3FOFC

Structural insight into the quinolone-dna cleavage complex of type iia topoisomerases
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
220
structure length
196
Chain Sequence
TPAQSNPAKNELYLVEGDSAGGSAKQDRKFILPLRGKVINTAKAKMADILKNEEINTMIYTIGAGVGKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKMSKGKGKKEEVAAWTDGELEELKGATLQRYKGLGEMDQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insight into the quinolone-DNA cleavage complex of type IIA topoisomerases
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Isomerase/dna
molecule keywords DNA topoisomerase 4 subunit A
total genus 19
structure length 196
sequence length 220
chains with identical sequence D
ec nomenclature ec 5.99.1.-:
pdb deposition date 2008-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
C PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fofC00
4G0WA 2XCTB 1BJTA 3RAEC 4Z4QA 4Z53A 3KSAC 2XKJE 4G0VA 1BGWA 4FM9A 4J3NA 2XKKA 3L4JA 4G0UA 3K9FC 3KSBC 5EIXA 3LTNC 3RAFC 2XCOA 4I3HA 2RGRA 4KPFC 3QX3A 3FOEC 3RADC 2XCSB 3FOFC 3L4KA 4KPEC 4KOEC 2XCRB 4Z3OA 2XCQA
chains in the Genus database with same CATH superfamily
5AKEA 3Q7QA 4XFJA 4FGKA 1SKAA 3DF7A 3K0AA 3N2KB 2C9CA 4HDNA 4LPKA 1QPZA 4NZZA 3O4RA 2P9FA 2DOKA 3L46A 4OAOA 2QRGA 4R2MA 4U2CA 3W5JA 3KEFA 4CCSA 2VK1A 3INRA 5BRJA 4DABA 2LCFA 3V80A 2ZIUB 3TQOA 2IZZA 1J0DA 1CF9A 1BA3A 2FQQA 2QW1A 2EBHX 1GAQA 2FQXA 2VSFA 2IP2A 3IP3A 1OJLA 5LWHA 3B6EA 5AM5A 3OU2A 3RSOA 3QMPA 4RA6B 4JEUA 1ATIA 2KHZA 1GR1A 3Q0TA 2CEKA 4HX9A 4HKTA 3T38A 3UH0A 1MCZA 2YZ2A 3ZZMA 2E4WA 1J06A 2B61A 3UPDA 1XPJA 3CCBA 1S3IA 3C5HA 3WK7A 3VC1A 2BBSA 4K6OA 3O26A 4KVZA 5CG1A 1ADJA 3K0SA 1LI4A 1EZ1A 1PYOA 1R3UA 1RLJA 3OFNA 1TW2A 3EE6A 1D0IA 1PV1A 4ZVVA 3MT9A 3LPDA 1EUDB 2REXB 3DWGA 1PS9A 3WNZA 3A1DA 1UKZA 4R1LA 4YRBA 2XTNA 5J1TB 2L18A 4MMZB 4KZKA 4U5QA 4B32A 3E35A 1V8OA 4NP6A 5FWXA 1SVWA 1SZJG 2O8VA 1RBYA 3OOHA 2Y0EA 5KX5B 1JYEA 1VCNA 2ILTA 4DLXA 1K92A 4Z54A 1EDDA 2PSEA 1UINA 1LI5A 3HYCA 3H1BA 5TVKA 1NPDA 4C6TA 1LKZA 1OXSC 3FKSD 4XGIA 3VC7A 5BN5B 2BJHA 1BRMA 5GY7A 2W0SA 5FLKA 3GRRA 5CJ2A 3KKMA 5EQDA 3JCZA 5ICSA 4C6RA 4LFAB 4L0QA 4AJ9A 5HGXA 4DB2A 2Y0DA 4TS1A 4XH9B 1NQAO 4K9SA 5H82A 1F2TB 1HZZA 1ZQ1A 2FAXA 4QLBA 4PU0A 1RMYA 4FVTA 3B12A 4TROA 2Q7OE 5DYWA 5JXGA 4P3PA 2BHNA 2FKNA 3W77A 5JBNA 1UPTA 5EIXA 4G1VA 4RTSA 1EQ2A 1XCBA 4PC3A 5C1PA 2YYZA 2OO3A 1M1NA 5HIMA 3K70C 3UCXA 1G42A 1TUBB 4HX2A 4Z4EA 1BE8A 3LT4A 4I5DA 1MG0A 3QY9A 4L5CA 1REQB 4OOFA 4Q03A 1BXRB 1QGED 4WA8A 2A5LA 3SE0A 4MIYA 3NDIA 3TRJA 5LOVA 2VDUE 4KI0A 4LYDA 1J21A 4HQKA 2VL7A 5J2TA 5BMVB 4N6NA 1G18A 3L8HA 5A3SA 3MIZA 2GRJA 4O02B 1P9NA 3OCYA 4RENA 2NZJA 5I8PA 1B1CA 3H9EO 3QKSB 1E7YA 4D8UA 4YUZA 3D7KA 4OSOA 3ONFA 5CXSA 1RXWA 3U4QA 3CZRA 4IV5A 4QYIA 5COQA 1RHQA 2WWWA 4PHCA 4ZK6A 5LZ7A 1JN0A 5T4EA 1T2CA 4YP9A 3LUPA 3T1VA 4D9IA 2KSQA 1V5EA 4O2BF 1GV1A 3EEBA 3PX3A 1MEEA 3CEAA 2QT0A 3FJYA 4HI0E 4JB8A 3KR1A 1BWSA 3AR6A 2AN1A 4E3ZA 3TFOA 1IBLB 1J0AA 2AEMA 5TNXA 1D07A 2JIDA 1WNFA 2XXJA 3SGLA 4ETNA 4I55F 5HBRA 4C03A 3LQ1A 4AMGA 3VPDA 3ZU2A 4EY4A 2IXBA 1I1QB 5DXFA 3T9CA 2F2TA 1JAHA 4UPEA 1LPBB 3GLGE 2JBHA 4UFPA 1SA0B 3V8BA 3B2NA 1UDRA 1T4DA 4GG1A 4EFMA 5AI6A 1OH6A 4JI0B 2XE4A 2H07A 5DN6D 2WIDA 3M9XA 2Q62A 3FE2A 2WJZB 2W2NA 2O8BA 2C3YA 4H7FA 3TB6A 2IHUA 3SM9A 3SK0A 3BWYA 3LCJA 3RUAA 3WKEA 3AJDA 5K2OA 2XAAA 4H7JA 1QXSA 3UT6A 3AW9A 3OTOB 4ND8B 4H7IA 4R8LA 4NCAA 5JE8A 2CBZA 2IZ6A 1XJWA 5JIBA 3X2FA 5BQOA 2IS4A 1DMRA 1HV8A 1D5CA 1OREA 3ZHQA 7AT1A 5LP6B 2QR3A 3TKLA 4TYWA 1TK3A 4TKUA 5BXYA 2O8CA 2NNWB 2PQMA 2TRSB 3C43A 2DWOA 2RJNA 3KD2A 3LQRA 4JS0A 3R76A 4C3UA 4KQJA 5DEIA 4BQSA 3AOGA 1C3EA 2Q1SA 2ZI7A 4YAUA 1M75A 1AQJA 3QLTA 5CBPA 1I7SB 2DKNA 2NSLA 1K0UA 2ZDGA 3H97A 4JP1A 3DTVA 1QAQA 1YQEA 2WJYA 2Y1LA 4XEUA 5BSUA 1EXMA 2YJ4A 3WWCA 4G5SA 2QD2A 2FV8A 3MLAA 4LY3A 3HS3A 1UCFA 4NOMA 8LDHA 1MB0A 1W1IA 2JGFA 2X5XA 2GQ0A 3N9IA 1WBBA 1AHPA 2QRZA 3EFBA 3EC7A 4TWJA 3FYUC 3OLVA 4TQUS 4J3JA 2JD2A 2P7IA 5JSFA 5BUSA 5HVNA 3UANA 3MA0A 3EDRA 1EUDA 2PKYX 2C84A 3E5MA 1AGPA 2IYSA 3HY6A 4I50B 1QHIA 2BGUA 4MW9A 3NR2A 4RIEA 2NVOA 2RSLA 2DHQA 1MNQA 2MSCB 5HDBB 4EARA 3ZBPA 4JJAA 5CT8A 5FWXB 3BDIA 2XYGA 2YV4A 1D4ZA 2BLNA 4HAXA 5KVVA 4BNKA 4GWGA 2X0DA 3KYCA 3M83A 1L7NA 2Z0MA 1QG2A 1GQFA 3F6YA 4GE3A 2ZUWA 3TLBA 1ZHOA 3CISA 2PO7A 2ZPTX 3I5XA 3BIWA 4GZ3A 1FUUA 3A4VA 2M6SA 1QGDA 1YOVA 2WZDA 5J4YA 1P44A 4I4IA 4YALA 4BMYA 3X1KA 1NDUA 3BFKA 1B3RA 2AB0A 4Z3OA 1BQ4A 4FFPA 3R6GA 3FRIA 2XQVA 4HH3C 4JN6B 4CKZA 3CM0A 3VH3A 3B51X 3CWQA 5EE9A 1UP4A 1STOA 1ECBA 2P27A 1NUTA 3GOHA 4S1NA 4TSFA 2BGKA 3CC8A 4QOHA 5E3JA 3VR3A 1YCHA 3IULA 3SJAA 2ZWMA 4YRAA 1FA9A 2BGMA 1A9XA 2CFCA 2PMCA 3HYNA 3NYRA 1THMA 2HFKA 4L6CA 3CZ9A 4UW9A 2GETA 1Q7RA 5JPCA 2HJVA 4RACA 4GPEA 5KCZA 3U56A 2XQJA 4MIOA 1E6MA 3T3DA 3TTXA 1E6KA 2B3DA 4PFQA 2WQZA 4N5HX 4CTMA 3WICA 3K9WA 1LFDB 3W79A 4E3WA 5HZGA 1DIAA 4UMFA 4X6LA 1KY4A 1JDZA 1NYQA 2HY7A 4XUCA 5EIWA 5GPBA 1XQXA 1A7KA 4IKPA 5I47A 5IEJA 3CRRA 3CX3A 1U2SA 5EAIA 3F7MA 1JILA 2DH6A 2OTCA 3D54D 4B6OA 4D9FA 2XVXA 3FTFA 1GL9B 2G08A 2P9JA 4XLLA 5EJAA 3ZNOA 2ZRMA 1GPBA 3K71B 3LHIA 4KNYA 4L07A 5I9IA 1JKMA 2VQ6A 1YBMA 4RA9A 5L3QB 4F4UA 3K6KA 3GBSA 4PEVA 5A5VA 4B33A 3G0BA 3U3KA 3HN6A 4OB8A 2ONCA 4WADA 1OLSB 1G8JA 1ZA2A 2GPNA 3BX1A 3FXAA 3SYTA 3IOBA 4B4KA 3QP9A 3PTZA 2BMDA 2RH4A 1EFCA 1WV0A 1NY5A 5AVWA 3C87A 3IV6A 4LZWA 4N18A 3GHHA 4U9UA 4Q24A 4ZMBA 4QHTA 3K0EA 1TU3A 2XOEA 1Y63A 1EFTA 2B7CA 1HRDA 2VF7A 3BTVA 4TOIA 1XTPA 1OGJA 4UM9B 4ZCTA 3BN3A 2GKOA 4KXLA 4TWAA 3WHIA 4A15A 1TJ4A 5D86A 3EXFB 3RUHA 1ODSA 5L3ZA 3ZWKA 1GG8A 1DZ3A 4Y6GB 5DBHX 1JA9A 1BE1A 1W1UA 2IKSA 4LS3A 1YB4A 3LQFA 3W2IA 4EG5A 1ISHA 4I1OA 2WTEA 3NBKA 5B1YA 2H7CA 2WKQA 2YN2A 3GNTA 2G1KA 1YB6A 2IXEA 3PDIA 2FN8A 4CG0A 1W0KA 3AONB 3FB4A 3M4NA 3VV3A 2IYXA 2HUNA 3OT4A 1OU4A 1Z06A 4IXTA 4LOIA 4FE7A 1KOLA 4QTYA 5IKXA 1HX7A 3DQPA 3WSTA 2H5IA 1H0KA 3WZMA 2IU0A 4Z5XA 2QLLA 3Q12A 3Q7SA 4KYUA 4Q47A 1RM0A 2WJ6A 2QVGA 2ZR9A 3E9YA 3H5AA 3P45A 4KFCA 3KKNA 5MF6A 2XLBA 4JSTA 4MEJA 5ECGC 3TOCA 3W1WA 4BO9A 2REQA 4Q0MA 2O2CA 2XYHA 3B48A 3EXIA 1Y7PA 3BA1A 1XZPA 3O7WA 3OJXA 1K6MA 2FR8C 4I1IA 1LNSA 4P9NA 3IAFA 4AKSA 2J0QA 2IXTA 2UZ1B 3C85A 3TFQA 4KL8S 3KB8A 4RWEA 5IC4A 5G1PA 3CPHA 1QHHB 3LCMA 4JOQA 2AMYA 5F2KA 4QUGA 4AJIA 3ZHSA 1L1FA 3ODGA 4HQ6A 1GYRA 5HIIA 2LWIA 3AJ8A 3EVEA 2CB9A 2WB2A 3ORQA 1ZRNA 2CXHA 4EUKA 4ZU3A 4WJLA 1E4OA 2B7LA 3SHFA 1VKJA 2F7SA 4LX0A 1U04A 1JG3A 2I22A 3GWGA 6CHYA 1P7PA 3G59A 2YNMA 3RK1A 2WUFA 3U7HB 1LV7A 2JJ2D 3GV0A 2OCGA 4GXNA 5F23A 3GK3A 5CX4A 1KWKA 3EPKA 2W5UA 1V4NA 5BUQA 1MABB 2EARA 3E8MA 4JOCA 5H70A 2H51A 3RVSA 1N9KA 2BFAA 1ENYA 4WNAA 3FHCB 2I3DA 4GX5A 4NFSA 2GUGA 2R1ZA 3QXJA 4K40A 3H2YA 5SY6A 5U4QA 4OP2A 1ULSA 5B6IA 1HQKA 4K2HA 3PHBE 2VEOA 3GXOA 1HE1C 2CUTA 5CPFA 2Q6KA 3R7DA 1WW2A 1HBJA 3HI6A 4C0KA 3OZIA 4C4TA 1P5HA 1MR3F 3EFOB 4RSRA 2OCDA 2FDXA 4WE3A 3T4EA 3HV2A 1LLFA 1RMQA 1P5RA 2I2CA 4DDVA 2W37A 5CLIA 5JQGB 2I3GA 2VF2A 3QVKA 4Q6WA 5F1OA 1QOPB 2ZTVA 4K9RA 1DJQA 1N5OX 1WEHA 3HABA 4Y2GA 5H9VA 1B23P 2JFVA 2VKTA 1KEVA 3DZIA 3DZDA 2Q1XA 2F1KA 4YT5A 3CFYA 5I9BA 5KWIA 5LKAA 3LXMA 1GRQA 1G5TA 3PQDA 4YFVA 4ZYWA 5AW4A 2JAXA 1TECE 2WQ7A 2OQ2A 1VLMA 4BVGA 3N0TA 3F8WA 1KPGA 3LGXA 2BGGA 2QXTA 4X7BA 2A0YA 3OZBA 4RIFA 4FHFA 1SGWA 4TVSA 4JLKA 2YRFA 1OLUB 4C6HA 1RWWA 1J4AA 4ZJZA 2JIQA 1VLJA 2FX2A 2QX6A 5FWYB 1GY8A 2YJNA 4FB4A 5FUBA 4CUKA 4DUZB 2ZI5A 3A3OA 3PDCA 5G53C 4MQEA 4EW6A 4EY7A 5B4VA 1UDXA 4LMRA 3I1JA 3Q88A 4TSRA 3L43A 4LMAA 2HWXA 3KLMX 1QIDA 2IY7A 2DU8A 2R751 5E2BA 1Z6AA 2FJPA 2WJAA 4GGMX 3ZLVA 2B99A 2A58A 2WT8A 5GZ3A 1BWRA 2QE6A 3QU9A 5IJZA 3R5JA 4LCBA 3DE2X 1YR6A 4H0FA 4QPNA 4Y9RA 3FPKA 2BIFA 2HTFA 4I2VA 3SN6A 4DNQA 2DY0A 2V7XA 3AP1A 4NMHA 4IJ5A 1KOFA 3LPAA 1OCEA 3LVRE 1NONA 1PN3A 1FU4A 1Z25A 3A2LA 2P1RA 3K8QA 1HRKA 1BDJA 4P36A 2QL9A 4P98A 3ZCVA 4DRXB 2IH5A 4QRHA 3KZOA 5K3AA 1RNLA 1BAPA 2C1EA 2O1WA 3E7PA 4CQJA 3E7WA 2X4IA 3ICCA 1TAUA 3VYVA 3RE1A 4PLPA 3FRJA 4R5HA 1PQPA 2YOFA 2I4LA 4HRXA 1MBZA 3JYLA 1AGYA 3EJWA 1SK9A 4XIJA 1CPYA 2XUPA 5A62A 5AIAA 2O54A 2XYQA 1JQDA 4P8RA 1H4TA 4YRDA 4XIGS 1CZNA 4Y9TA 2DG2A 1FPMA 3ADKA 4QATA 5EESA 4OXQA 4CUJA 4ZYVA 1NAHA 2VHUA 5IXSA 1KEPA 2MR6A 1TL7C 5LZ2A 2PLNA 3ENKA 1YGPA 3UUFA 4IZOA 3EYAA 2JVIA 2JHAA 4MS3B 5BN4B 3E5RA 4CTOA 1XZIA 1A9TA 2CC2A 2HSJA 4HWRA 3HFSA 4K86A 3OQMA 1QC5A 3QF4B 4JCCA 3ZS9A 2R44A 4BNMA 1UT8A 3K9LA 5C7OO 9MHTA 2AN5A 1NBAA 3QY0A 4G8CA 3HADA 1XHLA 3S70A 2BHLA 2O5EA 2H3HA 1P31A 3BKWA 3OX3A 4ALJA 4JELA 1JA0A 4YX9A 4HNQA 3DMTA 5FBLB 2BJVA 3QRWA 4KO1S 3IPXA 4HV4A 4E6EA 1RWOA 4IGFA 4PYOA 5JATA 3RT1A 3EPPA 3IUNA 3FOZA 3H8SA 1P60A 1XLTC 3RDPA 3OQJA 2F43B 2HNBA 4L9RA 1QIJA 4AIRA 4Y6SA 5FDFA 5HA5A 3E3AA 5IH3A 2O0LA 4J0EA 4TTTS 2PS3A 2XMGA 3JS5A 3TIIA 1GU7A 1WKCA 3CZPA 1X94A 3I2IA 2Y1WA 5JW6A 4QICA 2R6AA 4Z1MD 3II6X 1DO0A 2R1TB 4HX5A 4CQLA 4QULA 4L5IA 4Z9BA 1WMEA 2ADFA 3EOAI 3RSCA 3H42B 4RV4A 5A04A 1AO0A 5EUBA 2J8ZA 5ES4B 1G21A 2CE7A 2GBIA 3ZCRA 1ODJA 3MS2A 4HDRB 4B0PA 2NZYA 2RB4A 4PHTA 4OYRA 2HA0A 4B82A 4UU7A 2DWPA 1YQGA 4XDHA 4I6EA 2ETVA 2OBNA 3VX3A 3TO5A 3UJNA 2IX9A 1XTQA 2EQAA 3LSTA 2OC4A 4EKDA 1V5GA 1SBYA 2JBWA 4NYIR 3WK5A 4ZVQA 2J0UA 2NO0A 4I4TA 4Y6QA 1VL2A 1UJ5A 1XLTA 2VUUA 4YEDA 4F7WA 1HE3A 4RVOA 4UQLA 4TN1A 3ZDFA 3BSSA 1U0EA 4W9MC 3DDUA 3U4DA 2P62A 3WQRA 3K20A 3E3LA 2JGNA 4R1UA 1EFVA 1N6IA 1NPYA 1TZKA 4G86A 3ITEA 4EPXA 4N3GA 2IYYA 1F0YA 4ZVRA 5BR1A 1CY0A 5HTKA 1QPBA 3KELA 4UU1A 2AFRA 1ESDA 4YACA 3ELUA 4MI3A 4B3DA 2X6TA 2YIMA 5ESDA 5FLYA 1QMPA 4LBYA 4FUQA 1PJ4A 3B8EA 5E2AA 3RIHA 5B1EA 5KYWB 1XNJA 1Z3CA 2WWYA 1XROA 3NAGA 3IB6A 4BV3A 5DM70 1GNQA 5FTWA 2WNSA 1M76A 3PKIA 1XEWY 4JI8B 1EEHA 2YBEA 1FRQA 2R68A 1UK6A 3ASVA 4YPFA 1Q11A 5KQMA 4PQRA 4KOAA 4J90A 3TJRA 2QROA 1AUPA 2VZ8A 3OTWA 3ZC3A 5HFAA 2WTUA 3FZQA 5CCBA 1M2EA 4O33A 3W5UA 2YOHA 4UUAA 1UWKA 4GXQA 4R51A 4ZAZA 3DJYA 3HUEA 3ONDA 5F2EA 2EWWA 3QUSA 1EVQA 3RLIA 4G4IA 1NF3A 4LVOA 5EFOA 1IBRA 1XL0A 2CZGA 5DI3A 5TX7A 1SZPA 1XCGB 1E63A 1A4XA 4YR7A 3RF7A 2DFDA 4DZRA 3C8ZA 3HO8A 5A7HA 3TLYA 4QSMA 1GG2A 2NUAA 4WUVA 2JLQA 5DXJA 3HNOA 1YDMA 3SXPA 5EY5B 4G0UA 3I5AA 2HEIA 5ALGA 2R00C 3WMGA 4EVQA 4JP2A 1SC6A 1J97A 1B6RA 1U0LA 3HP4A 3QUBA 3WV4A 5JSKA 3FPSA 1SOWA 2D13A 5FPYA 4D9NA 3IEMA 3HGMA 4AMBA 2IVFA 5FRDA 2BFEA 4AN4A 1ZNWA 3OH8A 2MOKA 5K0NA 1RIIA 2DFLA 4N0MA 4W9NC 2Q07A 2VDWB 1I01A 1SKMA 3U6BA 3LZCA 1OXXK 3B89A 2FYTA 4ZOBA 1K4YA 2C97A 4ASUD 2IDKA 3F9RA 3DOIA 1GCIA 3NOXA 1RWMA 1DBSA 3JQEA 4RK5A 1P4RA 2PFGA 4RKYA 5TDHA 1NBWB 4ZVSA 1R0LA 5CDUA 3R6LA 4RSMA 5FBZA 1H1TA 2KBEA 3WLIA 2V7PA 4P0QB 1RYDA 3PCRB 3DHVA 7GPBA 1AQYA 1MQ8B 3QVWA 4A73A 1ZJJA 1PL6A 1C7FA 1ZBDA 3R3XA 1KYVA 4S1VA 1QPGA 4A8JA 4Q1DA 2UYGA 2OECA 4K28A 3DJFA 5CVTA 1V25A 2VCYA 3BJMA 5T4FA 3L6CA 2GTHA 1KETA 1Z29A 1AB5A 1U9IC 3GFPA 1DWPA 5IYZF 3ZGXA 5AUNB 2OD7A 3AJRA 1C3OB 3EXEA 1XPOA 5GJCA 4E33A 1W0KD 2VS1A 2I2XB 4V0QA 2QQEA 2ZRCA 2QTFA 3NX4A 1YACA 3DHWC 5ALEA 3Q72A 1M8KA 2BELA 2EJTA 1EDBA 5DCLA 4EJSC 2W11A 3QTLA 1UFKA 3KYIB 4IOLA 2OYSA 2ZTMA 5AVSA 1PZMA 5BV1A 4RKRA 4BFVA 1C7IA 1GL3A 2VDMB 4R9UC 4ML3A 1EUYA 1M66A 4DV4B 5KVCA 3FHOA 1DMSA 3U7EB 1ISMA 3D8BA 3DULA 1XRSB 2FCRA 4BS9A 1E9DA 4CM5A 1K63A 4ASUA 3RG2A 1PLLA 3SJBA 4D3XA 4XGQA 2GEUA 5NLLA 2FZEA 1CR2A 3DOUA 4DMRA 2DFVA 2W71A 5KAMA 3GLGB 2CV1A 3LP8A 2ZJAA 2XF2A 3MJDA 5TQJA 3OQNA 1KOGA 4C29A 2VVTA 3VYSB 3CZ4A 5INTA 4LF8B 1WF3A 4IRUB 3TRHA 2J33A 3WQQA 3E9EA 5TQ2A 5K8LA 4MUBA 3TBFA 3QYPA 4I55A 4JQOA 1GPJA 2PU7A 1MAWA 3CJTA 4GNKA 1HE5A 1L7QA 4U1RA 4B7UA 3GCWA 3SNHA 1KQGA 1OFGA 3BCUA 4OM7A 3O91A 2DUWA 2BEKA 3CZCA 4MX8A 4ITVA 5EVCA 4TMZA 1BYIA 2J7PA 1VE9A 3OZFA 4FGUA 4LIPD 3T9AA 5AVRA 3EF0A 1IVNA 3I92A 3OCZA 4IVQA 4LYJA 4JUDX 4ZOLA 2PUJA 2X9GA 1CLUA 1OI4A 2IBTA 1P72A 2ORED 1WO8A 3D8UA 3F5FA 4OFXA 3RIMA 3KT8A 3TAUA 3A4YA 4JKYA 4R1TA 5LJLA 1Z5UA 1QQ7A 2PZBA 3BWCA 2ECPA 2O07A 3GAZA 1EG2A 1T0IA 4PYQA 5AH0A 1JEDA 2Q5FA 3EGVA 3I1YA 4IJKA 4O08A 4AJLA 4CFSA 1HM5A 3G5LA 4CLRA 5AR1A 1F51E 2NU7A 2NXJA 3IHLA 1U98A 4FR2A 2C59A 2XHZA 3SS8A 3HB4X 5JADA 2ZITA 1Q6ZA 4W5JA 1D2GA 5HM8A 4M99A 3MT7A 3WYBA 5CM2Z 2VHEA 3L8MA 1SUSA 1V39A 2XA2A 3AUSA 5CM8B 1MB3A 1K08A 2PSJA 2QY6A 1L5NA 2OORC 3AR2A 1CQJA 5E9AA 2DTDA 1LDEA 2ZSFA 3AI2A 5DHAA 3STTA 1R9GA 2GYVA 3QFSA 4I9NA 3ZD9A 5LMUB 4WH0A 3G1TA 3EXFA 1CDDA 1ZM3A 3CZQA 3KLOA 4G1MB 4GGOA 5KSPA 5BVHA 5GJWC 3U3ZA 3GX1A 4FGSA 4F0JA 2NIPA 2OVFA 5K6RA 4I3FA 1XZHA 2OGWA 3AESB 1GLVA 1CG6A 4YB8A 2RONA 1EVZA 4DCUA 3MNFA 4NAVA 4FCTA 4K6KA 3C6MA 4OGGA 1VI6A 3CEJA 1SBNE 4W63A 4MWCA 2GBLA 5FOSA 1Q0PA 4BGUA 2PR2A 1P18A 3FAZA 3WIDA 4CIWA 4W5OA 3O7MA 5K2MA 5D00A 5KYUB 2OAP1 4B76A 4R84A 3OI7A 3EMKA 4US0R 2FW0A 3TW8A 3WGIA 1WU7A 4HGOA 2OOKA 1IOWA 1NNI1 1G20E 4ESOA 4D43A 1V9CA 2OCLA 2W9XA 4L6IA 3W5DA 4ZYTA 1CJUC 3ZLTA 2IODA 3H1TA 3MLBA 3RV3A 3V4PB 1EM8A 1O4VA 3E9QA 4MYUA 1U7HA 1ORHA 4XD7A 2K2WA 3M3PA 3CB4A 3D6JA 3LLMA 3OHPA 1PI3A 5M7EA 2AE2A 2QGZA 3R5KA 4PM4A 4R1MA 2YVAA 2BP7B 2V6IA 3UXEA 4CKXA 3RC2A 5BSKA 1N33B 1Y37A 1H23A 1YD7A 5IANA 1Z4PX 2QTWB 1MO4A 3C39A 1ZWLA 3KX2A 4YAKA 1F2UA 1R4NA 3PHCA 4YQZA 3H4TA 3IBSA 4Z9YA 3K0CC 1EGAA 3Q11A 4HYQA 5GONF 3SWWA 1FDWA 3AI1A 2W6OA 3T5AA 1HFEL 2CL5A 4CLOA 2CF5A 2FPPA 2WU0A 3CNBA 1W2WB 1NVUQ 3X1WA 1C2TA 3K9GA 1ZONA 1MUUA 2XZDA 4HPWA 1TPYA 4IP0A 4OXYA 1JSXA 1YB1A 4X3PA 3AT1A 4IDDA 5BMVF 2E55A 4XX1A 2O8EB 3D8HA 4ZOEA 1Y8ZA 4BO7A 2DYKA 5NULA 1UC5B 3MILA 4Q34A 4ECEA 2HX1A 3FI0A 3ECAA 3PG5A 1AV7A 4MYHA 4Q4JA 5FPPA 3S2UA 3I0NA 1XZEA 4GC5A 3QKUA 1ULZA 2IXAA 3GMDA 1DZIA 4ME6A 1Y4UA 2EAUA 2GARA 3QWFA 2WMOB 1C8LA 1PHPA 3GVPA 3HJRA 3M6VA 4JP8A 5FTMA 5JH7F 4KR0A 3EF3A 4Q4DA 4MVJG 3DMYA 1EGQA 2XNKA 4NOKA 3T1OA 4BV2A 2OVBA 2VA9A 2V45A 3EIUA 1OV6A 1QFMA 1Z2DA 3T34A 1WD5A 2FP3A 1TTPB 1PR6A 4OV6B 3VYRB 1NMSA 4PQEA 3T06B 4RKQA 4AXBA 5E3IA 2DJIA 4MP8A 3FVTA 4YHHB 3KQHA 1GPDG 2QTBA 4MROA 3VDNB 2XNJA 5MDHA 1U1EA 5KTYA 4O1HA 1IMJA 1C1XA 3ILSA 3ZE0B 3BFVA 3RCBA 3W5SA 5KNLA 4JT9A 3KOYA 1AK1A 3OQ1A 1SUEA 4F4HA 4FEYA 2H06A 1GU1A 1WB6A 1M7BA 5ADVA 4PXSA 4NBKA 2NG1A 4AKGA 2WP0A 4EB0A 4QT4A 4XVUA 1TKCA 4E2ZA 1NBOA 3NEAA 4WN9A 1OZAA 4MPTA 4HZUB 2BFBB 4ZI5A 4EHBA 3AG5A 3G8BA 3X1MA 1PL7A 1RU3A 1MX5A 2QKYA 4YXWD 1V5IA 3PEUA 3OIYA 4YRSA 4UJ3A 4G0XA 2JGJA 4BGEA 1E69A 2ZRFA 3QEKA 5ITZB 1NVAA 1N5DA 3NBMA 4BN5A 2Q2QA 2I1QA 1Z0AA 3BH6A 4QXQA 4IGKA 3E9RA 4UMDA 5ES3A 4CQNA 1GEGA 3QE9Y 3C5EA 4H3HB 1EVKA 5T41A 3ROGA 1WNTA 3MIIA 3ND8A 4IHAA 2GPBA 3D2AA 3PWZA 2I8LA 4E5MA 3P4UA 2VCEA 5HUJA 1J23A 2P40A 4XSGA 2V7GA 1NDHA 2J1LA 4ALIA 4K05A 3QMVA 4EB3A 4EELA 1TT5A 4DCNA 3PZBA 4MVJA 5EQFA 3R40A 4D4KA 4QU9A 2H7YA 3RBXA 5BYJA 1C0PA 4W4TA 1GTJ1 4EY6A 4RBNA 4PZEA 5E9QA 4GKJB 1EGHA 4E1AA 5BN5A 5KIAA 2BFCA 3LUBA 3O4FA 4OI0A 2X40A 4P08A 2L19A 4PAMA 1I13A 2GZHA 1X42A 3PQ6A 2Q3HA 1J99A 1J25A 1FYDA 3RVOA 3NNNA 3O4VA 1M34B 2A9QA 2GR9A 1KKLA 5DX8A 1K6EA 3PUKA 3Q98A 1CY6A 1X1QA 1M6NA 4NJMB 3U40A 3FFTA 3NYIA 1LBEA 5T8KA 1N0HA 3U4CA 3RUIA 1BD3A 1YH3A 5KNCD 4LYAA 3U13A 2OQRA 4N5NA 5TPZD 1E66A 3GT7A 3NBYC 4O4LB 1AQ6A 1KI6A 2CXNA 1LPNA 2J67A 2XDWA 3DOEA 1ZEMA 3EVGA 3OOSA 4N49A 5TPZA 1FNSA 3UTCA 1FJHA 1G2IA 4ESHA 4B1FA 4GYKA 1AGNA 3GLQA 1ZAYA 2VT7A 4S12A 5JVDA 3CVVA 1QH1A 3CG4A 3GEEA 2IELA 2AOTA 2QM0A 3EQ8A 4S2EA 3IGFA 1ZHFA 2FZLA 1G8YA 4FBGA 1PTJC 3WGNA 3JASA 3FJOA 1E7MA 3OFSA 1TJ3A 1QDUA 4AVYA 3CIFA 2WG0A 4M0UA 2IHBA 4WRRA 3UMVA 4CXMA 5JFOA 1DIRA 3AV3A 2ABWA 1KP9A 1FMLA 1GZ7A 3ER8A 1S9DA 1SD5A 2OK8A 5AM4A 2ZREA 3SU8A 1XX6A 3ZIDA 4WVFA 3NU1A 4KQ6A 1NURA 3PP8A 4QBGB 2DF8A 1VJ5A 3OA0A 4ZO9A 1CR6A 1X9GA 1GG5A 2GCIA 2YWCA 3CH7A 1DAPA 1KO4A 4YDQA 4IMIB 2I0FA 4L9AA 3OD5A 3VSBA 1G17A 1KAHA 1XEFA 1SCJA 2A67A 3PV0A 3VR5H 5KWEA 3HU1A 1JDUA 2NVBA 3OFVA 4V3BA 4CR7A 5F1PA 1BSVA 4RF5A 3UA4A 1W49A 3UHJA 2HK7A 3CYFA 2WF9A 5BMVA 1UKEA 2HI0A 4AN1A 1Z45A 1G2PA 3GGPA 2W98A 2ZTSA 1HZZC 3ELDA 4QIHA 1QZTA 1A9XB 1BEZA 4XD2A 4OHXA 1X7ZB 1LCIA 2HN9A 1LJ8A 1M0SA 1XT6A 2B83A 4BIIA 2JGAA 1KI4A 3PYMA 4EJ0A 2GLUA 1H4SA 2F59A 3ZGLA 4TS9A 1T0UA 4DLPA 3D4BA 3ZDDA 2ACVA 1FUYB 4R98A 1RCUA 2VYVD 4N0PA 5G4KB 4Z4IA 3ZV6A 3AWDA 3UGQA 4B7AA 1QRDA 2Z98A 1D7AA 1GA4A 3FZYA 3UMBA 1ESEA 1P4GA 4EKYA 1VIDA 2VJKA 4GZMA 4QUEA 1D8TA 3MERA 1XTZA 1C4XA 1QM5A 1ZUHA 2R2AA 3GZNA 4HWKA 1JLHA 4QDZA 5H3LA 2WSMA 1GDTA 3QH4A 3WFIA 3TSCA 3GFSA 2J46A 3G23A 1ZK4A 2HSGA 2YJGA 3PNBA 4PQFA 4FYKA 1FB5A 4BFXA 2J5RA 4NARA 4IFBA 4P3YA 1E1CA 4XFDA 2ZJ0A 4B2IA 1DQSA 1FSZA 2YNMC 1HO3A 3TK1A 1FF9A 3L18A 1LPAB 1SY7A 1KVSA 3W6ZA 4Q3BA 3AB8A 1YMVA 2O3RA 1DU4A 4MVJD 4UFOA 3ZW8A 2EW8A 5D6NA 4IFTA 4G23A 4NONA 1S0UA 3F4LA 4OB7A 3VAYA 4NBUA 1TEHA 2X14A 1XDSA 4LTNA 1JAIA 2DVMA 3RS8A 1U0FA 1IQRA 2BFCB 2YIJA 5AVJA 3PEWA 2H1WA 1OWOA 4DR3B 5EJ8A 4ISBA 1JQBA 3Q2OA 5FT9A 1NRXA 4LX8A 3RLFA 1CW2B 3IT3A 5DASA 2Y27A 5SZKB 1ETUA 2B7BA 2WKWA 4LFBB 2ZBVA 4MR9B 3WLEA 3FROA 4YCCA 1OXMA 2A86A 1KO1A 1GWNA 1UBTS 2EFYA 2PZAA 3E3OA 2R8PA 1PQWA 1CQIB 1GRCA 2P9YA 2ZYDA 4XVQA 4AWBA 5BWBA 4Y1RA 3VTFA 2NNLD 5EE0A 3DWFA 1N32B 3SXUA 1MZVA 4R8SA 1KJYA 4HYTA 4P53A 2OXCA 5BUCA 3VJKA 4O4LA 3NB0A 2VI5A 3P9KA 4R2XA 1OIWA 1TO6A 1KMIY 5DB4A 3SR0A 5L6LB 1V2GA 4AZWA 3D7LA 1ABEA 1VG9B 2AFHA 4G1UC 2CW5A 2I2DA 3TNYA 1JU4A 5DSTA 2BBTA 5F2NA 4E4YA 1IEVA 3UAGA 1E9AA 1UFVA 5KNDA 1K3TA 1BCRB 1PFVA 2ZT7A 1O1YA 3HXKA 4BP9A 5DGIA 2YVUA 1KZ6A 2BZ0A 3C6BA 4MGHA 3WQHA 4KH1A 4ZZ3A 1WXHA 2GYYA 4MZDA 1B00A 5E7IA 4EP1A 1E3EA 1YL7A 3VQTA 5TT0A 2FVXA 4OXIA 4DDHA 3FYUA 4RQUA 2AUTA 1LS1A 1TZ2A 1CS0B 3MWYW 4R2KA 1IY0A 1ICIA 2VF8A 1Z8HA 2WU3A 4MQMA 4RZQA 4CVNA 1Y6RA 4NU0A 1J2RA 3GHYA 3ZE9A 1Z0SA 4EGJA 4ZODA 3UFBA 2Q4TA 4XEHA 1NM5A 4NENA 1YC5A 3F8TA 2JLWA 2FN9A 2UZ0A 3KTOA 4FOSA 5EXXA 2M2IA 3C3AA 3S1AA 4BQRA 4N7MA 1VHQA 4BB0A 5JCXA 4OBXA 2ORIA 2CMGA 1W2HA 1AKMA 1ETHA 2OFPA 3KKZA 2JRCA 1C7EA 4JC0A 4QBIA 4JXXA 4DA6A 8AT1A 4Y2TA 2VDPB 1Z2OX 3IJEB 3NHPA 3PFGA 3FPBA 4BATA 3G79A 2HBQA 1W4LA 2IBMA 2FEPA 3QBEA 4FIZA 5DX1A 4F1KA 1BZYA 1G5IA 1TM5E 4YIKA 4IS2A 2JEZA 1RWPA 2TMDA 1NG1A 3PYXA 4X61A 5JDCC 1E4EA 3HWSA 2BGTA 3SG0A 9GPBA 3L1IA 3B52X 1G291 2POQX 2KX7A 3F5SA 4RMIA 4DNXA 3COJA 4OQMA 2F9LA 4MRSA 4I2NA 4LJ8A 2JVJA 2PVCA 3C5VA 3SJ7A 2QUAA 1YUMA 5E4JA 3M3DA 3RTAA 3URMA 3GRFA 5DGTA 9LDBA 3JTEA 2ZIZA 1KR5A 1Z35A 3ICVA 2IIVA 3UCFA 1PR9A 1ZXXA 3L41A 1M6WA 4KAXA 5DRYA 3FD8A 5DNCA 4LHSA 3TMKA 1U7PA 1UMBA 3D7NA 2R6HA 4CL3A 2ZT6A 3M9LA 5KTSA 2G80A 2ECQA 4Y30A 3GY0A 1LF0A 1JQLB 3E05A 4QQFA 1Y98A 2XRMA 3JQGB 4C7JA 2IH4A 2CLKB 1O6GA 1RE1A 4G5FA 1PR1A 3B85A 3KEOA 1G19A 2NX2A 1JQJC 3TE7A 4BPBA 5LMZA 3B70A 4MQUA 4LY6A 3OAAA 3LX5A 3DO5A 4PW0A 1O08A 4EG6A 5I7RA 2OB2A 2CL6X 3KYBA 3MPUA 2KW5A 4GW3A 1H8HA 4KP7A 2P6PA 2NTYC 4KOEC 4BNGA 3M1AA 3STHA 5HPYB 2ASEA 5C7IO 2PNFA 2WM8A 4R54A 1I4WA 3OQIA 4OMUA 1P3JA 2JLZA 4LZJA 2VFAA 3CNQS 2J07A 2FN7A 3H2KA 1A69A 4WESB 1RPJA 2P67A 2CXRA 3R0QA 4L0CA 2RHMA 4D8YA 4P3OA 5I8ZA 1XDGA 4GMFA 4PSDA 4QSHA 5CLHA 4B6RA 4ZGBA 1L7EA 2X8WA 1NN1A 1AKQA 1W36B 3MZ0A 5DTRA 1KQ3A 3ZCSA 4QFDA 5FL7A 5H81A 4DJFC 2D5CA 2CXPA 3HDHA 1TKBA 1VYUA 5KOIA 2OLEA 1Q1EA 4J0HA 3V4LA 1YFJA 1WCIB 2Z1MA 1VSQA 1DXHA 2DECA 4YJDA 3QQ5A 1AKVA 1CFJA 4MO9A 3ZDEA 1NBMD 2FFBA 3DAHA 1XP5A 4AJ4A 3SZMA 1DBQA 4MV9A 3N6VA 2I4MA 1GKKA 1E64A 4JUFA 4DBLC 5HX7A 4CM4A 1KKUA 3QKRB 4PNHA 5C31A 2YYYA 1XWWA 2QL5A 2J08A 5HCIA 4X7RA 5C5DA 1WCYA 4QARA 5CVUA 3EULA 3D0RA 1U28C 3DZCA 1ITZA 2LDBA 3MBKA 4Y0AA 5HK8A 1PX0A 4RM2A 2RAUA 4BKPA 4EBFA 1FMFA 1BOOA 1G5RA 2TS1A 5DE3A 1Y3DE 2G40A 4F11A 3HV0A 4PLYA 4KJZA 5E8JA 4IDEA 1XRLA 4MV0A 3UMSA 1YU9A 2HREA 1ZRSA 2D7CA 5I8WA 4HOYA 1JHVA 5A2GA 5HCNA 2YXLA 1IRXA 4CM8A 3NHYA 4NRDA 2J41A 2WMYA 4U7FA 4H6VA 1U7OA 3OQ6A 4GRDA 1DO8A 3RC3A 2Q9BA 4DIBA 3UFXA 3ASYA 3IEUA 4P3KA 4YAEA 3ZH2A 4LV6A 3FVWA 4KIFA 2HV8A 4YQYA 4LOKA 1O96B 5EIAA 2ZUBA 5TQ2B 2NU9A 2WVJA 2ZJ8A 3EDQA 4I5IA 1ML3A 5I01A 1F9EA 1OI2A 4F5ZA 1SXJC 3RUEA 4B4VA 5MFZA 2C9DA 1A1SA 2V7VA 3IUYA 1Z8FA 3BRCA 4OK6A 3OLXA 3DVRX 1CUUA 2FFQA 2EJVA 1E0DA 3KCQA 3EGCA 3RO7A 3A7EA 5E6UA 5C4IA 3DCNA 2VRCA 4Q19A 4QQRA 4ZT4A 1SC9A 1XCMA 1BJRE 2FOLA 4NNPA 1ESNA 1SZDA 4TTJA 4B0OA 1MORA 1Y0BA 4J16C 4B7ZA 5KO2A 1S2OA 4Z3DA 1XKXA 2QP4A 1BG6A 4OQQA 5KNBD 5CTAA 2FB9A 1GTMA 1KI7A 3A8TA 5KYKA 2V96A 4G26A 2B1IA 2ZE7A 4UZEA 3AY6A 4RFSA 3KBBA 5B1SA 3BJZA 5CAEA 4FWIB 1QVZA 4IJ6A 2YV2A 5EPEA 4QO8A 1GQYA 2BKVA 1K98A 1XHEA 3PEFA 1XZNA 3R6TA 2W00A 3ZE6A 2FRVA 2ACEA 1UPAA 4HJRA 5FP0A 5JEDA 2WJJA 1EJ2A 1XVVA 2C8VA 3QF4A 3QX8A 3UWMA 1JECA 4HLDA 4S35A 4QRDA 4CT0A 2RGNC 2EDCA 3QEAZ 1NJGA 5BVHB 4PC1A 1FQOA 3CLKA 3GJRA 2IIBA 4WLFA 5JNLA 1DRJA 3U39A 3CF4A 1NU6A 4TSKA 1W0CA 4L5AA 1KSJA 4HGQA 3W04A 3N5KA 4OJKA 1QQ6A 3OCXA 4B3HA 1FVXA 1I10A 4KN6A 3TDNA 1MB4A 4H17A 4IEFB 5KNCA 2MCFA 4JR0A 1KEEA 5DLEA 2VP0A 2AZXA 2SECE 3ORHA 3WDKA 4DXDA 3F3MA 2WB4A 4NDZA 3VHQA 3NKVA 4UZFA 2COEA 1H66A 2GCOA 3GRPA 1YDGA 2XXBA 3CF4G 2FMTA 1JLSA 3PGLA 1YZYA 1DHTA 1BN7A 2FOIA 1ONNA 2I5PO 3KHSA 4R9NA 5DPMA 5B3KA 3BDVA 1EBUA 4YMIA 2IPMA 3TLKA 2QLFA 3JAKA 2RB5A 3TKYA 2R96A 4MWTA 1KY3A 3RUPA 3SF8B 5A4DA 2XZLA 2O5RA 3O6VA 1XFAA 5FFFA 4CN8A 4FDLA 4KAFA 3VO8A 1NM5C 1JXAA 2P9CA 1D1SA 1M72A 2O1XA 4XRGA 4PAWA 4DE5A 1WQ3A 2AQHA 2ZRPA 1B2LA 3L1JA 4ZGWA 5MGBA 2PAAA 3WXMA 1UP7A 3K96A 3LWDA 1YB2A 1YNSA 1YRYE 1VMEA 3ZYZA 4ZVOA 4BJ1A 3O1JC 3AL3A 5C8YA 4E51A 2XNCA 5HF5A 1MV8A 1QHSA 2DY1A 1G3UA 1NNSA 4DSAA 1E9CA 4X41A 1QUFA 3GEPA 3LLSA 3VU0A 3R6DA 4M53A 1DAIA 3UW3A 3EVNA 5BQPA 3SFVA 1RJGA 4JI7B 2L69A 5ILOA 2HIGA 1VE3A 2ZT5A 3OESA 1N2GA 2XY4A 1IOVA 1N6RA 2JRLA 1RI5A 2DQSA 2LD4A 3HLTA 4GOKA 4HAWA 5T6MA 2C2GA 2HKIA 3RS5A 3JQCA 1TTHA 3CRVA 3IE2A 4YT2A 1B4DA 3JZDA 4R3UC 3WHKA 2FH5B 1UODA 2YW2A 4ZQHA 4EFLA 1FTGA 3BE6A 3A9VA 2X41A 3UGJA 3L40A 2ZZKA 3FPLA 3KOXA 2OL4A 4HNHA 1YR2A 5CG2A 5KWVA 1NN5A 3QZUA 2ZJ1A 1SO8A 1PVVA 2XUZA 1TD1A 1U6IA 3FTDA 3B3GA 2YXNA 4EVRA 5THXA 4R2HA 4ZJYA 3WL6A 4BFYA 4B79A 5GINE 1C4KA 4MUKA 1DGQA 3O3OB 3B82A 1MOQA 3IDFA 5A71A 3UXMA 4A0RA 4ZIRA 3O8BA 1E2JA 5LDGA 2IWHA 5LQRA 2JNWA 4D0LB 5FOQA 2JH9A 1T5DX 2XCQA 4G5XA 4LKRA 1QFSA 2JW5A 4DLUA 4AL4A 1QMGA 2N47A 2Q41A 3IRVA 3CX7A 3BD7A 4UUMA 2NW6A 5IC5A 2HDOA 3UMJA 3IQIX 5FWNA 4AJ1A 2WJ3A 5SV2A 3RK0A 1ORVA 4LZZA 4BRSA 1R3DA 1DUIA 4LN1A 3S5JA 4RTMA 1KEUA 3O2JA 2Y93A 3SP1A 1ZNQO 4L3OA 3MD9A 1GAJA 1OVGA 2EV9A 4QE3A 2AN4A 3OTGA 3M5WA 5SZHB 4M6WB 3WL3A 2OWDA 3DXYA 2GASA 1EVJA 2Z6UA 4ENSA 2ZGVA 1DFGA 3HRHA 1CYDA 4TL6A 4G1BA 5EUQB 4EA6A 3R3SA 1OAOA 2BDTA 2YZ7A 3MHTA 3FLEA 4FYMA 5C5IA 2VDLB 3R5SA 4PLWA 1Q2UA 2HGSA 4CEHB 4PO3X 3O8QA 5BWLA 2C94A 1KU0A 4JU8A 3V4FA 1Q0SA 3WI7A 4J7AA 2FXVA 2Q0XA 1NXOA 3OPYA 3NFYA 4B73A 3G5MA 1CDEA 4JUCA 3F73A 1O94C 5HILA 3VTAA 2OBFA 1MPTA 2E4AA 1GUDA 1NOIA 1T6XA 5JD3A 3S4YA 4DV6B 1MRNA 2GA8A 1GHTA 1H9AA 1ZY2A 4D74A 2FWBA 4NQRA 4FYVA 1C30A 2I7DA 2LGJA 5U9CA 3EPHA 5ABPA 1LD3A 4ZV9A 2Y77A 1NOJA 1GXSB 2MMGA 3CSDA 3AF5A 4JC8A 4Z2YA 4Q4HA 4AUNA 3VR4H 2HWKA 3KJNA 3FMVA 1TQDA 3IAXA 4J0CA 4N7BA 4QUDA 2HO5A 5A3JA 1WXDA 4C6TB 3D02A 3ASZA 1CF4A 1G64A 1N0IA 3E1GA 4DCOA 1D5WA 1F6DA 3AKCA 1SIWA 2JBAA 1J1IA 3GN1A 5F21A 5GGXA 1FUKA 3EEYA 5A4FS 4P34A 1K0FA 4PLVA 1BMTA 5AI9A 1CNEA 4N3NA 2IC5A 2Q5EA 1EMDA 4KVGA 5KNBA 3VKVA 3NANA 4BFZA 4ZXPA 1Z0IA 3IMEA 4V0SA 5EN4A 5AW9A 3T5MA 3OZCA 5E0OA 3PT9A 1RZUA 4CTNA 1DT5A 1MX3A 3I23A 4RGYA 4INZA 1K8XB 4Y0NA 4PYKA 1Z0DA 3OU6A 5I7OA 1AS2A 2J32A 4FWBA 5AYVA 1VA4A 1ZNYA 3A1VA 3DTYA 4Y1RB 4FK8A 4XPIA 3T0IA 4HEHA 5KEIA 4MHOA 5K01A 4OLAA 2CJYA 1H0RA 2YJ6A 4MA5A 2JGIA 5DI9A 5IHXA 5E1MA 5AOAA 4ZTUB 2WHPA 4D41A 5FPHA 3GLUA 4OY3A 4RLSA 3WY9A 4KXQA 4ZKEA 3BRQA 2Q1UA 3AR9A 1TIPA 1KPIA 3C8UA 1GO2A 4Z4QA 1DUSA 3B8HA 1PSZA 1ZH0A 4BQOA 3IIKA 3ZJ4A 1YV9A 3TTYA 2QR2A 2R7LA 3OLZA 1XNGA 4WNIA 1V8DA 2A33A 3LF2A 1ZLYA 5I9LA 3JQQA 3BEOA 1ZL0A 3Q41A 2XUKA 3QHQA 3M7IA 3G9XA 3E2PA 1QHEA 3PUVA 3JWPA 1Q22A 3G2NA 5FYDA 2RK3A 1LDNA 1PQYA 1T8UA 3FDZA 4RH0A 3ZX5A 2F3SA 2QYTA 1WMBA 1KI3A 1T10A 2FRDC 3DDHA 3DFKA 3FSGA 5MN5A 3ZE1B 5TVGA 3TQTA 4MDYA 4CN9A 2PDAA 3AIIA 1NI4A 1N8TA 1XA3A 2WD7A 4F96A 5CB4A 1Q0QA 2BMEA 3KSUA 3B1WA 4UHJA 5B7GA 2D1TA 3VX4A 1NP7A 1OFUX 4EUSA 1XAGA 4TKVA 3T3NA 4QJ4A 3ESRA 4OUKX 4V0NA 2XKAA 3FFAA 3ZQKA 4RYDA 2KE5A 1W87A 4K8OA 4UVHA 3AUJB 4H6PA 3GFBA 1CDOA 2QYOA 1V45E 3UWPA 4N41A 1I80A 3A7DA 3H17A 3IQGX 2YXBA 2ZLBA 2ZJ5A 1BHO1 3PKZA 5TMDA 4YPVA 4YQFA 2UVPB 1NUHA 3RIEA 4A27A 4EUHA 1UC9A 1VSUA 2BRUA 4FSDA 3KBOA 4MQ6A 1DT3A 2OGZA 5DF1A 3PHJA 3RG8A 2BEUA 4A36A 3DOCA 4F9GA 1X92A 2QTZA 3N6RA 3V4RA 4OKSA 3J7TA 2JK0A 3NTLA 3MTQA 2CF6A 4NZPA 4D81A 4HNRA 1Y7LA 1UJMA 1VPTA 2ZSAA 3QXHA 1UBOS 4N8EA 2WHXA 3MJFA 3PA6A 1UPXA 4GU5A 4B43A 4CM3A 4KMRA 2AI3A 1DINA 3NLLA 2BFMA 3EVCA 4ARCA 2H5LA 3ISJA 3IBYA 4PPNA 2VWQA 2HU7A 3M9WA 1DI0A 2IZOA 2PWPA 2QM3A 3KKOA 3MCTA 5EJ6A 5EC8A 3VR0A 3MMZA 1L5HB 3HVKA 4BWYA 4N3BA 5AW8A 1RAFA 2WIJA 1ZDMA 3GEHA 3GRKA 3CVXA 5G2OA 4ARIA 1KGSA 2QPAA 3D6AA 2XCIA 1N6NA 3A6LA 4YBZA 3R7BA 4BO2A 4JCOA 4Z7NB 4M1OA 1QHNA 3AR3A 3NYWA 4YAFA 4DR5B 4UE3S 4DPMA 2CBXA 3EBOA 2YDXA 2GHIA 4RPIA 1IUOA 5TJ9A 4OXRA 5FL7D 2ZI6A 4FMBB 2XX3A 3GZTB 4OI1A 4EYKA 2NVUB 3SEAA 4FR5A 2V54A 4GICA 4GLLA 4LHVA 1DV1A 1KJ8A 2ZYRA 2C7BA 2GS9A 1K06A 3DNMA 3DNPA 1BGWA 3REFA 4TZTA 4AB1A 2AMJA 1CC1S 2I1VB 3HCCA 3UHAA 4OHYA 3RFFA 4KR7A 3KSZO 2OYCA 2IDJA 3BGVA 3X1ZA 3LP6A 1RXVA 1MIHA 3WYGA 2F9FA 3N8IA 3OM8A 4J1QA 3S2ZA 1RLOA 4IOMA 4ED9A 1YQWA 1O6BA 2PGAA 1NUQA 1E2HA 3TCKA 1YI0A 3IVXA 1E7SA 1M8PA 4K6CA 2OBBA 2H6EA 2H2HA 2FR8A 3DC7A 1VG1A 4M9QA 2WUEA 3N8GA 5LD2B 2FFJA 4ZT3A 1WUHS 1THTA 4QUKA 3GFRA 2E7ZA 3GLTA 5EPOA 3DYIA 4BO1A 2FY8A 3OAAD 2AQ8A 2BW0A 3W5BA 2BTEA 2P35A 1WL8A 1V5WA 4ZZ0A 1F4PA 3AFMA 3O92A 1A8UA 4YJ2F 3TL2A 3CR7A 1WD7A 4R9RA 5K8UA 4QKQA 3TQSA 5E2IA 3O8LA 5D5HA 4JL6A 3VC3A 3AJ9A 4OHPA 1NXSA 4RJLA 2JASA 2FUKA 3D3WA 4NCBA 2KS6A 4B47A 2EX4A 3AFIA 4LKOA 2PRYA 3P0FA 3R1IA 3JZMA 3THSA 4LJSA 1GAXA 3KC2A 4Y7DA 3W9YA 1C7QA 3NW9A 2XW6A 4MLDA 3JD1A 3HZRA 3CN9A 4MLZA 1RQPA 4W1SA 3DBHA 4J94A 2J59A 3GDWA 5G3ZA 2C5GA 3LO8A 2IWRA 4D5EA 3QE3A 2FPSA 4BY9E 1QGUA 4QU8A 3UUWA 4P93A 4P4SB 5T3UA 4TZ6A 1LJLA 1AKWA 1IN4A 4BFWA 3AF6A 2XT6A 4EL5A 5KYYB 2PJRA 3FFBA 3V7WA 3HI4A 2PYZA 4GMXA 4IYJA 2NT3A 1OA1A 4Q3CA 2NZ2A 3C6ZA 2O2ZA 1QJCA 1S1MA 4WECA 1C9MA 1UPUA 4IEIA 3I32A 3IC5A 1PG0A 2J48A 3AUUA 5EKXA 5EWMA 2AG8A 3V1MA 1ZJ5A 2QLJA 4XSHA 3AR4A 2TECE 3T5BA 3AL0C 1PK7A 1ZICA 4UFNA 1PIWA 1PFUA 3HA3A 2F3UA 5LVAA 4LMBA 3WJ2A 2X4GA 3RAPR 4CZ2A 1KE1A 2GA9A 1U2GA 1A4UA 3BFJA 3CA8A 4UMEA 1LGYA 2W2KB 4L4SA 5CEFA 2I7VA 2PHZA 3BIOA 3OF3A 1QG6A 1K8ZB 4U3JA 2AVDA 3L05A 3N28A 1X1AA 1ENPA 1MJGA 3ZV3A 2EG9A 1YUNA 2GOYA 1ZMRA 3PHGA 2ODPA 4KFUA 1LSUA 2Z4SA 4M9UA 4BYGA 1T4BA 2OBXA 5DT9A 2H7VA 1VL1A 5BP7A 2P41A 3UT5B 1GD1O 2C3PA 1AMOA 1OAKA 2QNIA 3FHLA 3KJFA 3I04M 1Q0RA 4HUTA 4XI9A 1IH8A 1YF3A 5ESWA 3CKMA 3JPWA 1OE0A 2FG7C 5ECDA 3PGA1 2RE8A 4L8YA 3MQFA 3OETA 3P9IA 3N07A 3G5UA 4LVNA 4OBEA 2CMKA 4C0WA 1Q1GA 3FGNA 1Z5NA 1X39A 4YREA 2WLSA 4DY4A 5ADUS 1AC5A 3NALA 4AZ3B 2GF0A 1GKYA 1NHWA 1S2IA 3HRIA 3MTGA 4KEAA 5FAXA 4HDSB 3W8EA 5FBRB 4XYMA 1SZCA 2HF9A 3TNLA 4C06A 2IIQA 3K94A 4GHWA 1DQRA 5FUWA 3G0OA 1V96A 2C7GA 3VUFA 1NVXQ 1RYFA 3HY4A 5L4SA 2VZLA 1Q92A 4TWIA 1YWGO 4CL0A 1SUDA 2RH8A 3F0TA 5DIFA 4HLUA 4AX4A 1P4HA 4CL2A 4J6EA 2OLKA 3BCHA 3RTEA 4US1R 2ZUCA 2JD1A 3CCCA 3WLJA 1M6YA 2WSSD 3OIWA 5IWCA 2X7HA 4DQXA 1RI4A 1OY1A 3JQ6A 4NYIQ 3SYRA 4DIDA 1J2YA 2G5GX 3EVAA 5CDGA 3TGLA 1COWD 1F20A 1FYFA 3DBVO 1HFKA 2P0AA 3DFUA 2ZYIA 1W4RA 3PXUA 2O7RA 3PVZA 5BSGA 2YS6A 5JD5A 3WYAA 5HWSA 2NSJA 3NVDA 3OWHA 1Y48E 2LXNA 2OZKA 3KEGA 2NO6A 4OHMA 4E07A 4WJKB 3A1EA 4BFSA 4DR2B 1RWQA 4UEQA 1E32A 2BUCA 3AV0B 4GI1A 1RAGA 2BZSA 5I9MA 4I0WB 5DDIP 4G41A 1RTKA 1WPRA 3VR1A 1YDHA 3PX7A 2WF7A 2FQ1A 2QVCA 2W48A 4N01A 5K6TA 2PUGA 2R4UA 2I9PA 4RMGA 3OQVA 4P81A 4QG3A 1VSVA 1YRAA 2K5UA 4LJ7A 4Q7QA 1ZD9A 1P7CA 5AKKA 3LXXA 3GFFA 4ZVTA 5J23A 2ZBGA 3PHIA 5GOTA 3FLMA 4PSVA 3VO9A 2AEJA 2SKEA 1E9RA 1S6YA 4Q48A 4RKWA 3CX8A 1EX9A 1HYBA 4RJTA 4IUDS 1KDRA 1VGRA 1A7UA 2DC1A 1UBRS 2IEIA 2OR3A 2QB5A 3QWHA 2Z4TA 3OLWA 4WOPA 5AM1A 1K2WA 5ALIA 1V26A 3KR2A 1LU9A 2GHQA 4BASA 3L79A 5F4BA 3R3UA 1OX4A 1AO3A 4G5GA 1QCYA 3O31A 2R8RA 1O6FA 2CLMB 3CUSA 1ESCA 3I3SR 1ULHA 2ZIGA 3IFSA 3KOMA 3R0JA 1DQZA 2G25A 4KWEA 3MMNA 4PNZA 4JLAA 4ZDWA 1U5BB 3R09A 1H2FA 1J0EA 3OCVA 4PYNA 2B6NA 1L3BA 3KVYA 3VO2A 2JIMA 4LYGA 5ELMA 4A5SA 4EX6A 4IQ4A 1R1DA 2GVZC 5J4HA 1JHUA 3ORYA 2NXNA 2SKCA 3D4IA 3FM9A 1Y5RA 4WXHA 5FI5A 5KNCH 4LBVA 3RJTA 3U4GA 3LECA 3NV7A 4ZCPA 4UE6A 5CA1F 1DTWA 2L82A 4EB8A 2GJ4A 4ZQFA 4JY7A 2XMBA 3KSBC 4F2DA 3NGXA 4MR7A 4D8TA 3KXLA 3OICA 4YYZA 1PNQA 1R7RA 3EQ2A 2BBOA 1JJIA 2C4HA 2MDTA 3FUCA 1RJWA 2A4KA 2C1XA 2ZVDA 4XB1A 4Z0TA 5C8XA 5JLJA 2ZRDA 1DRVA 1U7DA 2F67A 1U1IA 4RX1A 2PSFA 4H77A 3B1YA 3B5EA 4GP7A 4PZ9A 4EBBA 1B6SA 3H3FA 2R60A 2IE8A 1MHPA 1Q1ZA 1SVNA 2HNKA 1X1DA 2ID7A 1UMCB 2NVWA 3AYZB 3CR8A 3DZKA 3FVRA 4YMTA 1WMFA 5C1DA 4YR9A 2Q6VA 9ATCA 4FFBB 1SELA 3ETGA 3U80A 4OGKA 2WAAA 2XUOA 2Y0PA 1EFRD 1YJ8A 2Q6TA 4LJ4A 3GJTA 4XLTA 3VZRA 4BWFB 4C78A 2VLBA 2VTEA 1QQAA 4IVPA 5IEBA 2Z5VA 4PRKA 4LJ9A 4O8CA 3ZHOA 1YJXA 4EAQA 1JB9A 3FSEA 3LJKA 1HLPA 1UT6A 2YHIA 2Y67A 1F60A 4OYLA 2WRZA 1MH1A 1M10A 3KXIA 1FSFA 3CLVA 4JUAA 2AYXA 5K3SA 2J0SA 2B1RA 5C8DA 4MUNA 3HVUA 5FLXA 4PLGA 3RAEC 3RS7A 1NL3A 5IXYA 2C77A 4JHLA 1T91A 3EEFA 5TSDA 5LKRA 1K7EB 3SX4A 1D6MA 3FMFA 3USCS 3GJ0A 1SH7A 3P9XA 2CT8A 3ULKA 3EDCA 4CLOB 3E9DA 4GIBA 1WA5A 4HJXA 4CTJA 2D2IA 1I8TA 1OILA 2VHZA 2G0TA 2IPOA 1VLZA 3GC6A 3NOQA 4MGKR 4H31A 4F97A 1E7WA 2PCLA 1OH7A 4LTDA 3U6KA 3AY3A 3CUYA 1M6VB 3VU1A 1XMJA 3IERA 1S9HA 1WKBA 4KE7A 4TQ9A 4L15A 2XRZA 4BMNA 2CV0A 4IIGA 1GYPA 4GXTA 5AW7A 1I2AA 2J3DA 2E5WA 2YZMA 3GB9A 1T2AA 3LS2A 4MA0A 4BUZA 3DOOA 2DBZA 1I0IA 4ECAA 2ZJBA 4WHMA 3ROXA 4L8FA 3WL4A 1XPRA 4OQDA 2VQDA 2VP4A 4J75A 2O4UX 4AKIA 3KO8A 1ECGA 4J2TA 4D3SA 1CUXA 1GN9A 4E4RA 2YINC 3I2JA 4TTSA 4AYXA 1DWQA 1JDJA 4R69A 1IPEA 3D31A 4XXHA 3SZUA 1G5FA 2C2XA 2QI9F 2C3UA 4RW0A 4KAJA 1W2GA 1TQ8A 5E1DA 1WCV1 3H5IA 3JZIA 4MQLA 4MULA 4Q82A 4RHEA 5SYAA 4BNIA 2CXUA 4C20A 5H4HA 4UOZA 9LDTA 5DSZA 4DQVA 1TC1A 2E89A 1AN9A 3BA6A 4WAUA 1XDZA 3A14A 2C4MA 1UOQA 2OO5A 3S1LA 3ZS8A 5JD4A 4OJMX 5TIIA 4NG5A 4FZRA 4C01A 5DN6A 1N1MA 3BXZA 2XUAA 1PCXA 2G82A 3KD3A 2I4NA 3I53A 4QX6A 2ZE5A 4BL5A 3KXKA 1D4AA 2J5KA 5B5SA 2Y6VA 3IODA 2RGYA 3TBKA 1FNNA 5DYYA 2PVSA 4LGMA 4U7GA 2EJUA 3LQYA 2BCJQ 5T5QA 1PKEA 3QWIA 2OSVA 4ANFA 1BU5A 4CKEB 4ZU6X 4RIGA 1B42A 3WNVA 4DQ0A 3ZV5A 1DOAA 2PUAA 1MT3A 4XTCS 3NTOA 4PZUA 3U7IA 4NBWA 3FOEC 1NVGA 3TTWA 3L1UA 3ZE7A 4B3BA 2ZWIA 5DNVA 4MGZR 2I87A 2VWGA 4KXUA 3LNCA 5C1IA 3NUZA 1KORA 5D87A 3VR4A 5SZJA 1H5UA 3CKKA 5EEGA 3G1UA 3U2QA 5KQSA 3FLBA 2BMFA 2C2WA 5JCJD 4GL2A 4X24A 1B73A 2P5TB 5LB4A 3QFHA 5JARA 3VAAA 2BM0A 1IB0A 3GJ4A 4X3OA 1DTWB 4QAQA 2A5FA 5FFNA 5ENZA 3GPBA 5LQCA 2OO5C 5J2UF 1BDHA 3IMCA 1EFHA 4U7DA 3TZEA 4H1TA 5FUXA 2JEOA 5KOHB 5K0EA 1SG6A 1P7WA 3VMMA 3BMXA 3U4AA 1DKOA 4PC7A 3ENNA 1Q17A 4GUAA 4POAA 4RD2A 5HE9A 4ES6A 4OIMA 1S02A 1T3SA 3LBHA 3EZ7A 5KKAA 2FJ0A 1UM8A 1UPBA 3GDGA 5H3CA 3U9TA 1Y3AA 1N25A 1LFAA 1LWOA 3ICPA 3RHSA 3LX6A 1YZFA 3P0HA 1J07A 2ZROA 2R6R1 2ATEA 4TV9B 5CR9A 3TX6A 3T9FA 2QP9X 2FHSA 4DPKA 3M4XA 1P62B 1DEKA 1P39A 1H2EA 2OORA 2P9QA 1X7XA 1V6AA 3FYCA 1R27A 3KRTA 3KWJA 4KQKA 4LYFA 3DB1A 4EW1A 3BORA 3HCPA 1NT2A 3WRWA 2K7ZA 4ZVMA 1E1DA 4Z53A 1XL1A 1ZN2A 3VO1A 2NP6A 2EGHA 2GRAA 2VAXA 1C7ZA 1X7WB 4Z2AA 4RFSB 3G6WA 2PE5A 4KRGA 3VVCA 4I50A 1BXKA 2QDKA 1SVUA 4ZCRA 4IQ0A 4H0NA 5GAJA 1GUZA 4YUAA 3E4DA 3F97A 3Q6NA 2ZS8A 3VR4D 4UNRA 4X90A 3A11A 3AGPA 3Q8LA 1NWHA 2BMJA 3JD3A 3VA7A 1V43A 2QN6A 4YRQA 1UOOA 2HJRA 4FOPA 3PZRA 1E2NA 2CLDX 1T9GR 1C9KA 2AC2A 3AVTA 4DZZA 4X0EA 4P7KA 2DBYA 1AA6A 5AVKA 3AP3A 2WJGA 4Q7JB 4C04A 4MW0A 2O2GA 1MX9A 1V1JA 4QM7A 1FYVA 4UBLA 4YMGA 4MP6A 3QVJA 3E84A 2X9LA 1M2GA 3BOSA 5HM6A 2DR3A 3ZJUA 2GLTA 3UFXB 2A78A 3R0XA 1S3GA 3FSRA 5AESA 4P4NA 3PS9A 3H2IA 2XRYA 2GZDA 4AULA 1K5DA 1F0PA 1WVMA 1Q95A 2J9XB 3QX7A 3SCZA 5C35A 5HS4A 3AEKA 3SHVA 3IQEA 3RHZA 2YV3A 1OXBB 1V7PC 5IKEA 5MFPA 2R00A 2ZAOA 1RPNA 3QXSA 2GAAA 1YU6A 4JNKA 1CD5A 4IXDA 2GCGA 4DXHA 4N0EA 4CM6A 3K5WA 1REQA 1S3SA 2EQBA 3EGWA 3GJZA 2B1JA 2C4WA 2MYPA 3QKRA 2QTMA 4IFEA 4O3MA 1PNOA 1L4HA 3FPJA 3PUWA 4UCWA 3VSAA 3O74A 4JZYA 4C0JA 1JH8A 1XRRA 4IX9A 2FPOA 3E58A 3OUZA 3GIDA 3B9RA 3LYLA 2Q3LA 5DGXA 4JI1B 1TF7A 4TYMA 4QWMA 1T9BA 1O54A 3VZDA 1WZ2A 1XCPA 1QHXA 1ESMA 3ZZTA 1R10A 2QBYA 5CA0A 4BX2A 4CKWB 4V02A 3NWBA 4C5BA 5AI5A 3OCJA 1G38A 5EINA 3WLOA 1GFWA 1XJ5A 3P94A 4LHWA 3Q3VA 4GT1A 4MPPA 4WBNA 5A3RA 1DIOB 1EWTA 2WWVD 1XZJA 4XIIA 3CJRA 4X95A 3N2NA 1ISIA 1V8FA 5CK4A 3ESQA 1B8PA 1ZESA 2QPOA 5ERGB 1NQUA 1C9EA 1E1KA 3QJYA 4GE0A 4MV7A 1V37A 3DEYX 5AKGA 2BTQA 2YBDA 2DUJA 4H7EA 4PBSA 2I6FA 1NOKA 5BRNA 1E6UA 3RREA 4TL7A 3FCXA 4RA6A 1FW8A 4Q1EA 2W83A 1BW9A 3UOGA 3OIGA 4XVRA 1F8FA 1RM3A 2PLWA 2IT1A 4JJEA 1Y1SA 5CNIA 4ZMSA 5HSGA 4ZWNA 2UZ1A 1SBIA 1VLVA 2J3LA 2NXCA 1OLXB 2WT4A 2XIQA 4FDTA 2ECOA 4HF7A 4TXMA 5FPTA 3FYSA 8ATCA 5HF8A 4J16A 2DGDA 3R77A 4MWGA 4JA2A 3WKCA 1KZ1A 1APBA 1FJXA 2HADA 3DMRA 5KNDH 1O89A 3CY6A 3G8AA 2P11A 4G24A 5K7SA 2A0KA 4B9EA 3T5GA 3EQ7A 3BBPA 2Z6QA 4JR2A 4PVCA 4R05A 4YJFB 5B2FA 2VHYA 2Z2IA 1YQDA 1GCAA 1QK5A 1Z38A 1ZK2A 2HRCA 2VWPA 3TR6A 1RJ9B 1T2NA 3KR9A 4FXPA 3ZHVA 1SVOA 5L3SB 1I9GA 1I3CA 3AVQA 4UHBA 1OFVA 3HA2A 4YGYA 1I4OA 4BXOB 1SUCA 2AFHB 3VBEA 1DKMA 1C80A 1E1MA 4KGZA 4DQUA 3WAKA 5BR4A 1HNZB 1VYVA 1ZU4A 2REOA 1MIOB 3Q9SA 4E30A 2Z8XA 1RM5A 3WGKA 3ER9A 1WB9A 3BM5A 2XXAA 3TUJC 1QO7A 2FLKA 5EJMA 1NE7A 1SK8A 4PPYA 4Q4JB 5DKFA 1H2AS 2DJ5A 2G1UA 3MMXA 3VVLA 4B46A 4B40A 5BW8A 1D09A 1XUOA 1IVSA 5KYTA 1PJ3A 1T5LA 1J0XO 2X5NA 3R24A 1CS0A 3DVQX 1A7AA 1I7PA 4KPUB 5CDSA 4G89A 1C0EA 2GN1A 1FTQA 1YOVB 2IPNA 4WKOA 1E3QA 3FDJA 1SHTX 4FKZA 5B36A 3GDFA 3M6MD 4JB0A 5T4BA 3WLTA 1CR4A 4IWNA 5BQ5A 1SIOA 4ARAA 2OMKA 3GVCA 4V3CA 3QE0A 3QV1A 1EX1A 1DEAA 2ZVPX 4DMUB 5AI4A 1JHQA 4DW8A 1P6UA 4V0MA 2XMQA 3SKYA 4DLAA 3U1BA 2YWXA 3H9JA 3RRXA 4BMZA 2A8YA 3Q6MA 2BD0A 1E9BA 3BS4A 3GVIA 4PBTA 3ZD8A 2QG6A 3BMNA 1JR3A 3U7JA 3LPNA 4MRMB 4B3FX 4NYJQ 5DULA 4AJEA 4F06A 3N87A 3BXGA 1OH8A 1LDGA 10MHA 1DBRA 2H5JA 1NJ8A 5AJYA 1JJ7A 2VJMB 1E4EB 1M0TA 1NMYA 2QP3A 4REMA 4UKDA 3NDBB 1UXGA 1UK7A 3H18A 4MCHA 1BMDA 1O3YA 1WZUA 2J9ZB 2OWEA 1V7ZA 3BRWA 1TCBA 2GUWA 4TMKA 4KWIA 4K6MA 4IF6A 1AUXA 2OFXA 1CF2O 3ED5A 4K46A 2PXHA 3DP7A 3ND5A 1MX1A 3VR3D 1NZJA 1QBKC 5AMXA 1QYIA 2I80A 2GTPA 1A1VA 1TE2A 5B2EA 3DLPX 4TKLA 4U7JA 421PA 2JFYA 2IU6A 2PA3A 4NENB 4RK7A 1NP6A 3OTHA 4WOCA 3W7AA 1JEEA 2AFIB 1F9AA 4RDXA 2FPRA 4KX5A 4Z4GA 4DGQA 3V4SA 2FUG1 3G85A 1OXKB 1OHHD 1IY1A 2WUGA 1RKXA 4I5EA 5DFAA 4WCFB 1DIGA 1P75A 1X9HA 2Q49A 4FFOA 4DREA 1SBTA 2CFIA 3DE3X 1NI4B 1O57A 4GMKA 4L28A 4US2R 1H3FA 3U4IA 4YP7A 2ZI3A 1NTOA 2CLSA 5AHWA 3W2HA 3QHAA 1E6WA 1PRYA 1XZQA 1ID1A 3QLEA 4M22A 4LGVA 4IQGA 4R2JA 4YXFA 4YI3A 4URZR 4UATA 3MELA 2HPZA 3BHJA 2JBAB 5JYCA 1GPAA 1ZOIA 1O58A 2DQYA 1AOXA 2CHQA 4PLCA 2ZAMA 3H5VA 2VJQA 4MKRA 4FFLA 4UUOA 1JIKA 3A10A 4GI2A 5FBHA 5J2UA 4LXTA 2IEAA 5CFNA 4DC0A 1A2KC 1DBIA 2Z57A 4QGHA 3W6OA 4PG8A 1MAAA 4UAUA 1QR2A 1U0JA 2BEJA 4MS4A 5FO0A 4CIBA 2F1RA 5LB2A 2OXIA 4G1CA 2VT6A 3W6PA 3T5PA 1OW3B 2X3FA 3IR5A 1XCOA 3MTDA 2O2DA 2ZE8A 1ZD3A 1X0XA 2WEKA 5PNTA 4RLQA 1OAAA 1RJDA 3GP8A 2ZAIA 4Q39A 2G7ZA 1S1CA 1H8ED 1D8AA 2H1CA 2NAFA 4BZQA 2GK4A 3DONA 1Z07A 1K89A 1RAHA 1SM4A 1PP4A 5EIBC 2VAVA 4BVBA 2AFVA 4QDKA 3ZD6A 3TGPA 1JJAA 2DR2A 4CEIA 3UWSA 5E0KB 1HYGA 1Z6QA 2Q9AA 3QX9A 1QK3A 3DXFA 4O4IA 2OM6A 5ESRA 1MGOA 4WW0A 1TI7A 1XTBA 2I55A 5EFZA 1DKPA 3OF5A 2VN8A 4CFYA 2FPMA 2QOEA 4KQ2A 3ZGYA 1H1DA 1HTWA 2GPSA 4NK5A 5EA2A 4AG3A 1H1LB 1Z83A 2XNDD 3S27A 4LC9A 1H3EA 3GF4A 2Q3MA 3QLJA 3QU2A 4H6XA 4LDJA 3QG5A 5CYGA 1I4TD 4IFIA 4IWYA 2JLSA 3SM3A 1P1RA 4J4HA 5IH7A 1CZOA 1Q3KA 1AS3A 4NU8X 2Y71A 1BE6A 2FZCA 3W3AD 1U9JA 1N7IA 4Y2HA 1AHNA 4B84A 1Q91A 1CUVA 4P33A 4Q9IA 5JU6A 1P91A 2X1HA 2A0FA 5CVJA 2GKGA 2QMZA 3HEBA 1H93A 4RTRA 1KDYA 1Z15A 4BNNA 1LLDA 1HNWB 4AUEA 4HVAA 2QJTA 1IZZA 4KWHA 1T4CB 4D0RA 5EHZA 1XOIA 1TXGA 5HBGA 3ANSA 3EA4A 2XD9A 3BL5A 4GLBA 1KOJA 3LKBA 2FG6C 4C88A 4TV8F 1IOZA 1E20A 2CDNA 2D5LA 2Q29A 1U0HC 4MUMA 4KRXA 4OLBA 3CTMA 1NUAA 2PSDA 1UDWA 3BEDA 3KPVA 4MICA 3NJRA 3NEYA 4FYJA 5BSFA 5EMHA 5I48A 4DCVA 4YC7A 3F5QA 3PNYA 1Y4AE 4EMUA 1AMUA 5J2TB 3N0RA 4YAIA 4L8WB 2FSSA 1UC4B 3OJOA 5K3FA 5CDFA 4B2LA 1JDNA 4O2AB 3M5PA 3QYFA 4NYMQ 2OHJA 4DANA 1TTTA 3V5NA 1DRUA 2JLYA 4NX2A 3VJLA 4R1SA 1R6DA 3UUEA 3K1JA 1GTVA 1JXQA 2XRFA 2W2PA 2P4QA 2R65A 3CUTA 1TNDA 1YZVA 1TF5A 1VECA 1ZXBA 2FEXA 1CY8A 1V2HE 2D3WA 1TOAA 2H4FA 1UXHA 4UM7A 5DOVA 3HVIA 1CEYA 2QENA 1J09A 1DKUA 2ZWAA 3IESA 1SRRA 4Q3EA 3R0IA 3EZFA 4WACA 4YMSA 4L6AA 4PZDA 2QPLA 4PS0A 3USZA 4BAZA 1PVDA 3FTEA 1HKHA 1F6WA 1I3MA 4ARSA 5CFRA 2JCGA 3C3EA 1I9CA 1UEXC 1JHPA 1JL3A 3OJWA 2JH3A 4NCIA 5F4ZA 5FHQA 2M6LA 1N6HA 3U44A 1HORA 1XD2A 2FUCA 3LT1A 3BTSA 3O4IA 1GR0A 4GMDA 1CRQA 1QBGA 3DS8A 5CK5A 1M9NA 1N5LA 2L17A 4QA9A 1XV5A 4QHYA 4M87A 5EGSA 4GPTA 2EEZA 4Q3KA 4RMHA 2ENWA 3SSNA 4BAGA 1IHUA 3HB1A 3NRBA 3S6JA 4PYIA 3AHHA 2EJCA 3QEMA 4E0BA 3ZG6A 4LA4A 4Z49A 5K0TA 1P61B 4UAGA 4RQBA 5DP1A 1O5IA 5LUAA 1QX3A 1E3IA 4PRZA 4XJTA 3RYFB 4AMVA 3TL3A 2AH5A 3TR0A 3KZ1E 2PKRA 3IXQA 5AICA 5F7OA 1Y5IA 3L6DA 3RYIB 1WKVA 3EWSA 2GGSA 4KN5A 4NMXB 4XWYA 3T7IA 4L78A 3H87A 3UW1A 4BNYA 1BVRA 3DO8A 4M1KA 2FPGB 2NACA 3GUVA 2Z9BA 4AF8A 1YE8A 3T7JA 4OX9B 4KMMA 1IYZA 1XVIA 5KTRA 1PZNA 1KJJA 2RC6A 1I7LA 1LBIA 2HIMA 1QDEA 3IXLA 4N03A 4RELA 1VCMA 4K5QA 3RVRA 1U8YA 2HXYA 4MB6A 1FPQA 4IGIA 4DAOA 1XXHA 1JZTA 4COKA 2IF2A 4IXWA 1NVDA 3O03A 1F0NA 5CIWA 4CNQA 3RADC 2PGIA 1V4BA 5TGTA 3VHRA 4BZPA 1FIUA 4YP1A 4KREA 5C80A 3FX2A 3K35A 1U63A 4JLWA 3L7BA 3WNCA 1E2PA 2PWBA 4OREX 2WFLA 4GKAA 4BBZA 1UXOA 2VRCD 2CXQA 2G09A 1KAGA 3KLNA 4XM2A 1FNDA 1ZOOA 3L6UA 1L6IA 3L4BC 2H1FA 1A2QA 1G41A 4QTXA 1YS7A 1FRVA 2AG5A 3UGKA 1K68A 2VT2A 3T3IA 4NR0A 5DHFA 1ZH2A 1YQ9A 1CUEA 1WVGA 2P4HX 3JVEA 1PTJA 3FI9A 1UMDB 5CH8A 1V0JA 3T7KA 4K3UA 2IXFA 2VNIA 3HG7A 2ZS7A 2JA2A 4II3A 1P2VA 3SKXA 3T6KA 1TM2A 2EIHA 1W0JD 1F5SA 4ACAA 5JROA 3DO6A 4MR9A 1AV6A 2Y4NA 2BT4A 3RSQA 4C0SA 2GK7A 4AURA 1UBGA 2X2PA 1MZPA 4O5AA 4I8IA 3HP7A 4C4OA 2I1LA 4CMJA 4MGIR 4ZPJA 5DBGA 3VKUA 3WLKX 5JZSA 1Y8AA 1ZD8A 2D2EA 3FVVA 4H7HA 1F2UB 1R4NB 3FRHA 3PK0A 4FGLA 5DIZA 5A4JA 3MJSA 5T3YA 2LV8A 1XMIA 1G7RA 3F6EX 1P2DA 4FFRA 3DLCA 3AO0B 5T67A 1QVWA 1OQAA 1W5AA 3N0VA 4HAYA 1I2MA 4LXGA 4DKXA 4UDOA 4CMEA 5KHOC 3FTCA 4LWZA 1BCRA 3D6FA 2YCBA 4YT4A 1TUIA 1YZUA 3AKEA 2QJWA 3PXXA 3V7NA 4JLBA 4LC1A 3VDRA 5JD6A 3SFTA 1AZWA 2IZ1A 4F60A 4I9UA 3ZHUA 2PXXA 2Z2XA 3IAS1 4W5NA 1N8SA 1OI7A 4P7JA 2NP7A 3N53A 4X1YB 3MM4A 1XDBA 3RTGA 1AZLA 3RVKA 4Y1GA 3KYDB 4ZQCB 2BAGA 3WYEA 1IBMB 1ORRA 3H11B 3FN4A 2PSSA 4LF4B 1XZBA 4HP8A 4M8LA 3OWXA 3B1FA 3I0MA 4GSKA 4IINA 1CY4A 2QQ0A 4F45A 1IPHA 2WHEA 3PIIA 4CBVA 1SHUX 3OIDA 4MEAA 2ZSDA 3PQ4A 1YCDA 4MJ7A 4ODIA 2CLIB 3D0QA 3WG9A 1KF0A 1UH5A 2W2KA 3KHTA 1AS0A 2HK9A 2Z8YM 2WYOA 4IDBA 1E3MA 3UWDA 3R8FA 1H2RS 1FFYA 4OSEA 3DYBA 1P8AA 2CNWD 1PU2A 4WSOA 1FP4A 4BNUA 1PZFA 2NO9A 3HXLA 2KYRA 4LWOA 3U31A 4EITA 1B93A 1YAHA 2EFJA 4J7XA 5BWNA 2H1IA 5KYVA 3OKFA 4ZHSA 4CYMA 2F4VB 4O2LA 1X3SA 3BVPA 3VVBA 1N57A 3LX4A 1T36B 3NO4A 3ABZA 3RRNA 4QL3A 1XMXA 3S44A 1MW8X 3RC7A 1ZWKA 4IUBS 1R0KA 2HJ9A 3KAJA 1F7UA 2Y9PB 4RAOA 4FHCA 1QRTA 2FW9A 3H05A 3CX4A 3LBFA 3MK31 3PNLA 2PL9A 2HSEA 3O47A 5GONB 4GRAA 2Q1WA 5JISA 1S2GA 1GGKA 5HKBA 3IIEA 4B75A 1VMDA 1SU8A 2JI9A 2HNAA 3UYLA 3GPLA 3O0DA 3P2YA 4CU5A 4V38A 4R16A 4O4JF 3CE6A 3MGKA 3JPYA 2HC9A 4W7IA 2AJCA 3EGXB 1W6UA 3I4LA 4NG4A 4PLZA 1M2NA 5CHEA 1E1QD 1XB2A 5FD8A 4R1OA 5GZ6A 3AU9A 1JHMA 4L5BA 4OB6A 4DLNA 3J81A 1DCKA 1KDPA 5L51A 4IY1A 1Y8QB 5EZ6B 4EHAA 2CZCA 4A1FA 3UB2A 2XXAB 4S0ZA 3E0XA 4KVAA 4EGAA 3P4YA 4FMDF 4JXZA 3PFNA 4E32A 5C34B 1E77A 3FETA 4HLCA 1D03A 4GUDA 3BREA 1PUXA 3C8HA 1AZTA 3GN2A 2FZGA 1X7YA 2WSSA 3ZQ4A 4HB3A 2C2OA 5JNWA 1FSSA 3AHEA 1A98A 3ZVRA 1NIJA 5B55A 4KU4A 4U7WA 4JJIA 1BVUA 4LXHA 2Q2WA 1NLFA 4YRTA 4L5YA 4EJSB 1RQ7A 1SCDA 4UTOA 2NTVA 2Y92A 2ZE6A 4PLFA 3I28A 4RZ3A 1W4BA 1X7GA 2ZZMA 2HTEA 2HSDA 3U3XA 2G72A 3TWOA 2AW3A 1W9HA 1JFRA 1MPXA 1Q3HA 2QD4A 1ZX1A 3B20A 3FGOA 4C0BA 3I9MA 4KYIB 2UV8A 3OP4A 1T8YA 2PUWA 1YI8A 3BQMB 4URFA 3WLQA 4UEOA 4C76A 5AW3A 3EFOA 5JDIA 3KPUA 4LDPA 2RHDA 4UAVA 3FBGA 1F3OA 3ED1A 5ALFA 4H4EA 4M1WA 5B37A 3I6YA 5DX0A 2HHHB 4A5OA 3IEPA 1ZIYA 2QTTA 2VNJA 2CK3D 1F6BA 3WJ1A 4EX7A 5KYXB 1MRSA 4WV3A 2JJQA 5L3RA 1B0PA 2VJYA 2BGJA 3L7KA 1LPPA 4Z8YA 1TDJA 3DFIA 4D7AA 3U7GA 3S0JA 3VOSA 1Y4ZA 3VU8A 1Z0JA 3M5DA 3QA9A 3FFWA 4QDJA 1UBMS 2DSNA 4P6VF 1W76A 3KPJA 2WICA 3PIDA 5E6RB 3JTMA 3ZKWB 3AETA 1RXYA 3ZW9A 3V33A 1A77A 1V7QA 2P0YA 3ZCQA 1N2SA 4S04A 5C4GB 2I6XA 4M1MA 4AP5A 3AQIA 1JI3A 1OASA 3L7NA 1N3BA 1TT5B 2AZDA 5CHYA 2OHIA 3IUEA 2PAFA 3OECA 4M21A 1U4SA 3ROQA 3T7RA 4EHIA 1DWUA 1WTCA 1K27A 1HDGO 1SR8A 2QRLA 3PD7A 3UJPA 1QHHA 2D62A 3CWCA 1RE0A 2ISQA 3BICA 4MNTA 4W5RA 2WMDA 4E1BA 3DXXA 1ISGA 5AK5A 3PE6A 2BMAA 2MTBA 2WYHA 5CNKA 3ROMA 4HTAA 1B8NA 1H2HA 3AINA 4C7BA 4F2HA 4D4HA 1LA2A 2L2QA 3ZU5A 3F49S 4MWSA 4M0MA 1C3XA 1KA9H 2ZWOA 3H84A 4MWBA 5ISMA 1V6SA 3TQIA 4D42A 4ERNA 4TL9A 4O1IA 4X63A 3TB4A 1H4QA 1UMCA 2HPAA 2IYWA 1T3HA 1SPXA 2IVZA 2ZRHA 3BSYA 3ENVA 2VPIA