2SA 3HJTA 4C4XA 4ND8A 1P29A 1M7GA 3NKVA 1VPLA 1Y4UA 3KS9A 3JQFA 4L95C 2C7VA 3SC2A 5B1SA 4WXYB 3DM9B 3KEOA 3N6RA 4L15A 2W98A 2I54A 1NP6A 3V00A 2WWHA 1JU4A 5IASA 1D2NA 4ZCSA 4KLZA 2WMDA 3TR5A 3WWEA 1ZEJA 4AYTA 3Q7RA 4HYQA 3C4JA 3T5AA 3JAMA 4S05A 4LG1A 4OA8A 1MEJA 4XQ9A 2QRHA 3DV9A 3UMBA 3A1WA 1C1DA 4EI7A 2VRCD 3SZOA 4DLSA 2IXFA 2TMDA 2GCOA 3KWMA 4GEKA 4HN9A 1LTKA 2OAEA 3C8HA 1M76A 3GBSA 4HO1X 5ALMA 1NXWA 2ZI7A 4DY6A 3QM1A 3BWXA 2QIPA 3DV2A 3MELA 9LDBA 1E9VA 1PJ4A 4PRKA 4YUXA 2QEQA 3K0SA 5JZVA 2VOEA 3D8HA 3K6JA 4H2DA 4HEJA 1I8TA 2NT4A 4CMGA 2JFGA 2JZOA 4DREA 5F52A 1VDZA 4GLJA 4YUYA 4HMQA 4NOMA 4LMAA 2QQ5A 1Q84A 2AI2A 3OTWA 4LY6A 4R2WA 3PFHA 4OYLA 1IN4A 1GTL1 2CFCA 5CM9C 1U8EA 1TC1A 2HD4A 2QYOA 1YRBA 4LXXA 4MLDA 5KPJA 4A3SA 3AFIA 1SK9A 3H1EA 3UJCA 1LLUA 5EZ6B 3ITKA 5B7PA 1OLOA 1S01A 1IQ0A 2BH9A 1D5CA 1UAGA 4QOEA 4UPEA 2VTDA 5SY4A 4NARA 3RC9A 3KD2A 3FX2A 3LVBA 1H5QA 4XW2A 1J1ZA 2P1DA 4AD8A 1JR6A 4ZT3A 1RM5A 2GMWA 5K3FB 2IELA 2IIQA 4GSKA 3AB8A 4RJKA 1G20E 1LI7A 2PGAA 2ZRDA 4ND2A 1P7VA 2CMFA 1I3OA 1PL6A 2W2QA 3GLQA 3NBQA 4PTYA 1YDGA 3BJEA 2GD0A 4RZ3A 3NUQA 2B3DA 4UDOA 5HK8A 3Q3GE 1HDZA 3ZD8A 1AS0A 4DZRA 1D1SA 4EFLA 3ESRA 1D7AA 2JAQA 1FQKA 2OCKA 3GEDA 3PWSA 1C9JA 1CQIA 1ULZA 2OCIA 2WDZA 4QGFA 1VMAA 2FUG6 3CVYA 5D3MA 5DGDA 4Q9LA 1P9NA 4B3XA 1E79A 4U5QA 3GJTA 4XWAA 4WD3A 1CIVA 2QT9A 4FFRA 4C14A 5EZSA 3DFFA 4IEIA 4RPIA 1ZD5A 2R8ZA 1WKVA 1QV6A 1NR7A 3HCAA 1JDNA 1RYZA 2NV2B 1WWKA 3FKSA 4OJNA 1D04A 3ES9A 3V3KA 1R10A 4YP5A 4J16A 1VCOA 3LE8A 2COKA 5FADA 3CNOA 4MVJA 3CE9A 4ZQBA 5JAIA 1ZIXA 2BI7A 1GFWA 1G60A 1QGUB 4XJTA 1RXIA 2F9LA 3N9IA 5KKCA 1PQYA 4G67A 3OE5A 1QDEA 4B17A 4EB3A 3HA3A 2OFWA 3SEQA 4XGQA 2W70A 2DGDA 4MUXA 1ULAA 4RA9A 2ZI6A 4BO7A 3RTGA 3PVSA 5JSFA 2NU7B 2B1RA 3QEJA 3VC2A 1KMIY 2YOGA 4AMZA 1W6UA 3JQCA 2AFIA 1NFFA 5L3QA 4AYWA 4ZHQF 2XT9A 3TRDA 3S81A 1I94B 3DXFA 2PKYX 5ELLA 1M2VB 1OTXA 5LQNA 3PQ4A 3R5KA 1NQXA 1MRZA 2QPTA 2ZITA 1MXFA 4KVAA 3CGGA 3QU7A 4JJFA 4O29A 3F71A 3TINA 3EDMA 4BQNA 4CCYB 3VVLA 5IBQA 3OTOB 1WCIB 4OX9B 1LEHA 4MV6A 1I4LD 1VA5A 3BM5A 2P3SA 4MUHA 1P2FA 2NYVA 3EOBI 1HURA 2XYVA 2F64A 4ITRC 1OREA 1RWMA 4URFA 1WB9A 1GYQA 3LGXA 1QOPB 3SMVA 3TVYA 1XKTA 4RQAA 4EI2A 1I6WA 1V2HE 4XVRA 3KSRA 2FW6A 4W4TA 5J4LA 1FZTA 4G0WA 1HDYA 1P1RA 4R5HA 4B6GA 4NCKA 3GEPA 5IJAA 3RUIA 4XGKA 4E5MA 4EMUA 4WNIA 3MS4A 2PX4A 1TCBA 4HQ6A 1OXMA 1Q1EA 2IEAA 4FUTA 2A1TS 1ZQ1A 4YB8A 5IWCA 2IEIA 1TF7A 2PL1A 2Q2OA 1CIPA 3A28A 3BE4A 3KFVA 4LPSA 4Q3KA 1MV8A 3MYYA 2AGVA 2F4VB 2OV3A 4HLQB 2I76A 2JIMA 2OHGA 2XI4A 4ARUA 1ZOPA 1R4MB 1BQ3A 5LXTF 3TR0A 1NF9A 1R74A 1H2BA 1QHXA 1CJSA 3GAAA 5LFAA 1NTRA 1YQTA 2JI9A 1ZNXA 3FOAA 4JP5A 4GMKA 3MW8A 4LJ7A 1P7YA 4UDYX 4YRSA 2J48A 1NVWQ 3PQ8A 3CEPB 4QWMA 3EH1A 3GVXA 1DG3A 1XDWA 2MSKA 3IDQA 4EQZA 1Y9AA 4RM2A 1P1IA 1RJFA 1IG3A 3AKCA 3KVYA 1TKCA 3NEJA 1DCTA 5C31A 3H9JA 2C04A 4J94A 4RTNA 2JLVA 1Y8QA 1SUEA 1FXWA 2VNJA 3JSAA 5K8VA 2HEGA 5E9AA 1C3EA 1MB4A 4OJYA 3GUUA 4URYR 2VF7A 3OKCA 1U31A 4MMYB 1R0WA 4IJKA 3ROZA 5KNCH 1TM2A 2F4NA 2NO4A 5J5CA 1J1UA 4QQFA 3R3UA 2AYZA 1ENYA 1NLUA 2NAPA 4X3OA 5IC6A 1R0CA 2Y1LA 3KJEA 4RTLA 4YR7A 3EVCA 1F8GA 4GKJB 1XKLA 3H1BA 4JH0A 4DVGA 3AEZA 1ONPA 4W5TA 4ND3A 3I23A 1E5QA 2RGAA 3O7WA 4EL5A 5BVGA 3IEVA 1U6JA 5K4HA 5JBIA 4JAVC 2DHEA 5AKLA 1M34E 2WM3A 1IWOA 2IXAA 1IY0A 1G0NA 3GLRA 5JBQA 3MXTA 3ETCA 1T2DA 2CCGA 3HN6A 2BGRA 3L92A 1G21E 3R3XA 4N5HX 5D86A 4PSVA 1JFSA 1EFPB 4AY2A 2C99A 1LW7A 2EC5A 3X1WA 3DE3X 4M7PA 2E4UA 1S3SA 1ZONA 4Y6GB 4NZPA 3R5JA 1EK5A 3S2UA 4BBJA 5JSKA 1HZZC 2W6MA 4ZP1A 4I1OA 1X7YA 5BYJA 3H99A 4BV8A 5B1HA 1Z16A 3HVKA 2FAXA 5BRAA 1PE0A 3GJ6A 1I4EB 2N47A 4QULA 4QBIA 2GPYA 2QUJA 1NXSA 2QGFA 2WABA 4KFRA 5ECYA 3RVPA 5IANA 1U5AA 4G01B 4W5NA 1R8QA 4WERA 4F2HA 1GGJA 3DHVA 4IDPA 2ZJZA 1SG0A 5DLPA 4J7CA 1NE7A 3ONVA 4CEJA 1S0UA 3RYCA 3K6SA 3LQYA 4MQFA 1V6SA 5CD9A 4JWTA 2YXEA 1K4YA 3RV3A 1HE4A 3AEQA 1HYEA 2QRPA 5CCDA 4WESB 2ZPAA 4AI6A 1YA8A 3SF8A 1W49A 5ELXA 5BXQC 2I4MA 3IDSA 4TSRA 4O4LA 4XE5A 4I4IA 5CVEA 2XD9A 2O0LA 1YIAA 2B2XA 3OJFA 4KVZA 5KJ6A 4EUKA 3G7NA 2QZPA 4OO3A 2B25A 4E1AA 4NDAA 2X7XA 3C5HA 4L8VA 4UW9A 1P2BA 1VRWA 2R6FA 3E7XA 2PKQO 3M4YA 3OT4A 1XG5A 4MB2A 4QX6A 3EPKA 1M1XB 4YACA 3MBKA 2JLYA 1IBSA 1SUPA 2EL7A 3QFHA 4JCOA 4U6SA 4MPTA 3T1TA 1N2XA 2PPLA 2FGJA 3O38A 4FYPA 1SVNA 4WN9A 4DBLE 3HR4A 2XUPA 3QV1A 3TL2A 2RGEA 3G9XA 4PSUA 2ILVA 2XYQA 1GG5A 4YROA 2MINA 1RT9A 2MYNA 2RHDA 2CZQA 2I66A 4GXRA 4PQEA 3IBTA 5AXAA 3ZTYA 1KYXA 1PYOA 4PN3A 4S1PA 5I7FA 3OCCA 3PBKA 3ENQA 1Y7PA 3KQOA 3EZGA 1T24A 3LLCA 4LTMA 5FUQA 1X80B 2BYTA 5AFSA 4CIYA 1X1AA 4ZMSA 3HRIA 4ER3A 2IZOA 3DEAA 4EVRA 3W3AA 4B31A 2ROQA 1CY6A 3MHPA 3URMA 3WC4A 1FRFS 3UJBA 2PUTA 3R0ZA 1MEEA 2OHXA 2DPLA 4PQRA 4Q3DA 4S1TA 3TRFA 4FR5A 2MWMA 4IRXA 1KEZA 1U0BB 5HIMA 4BBAA 2EJWA 4U7TB 3SSOA 3LF2A 2A9QA 3WQBA 3RT1A 4B6OA 4EO7A 2D2FA 5F1PA 4E2ZA 3DEFA 3JSXA 4MVJP 3HBLA 2CCKA 2ZUVA 4KPGA 3PQEA 3T7RA 5I9TA 4EFDA 5G2OA 1L4FA 2AR0A 4B4VA 4FX5A 2AJCA 3BICA 4CEIA 3MWDB 3F78A 2II6A 2WRZA 4ERNA 2ODAA 4WBNA 2WHQA 3IT2A 4EDHA 3A31A 5CW1A 2G88A 2Q41A 2IQ5A 2HMTA 2O1EA 4KXXA 1PKXA 1YS2X 2GN9A 2WMOB 2O52A 3N7AA 4PF1A 5AJVB 5DNAA 5HQJA 5FTNA 4MNTA 4X0EA 4ZAFA 3K9GA 3EWNA 2IXTA 1SCQA 4UARA 3HFJA 4B3IA 5J1SB 1XZIA 2EZUA 2C7RA 5K0SA 1EVIA 3KT6A 3LUGA 2AUTA 2IJGX 3JYHA 4JJ4A 4S1VA 3UT5A 3VHXA 4QM6A 2JI4A 3S2YA 1I2DA 4A5SA 4HAVA 1X7ZA 2CLCX 1OB5A 1BROA 4H0FA 3W9UA 2VHQA 5KHAA 5BY2A 4GI7A 4DXAA 3FRIA 5ELMA 2FP4A 2O57A 2ATIA 2PFGA 3DMFA 3EIFA 3OIWA 3IEUA 3KR2A 3P2EA 1U02A 2E18A 2G8LA 3KD3A 3KLNA 3OPMA 4G37A 4O4IB 1E3QA 4R6XA 4TKMA 2GEUA 2Y76A 2QT1A 2PU7A 3DDUA 1P2SA 4ZXPA 1YCDA 1ZJZA 1ND6A 2Y1FA 3VU9A 2LW7A 4FYWA 1ZSVA 4FXPA 4DDUA 4GU5A 2JFFA 3BE5A 4Z8YA 1KI3A 1H0KA 1SG9A 1VMIA 2WTXA 4BKQA 1JNYA 2JGFA 4RV5A 2FOIA 1AB5A 2HRZA 2NSDA 4L0CA 1R8YA 4DADA 1XUOA 2QG4A 4FXOA 1VIYA 2M6KA 5A1JA 2HIMA 3BQ9A 4Q19A 4A2CA 3R5SA 5T4FA 3DH0A 4BDSA 4BB9A 1KQNA 4G2NA 4XUCA 3ZJTA 1ETUA 5BN1A 2VAVA 2F2TA 3GUCA 1FVFA 3DKPA 2BFPA 1OTYA 4J03A 4YJ3F 2PAAA 3JALA 1M74A 2PWPA 3EGDA 3R75A 2YJNA 2VP6A 2PZFA 3N2EA 1RXEA 3D6NB 4J4HA 3ZDYB 5I7VA 3MT0A 1JB9A 3KVNA 4ZJYA 1SQFA 3MCZA 2RGXA 3HSKA 3LDGA 4WOKA 1K8RA 4QTYA 2YL2A 1SUIA 5BQFA 3PL5A 4CV2A 4CV1A 5CCEA 1K4KA 2PX0A 4GKKB 5F33A 4BLQA 1E8NA 3I72A 5I7SA 5LDHA 4PY2A 2I8AA 3I5UA 1KI1A 1QIHA 1J9EA 4OQFA 4PG4A 4PYNA 3SM3A 3UATA 3UJ9A 3CKYA 1X9GA 2CD9A 4UTRA 5D3ZA 4YPVA 1P5JA 4E6PA 5C7IO 1J0CA 5LQRA 2VWPA 3PNLA 4OSOA 5JD4A 5HE8A 1R9NA 2HPHA 1VL1A 2EXXA 3QE4A 4YGYA 5C1OA 5DBFA 2QQGA 1A4RA 3F8WA 3RC2A 4BMCA 4PLWA 4BO0A 1RIFA 1ZUWA 4DQDA 5JQWA 1Z6AA 3N53A 3O8LA 3AVYA 2WWIA 4KWTA 4M21A 4O5AA 4JENA 1LUAA 2Q0QA 3GGOA 4X61A 1T15A 3S99A 3DWFA 1IEXA 1V37A 1Z17A 3PUVA 1T0UA 1AQIA 3TFQA 4X20B 5JYCA 4B9AA 3FXAA 2IH5A 1X19A 2OZKA 3AT1A 2EEZA 3UHAA 3DEYX 3WL6A 3C3XA 1XPRA 5JNWA 4CL8A 1XZJA 4Q4DA 1QOQB 2VTVA 7MHTA 3HJGA 2Q2NA 4N0QA 4V1CB 2ZS8A 5JVDA 5FNVA 5B7NA 4YRMA 1RFLA 5FFFA 3OPVA 4J90A 1UJMA 1W34A 5FA6A 4DQVA 2Q62A 3ESYA 1P31A 2JL1A 4KAJA 3QI2A 2A0WA 4AICA 4QYIA 3GR6A 2MHCA 5AVXA 3N0VA 1NNLA 3Q8MA 1XNJA 3NASA 3K72B 5LZ5A 5ITSA 2JCVA 3SR4A 4ZZIA 2UXCB 1KZ4A 2ZUUA 3EXHA 1KDZA 1NZJA 4YREA 3DTVB 4UASA 2J87A 1QNLA 3KR1A 2Q5QA 2WJWA 1E2NA 3IR7A 2FU5C 4Z2YA 5TT0A 4HUQA 1QX3A 1J5EB 1VECA 5DNDA 3ZUGA 2GRUA 1EX7A 5CB4A 1L5LA 2A1IA 5DSZA 4DLWA 4BCBA 2WJHA 1U8CB 3DBVO 3C0KA 5A9SB 1GGVA 2D3WA 2QUKA 4KOEC 1CUIA 2Z8XA 3S1LA 2VH2A 4PZLA 3RAGA 2DETA 2O8DB 1HL3A 2FW0A 1WD5A 2GHTA 1A69A 3FTDA 1E4VA 1ECGA 1K2WA 4QQKA 2J4FA 4PEVA 1V45E 1JQEA 3UAOA 1SBCA 2X4IA 1V6AA 1XL0A 3EG9B 1NQAO 4AKTA 2I62A 4ZWNA 2BBOA 5HFNA 3O8OB 1QIFA 4RJTA 2F7SA 2BRUA 4WZBB 5B58T 5TMPA 4HOYA 1BKDR 4I36A 2DKFA 2I7CA 3UJ3X 4UM9D 3WRYC 1R6UA 1XR3A 4JEHA 4BNLA 2MR6A 5DHQA 4PINA 3C6YA 1KZ9A 2W2KA 4RIFA 5CX1A 1WDMA 2RH5A 1KOJA 3NTVA 3W5VA 1W4ZA 2QVZX 3T9BA 3T1HB 1OLUA 1THMA 3UO8B 3WYGA 3ZBTA 1P0QA 4I1IA 4RHXA 4ZYVA 4EHLA 2EV9A 4GQBA 1B00A 2I33A 1NI4B 1XLTC 1ADBA 2IHJA 2P6OA 2FQQA 2PZEA 2RI0A 1K66A 3A3YA 3BFPA 4OB6A 3BQNB 4JLSA 4Q9DA 3U37A 5BPHA 1HLGA 4ZA2A 1USGA 1U2DC 3A3KA 1QS0A 4M89A 5ILGA 3IOBA 3LWNA 3GCWA 3OZRA 4FYYA 2XWBF 1P4GA 1S2GA 2W6PA 3FVRA 4M7OA 2BI8A 1GKKA 4QQ8A 1KHTA 2YFKA 1C7ZA 1X38A 4HDCA 2NOAA 3LHDA 1V11B 5AK4A 3GLHB 4FFSA 1VHTA 1Q50A 1TTQB 2DPGA 3HKCB 3HP1A 3M2PA 3T9CA 3LPDA 3VVMA 3WB0A 2GN1A 4CMEC 4XPZA 3L79A 3CONA 2ZYSA 4I99A 3AR6A 3L84A 1NXTA 4F5EA 1NURA 1FK8A 1RM4A 3H7IA 3BQMB 4M9UA 1PR4A 2AHRA 1NT4A 3FKQA 5JROA 5M34A 4DAEA 2ZRQA 1IC6A 5BMVB 1E3TA 3KEQA 4PO3X 2ZU0C 4HWOA 5EI5A 1B1AA 1JYSA 3PGKA 3RB8A 3RASA 1P72A 3FFXA 3KOOA 4WXHA 4KK3A 3R41A 1U7DA 4N0EA 4JLBA 4YQYA 1S4MA 2DRIA 1G7SA 1CY4A 2GEBA 5JXJA 5FHRA 4FMPA 3HP4A 3EEBA 4KNVA 1ECBA 4ZC8A 4GQAA 3ICOA 4NPAA 3W1EA 3K70B 1KZYC 1I2ZA 1HEIA 4BKOA 5A5EA 2H2DA 5JDCC 4DILA 1RPJA 4TYQA 5FPYA 5LOVB 4H6PA 3U7QA 1JHZA 3D5QA 2ZREA 1F17A 1LV8A 1HR0B 1ZD9A 2Q5EA 4L07A 1C3JA 4NF2A 4UXIA 2NO6A 1J5XA 1ZGAA 2QVCA 1CTQA 3HBFA 3QXHA 4MUMA 2QP3A 3ND7A 4PO1A 4XUDA 3TAUA 3ZOKA 2B9VA 1LSUA 3BMNB 5IH7A 2G1JA 4B2PA 2ZBFA 2XWJI 4AJNA 3N74A 3QX3A 4LK3A 4J29A 2J5RA 3OLXA 1ISGA 4DLKA 4LFCB 5AK0A 1M1UA 3JRWA 4OXIA 4KXVA 5JLAA 2AEFA 3ZZNA 2PJRA 3NM4A 1Z5PA 4ODIA 4C88A 2ZJ1A 3I05A 3JAKB 1DC5A 1PWZA 3ZE8A 3WGGA 5KYYA 1M2KA 2O20A 4DR1B 4I3HA 3S70A 2WIAA 2V74B 4PLCA 4B2LA 1X3SA 4C0WA 3M1IA 1OILA 2BHRA 2ZJ3A 3ED5A 1PJ8A 2DB3A 2PR7A 5J2TF 5AIAA 4NC9A 3JZAA 4OQYA 1G8YA 5EERA 1A0OA 1LTHR 2XVXA 1PGNA 2CFTA 3AWIA 1TYBE 4IMRA 1MHTA 2LXNA 1PEKE 4P4GA 2O48X 1SKUA 3ANMA 3ASVA 4L8FA 1QHSA 2WI8A 4UBLA 3WKBA 3K30A 1MIHA 2UVPB 3IAUA 3KXPA 1IUKA 1P81A 2Z58A 3A4YA 2JKYA 4CLHA 1O87A 5F2KA 4X24A 2ZRMA 2WFMA 3UA3A 1Y6JA 2BIFA 3R77A 4YBZA 4HWGA 3ELDA 2GUWA 1E1CB 1F06A 3OFSA 4PNHA 2V9CA 4RUKA 3VKGA 4HZIA 1E2UA 2YMPA 3GCZA 3OT5A 5IXYA 1XF9A 4X64B 4DLYA 1IUPA 3N8HA 4JI0B 4I66A 1LPAB 1B8OA 1KJWA 3PJRA 1Z4MA 2IYOA 2QTCA 3PHBE 3LQ1A 3QFCA 4RS3A 3O8RA 2IXBA 3DHYA 4ILKA 4ND6A 4CMEA 3GV0A 2O8FA 2C2ZA 2WNHA 3S4YA 4BNIA 1N7HA 2MYPA 2ZBUA 3D5EA 3ZHUA 2QDXA 1R6TA 4MVYA 5EE9A 3L1HA 2BFWA 4GOMD 1F2UB 3RYHB 4BE9A 3LZ6A 4BN4A 4BECA 1XXHA 4OCZA 1TEZA 4NPCA 1PZNA 3HY6A 3IYLW 3QBTA 5KYUA 3PNSA 3HE3A 2IPLA 3NOVA 3FWHA 1A9XA 4BVEA 4LMRA 4RSMA 5GOZA 5LMCA 5ICCA 2QA5A 3RJ5A 5E9WA 4XCQA 4LZPA 3ZV5A 4Y2YA 2FG5A 4KXUA 5ALRA 5CH8A 2HH9A 2FSSA 3W5SA 3ZQ6A 3SVZA 3B3AA 2ZAMA 2ZIEA 5CP8A 2E21A 4RORA 2NM0A 4FKBA 3TW8B 4Z4GA 3H4VA 2ZYAA 2MR5A 4FOLA 4OHFA 5AESA 3EWAA 1KTVA 2PH5A 1Q20A 1YRWA 3DUWA 3F2VA 3OG9A 1USIA 1MJ5A 1LBTA 2MMGA 4JUCA 5BWLA 5LB2A 3U7HB 5TVKA 2P79A 4C0QC 4C6HA 4CKWA 3EK2A 1H5NA 3CR3C 1I0ZA 1SU7A 4O2BF 3ROPA 3W90A 4IJMA 3L0IB 1TXGA 3A1UA 3QXXA 5ITVA 1BAPA 1HYHA 2I67A 1RW4A 3R0JA 2YJTD 4Y6OA 1P9WA 3FPHA 1QBKC 1QPGA 3L7KA 3KKZA 3DD5A 4O8ZA 4YCCA 3IUQA 3LHIA 2GEJA 3NONA 4Q7EA 3V9PA 4YIHA 1IRIA 2HHLA 2Q5HA 2BMVA 1FPQA 3M5DA 3MWJA 2ODNA 2QPOA 4V38A 3R7WA 4D6YA 4BEWA 3NS7A 1KKMA 3MJRA 4IGIA 4YJGA 2ZT8A 4RM3A 3T9EA 2O2GA 3QE2A 1DTEA 3W6OA 3F5DA 4YP0A 1JIQA 3AF4A 2CXPA 3QOYA 3F3KA 1TCAA 3LTEA 1M7HA 1ZGZA 4JB2A 2D5IA 4IQGA 3FVVA 5LVAA 2R68A 3A0UA 2XT6A 4G97A 4DRYA 1JKXA 2DUNA 1GT91 4PFJA 4UDXX 4LJ9A 3HJFA 1JTFA 3FNRA 3DYIA 3EAQA 1Y82A 2IS6A 2WR8A 3BULA 3CNNA 3FCUB 3C6QA 3WNDA 5MN6A 1N5KA 1R5OA 1D6MA 1RAHA 2IEYA 5DTMA 2HWKA 2EG5A 1G5HA 1EZZA 3GT3A 4MCIA 1L5SA 3BTVA 4PCAA 5THQA 3TX2A 2HW8A 2BKVA 2WQZA 3GCXA 5D6NA 3ZQUA 2QMHA 5I7RA 4D9BA 4RJLA 3INNA 4MYUA 3WRVA 1I7SB 1N34B 1IOWA 5ESWA 1FDIA 4TQAA 3AUTA 2FCAA 5I48A 2RK3A 5FWYA 4HF7A 4YRFA 4JBNA 3LXMA 3KJFA 3WIUA 1SCUB 3NGMA 1U0NA 2SHKA 2VYFA 2VJPA 3LLUA 5JPIA 3W6UA 3WYDA 1Q0TA 4II2A 3U4QB 2XDWA 4IV8A 3WTBA 1Q5PA 2H1RA 5L7YA 3OKAA 1TE2A 2IIPA 3A4VA 3OJCA 1PJLA 1R8SA 2ZIVB 4H16A 5G02A 3DXYA 1EB8A 3E53A 2IX9A 2DBVO 1K7XB 2NVWA 2FZ5A 3DVRX 3H83A 5EQFA 3I34X 2PQMA 3EZLA 1JHYA 4WY2A 1G5PA 3WYEA 3MOSA 5COBA 5EJ7A 1UIRA 1KFCB 3C6XA 2CJXA 4FYHA 3FSGD 4O63O 1QE5A 1A4UA 3H2SA 4HFMA 3WX0A 1Y6QA 2FZVA 1SURA 3D2BA 5E6UB 2VPIA 4MMXB 4UZEA 3TG8A 5AXBA 2N0SA 1U2QA 1RZRD 1WMAA 2VXOA 2A5DA 1NNSA 3FYHA 4KDCA 1O96B 4NFHA 5EUBA 3VO2A 1KO5A 1WP9A 1DC6A 1Q57A 3CXRA 5KTOA 1BVYF 3IXQA 3C43A 4JLDA 2I87A 4FHFA 1NC3A 1YHZA 1IZYA 2ZKLA 1VJ0A 3UMVA 1J0AA 3U5TA 3OUZA 4GS5A 1LBQA 1MNQA 3I2YX 3MTQA 3TEMA 4MGYR 2VQEB 3EUAA 2CV2A 4LE2A 3NVAA 5TB5A 4FW9A 3UHOA 4LZOA 1O6BA 2I6FA 4DSUA 1L1RA 4ICIA 2QOEA 5EHZA 5AW2A 4DV2B 1N3BA 4R5MA 1RYYA 3JASB 1DX9A 1LS6A 4UD2A 3S7ZA 1XCPA 3RU9A 3FBGA 1GZSA 3GCDA 3RU7A 2IP2A 2PJDA 3LIPA 1UUFA 4UTZA 5U4QA 3H2ZA 4WIAA 5IDQA 1Y6FA 5EPEA 1WQ1R 1K7SN 3IIJA 4M0EA 2NACA 1X2BA 3AX6A 1QE0A 2PLAA 1LRJA 5JCOC 2OY0A 4LHEA 2PWYA 3RE1A 3U31A 1I4OA 3HXQA 1KDYA 2JDID 3SP1A 2OBYA 5H7XA 4AN1A 4P33A 3TRJA 5TIIA 2FPRA 4QVGA 1PWEA 3UENA 1NKVA 1WNTA 2PZJA 1NQVA 2QG6A 5KSOA 2CNBA 4DLXA 4N9WA 1ZITA 1MA0A 4XGRA 2HCRA 5ADUS 1WHSA 2MYUA 2W8ZA 2X5JO 2Y9PB 4RH1A 5DISB 4YRPA 1OXVA 3AWDA 3UMFA 5AVVA 3R6TA 4N54A 3LCMA 4X54A 4EX7A 3D2LA 5EZYF 3ROXA 4I3FA 4RZSA 3RPEA 2JLZA 2NUAB 1MH1A 2JH9A 3CC8A 4R4JA 3C3BA 5ULLA 3KEFA 3IXLA 3VQTA 4JUBA 4QQNA 1MC5A 3FWZA 1Q7RA 4M1KA 4R2KA 1EWRA 2VDKB 5FV7A 1BO6A 2D62A 5BUZA 4QTZA 3PS9A 4ARAA 2HGZA 1CZNA 1ELOA 2BBTA 2GA8A 2PKEA 1HORA 2VHJA 4V0MA 4DCJA 2E4WA 1F6BA 2CEKA 4UTOA 4W5QA 2E5WA 2OBBA 2PT5A 3DCYA 2Z08A 3KKKA 3VZSA 3NFRA 4MINA 5COAA 3RF6A 2YV4A 3L1VA 2CVHA 3Q9SA 1AKEA 1DC8A 1EP2B 1YRLA 4PHFA 5BOSB 1XLVA 2J3MA 4IMJB 1NJ8A 2HB6A 3IOYA 3JWPA 4YWJA 4DBLC 3OQ1A 1V7PC 4G8DA 3TGWA 1JZQA 5B3KA 2PS0A 3R74A 3I5XA 3OZXA 1VE7A 4K9QA 3PDHA 2IYQA 1V48A 2P9JA 1PEYA 1UJ5A 3RTBA 3T3EA 4C07A 3OZVA 5CDFA 4EY8A 4MGZR 4NOJA 3W0LB 3UMSA 1RZRA 4BO3A 2C3OA 3KDAA 1T4CB 3AZPA 3CPJB 2E0IA 1Q7GA 3KQYA 3R6DA 4HAZA 1US8B 1MOZA 3KZKA 1XZAA 3BXGA 3VZQA 2VJCA 2CV1A 1QBGA 1WXQA 3DG9A 1FTGA 3PRKE 5FFNA 3FOCA 1PR1A 2ACVA 3AG6A 5A71A 1VYVA 3ZD7A 5EWJA 1ZWKA 2GAIA 2DUMA 1UPBA 1SXHA 1R37A 3AJEA 4Y7DA 2RHTA 5H59A 2I7XA 1GILA 1CJCA 1KERA 3DNMA 1N2OA 5KKAA 3W7VA 1G6OA 3EXEB 4GUAA 3JQAA 5C5DA 4JMPA 5CXUA 1RBZA 4QDTA 1LSJA 4C01A 1TMYA 1B6GA 4QARA 1DAPA 2WTNA 1ORHA 2R5WA 3L40A 3QUSA 3FCCA 3I30X 4J0HA 2N9UA 1RC8A 2BZ0A 1T5BA 4FD3A 1IPEA 1PDWA 3EYWA 4GC5A 3ZCSA 3RC8A 5C8XA 3ZHYA 2B1QA 4BP9A 3H5LA 3G0OA 1Y3FE 4TMYA 1UJ2A 3Q2KA 2L2QA 4D0LB 2JDIA 1AQYA 1JLLB 3WYBA 4MTLA 3RSSA 3CQ9A 3OPQA 4C03A 3STYA 3IQXA 1V8OA 3HUDA 5FEMA 4RAOA 2D3TA 3I28A 1K2VN 3GDOA 5AKGA 5HZKA 1QH9A 2J0VA 4PX3A 3V4LA 1TIPA 4YDSA 1VGVA 1U2GC 3PPXA 4UUBA 4PGFA 4A2QA 3RRFA 1WXDA 3H8SA 3VNAA 4CM7A 2Z6UA 1WUKS 1XTZA 2EKZA 4NJEB 2VIIA 4PXAA 3ZI0A 1N0VC 4N1AA 2HCJB 3M49A 4IWYA 3I04M 2TMYA 1UKAA 3EVBA 5HQ3B 1AZTA 3EVAA 2FLWA 3C85A 1C8KA 3H5NA 1OD6A 2VA9A 3GW8A 3HUEA 3FOEC 4TRRA 2JGAA 1HNXB 2JI6A 1RADA 1IAVA 2QLNA 2W83A 1B2LA 3DB2A 3U2QA 4E08A 2B78A 4NEHB 2JW5A 3IV6A 2P0AA 2RDMA 5CH5A 1AXEA 4G56A 2V96A 1CUJA 2BKUA 1PF7E 4HLNA 1ORVA 3AHGA 3PJDA 3B5EA 3I73A 1RLIA 5EJFA 5ALVA 3K8QA 3A9UA 2Z2YA 3JVDA 5FYDA 3PGA1 3K8OE 2PD3A 1GTZA 3BWCA 3V7NA 2AXQA 1TOAA 4I1UA 1MAWA 2V45A 2YXDA 1Y3BE 4EJSB 2AG8A 1D2MA 3S28A 1KP3A 3EEYA 1NP3A 3ZJYA 5I01A 3CLSD 3D0RA 1DXHA 3PSAA 3QTBA 2I78A 2C5AA 2ID9A 1E6LA 1QO0D 3AESB 3V55A 4CR6A 4D9IA 3L07A 3L6OO 1BMDA 2QSYA 3AOEC 2YY7A 4R8RA 4AP5A 4FDLA 1HLFA 1ZGCA 4P53A 3COJA 1T29A 2P30A 3A4IA 3CH7A 1U8FO 1Q91A 3OLYA 3GUHA 3OU7A 5ADVA 1P6XA 2JHPA 2FGKA 1GOTA 1CFZA 5DRYA 3V7WA 1XZCA 2WKRA 1SQ0A 5AHWA 4AY5A 4C3OB 3N05A 2E3JA 2ZUFA 4CWAA 1LLDA 4F71A 4LJKA 4MWSA 3QEMA 3VOBA 4EUNA 4IDBA 4F4HA 3FUTA 2C3MA 1J0BA 1U8XX 3GPDG 3GDWA 1P6UA 1RSZA 2WNIA 4FINA 4RYLA 5MN5A 4KHPB 5F2NA 1JDVA 1X0VA 4IJVA 4QT0A 4XD7D 3VU8A 1O0CA 2GYYA 2HYIC 1WV1A 3RRNA 5IPFA 5DIFA 3AEKA 4KE9A 4TVBA 1O89A 4YECA 3VKVA 2EQ5A 4R0VA 3GNLA 1J06A 1W96A 4K87A 4HDAA 2B20A 1O2DA 4TRMA 4OXYA 1JEEA 1SD2A 4LXYA 1Q0LA 4YEDA 1IE3A 5JOQA 4QSHA 3IQEA 3TOSA 2V8OA 1S1MA 4J0JA 4WZ6A 1AUQA 3ABRB 1CZLA 2DTXA 2RJOA 5BNFA 5C7OO 5JMOA 5FTJA 3PTAA 1Z6XA 1NN1A 5JSZA 1BXGB 5CJ2A 1OC4A 5L3VA 3SKYA 3T1YB 1U3FA 1ZK4A 5F3DA 4BZXA 4S1WA 4XCVA 3R9IA 1K8XB 4O02B 3VC1A 3FDIA 1EIZA 4H4EA 4F3YA 3M2TA 5CDGA 3U9LA 2VQ6A 4BS9A 1JIUA 1VFPA 1V5EA 4IH9A 4ECEA 1ZC3A 4Z9XA 5IJ9B 5IF9A 2C2YA 4TYWA 4ZHSA 5G0SA 1TJPB 4V3CA 4PR3A 5KMGA 4L1KA 4GXQA 3H1TA 1PU2A 4P86A 2HUNA 1J8MF 2XSZD 4Z7QB 2Z8YA 1EJ6A 4ENUA 2LDBA 4BCDA 1QG6A 4V2IA 5FBKA 4D46A 2G6TA 3EE6A 1RI2A 2B83A 4MLPA 2XKJE 4XWGA 3EPHA 4LQCA 3GNSA 3SQOA 1QE3A 2X41A 2XTAA 3CEMA 4WVFA 1I2BA 2ZTLA 3GHYA 1XZKA 2ZIAA 5F4BA 1DRKA 1U1EA 2Z2IA 1AURA 2A1TR 3NC0C 3R3SA 5AVOA 3A4TA 1G8PA 1J2EA 3AUKA 4FDVA 4M1QA 1MB0A 5KDLA 2WQ6A 1OI4A 1NN5A 4WFIA 4XAQA 3ASYA 5BSTA 2NSJA 3GF4A 1YC2A 5AKIA 2ATEA 1YQWA 1MXHA 3PC8C 1YHNA 1XTVA 1KSHA 4YAEA 4B44A 1I36A 3SHQA 1UK9A 2I2DA 3HXPA 4NY1A 5DWDA 2YNMC 2GWRA 2KLBA 2QL5A 3TZEA 1Z7WA 3DZ8A 2YN2A 1H9CA 4WOBA 1TGYA 3OMLA 1BDJA 1XT6A 2HHCA 5FD8A 1BJTA 4FYVA 2H1HA 2YC2C 3K53A 1SU6A 4OREX 5AJTA 3X1KA 2BN4A 1U81A 1AA9A 5TR9A 3LDUA 2Q1YA 4KFTA 4JEIA 5FDFA 4CQLA 4ARZB 2AFHB 5AJWA 4EMTA 3IX7A 2GTHA 3UXHA 1M6EX 2WILA 3AEUB 4H1UA 4MR9A 1U5BA 1QVRA 1Z5UA 3ZKWA 5HFJA 1C0KA 2WYOA 2ZEJA 3L8CA 2JGRA 1ZBQA 4KRGA 4WLNA 1WUTA 3JR3A 3LUFA 1UKYA 5AK5A 3ICVA 1KYVA 2VPQA 1ODCA 4G84A 5EXPA 5HJ5A 3FYDA 3CX8A 3B3FA 4AX4A 1XHLA 2R1ZA 3BTUA 1PJSA 2K2QB 3Q7SA 1V8ZA 5A2QA 3ENKA 3UOGA 2FFRA 2OQ2A 1MAUA 1NOIA 4HGRA 3RLFA 3DEZA 1NBWB 4WEOA 5FV4A 4BX9A 3K0CC 2A8YA 1W75A 4KK4A 4RZHA 3U6KA 1E2LA 2E2WA 1A5AB 3T7DA 4ESOA 4GNKA 1I1QB 1R6BX 2FTKE 4F4IA 2JFNA 1DAOA 1YB1A 1BXZA 1NQUA 3EHDA 1V47A 4HYTA 3SKVA 4RH3A 1C4OA 3IT1A 1IIRA 3U7IA 1ANKA 2PA3A 5JJ5A 3LXXA 3OP1A 3ZE2B 4LOHA 3G2JA 1SCDA 1HF3A 4L4SA 3AM3A 3I64A 2FWBA 1XKQA 2JLBA 3KTOA 1FLDA 1UMDB 4MICA 5D3QA 1DQPA 2BW0A 2JGNA 4YI3A 4UNQA 4H0CA 2O1XA 4MGHA 5FH9A 3X1JA 1W93A 3BJIC 4WA7A 2XUHA 2XSZA 3ML1A 1G8AA 1YD7A 2ETXA 3Q3JB 1II8B 3MBIA 4OFBA 3OWHA 5DI3A 2REQA 4Q05A 3RODA 4ESHA 3SDZA 3PSHA 3ZVLA 2QNBA 1W0CA 4O4HF 1F7VA 1LCIA 1TNDA 3AR9A 2GVZC 3EPLA 3R6WA 1G5FA 1S89A 3AI1A 3DA8A 1F6WA 2PH3A 1CUGA 1NATA 2V6IA 1BEEA 2NO5A 4MW2A 5ER6A 2I1VB 3NVMB 1Z38A 2H07A 1T4BA 1V9SA 4IXDA 3HXOA 4C1BA 5CLJA 1PI3A 4FMCF 1I7QB 4I9NA 3P2KA 3O7MA 4N03A 4X1YA 1DTSA 2NZVG 5E7MA 1BMTA 2F1HA 3W5AA 1ISJA 1JZTA 4RKWA 2APJA 3O8CA 2WZQA 3PGJA 3WWZA 4AZWA 3IMFA 2FDCA 3EVNA 3O8QB 4X6UA 4AZSA 2O2CA 2C84A 1C50A 4EF6A 2DLDA 4FR2A 5K05A 1JR3D 2ZFUA 3WGIA 1EQAA 2O3UA 4QTUB 4WLFA 1XMVA 1EVLA 1JDJA 1YU9A 1TLFA 2GXSA 3KUCA 2BFBB 2QPLA 4XSHA 1NNI1 4J76A 4NYJQ 5I45A 1NLZA 1SHUX 3EA4A 1J5PA 3F5FA 3HA5A 4M88A 2RKWA 4MV3A 5TPZD 3FOFC 2WUFA 5JY1A 4A8HA 2VAPA 3FCXA 2I80A 2CNWD 2MDTA 1FFCA 1QZXA 3PNVA 3UG6A 2LUOA 3WOVA 1JG2A 4D02A 2AOTB 4X93A 1QU3A 1Z7YA 2A1UA 4RKQA 4YJKA 1ZW1A 4AY3A 3CIFA 1GQ2A 2QUHA 3HWWA 1CUEA 3ELWA 5B2EA 4P92A 1JHUA 2C82A 2WC1A 3M8KA 4M86A 4FB4A 3VPBA 3HR7A 4JVNA 1JNXX 4RULA 2ZIFA 3P1JA 2V9PA 4A8JC 3I01A 4M0LA 1G41A 4ZAWA 2UZ1B 3UAZA 3Q1KA 3DB1A 5B53A 2ZWPA 4WZZA 4BE4A 2QM3A 3GLFB 1FIUA 1Q22A 3EEOA 1JPNA 4E5UA 3M3HA 4PNPA 2AZ4A 5CDTA 3TNDA 1RZVA 1SCIA 2A9KA 2NTEA 2ODPA 2X0JA 1FJ2A 2ZUDA 4IJWA 4LJLA 3BILA 1E5DA 4MDEA 5A1TA 4EB8A 4BP3A 1QH1B 3ER9A 1DJPA 1MW9X 2ZIUB 1K88A 4D3XA 4DSAA 5L45A 2R00A 2ZM5A 3JQGB 4JBIA 4LZZA 4ER5A 3I3SR 2W5UA 3DC7A 4AUMA 3RR2A 1KMHB 2H85A 4DZTA 4K9LA 4KH0A 2JAOA 4UMEA 1D2RA 1F8UA 4WA8A 3SHTA 4PSDA 1L8OA 2QU8A 1NRXA 2YTZA 3LYAA 4TN5A 3DE4X 1S3GA 2C8JA 3COYA 5IYZF 4BWGA 1YZNA 2HIHA 4DLAA 2P9CA 3ORQA 1AKVA 4MULA 1J1IA 1TL7C 1U2SA 3B8HA 4Z6KA 1CDOA 3EEFA 3ZTTA 1EP1B 2XVYA 1U2ZA 3BA1A 3PXEA 3QBJA 5H4GA 4OU5A 3B36A 4LYHA 3RM3A 5KVVA 3LUHA 2ZRBA 4U3JB 1NJ1A 3RVRA 4CKBA 2A7QA 1QQ5A 2FSHA 2BDEA 2FWNA 4HLCA 4PZDA 2A94A 1XVIA 3INRA 4Y2JA 3WMRA 3RVMA 2AG5A 5A4KA 3T4PA 3ZX4A 1FJXA 1KAHA 1ZI8A 2O2YA 3FDZA 2XB9A 4KREA 2DPYA 4OIFA 5T8KC 4IIJB 4EVQA 2HRDA 4QE3A 1SXJB 2OO3A 4NU5A 5IVKA 3U7GA 4BX3A 4PZ9A 2CNNA 5ALWA 1YBHA 5JS6A 2M2IA 2GZ1A 1U65A 2XOXA 4ZYZA 2JD2A 5ADHA 4JVSB 1FTYA 2I3DA 3A37A 2XKKA 2C4MA 1N8SA 5ALPA 2QD3A 2QTLA 4IKEA 4RQBA 2RHLA 4Q39A 2CNWA 1EFLA 4AJJA 2XDQB 3IJRA 4TL9A 1BX0A 1HV8A 5JDCA 3PI6A 4FN5A 1JLMA 1W4RA 2YWBA 3WO0A 1TTPB 1CQPA 3QX9A 2QRGA 1SOWA 2PUGA 3DMHA 1RM3A 2FPWA 5KB3A 1WPQA 3QX8A 5ALSA 3JY6A 3C3CA 1SVKA 4Y2QA 2WD7B 3QWFA 4EFNA 2GBCA 2GEVA 3MT7A 2B7CA 4MUNA 5KYGA 1EDDA 2Q5JA 4TUYF 1WU7A 3QTLA 1W47A 3I1IA 1ZXXA 4EITA 1BKSB 2JASA 1ZHOA 3GQBB 4IW3B 4R3WA 4KIGA 3PHHA 2BM0A 2NU7A 3FF1A 3GGSA 1YCGA 4XH9B 3VR2D 4ETWA 3UAVA 3MK31 2P69A 2VBFA 2PVPA 3B9QA 1YFZA 3PEVA 2C83A 2JI7A 4N39A 1TM3E 1VPVA 2PN1A 3U4HA 4BVJA 1LLQA 1NVBA 2B92A 4LRQA 4UU7A 5DULA 3HVHA 2JKZA 4LDRA 1KYZA 4B4KA 4CCYA 1D07A 1V8BA 1XYGA 3DE1X 2ZRGA 4TMWA 1H2YA 4HFJA 4BQSA 1XVTA 1DLJA 1FLAA 1MEOA 1M3SA 4WBSA 5ERXA 5AVKA 3REOA 2Q8QA 1U2EA 4NZ9A 1DQRA 2ZBPA 2ZYWX 3BPSA 1U7PA 4PQFA 4R40A 1GL9B 2C07A 2Y1WA 4AROA 4ZO7A 1AQNA 1SD1A 2VAXA 3V1TC 5JH7F 5JD3A 1N2HA 1G3RA 3TRKA 1I5EA 5DMHA 4LC9A 4MROA 1VCHA 2P9QA 2R25B 4XXHA 4XYGA 2KX7A 3WNVA 4CTKA 1Y3AA 4HGQA 2YRXA 4RMNA 2WB2A 1CZKA 3MCVA 2Q3HA 3ONWA 4R8LA 3T15A 1R4MA 4E2WA 1YE3A 2P1RA 3QYFA 1D03A 1VMKA 4Y6RA 4D0RA 1Q6YA 3OM8A 5LA6A 2WE8A 4M38A 4WE3A 3AF6A 2ZAGA 4ENPA 2DUJA 4CM4A 1LGYA 3AVTA 3B70A 2FSIA 4FC7A 4V3BA 5G41A 1T0HB 4DR6B 2EJCA 2W2NA 5DE3A 1VM6A 4BO2A 4ZI7A 4TTJA 4Z4QA 3OQPA 5KTKA 1P0MA 1UZAA 3O2NA 4WAUA 1S3IA 4H7IA 3T7IA 1UIMA 4HLUC 4RQTA 3IAM6 5CA0F 4BJ1A 2BD0A 4QU5A 1AUXA 1U11A 1V4BA 5IFKA 1SXQA 1P2UA 1B93A 1E2QA 4M9XA 4CMKA 2XLCA 2Q7DA 3QPWA 3RS3A 4HDOB 3UJ7A 2KM1A 1XD2A 2GT1A 1SVLA 3OU6A 3L4BC 4HNQA 2CNDA 1G2OA 3MWFA 4H7HA 3QE0A 1V9LA 3E6AA 1AKUA 2Q5IA 3G68A 5CGZA 1E3DA 3VZPA 2XQKA 4C5AA 3BAZA 4F97A 5KNBD 1WEHA 1YVPA 4RYDA 5HF6A 4CT5A 4O2RA 1DKUA 2FX5A 1QCZA 2GB4A 4QEDA 1P4SA 1BGXT 5FJIA 5IM4F 4P84A 4XEUA 5DHUA 5KVQA 3OZWA 1I4WA 3HO1A 4A6DA 2YBEA 3LK6A 3DT9A 5FPTA 1PO7A 1NHWA 4ZTBA 2QM7A 4ASUA 4NDNE 3OHSX 3AHHA 3TQQA 4DSOA 1ZJ5A 1L5YA 1JBQA 2WWVD 2XF2A 2I34A 2L18A 5JV5A 1H8EA 4OI1A 1YFKA 1Z2CA 2HSJA 3EMDA 2VWHA 4GLLA 4CDGA 5KHOC 3R7DA 2EF1A 3G88A 4B8WA 2WG1A 4YS6A 3H8JA 1WHTB 2WUVA 3H4TA 4C04A 5C37A 3M9WA 3W8RA 3AV3A 2VNSA 4EAAA 1QIDA 3QU4A 4KWEA 2PLRA 1GQSA 1ZS9A 2O2EA 3OI7A 2F3UA 1HKHA 1OI3A 3NVDA 4ADSG 4IWNA 2IYFA 1C7EA 2XV1A 2JBWA 5KOIA 4OVKA 1SKBA 1PFKA 4TS3A 4DRZA 1RS0A 4LOLA 3UK1A 4TV8B 2OVBA 2P40A 4E51A 2W48A 5EUMA 1NG1A 2HK8A 3IAS6 5JXGA 2H7YA 1Q3TA 1ODLA 2QTVA 1AQ6A 2OO5A 3ZW8A 2UVQA 2UUAB 3M6VA 2PSEA 4H27A 3TO5A 3T34A 4FC6A 1BMFA 1IZ0A 3EGVA 3LYHA 4E15A 2OA0A 1JHAA 3EISA 4M36A 4NICA 4F4JA 4NG5A 1DRWA 4OMCA 4PX5A 4CUJA 3I9V6 1C3VA 1K7YA 5C8DA 3ZIDA 2HNBA 4CTNA 2BLLA 2H9IA 4HL6A 3QKRA 3L0PA 5DPMA 4I8IA 3S8MA 3V4PB 1XDBA 2FJ0A 2DR2A 1O97C 4L2IB 2ZBDA 5EQTA 5D8DA 1QF9A 2Z5LA 3FHOA 2AHOA 2BEVB 3GJ8A 3EZ9A 5CPBA 4ZVMA 3VR5D 2LCFA 1MJHA 3UJAA 1SVOA 4NIMA 1UKEA 4OJTA 3W8FA 2ZE6A 1OFUX 1TVKB 3QHAA 5PGMA 1FVOA 1OZAA 1HNWB 1Q11A 2ZETA 1FSPA 2HA4A 4AULA 3LL7A 4A0SA 5SICE 5F1YA 4UATA 4ZOAA 3DUFB 3BE8A 2D1SA 3K1TA 5TEWA 2VCEA 1G6KA 4DV6B 4IDCA 2P9GA 3D8SA 3Q12A 1REQA 2GNPA 2WKSA 4Z1OA 5GINE 1YI0A 1ATZA 1T5HX 3DZJA 3GLIB 2GN0A 4AQDA 4FDMA 4B79A 3BUSA 1TA9A 3ZLTA 3HDHA 4UE2A 3K2QA 1EK0A 1OC2A 1BGVA 4CN8A 1YE5A 3SIWA 4E14A 5BSHA 1KJIA 1QIGA 3ZDXB 3JARA 4Q6WA 1E4YA 1S2LA 3KPUA 2IYAA 2Q9AA 4D3DA 3G0GA 1LDEA 1VSQA 3COZA 1RP7A 2P2YA 3AVPA 2OC9A 4RZXA 2PRIA 3EAFA 1H4SA 3N2KB 2IH2A 5KQRA 2DQ4A 2CLSA 2WWTA 4UHFA 4WZAA 1A5TA 3LU1A 3LBYA 2GJAA 5FOWA 3CZCA 2HRBA 3MWDA 1NUSA 1JQJC 3ZZ0A 4A92A 4GM4A 4JJZA 4AJLA 3VHRA 5FI0B 1FYVA 3ZIUA 3HDQA 2A5GA 4GE0A 3T5TA 4D3FA 4Y2GA 3MFYA 4OBEA 2IEDA 1WVGA 3BOSA 4KVFA 3TZLA 6LDHA 5AUQA 4YPFA 2D5BA 4UM5A 1CWUA 2ZRLA 3HBAA 1VDMA 1DV1A 1X39A 4FW8A 2OHIA 4G2TA 1MP0A 2A5YB 3W9YA 3ZU5A 4Z4CA 4EPYA 1EGVB 2X0NA 4UU1A 1ZLYA 5BRJA 3K0EA 4JU8A 1WUIS 2I3GA 1NPDA 2PKXA 1NOJA 4I8DA 3RUHA 3T52A 4KFUA 5EXEA 1VJ1A 3OZUA 2GK3A 1E92A 1O0BA 1J7KA 3ER6A 5HKOA 1GUDA 5JWOA 5DYGA 4EGCB 1CW2B 1K5GA 2FETA 2YVUA 4J2HA 3CLUD 4R2IA 3T7EA 4D3YA 3CEHA 1LJ8A 3CX6A 3ILHA 4D6PA 4QUGA 2CLMB 1O6FA 3UYLA 3TFOA 2IYEA 1KS2A 2E82A 5AQ1A 1P33A 2B82A 2WT8A 3QVJA 2JJ1D 4LCEA 4WXMA 2Q29A 1E1RA 1KBQA 1Z45A 1XMXA 2BELA 4FYIA 2YWCA 4QU0A 4F2WA 3DEJA 1DLIA 1P2VA 1UT8A 1W5EA 3QE3A 4M60A 4F21A 3NBXX 1LDMA 1RI5A 2LBPA 3PPIA 1ECFA 4YJHA 3IELA 3Q85A 1EFRA 2Y4OA 1ILWA 3P0EA 4K28A 4TRJA 4CL0A 4HVLA 5I7OA 1QF6A 3KR0A 3RC3A 3QVGB 4LFBB 2PR2A 4KODA 1VHLA 2C9OA 3AUFA 4CIAA 3FD8A 1DMSA 1BVUA 2IKSA 1ABFA 4I55B 4WQMA 1PFWA 1RXCA 4WSOA 4QPCA 3FPBA 3FETA 4ER6A 1R15A 1D4OA 2V4ZA 2Z56A 4C4YA 3ICWA 3H7AA 4XUEA 4FFNA 2ONZA 4RF4A 5SY6A 2QX4A 4PANA 4K6MA 5CNMA 2VDUE 3NXKA 3GRVA 4IIGA 5BNZA 3UW1A 2ZE7A 2HQSA 1NG9A 4KXQA 5LWQA 5K1ZA 4CDRA 4LNUB 1AHHA 6REQA 2W22A 4A6EA 1ZC4A 2V4MA 4NEGA 1GG8A 2VK4A 4QFMA 2EVWX 2YWGA 4ZJPA 3JXEA 3KOYA 5IJ0A 4DA4A 2PGLA 1KSJA 1ZM7A 3S1AA 5K6AC 3F8TA 1U4NA 1JBEA 3H8WA 1N2CE 2C97A 2IW3A 3QBDA 4TVSA 2G1KA 2HJWA 3VOAA 1A9OA 4D5EA 1EXVA 1U4SA 4URUR 7GPBA 4REQA 3RSOA 4H3HB 4U63A 4Y2PA 1ECCA 3NWBA 2FI1A 5DTIA 3P4XA 3SDBA 4BLUA 3TR6A 4EW2A 5B2ZA 2IYZA 2AR7A 3MJEA 3EAGA 5HR5A 4EW6A 2O8CB 2AI3A 2H6EA 5L4LA 5DK6A 4O33A 4X20A 2OLKA 4LYAA 2A0FA 1OROA 4RFVA 3GMTA 5J4VA 4FEAA 5CLQA 4ZVRA 2IOFK 2CBXA 4QUBA 3TQOA 4B35A 1KY3A 1B3RA 3QP9A 4Z3OA 3HK2A 1OYVA 1XFAA 2HWXA 4LDQA 5FBRB 5G53C 5J2UB 4NBWA 4WI1A 1MF7A 3GT4A 3V3TA 3G1TA 4UUQA 4R71A 1OAOA 3H2YA 3TCNA 3MMNA 2PLFA 4QDOA 5BYKA 1SC6A 3B60A 4CMIB 2VSYA 1SBYA 1SUDA 1K63A 2AKYA 2YVQA 2O14A 4DGQA 1B3BA 2DC1A 3Q88A 1OYYA 4P3XA 2V03A 1BWSA 1Z0IA 3ERCA 1DXOA 2PUFA 1AH2A 4LF7B 1Z4JA 4HAIA 3KKMA 5ARCA 1AKYA 1NLMA 2IC5A 1V41E 3IMEA 3PIRA 4I1VA 2EP7A 1PIWA 4L3OA 5KI6A 5JRDS 3K6RA 1Z5ZA 1IY1A 3IA2A 3IV7A 4LE0A 1OWPA 4MR8B 2CSUA 3BMCB 1ZH4A 4QEKA 5GWXA 3RJ9A 3L7AA 3RHSA 1KVQA 4BMOB 1M83A 4QT4A 5A9SA 3DFIA 3G5AA 1T2EA 2X1LA 4BZWA 2H00A 1ZVQA 2NADA 4M1ZA 4OGWA 5J9FA 4M99A 1X8LA 2HWWA 3ELYA 3N59A 3Q9UA 4U0KA 1RAFA 1I2CA 5KUTA 2Q3BA 5CUQA 5JMWA 5KNCD 4I6GA 5EKUA 4DA6A 3VKHA 4JB3A 2NZUG 4HDSB 3SR3A 2P9TA 2HRCA 2AOXA 4EJ0A 5KX5B 5JADA 1XTKA 3KJZA 1QOZA 1WL8A 3H9EO 3QKWA 1J25A 1MORA 1L5NA 1P3JA 4KQMA 2PRZA 5SZHB 1FUKA 3CWQA 2XBUA 1DBWA 3FZEA 4MV4A 3KYCB 3H1AA 5DZSA 3C3YA 4B5KA 3SJCA 4BV9A 4DBZA 4WW0A 2CJWB 2CXSA 1U9JA 4NCHA 1YS1X 2CVPA 5CAEB 5A5FA 4GOJA 5I8WA 2P67A 1Z47A 1PJTA 3H04A 5I8PA 1NC1A 2JGDB 3WR5A 2OO7A 2PU5A 4RE5A 2WF5A 4XUGB 4KX3A 4UXHA 4XOUA 1AOXA 1XF1A 5GPBA 1E2BA 2WMYA 3QXSA 1WA5A 4LS3A 1I4TD 2CFSA 2QV7A 4N5MA 5CMLA 5E9JA 4B7XA 3OAAD 5MFZA 5C5EA 2C96A 1HE3A 3N58A 4MQEB 4ZZ3A 3ZDCA 3D6HA 1OJ7A 4FGKA 3IA7A 4QOGA 1YVEI 2PZ8A 3BIWA 2COEA 5DX8A 2RCYA 1CEEA 3REQA 1N9KA 4F4UA 4MZXA 4RGYA 3VSDA 4B7UA 2YWEA 2GBGA 4NV1A 3HKCA 2OORA 5TXGA 2A5LA 2QAJA 5G1NA 3CJRA 4CQMD 1IXZA 2ETVA 2R7LA 5I7HA 3F9IA 1VLQA 5BSRA 3RW9A 1L5RA 2FFAA 3PTZA 3AB7A 1CRWG 1GG2A 2XYPA 3PHIA 3N2GA 4IJQA 4ZVUA 3V7UA 1RXUA 1XK7A 4I4TA 1NLFA 2JB9A 4KZKA 5LC1A 1EP3B 4YV7A 3U6BA 4V0QA 1N77A 3K0FA 3ZI7A 5NULA 3FPEA 4AO7A 2PS9A 4CKEA 4MI1A 3AEXA 1LK7A 2H5EA 5JPCA 2AOVA 1W52X 4Y6LA 5H3CA 1GNRA 4OIMA 1KO8A 3C3KA 3EULA 2QR3A 4YCDA 5HRUA 2AJDA 2FPIB 5I9LA 1RABA 1F2DA 2WQ7A 4LOAA 4DHWA 1Z7BA 3K9FC 1MDBA 4PVCA 1JEQA 1TK3A 1XTBA 3LFHA 4EATA 4FDUA 3RVNA 2P90A 4XIFA 5HYVA 3M89A 3AP1A 3KSMA 3Q8WA 1H22A 1YJXA 2RI1A 3WBKA 3QPAA 1MX9A 1DBQA 1C7IA 1OWOA 1M1YE 1Q17A 1WLYA 3GHHA 1N6IA 3NJ4A 2XNJA 3ODPA 5DNVA 3L7BA 4AG6A 4ZOLF 1RDFA 3R0IA 4EEZA 1KRWA 2G6BA 1KNXA 1Y4SA 4PZEA 1JECA 2QMYA 1JEJA 3EFBA 1HOXA 1GNTA 4IZOA 4RK1A 3O0DA 4YIKA 5TQ0A 4P82A 2OQIA 2PPVA 4TM8A 3ZD9A 1RXYA 2FY8A 4ZU1X 2IYYA 3OQMA 1Y1LA 4IDEA 2NVUA 3HADA 3KUUA 3ZVRA 3KK0A 2GEKA 3INTA 1IN8A 3CO0S 2M1ZA 1LQUA 3KETA 2V7QD 3V8EA 2AWOA 3RGGA 1QYRA 1PV4A 3N1UA 2CT8A 2M98A 4RVOA 3OH8A 4O0LA 1QGED 4MV7A 4NABA 1P45A 3W2TA 2G80A 3H0KA 5KQPA 1CLEA 2WOOA 2BI4A 5EIBD 2NU9A 4J9UE 3MSCA 1FZQA 1HK7A 1M10A 2HDOA 3OAAA 2F00A 4Y1FA 2XH8A 5FORA 3DL0A 3E5RA 3QVMA 2A84A 3EJWA 4FBGA 4E3ZA 2C59A 1QNFA 5EP2A 3X2FA 1CJVC 2I99A 3L5KA 4FQ5A 3EQ2A 4R9RA 3W79A 2EJUA 2OXEA 2JA1A 2XCIA 3PE6A 3RTEA 5ITZB 2P6RA 3OE7D 4WHMA 1A2OA 3OOEA 3VISA 2WU8A 4DEXA 2WD9A 1Q1QA 2A88A 3H5AA 1KE1A 5LP6F 1VA4A 1I01A 4YK7A 3JYOA 4KYVA 2EQBA 4GM0A 4TOIA 3LY5A 1ZD8A 3GEIA 2XECA 2CJFA 2FP3A 2GKSA 3DSRA 1WUJS 4G1EB 1Y8AA 4AAYA 5LYJF 1JG6A 1V1MA 1YBAA 4PWYA 1T2VA 1H9BA 4ETNA 2BE7A 1G66A 3GA0A 1V25A 1G291 2NZ8A 4JLVA 1QIJA 6Q21A 3DBIA 5K8JB 2G17A 2RHMA 3ETHA 3IB6A 3LBHA 4LX8A 3NANA 3G2LA 1W2HA 1GQFA 3LUKA 1JI3A 4JHXA 3DLBA 1YKFA 2IEBA 3U3RA 4TM7A 2CUKA 3WYCA 4GMFA 3VO1A 1LLCA 2JK1A 2V98A 2V97A 4ZCPA 4C0BA 4ENRA 4HAOA 3UQZA 1KIFA 4WJKB 3T5CA 1PW5A 3W5JA 2OG2A 3WLHA 4E11A 3FTCA 4MV8A 4TYYA 1CNMA 2FEPA 1H2FA 2O8VA 4KWIA 4DDKA 1C7JA 2QL7A 3HB7A 4YAGA 2CD7A 5TNXA 2XMCA 1EAMA 3DBRB 5FBQB 3AGQA 1H6BA 1GAQA 2XB4A 2VSQA 1BHSA 1U3CA 4UEQA 4R1OA 4NHEA 4ZK2A 4ARVA 4ND7A 4NRDA 1WCWA 3FA2A 4RU1A 3PKZA 1WXIA 1DVRA 1ZUNB 4MKIA 4AFNA 1IRXA 3EX7C 1WD7A 3ISTA 1FFSA 3AM5A 2RB5A 5I9MA 1AD2A 4OSEA 2HYDA 1W36C 3LO5A 3PP8A 4L50A 1ZD2P 1G5TA 2QW0X 2Z1DA 3IMCA 4Q5IA 1OT5A 4QUKA 1Y7TA 4TPKA 4DIMA 4LECA 4B9EA 4UFPA 4J91A 1IJFA 4JI5B 5IG2A 2AF4C 1R6VA 3PUXA 4LF5B 1G4HA 2C57A 1KY2A 4U2BA 1RI3A 2VDJA 4FKZA 3S2IA 3PFNA 4E5YA 2Q5OA 4I5GA 2CVOA 4MUJA 1A96A 3PUWA 1XZEA 2IHUA 4BX2A 1JLKA 1LVGA 2IDZA 1Q1ZA 1WY5A 2AB0A 1N5RA 1U90A 1Z34A 2V7QA 4JLJA 1A72A 3RC7A 5EN4A 3OOWA 3NHYA 5CBKA 1H2WA 3BKWA 3PNPA 3MUOA 2CVQA 1RLTA 1XJCA 2PRKA 3HCDA 3JPYA 3ZDRA 4G4SP 1KI8A 3E9DA 4KXYA 5KYXB 1N6PA 1E69A 3P45A 3IE1A 1O7JA 4ZVPA 1JDZA 4N6OA 5DTQA 3VDQA 1MU0A 3D6JA 1HA3A 1WDKA 3FUXA 5JFOA 1XU9A 3V1LA 3WQQA 4RIIA 2GCIA 4AZ0B 5C18A 4HJXA 1A27A 2ZJ5A 1E1KA 2WIJA 3P8ZA 1YHYA 3OE7A 4XIGS 5IVPA 1L3CA 2FPGB 3LDHA 4DPLA 3FRHA 2R6GA 3K1YA 4CM6A 4A15A 2XRMA 3VPDA 4JP2A 4XLTA 4DCMA 1TT5A 1Y1PA 3M6FA 1P5RA 4FZJA 5HP4A 1RKXA 2AV6A 1BEZA 4GDMA 4G1MB 4DBVO 4GYWA 4IOMA 2NSLA 1GRVA 2YS6A 3N6XA 1M72A 5HCNA 1IJKA 3GLGB 1E66A 2DLNA 4DCPA 1SB9A 4TLMB 3P9IA 2EW2A 2FDRA 4ML3A 4TGLA 4WKGA 8LDHA 3ZLVA 3TRIA 3H1FA 3OX2A 3DOCA 4X92A 1NJ6A 3QUAA 4EG3A 4MV5A 4KRFA 2X8WA 3QU2A 4UEWA 1BCSA 2WYVA 1TK2A 4M1YA 5LP6C 4QDXA 1QAOA 2H06A 5BV8A 4M1EA 4KYTA 1EGQA 1AS2A 5JNLA 1YC5A 2IYNA 1EJ2A 4IIFA 5CRIA 5B1YA 5C8YF 5C7YA 2E85A 3MGAA 5EMNA 4BN5A 2ZRHA 2D1RA 1FFXB 3H86A 3CSUA 2CL5A 3CZ4A 3F4BA 3FJ1A 5E6UA 4FFBA 4C1NA 3SYRA 4TTTS 3T1VA 3A3OA 1KKLA 3LPMA 4X00A 4GR5A 4KQ2A 1UPTA 1E6CA 3KQPA 1QC5A 1A98A 1IL0A 1YOVA 2AQHA 2HXYA 3L7JA 5JQGB 1DFHA 3ZGVA 4UJ5A 1T9AA 1L4YA 1SHJA 3A32A 4TLEA 3V1MA 3WGKA 2BGWA 1Z8FA 3EF0A 3KEMA 4G5HA 1T9GS 1X7HA 1GNLA 4EHNA 3LW7A 6ABPA 2VRWA 3DGEC 2J1LA 4AP9A 3TJZA 2EJVA 3KEGA 3V4RA 5JWRA 3SQMA 4GI2A 4IF4A 2NU6B 1T36B 2ZE8A 5KOJB 2H11A 1INLA 4L6AA 3QBVA 1QQAA 4LHSA 1QG4A 2PBRA 4M6WB 3OPXA 1I32A 1GSOA 3NV7A 5A5DA 3SF0A 3DE2X 1N5IA 3KE8A 5IEJA 3NW9A 4OY3A 2CB9A 1LF5A 4I08A 3ND9A 3PUJA 2PEZA 2C2MA 2DFDA 2DTDA 2RJNA 2WIKA 1PR6A 3K0AB 3KIPA 4BRWA 4BGUA 1Y3DE 3TL3A 3TQFA 4CHTA 3A7EA 5LM3A 2G4CA 1FC0A 3H3XA 1DUSA 2BR4A 4I4CA 3ABQB 5DP1A 4Y30A 2JRLA 4DDTA 4RV9A 3CJQA 3GH3A 3OMXA 1JHXA 1P80A 1XP5A 3BWEA 2PMEA 4HJRA 3TSWA 4XVUA 1GV1A 1V9CA 3OIVA 4G5FA 3H2BA 2XQJA 1UM8A 4GR4A 4U9IS 2D0PB 3OQBA 5EWMB 4Y6QA 3T12A 3HL0A 4YXWA 2OHJA 3PPYA 4CLRB 2OV8A 1HZZA 2UAGA 3FCEA 5SY9A 3KHUA 4RDIA 4TX1A 1DBVO 3FUVA 2DMRA 4G25A 2C95A 3ZZMA 1YS6A 4JC5A 1PFQA 3WDSA 1Q6ZA 1F4PA 3UOAB 1CUWA 2HLHA 2WPDD 3LLSA 4BWYA 1CD5A 1U6IA 1N2IA 3G1WA 1IXKA 4I8XA 3TSAA 3OZCA 3MT8A 2IGTA 3LT0A 3ZV6A 1AF4A 1F7UA 1EUDB 2IDMA 3SK0A 3IJPA 1GYPA 1U3DA 3T3GA 3CEJA 5FA5A 2WZBA 2FFBA 3L41A 521PA 3DPUA 4X3CA 1MQAA 4AWXA 4ZHQA 4BNNA 1YRHA 1TZ2A 1B4DA 4OL0A 4Z7OB 1E4EB 3GJYA 4GT1A 1WPRA 5K20A 3JATA 2FR8C 1WSBA 2VWQA 1YQGA 1AS3A 4W6QA 3X1DA 2I6QA 2NNWB 3MUNA 1IULA 5EJAA 1GVHA 1YR8A 2ZULA 3RFUA 1TCCA 3AOGA 4NCNA 3RVOA 2GBIA 2Q8NA 4JI7B 2C3UA 5BUCA 4CZ2A 3R2JA 5AW4A 1NE2A 1BE1A 1CSEE 3EIEA 2P1ZA 5CFMA 3MXOA 4OLFA 4XPIB 2J6IA 4BWVA 5HCUA 3RUPA 1N33B 1O9HA 4OYYA 1G1MA 5JH7B 3NBFA 1W88B 4RHUA 5F3RA 3D8BA 1P0PA 1XEWX 3DW1X 4L27A 4KYUA 4R83A 2ZT6A 2X9LA 4X1OA 3EARA 2ERCA 1PK9A 3H1PA 4BO5A 3AI3A 1CERA 5LXTA 5FPPA 2ZS9A 1DOAA 1RBMA 1VG1A 4D79A 2JLUA 4AZ3A 1E9EA 1N9GA 1GNSA 2Z3ZA 4U2FA 2NUBA 1F6DA 4DR7B 1J90A 3VNSA 3D1JA 5CX4A 4RTPA 4KZPA 1HO3A 3K15A 3R3VA 4JKOA 4U2DA 5TPWA 4B2IA 5BR1A 1AQJA 4ABTA 3SNHA 2WUEA 1CQZA 1GZHB 4PXSA 4W63A 3SIPA 1PS9A 3THWB 2A14A 1KEPA 4L9SA 4KR3A 3BB1A 3WP0A 1U0FA 3AUAA 4N0PA 2QLBA 4CM1A 4Z7NB 3FWPA 3LY9A 2IYWA 1TUGA 3A1SA 4IIDA 1TQ4A 3Q87B 4W5WA 4WEQA 3GJSA 1PV2A 1AU9A 4P0QB 1N6RA 4MA5A 3T7TA 3L3BA 5AI8A 1JIXA 1GUYA 3CA8A 4O25A 1ARZA 2OFOA 2VDQB 2VUIB 3WSVA 5J43A 1Y80A 4R2JA 3H5OA 1G42A 3KYJB 3RRYA 3AB3A 2VQFB 1SCJA 1CJMA 1C1DB 2FUNB 1P4AA 3W5BA 2EOAA 1UDAA 2GCOB 3ZHSA 4GMDA 4FONA 2X5NA 2FJUA 2WMNB 3P0FA 1TKAA 5JNRA 2P9ZA 4I1YA 1T3LA 5E6SA 3F9RA 3ZQKA 2UZAA 2IXEA 2AC2A 2D74A 3ZHRA 2JA2A 1H0RA 3HC7A 2BDTA 2GO7A 4JYBA 1UMCB 2XGOA 3T35A 3NAGA 2NPFA 1U1IA 4HV4A 1AM4D 2CDCA 1V8PA 1CIJA 4HXFB 3EVDA 5FBWB 1B0PA 1TDJA 1WTAA 4LHYA 5HF8A 3MRVA 3T7JA 4D2IA 5LJLA 3HXKA 2PX2A 4K9NA 1NBHA 1I4DD 3V4SA 2XYHA 4DV3B 1JVBA 1FX0B 2RARA 4KC0A 2JF0A 4KUEA 5CFOA 1E20A 3EDOA 3BMQA 1EG2A 4N3CA 4E5DA 5DNCA 1GL6A 2R65A 1RRGA 5E4TA 3L8GA 4Y9UA 4QU8A 3UGKA 3REFA 1T9ZA 1VLLA 4ITVA 1ZXLA 3KHKA 5L6MB 3PJFA 5FOTA 4HH3C 4FZVA 1BJRE 4KI0A 2ZZKA 4HGPA 2LCQA 3UT0A 2GFHA 2RH9B 3NDBB 1FNMA 3V9AA 1H9AA 3KR9A 4Q3CA 2QB5A 1LA2A 5EIWA 1BIFA 4TT3D 3LOPA 4L6CA 4ZDKA 2HJGA 3CLKA 2CEAA 1ZY2A 2EBWA 3ZK7A 3ONEA 2WYIA 1VJRA 4KO2S 4MW7A 3UXMA 2V6JA 1CUDA 3V8PA 4DM3A 1N36B 3Q5DA 2CXTA 3N2NA 3DDSA 4RHFA 5GONF 2JK0A 3U9TA 2WM9B 4WXRA 2I5PO 4YLEA 2NQ2C 3LA8A 1A5ZA 1CQIB 1NR1A 2B3TA 5L51A 1JR3E 2ZSJA 3D7NA 4BQIA 5D3MB 1S9DA 3GWZA 1MIOA 1V5FA 3M6MD 2I7TA 1DDOA 3I6MA 3RRXA 1MC1A 2EHDA 5BW4A 3CGWA 1GVNB 4G0YA 4JBXA 4BY9E 1SO8A 5HMLA 1TTTA 5DLDA 2ERXA 4NS4A 5KQMA 5HTKA 4DNPA 2PA0A 5JUWA 3AL0C 3EXIA 5B5SA 2G76A 2W2PA 3GRAA 4LWOA 1C8BA 2EJBA 5IX8A 2X23A 1ZP6A 4DZZA 4L08A 4Y2XA 2OBLA 2VYCA 1EP9A 1HYGA 2WLTA 3K4PA 4ZCQA 1PX0A 1U80A 2UUPA 4TN1A 5LBUA 1ZR4A 3I6IA 1FU7A 3DE0X 3F6CA 4UMFA 1U8TA 5L40A 1X74A 2Z5VA 1H6CA 4EKDA 2GN2A 3DR5A 4LKOA 1C9YA 4OAOA 4D9JA 4ZCLA 1DIHA 4PNEA 4MYCA 2V3VA 1IM8A 1NOKA 4B81A 2I3BA 2X6QA 4GPBA 2AFIB 5L3QB 1Y8RA 1YUMA 2GSDA 3C7CB 3BSFA 3O4VA 1K9VF 2DQZA 1FYWA 2OHOA 2X15A 3AKEA 1JKMA 1M2HA 3MOGA 1LS1A 3O5AA 4LDAA 4ZAYA 4BBPA 1T3HA 3GZ4A 4EB0A 1G59A 2H51A 3S2SA 3QU9A 1SGWA 2W9XA 4HDMB 4UMDA 2LVBA 3WICA 1K6XA 2LIVA 3DZFA 3VAZA 3O74A 2OCYC 4DLVA 1DBIA 3S27A 3TM4A 4MW0A 4KDRA 1VI2A 4IUCS 2J5BA 3ORSA 3NT2A 1I7LA 4RESA 3SKXA 4YYZA 2FX2A 2H3EA 3CNHA 4IIVA 4RSRA 3V8BA 1UQTA 5EIEA 1D1QA 5LMZA 3JWHA 4BFXA 4IWXA 4RE6A 3I61A 1Q15A 4HFRA 1SHKA 4WCDA 1NBMD 2HU7A 3AFGA 2ZJAA 3B2QA 1V3UA 4Q9AA 3UIEA 4ZYLA 2ZLBA 3KKEA 3KZVA 3C3WA 1P2GA 1OBHA 4QDKA 1OY1A 4RANA 3EZFA 4C20A 1HY3A 1DU4A 1CUHA 1VPEA 3N3BC 3PEUA 4QATA 4B84A 2I1QA 2Y92A 4M3NA 4ER7A 4Z49A 5C81A 4PC6A 2FQ1A 5ENVA 4WGFA 3S5UA 4ALKA 5LQJA 2JC3A 2D7CA 1P1JA 1D09A 3DOIA 5A4JA 3BFKA 2CHFA 5C3MA 1E2MA 3GRKA 2QX7A 3OIGA 3ZCTA 3C3PA 2XQFA 1XAHA 3W77A 3BIJA 1QRRA 3WYAA 4OJKA 1D8AA 3GPCA 4RY8A 2DR0A 2F6RA 3JVIA 3EWIA 1KWKA 1WMDA 3LSTA 1XPOA 2AK3A 1GSHA 1E0AA 1XQVA 5C7LO 4CLDA 3H16A 1Y8QB 3OQIA 2REXB 1I6LA 1ZCAA 2DCMA 2WVGA 3VYRB 4AG5A 5ALQA 1DKQA 4TV9F 4XIIA 4X7PA 2GK6A 4IRMA 4JYCA 4BFYA 1OH7A 5EIXA 1L8QA 1XLTA 3EPPA 3T5GA 3UK7A 1FUUA 3S1SA 2VK2A 2PX6A 3AMVA 4RSGA 1U2DA 5IKOA 1YR2A 5I9SA 1H2HA 3ZD6A 4O2AF 4U2GA 4WNAA 5FQOA 1JU3A 3WGTA 3BXOA 3I6QA 4WKPA 3WGVA 1P17A 1U2RA 4Z9YA 3TWOA 2XDYA 3I39X 4YJ3A 4XQEA 2DWPA 3AZQA 2XCRB 2XNSA 5L53A 5IBPA 3SPXA 1TCUA 3TSZA 5BVGB 1XEXA 2IHKA 2A58A 2GZ2A 5AOBA 2ONYA 3AIOA 2CKDA 4QNRA 2A9FA 5TGDA 1E9AA 4TWJA 3VPGA 2IU0A 1RRCA 1KOGA 2D59A 3KC2A 2B30A 2IEZA 4GXNA 4D8VA 3ISJA 5BSEA 2HY7A 1XNHA 2ZJBA 1N2GA 1OBVA 1YZGA 2FG6C 4NG4A 3KCNA 1TFUA 2OFFA 2BMDA 2H7VA 3IEKA 5KWSA 3RUAA 1E59A 3O9MA 4MKXA 1N5JA 5I4IA 1DCFA 1B76A 1U9YA 1X7YB 2FRDA 3TQHA 2DERA 4F9TA 1WSAA 5EFOA 3RJZA 2R4UA 1EVQA 2P7HA 1CUBA 5CGQB 4OQEA 3ZVKA 5U4XA 3CSSA 3NJ8A 3SSNA 1PCXA 3TN7A 4PICA 3THOA 4WRRA 1G19A 1IBLB 1FFAA 1GPNA 3ZHQA 1Y4ZA 2O7VA 3CUKA 3D0QA 4LVCA 1OU4A 3FIJA 1WB5A 3T54A 5B1EA 3A05A