3FOOA

A triangular cytochrome b562 superstructure mediated by ni coordination - monoclinic form
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMCDFAAGFHILVGQIDDALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A superprotein triangle driven by nickel(II) coordination: exploiting non-natural metal ligands in protein self-assembly
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
molecule keywords Soluble cytochrome b562
total genus 41
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2008-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3fooA00
2BC5A 5JS5A 4JEAA 1E84A 1CPQA 256BA 2J8WA 1YZAA 2XLEA 4CX9A 3M79A 1JAFA 3M15A 4U9DA 3QW0A 4D4XA 3IQ6A 2XL6A 3HNKA 3ZWIA 1EKYA 4CIPA 3VRCA 3NMJA 3TOLA 5JP7A 1E83A 5JUAA 4CDVA 1YZCA 4WGZA 2XL8A 3HNIA 2J9BA 4U9EA 3ZQVA 2XM0A 3U8PA 3QVYA 4JKVA 3C63A 3FOOA 2YKZA 1LM3B 2YL0A 4JEBA 3NMIA 5JSLA 2XLMA 4EIYA 5B3IA 2YLIA 1MQVA 1APCA 3HNJA 1RCPA 1YYJA 1QQ3A 2YLDA 1YYXA 4IAQA 4CDYA 1NBBA 1CGNA 3M4CA 2YL3A 5JRAA 4NC3A 2XLVA 2YL1A 1M6TA 1GQAA 4N6HA 4CJOA 4WGYA 3IQ5A 4L6RA 2CCYA 3QVZA 4CJGA 1CPRA 2XM4A 5AGFA 2XLWA 1E86A 3HNLA 1E85A 2XLOA 4ER9A 3M4BA 1A7VA 5JVEA 2QLAA 3C62A 2XLDA 2XLHA 3QW1A 3TOMA 1BBHA 2YL7A 4D4NA 4CDAA 4JE9A 1S05A 5JLIA 1CGOA 3DE8A 3ZQYA 4ULVA 3ZTMA 4IB4A 5JT4A 4IARA 2YLGA 4N4WA 3ZTZA 3FOPA 1QPUA 3NMKA 3DE9A 3L1MA
chains in the Genus database with same CATH superfamily
3EH1A 3W2WA 1LS4A 2IXOA 2MHRA 4YN0B 5B1BC 4BJ5C 3ZSUA 4J30B 2ICWG 4PJJA 4YT8A 4EHPA 2G3KA 2X51A 3RKOF 1AEPA 4CX9A 1T6IA 4G78A 2ZXWC 2KC3A 4MQ9F 3V7OA 2WVNA 1SR2A 4JCZA 4PJNA 2I8BA 1ZHYA 5CIVA 2HV7A 4U9DA 4CS7A 3S29A 1NFOA 2EPLX 4HEAJ 3C7JA 4AL0A 3QW0A 1ZZPA 3EHMA 3TQOA 3AGUA 2EPMX 1T6QA 1QVXA 4X0RA 5DS6A 4EKWA 4JJGA 1U0BB 2H7OA 3AG2C 4D4XA 3CSKA 3OEOA 5DS4A 5EHHA 1LIHA 4EBKA 1MMDA 2J9UA 3ZWIA 4U5GA 3ZG1A 4CIPA 4MVRA 4JTCB 4LLEA 4O6NA 2H8AA 1TWHA 3Q6MA 3DAGA 1U6HA 1OCRC 2HSBA 3IQTA 4MVSA 4WGZA 1ZW3A 1LE2A 2OEVA 1QLEC 2PF4E 4JTAB 3NDBB 2ETSA 3RFYA 4BPMA 1LKXA 1SYQA 3B0PA 3CZ6A 4XLNF 5KYYB 3AG3C 3E9VA 5FZTA 1BZ4A 4OD4A 3DM5A 4FWVA 5A6BD 2HV6A 2JPUA 2LSEA 1OR2A 1T01A 5E3CA 5KYUB 4JKVA 1ORYA 3KYIA 4UDVA 2Q9BA 4E18A 2MYSA 2RSEB 2YKZA 1LM3B 2IOQA 1ZHXA 2A0UA 2EIKC 4ULWA 4AX2A 3H2UA 3PDMP 2DB4A 1QSPA 4XEFA 4DRHB 2W9YA 3RVZA 3BRJA 2B0HA 4BJ1A 5B3IA 1PV3A 2PNOA 2HKVA 2DGJA 3KPHA 1OCOC 1U89A 4G0HA 1O5HA 5A69A 2XXAA 1D1BA 1V4AA 1ZW2A 1Z5ZA 1V54C 1A41A 2EPKX 4IAQA 1OXBA 2HMZA 1EA8A 3FAJA 1M56C 1S7ZA 1NFNA 2P6VA 2Y39A 4ZLCA 2OEXA 2YL3A 5JRAA 3GEEA 4MW8A 4ONSA 3VF0A 4IAOA 2YL1A 3SXKA 4N06A 3GORA 1M6TA 3B9QA 2KQ9A 2BE5F 5COFA 1TKNA 4KI2A 1TFOB 3JSEO 4RBNA 1JR8A 1EQ1A 5F28E 1MNEA 4N6HA 4CJOA 4G7OF 1SZIA 1M2VB 2C04A 1R5ID 3GEHA 2J9VA 3LNMB 4YJWA 5L0GA 3LUTB 3POVA 2KNHA 2LFFA 3U2LA 3NYLA 2XM4A 1YARO 2CDQA 1KU2A 1M57C 1DOVA 2EIMC 2QTVA 4IJJA 1TR2A 3S28A 3EQLF 3KKBA 3WG7C 1Y6DA 1NU7D 4NTBA 3VYWA 1E85A 3MFNA 2A69F 1BR4A 3EPVA 5BQGA 2XLOA 3GM2A 5BUOA 3LAYA 1Z63A 3UR3C 4BJ6A 1BR1A 4DVYP 1A7VA 3KH2A 1EI7A 4YWQA 3FAPB 4P9FA 3AQBA 3ZVRA 3C62A 1SF8A 3WODF 3U3BA 3TOMA 2YVKA 1OW6A 1QZXA 1Q0MA 4QDLA 4XWJA 2DI3A 5K0IA 2WZLA 3UGPA 4JE9A 4LERA 1S05A 2M4EA 3CQZA 3JT1A 2MWQA 2NUTA 2Y69C 2YZSA 2D4UA 3ECSA 3M1CB 3EGXA 3EG9B 4BEJA 1A0BA 1MNDA 3JZ0A 2HS5A 2L6GA 2X0CA 5JT4A 2L81A 2R7TA 4JCHA 4LACB 5KYXB 4KNWA 2IBFA 2PBEA 2XL4A 2EIJC 2YLGA 2ZXPA 4DBQA 3SXZA 3W8IA 1VLTA 1ST6A 1WASA 4U5CE 4MTOA 1H9GA 3Q7LA 4JEAA 1NG1A 2P1AA 2OG2A 4DJ9A 2VCCA 2R7WA 3JYYA 4YL0A 4BJTA 1ZVZA 2KK1A 2YEVA 1D0ZA 3IHUA 3M15A 3G4ZA 5L0CA 1YAUO 2ZXRA 2QY9A 2R9RB 4C3EA 4WJ0A 2R7UA 2CYDA 4C3DA 1K04A 3G50A 4YK5A 4PFOA 4YT2A 1T6UA 1FTSA 2OKUA 1HW1A 1G4WR 3LESA 1TFKB 2AWYA 1E2XA 3LEOA 4LDKA 5JP7A 3TOLA 1D0YA 3K1HA 1E83A 5KYWB 1BR2A 1V55C 2NSFA 2P7VA 4J7YA 5F5HA 1D0XA 5JUAA 1YZCA 3QZCA 1I4YA 1RMVA 3LS1A 1D1CA 4ZLDA 1Q0FA 2J9BA 3DJNB 2G3VA 4BEMJ 4FESA 2WL8A 2XM0A 4J7TA 3B71A 2R02A 3U8PA 2WZFA 2L7AA 1HMDA 3MX3A 1W2WA 3G4XA 3K6BA 3C63A 2CNWA 1WOLA 3US6A 3H2VA 1A7DA 2EPOA 2NUTB 3IEEA 3K33A 2LCHA 1FMWA 2LD6A 3EGXB 5JSLA 1WN0A 4U5FE 3ZIBA 3NG1A 4C7OA 3KYJA 4G7HF 2QNLA 1FNTc 1H7IA 1TWCA 1FMVA 2KYHA 4DRJB 5L0FA 2P61A 2L6FA 3K66A 3AG4C 1YA9A 1I5NA 4XTKA 4Q7CA 3S27A 1BDJB 4ANJA 1RCPA 1QQ3A 3FXHA 2OQMA 1YYXA 1YDIA 2HFIA 2KSFA 2NUPB 2WVOA 2Q3TA 2NSGA 3T9OA 1NBBA 3C8GA 1CGME 4U5BE 5DQTA 4O7GA 2F22A 1LS1A 2R03A 2W45A 2DYRC 1G8XA 2XLVA 3KL4A 2LK4A 3LS0A 4Z9JA 1WWPA 4EUKB 3ITFA 4EBJA 3C8ZA 1WTYA 2NG1A 4H54A 4YL1A 2Y3GA 1GQAA 2HMQA 3SP1A 1RXQA 5HSWA 3A11A 3NYMA 1LI5A 4C3BA 3TULA 3IQ5A 3K7DA 3O39A 4LDQA 2HUJA 4FAPB 4W8KA 1FAPB 4E7ZA 4O6YA 1NZEA 2KGOA 5KYWA 3WHNA 3U0CA 1N1CA 5L0JA 4CS8C 4K7BA 2A1DD 3TD7A 3HNLA 3NKEA 2JD3A 4PR9A 2VC9A 4DBRA 2C03A 1O3UA 3EH2A 2J7PA 3EZIA 4ER9A 4CBEA 1LVKA 2XS8A 1JMWA 4AK9A 1OKKA 1OW8A 2G62A 1ORJA 5JVEA 3EGDB 4WABA 3ATPA 1KTMA 3JRMO 3PMRA 4JRZA 1BBHA 3TK0A 1OCCC 4JC7A 4BJ5A 2R7QA 4N6CA 2PX3A 1YA7O 2HZ8A 5T3TA 4C7OB 3R7CA 1MMGA 1Z6AA 2J0WA 4OIOF 2W4BA 3VAYA 4IB4A 4KBLA 3DKAA 4CSAC 4JZAA 4E0IA 1OQCA 2KJGA 2R7OA 1IW7F 1C17M 2RD9A 1Y4CA 3C8GD 1FFTC 3IPMO 3ZTZA 1QPUA 3F47A 3I4UA 2WB7A 3L34A 3DE9A 3L1MA 1B68A 4Q4ZF 4MW3A 3DWWA 3O10A 3SZRA 1VTMP 1E84A 1AUEA 5L0HA 5BQHA 4HE8D 4A4AA 5A6JA 1YZAA 3U2MA 1JRAA 1VYIA 2M64A 3NKDA 4DVZA 3UMKA 5A6AA 3A9CA 4XEKA 1Z23A 2DYSC 4XPWA 3HJCA 1O87A 3U9MA 5GPGB 4G7ZF 4OIRF 4O79A 2CGEA 2H7VC 1K05A 3SYNA 2XXAB 1G5ZA 2V26A 3DD7A 2FGYA 3H65A 3MYIA 4CSAA 1TWAA 3RW0A 3L0IA 4GEHA 4MVQA 3IQ6A 1J8YF 3AGTA 3GM3A 3SXMA 3X2QC 1EKYA 3NMJA 3W2VA 4OIPF 3UGOA 1FR0A 2QE9A 2J7PD 4P6IC 1YJGA 3FMSA 2V3CC 2XL8A 3PCVA 2ZXOA 3E70C 2D5RB 3DJUB 1LE4A 1LPEA 5COMA 5KYYA 1PD0A 1I4ZA 4U5HA 4W8PA 3RYLA 2XSEA 4O6MA 3GODA 3IQCA 3UMIA 3ZDLA 2AU5A 2PFDA 3FOOA 3DXJF 1WATA 2AWCA 3O6XA 4DXWA 4IRUA 4NQFA 1ZHTA 2OJED 2R7XA 2R7RA 1VYKA 2L6HA 3V5ZA 3FDQA 5AC5A 4EIYA 2OJQA 2AP3A 3BEHA 4DRIB 1OXKA 4E0HA 1C03A 2YHSA 5E3AA 1APCA 3HLZA 1YYJA 2J45A 3UMHA 2XS1A 4JVSA 4NCQA 4YT5A 2PX0A 1YLMA 3ABMC 3Q7GA 5CI8A 2EINC 5E2QA 5AC4A 4CDYA 1C02A 4QI2A 1JOGA 3KMIA 1OW7A 1UFBA 5CI9A 2HSQA 3SXYA 2Q9AA 1HE9A 3M4CA 1LI7A 2R25A 5EK0A 1VMAA 4NC3A 3MYFA 3JTLO 3RIPA 2A6EF 2GAQA 2CW0F 3RVYA 1HE1A 3N24A 2R7SA 3S84A 4I44A 1TWGA 3DZAA 1M2VA 1HMOA 5L0DA 2FFHA 4WGYA 4PJMA 3LEVA 5L3VA 2JX0A 2L9JA 4BJ6C 2UUIA 3GANA 4GYTA 4IWBA 2LFDA 4R32A 1XZQA 4JIOA 1VK5A 4MVZA 3U8VA 3GWNA 3R2PA 2XLWA 4MVUA 4MTFA 5L3QA 1V74B 1PCXA 1HY5A 4B6IA 5KYNA 1VOMA 1YVIA 2VB6A 2HJ3A 1H9TA 2VH3A 3V5XA 3EFOB 2R7VA 1F1MA 1ZHWA 2Q4FA 1GM5A 1T9KA 2FAPB 3C18A 1FFHA 1ORSC 2QLAA 2J46A 4MTGA 5DVWA 2XLDA 4RDAA 2XLHA 3QW1A 3HKKA 4U5EE 4XPXA 1AVOB 2YL7A 4D4NA 4CDAA 2IXNA 5JLIA 2VCAA 3QMKA 1OKKD 1Q0GA 4K0DA 4M63A 4ULVA 2O9XA 3ZTMA 1DOWA 5A6KA 1RKEA 4KC9A 2IXPA 4MVMA 1PD1A 1Q0DA 2UUHA 2VCBA 3RQEA 4DOZA 3EG9A 4YL3A 5DQZA 3ABKC 3B0UX 4CS8A 5DS5A 4N4WA 2HJMA 3W4YA 4JTDB 5D92A 5KYXA 4F4BA 5EGYA 4OIQF 1L3PA 4HFFB 2BC5A 1R4TA 4Z9HA 1UG7A 5JS5A 5L0IA 4J32B 1ZYRF 1CPQA 256BA 2IYLD 2J8WA 3FHDA 5B3SC 1IZMA 3JCUQ 1L7CA 3CAXA 1RJ9B 2XLEA 2YQYA 5T3WA 1H6GA 1MMAA 2P0NA 3W8HA 3M79A 2J0XA 2OCCC 3EHNA 1JAFA 5D91A 3SEOA 3TJ5A 2KW3C 3U5SA 3CEXA 2ZD9A 5FCLA 4JW1A 2A68F 4H4KC 1VB5A 4NTAA 2IM8A 1ZHZA 3AJMA 3DM9B 3ASOC 1T5OA 3JSZA 2Y3BA 3S0XA 2NPUA 1OCZC 3EZHA 3L8JA 2XL6A 3N2ZB 4PK4A 1NU9C 3HNKA 3DMDA 5TJ5E 3V5YA 2QUPA 1OR3A 4XLPF 2Y3DA 2VASA 3VRCA 3RQFA 1SMYF 3T4RA 4E17A 4LLCA 2W4MA 2WVQA 4CDVA 4XPYA 2LIGA 3F46A 3O55A 4KNVA 2ZPAA 3EFOA 2A6HF 3HNIA 3MLGA 4AE4A 1Z7Qc 2Y3HA 3K1IA 3OA1A 3PHF2 4CS9A 4U9EA 1WGWA 4BG0A 1HW2A 3ZQVA 2AVKA 4PACA 1TQGA 2Q00A 3DAFA 3LNRA 3NYJA 4HFKB 3Q6NA 2CNWD 3GEIA 3T6JA 1GS9A 1GGQA 5BQIA 3B29A 3QVYA 2E87A 3ABLC 3JYHA 4XEVA 1RKCA 2Q7RA 2YL0A 3X1OA 2IXMA 3J06A 4JEBA 1VLSA 3I5PA 3NMIA 2TMVP 1RKEB 3GM1A 2XLMA 4GQHA 3VM6A 4EBBA 3L8IA 4NTFA 4MNDA 2EILC 2YLIA 1MQVA 4RD9A 4I1OB 3HNJA 2YWAA 2OOCA 3K1IC 5T1DB 3NRHA 3FVYA 4EWCA 2YLDA 4LDRA 2GA0A 4E7SA 2EPNA 3AOUA 1NLXA 3T6GB 1J8MF 2PP4A 3S9OA 2NUPA 1RJ9A 1ZU4A 3ZC4A 4MVOA 3RQGA 1CGNA 2GWWA 4CS9C 4I1MA 3NMKA 3LJBA 5E33A 3C8GB 1ZU5A 4NY3A 3I5QA 5COGA 2R05A 3T6BA 2OU6A 4A2NB 4Q5SF 1JPJA 4I3MA 1A7EA 2ASRA 1XZPA 4IGGA 3RH3A 3AQCA 1Z3IX 1Q0KA 4L6RA 2CCYA 3JRTA 2Z15A 3LLKA 3QVZA 4AL1A 4CJGA 1CPRA 4P9TA 2YRFA 4QI0A 4YT4A 1JPNA 3EJNA 5AGFA 2I15A 3N0TA 1E86A 2XRHA 3WAQA 1K40A 4Z9IA 4CIHA 3B0VC 2GFHA 2H7BA 3U3FA 2Q9CA 4AE4B 1D1AA 4OD5A 1G4US 2B0JA 2LQGA 3M4BA 4XQ1A 1XWJA 2LP4A 3EGDA 1NSGB 4OINF 5F5FA 4JURI 5B1AC 4MS2A 4PJLA 3LLIA 3OWTA 2A0BA 5DLJA 5IY5C 3SNHA 3TJ6A 4FX5A 5A6BA 5KYUA 3UNGC 2J9WA 1QKRA 1M2OA 3QTHA 1CGOA 5HV9A 3DE8A 3MBGA 3ZQYA 1MMNA 2WZGA 4IARA 3U9JA 3GWLA 3S90A 3AG1C 3HTKC 4K1OA 4U5DE 3DI5A 3FOPA 4JJFA 4PFPA 2BL2A 3ASNC 1KNYA 2GDCA 3RF3A
chains in the Genus database with same CATH topology
2BC5A 5JS5A 4JEAA 1E84A 1CPQA 256BA 2J8WA 1YZAA 2XLEA 4CX9A 3M79A 1JAFA 3M15A 4U9DA 3QW0A 4D4XA 3IQ6A 2XL6A 3HNKA 3ZWIA 1EKYA 4CIPA 3VRCA 3NMJA 3TOLA 5JP7A 1E83A 5JUAA 4CDVA 1YZCA 4WGZA 2XL8A 3HNIA 2J9BA 4U9EA 3ZQVA 2XM0A 3U8PA 3QVYA 4JKVA 3C63A 3FOOA 2YKZA 1LM3B 2YL0A 4JEBA 3NMIA 5JSLA 2XLMA 4EIYA 5B3IA 2YLIA 1MQVA 1APCA 3HNJA 1RCPA 1YYJA 1QQ3A 2YLDA 1YYXA 4IAQA 4CDYA 1NBBA 1CGNA 3M4CA 2YL3A 5JRAA 4NC3A 2XLVA 2YL1A 1M6TA 1GQAA 4N6HA 4CJOA 4WGYA 3IQ5A 4L6RA 2CCYA 3QVZA 4CJGA 1CPRA 2XM4A 5AGFA 2XLWA 1E86A 3HNLA 1E85A 2XLOA 4ER9A 3M4BA 1A7VA 5JVEA 2QLAA 3C62A 2XLDA 2XLHA 3QW1A 3TOMA 1BBHA 2YL7A 4D4NA 4CDAA 4JE9A 1S05A 5JLIA 1CGOA 3DE8A 3ZQYA 4ULVA 3ZTMA 4IB4A 5JT4A 4IARA 2YLGA 4N4WA 3ZTZA 3FOPA 1QPUA 3NMKA 3DE9A 3L1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BC5 A;  5JS5 A;  4JEA A;  1E84 A;  1CPQ A;  256B A;  2J8W A;  1YZA A;  2XLE A;  4CX9 A;  3M79 A;  1JAF A;  3M15 A;  4U9D A;  3QW0 A;  4D4X A;  3IQ6 A;  2XL6 A;  3HNK A;  3ZWI A;  1EKY A;  4CIP A;  3VRC A;  3NMJ A;  3TOL A;  5JP7 A;  1E83 A;  5JUA A;  4CDV A;  1YZC A;  4WGZ A;  2XL8 A;  3HNI A;  2J9B A;  4U9E A;  3ZQV A;  2XM0 A;  3U8P A;  3QVY A;  4JKV A;  3C63 A;  3FOO A;  2YKZ A;  1LM3 B;  2YL0 A;  4JEB A;  3NMI A;  5JSL A;  2XLM A;  4EIY A;  5B3I A;  2YLI A;  1MQV A;  1APC A;  3HNJ A;  1RCP A;  1YYJ A;  1QQ3 A;  2YLD A;  1YYX A;  4IAQ A;  4CDY A;  1NBB A;  1CGN A;  3M4C A;  2YL3 A;  5JRA A;  4NC3 A;  2XLV A;  2YL1 A;  1M6T A;  1GQA A;  4N6H A;  4CJO A;  4WGY A;  3IQ5 A;  4L6R A;  2CCY A;  3QVZ A;  4CJG A;  1CPR A;  2XM4 A;  5AGF A;  2XLW A;  1E86 A;  3HNL A;  1E85 A;  2XLO A;  4ER9 A;  3M4B A;  1A7V A;  5JVE A;  2QLA A;  3C62 A;  2XLD A;  2XLH A;  3QW1 A;  3TOM A;  1BBH A;  2YL7 A;  4D4N A;  4CDA A;  4JE9 A;  1S05 A;  5JLI A;  1CGO A;  3DE8 A;  3ZQY A;  4ULV A;  3ZTM A;  4IB4 A;  5JT4 A;  4IAR A;  2YLG A;  4N4W A;  3ZTZ A;  3FOP A;  1QPU A;  3NMK A;  3DE9 A;  3L1M A; 
#chains in the Genus database with same CATH topology
 3EH1 A;  3W2W A;  1LS4 A;  2IXO A;  2MHR A;  4YN0 B;  5B1B C;  4BJ5 C;  3ZSU A;  4J30 B;  2ICW G;  4PJJ A;  4YT8 A;  4EHP A;  2G3K A;  2X51 A;  3RKO F;  1AEP A;  4CX9 A;  1T6I A;  4G78 A;  2ZXW C;  2KC3 A;  4MQ9 F;  3V7O A;  2WVN A;  1SR2 A;  4JCZ A;  4PJN A;  2I8B A;  1ZHY A;  5CIV A;  2HV7 A;  4U9D A;  4CS7 A;  3S29 A;  1NFO A;  2EPL X;  4HEA J;  3C7J A;  4AL0 A;  3QW0 A;  1ZZP A;  3EHM A;  3TQO A;  3AGU A;  2EPM X;  1T6Q A;  1QVX A;  4X0R A;  5DS6 A;  4EKW A;  4JJG A;  1U0B B;  2H7O A;  3AG2 C;  4D4X A;  3CSK A;  3OEO A;  5DS4 A;  5EHH A;  1LIH A;  4EBK A;  1MMD A;  2J9U A;  3ZWI A;  4U5G A;  3ZG1 A;  4CIP A;  4MVR A;  4JTC B;  4LLE A;  4O6N A;  2H8A A;  1TWH A;  3Q6M A;  3DAG A;  1U6H A;  1OCR C;  2HSB A;  3IQT A;  4MVS A;  4WGZ A;  1ZW3 A;  1LE2 A;  2OEV A;  1QLE C;  2PF4 E;  4JTA B;  3NDB B;  2ETS A;  3RFY A;  4BPM A;  1LKX A;  1SYQ A;  3B0P A;  3CZ6 A;  4XLN F;  5KYY B;  3AG3 C;  3E9V A;  5FZT A;  1BZ4 A;  4OD4 A;  3DM5 A;  4FWV A;  5A6B D;  2HV6 A;  2JPU A;  2LSE A;  1OR2 A;  1T01 A;  5E3C A;  5KYU B;  4JKV A;  1ORY A;  3KYI A;  4UDV A;  2Q9B A;  4E18 A;  2MYS A;  2RSE B;  2YKZ A;  1LM3 B;  2IOQ A;  1ZHX A;  2A0U A;  2EIK C;  4ULW A;  4AX2 A;  3H2U A;  3PDM P;  2DB4 A;  1QSP A;  4XEF A;  4DRH B;  2W9Y A;  3RVZ A;  3BRJ A;  2B0H A;  4BJ1 A;  5B3I A;  1PV3 A;  2PNO A;  2HKV A;  2DGJ A;  3KPH A;  1OCO C;  1U89 A;  4G0H A;  1O5H A;  5A69 A;  2XXA A;  1D1B A;  1V4A A;  1ZW2 A;  1Z5Z A;  1V54 C;  1A41 A;  2EPK X;  4IAQ A;  1OXB A;  2HMZ A;  1EA8 A;  3FAJ A;  1M56 C;  1S7Z A;  1NFN A;  2P6V A;  2Y39 A;  4ZLC A;  2OEX A;  2YL3 A;  5JRA A;  3GEE A;  4MW8 A;  4ONS A;  3VF0 A;  4IAO A;  2YL1 A;  3SXK A;  4N06 A;  3GOR A;  1M6T A;  3B9Q A;  2KQ9 A;  2BE5 F;  5COF A;  1TKN A;  4KI2 A;  1TFO B;  3JSE O;  4RBN A;  1JR8 A;  1EQ1 A;  5F28 E;  1MNE A;  4N6H A;  4CJO A;  4G7O F;  1SZI A;  1M2V B;  2C04 A;  1R5I D;  3GEH A;  2J9V A;  3LNM B;  4YJW A;  5L0G A;  3LUT B;  3POV A;  2KNH A;  2LFF A;  3U2L A;  3NYL A;  2XM4 A;  1YAR O;  2CDQ A;  1KU2 A;  1M57 C;  1DOV A;  2EIM C;  2QTV A;  4IJJ A;  1TR2 A;  3S28 A;  3EQL F;  3KKB A;  3WG7 C;  1Y6D A;  1NU7 D;  4NTB A;  3VYW A;  1E85 A;  3MFN A;  2A69 F;  1BR4 A;  3EPV A;  5BQG A;  2XLO A;  3GM2 A;  5BUO A;  3LAY A;  1Z63 A;  3UR3 C;  4BJ6 A;  1BR1 A;  4DVY P;  1A7V A;  3KH2 A;  1EI7 A;  4YWQ A;  3FAP B;  4P9F A;  3AQB A;  3ZVR A;  3C62 A;  1SF8 A;  3WOD F;  3U3B A;  3TOM A;  2YVK A;  1OW6 A;  1QZX A;  1Q0M A;  4QDL A;  4XWJ A;  2DI3 A;  5K0I A;  2WZL A;  3UGP A;  4JE9 A;  4LER A;  1S05 A;  2M4E A;  3CQZ A;  3JT1 A;  2MWQ A;  2NUT A;  2Y69 C;  2YZS A;  2D4U A;  3ECS A;  3M1C B;  3EGX A;  3EG9 B;  4BEJ A;  1A0B A;  1MND A;  3JZ0 A;  2HS5 A;  2L6G A;  2X0C A;  5JT4 A;  2L81 A;  2R7T A;  4JCH A;  4LAC B;  5KYX B;  4KNW A;  2IBF A;  2PBE A;  2XL4 A;  2EIJ C;  2YLG A;  2ZXP A;  4DBQ A;  3SXZ A;  3W8I A;  1VLT A;  1ST6 A;  1WAS A;  4U5C E;  4MTO A;  1H9G A;  3Q7L A;  4JEA A;  1NG1 A;  2P1A A;  2OG2 A;  4DJ9 A;  2VCC A;  2R7W A;  3JYY A;  4YL0 A;  4BJT A;  1ZVZ A;  2KK1 A;  2YEV A;  1D0Z A;  3IHU A;  3M15 A;  3G4Z A;  5L0C A;  1YAU O;  2ZXR A;  2QY9 A;  2R9R B;  4C3E A;  4WJ0 A;  2R7U A;  2CYD A;  4C3D A;  1K04 A;  3G50 A;  4YK5 A;  4PFO A;  4YT2 A;  1T6U A;  1FTS A;  2OKU A;  1HW1 A;  1G4W R;  3LES A;  1TFK B;  2AWY A;  1E2X A;  3LEO A;  4LDK A;  5JP7 A;  3TOL A;  1D0Y A;  3K1H A;  1E83 A;  5KYW B;  1BR2 A;  1V55 C;  2NSF A;  2P7V A;  4J7Y A;  5F5H A;  1D0X A;  5JUA A;  1YZC A;  3QZC A;  1I4Y A;  1RMV A;  3LS1 A;  1D1C A;  4ZLD A;  1Q0F A;  2J9B A;  3DJN B;  2G3V A;  4BEM J;  4FES A;  2WL8 A;  2XM0 A;  4J7T A;  3B71 A;  2R02 A;  3U8P A;  2WZF A;  2L7A A;  1HMD A;  3MX3 A;  1W2W A;  3G4X A;  3K6B A;  3C63 A;  2CNW A;  1WOL A;  3US6 A;  3H2V A;  1A7D A;  2EPO A;  2NUT B;  3IEE A;  3K33 A;  2LCH A;  1FMW A;  2LD6 A;  3EGX B;  5JSL A;  1WN0 A;  4U5F E;  3ZIB A;  3NG1 A;  4C7O A;  3KYJ A;  4G7H F;  2QNL A;  1FNT c;  1H7I A;  1TWC A;  1FMV A;  2KYH A;  4DRJ B;  5L0F A;  2P61 A;  2L6F A;  3K66 A;  3AG4 C;  1YA9 A;  1I5N A;  4XTK A;  4Q7C A;  3S27 A;  1BDJ B;  4ANJ A;  1RCP A;  1QQ3 A;  3FXH A;  2OQM A;  1YYX A;  1YDI A;  2HFI A;  2KSF A;  2NUP B;  2WVO A;  2Q3T A;  2NSG A;  3T9O A;  1NBB A;  3C8G A;  1CGM E;  4U5B E;  5DQT A;  4O7G A;  2F22 A;  1LS1 A;  2R03 A;  2W45 A;  2DYR C;  1G8X A;  2XLV A;  3KL4 A;  2LK4 A;  3LS0 A;  4Z9J A;  1WWP A;  4EUK B;  3ITF A;  4EBJ A;  3C8Z A;  1WTY A;  2NG1 A;  4H54 A;  4YL1 A;  2Y3G A;  1GQA A;  2HMQ A;  3SP1 A;  1RXQ A;  5HSW A;  3A11 A;  3NYM A;  1LI5 A;  4C3B A;  3TUL A;  3IQ5 A;  3K7D A;  3O39 A;  4LDQ A;  2HUJ A;  4FAP B;  4W8K A;  1FAP B;  4E7Z A;  4O6Y A;  1NZE A;  2KGO A;  5KYW A;  3WHN A;  3U0C A;  1N1C A;  5L0J A;  4CS8 C;  4K7B A;  2A1D D;  3TD7 A;  3HNL A;  3NKE A;  2JD3 A;  4PR9 A;  2VC9 A;  4DBR A;  2C03 A;  1O3U A;  3EH2 A;  2J7P A;  3EZI A;  4ER9 A;  4CBE A;  1LVK A;  2XS8 A;  1JMW A;  4AK9 A;  1OKK A;  1OW8 A;  2G62 A;  1ORJ A;  5JVE A;  3EGD B;  4WAB A;  3ATP A;  1KTM A;  3JRM O;  3PMR A;  4JRZ A;  1BBH A;  3TK0 A;  1OCC C;  4JC7 A;  4BJ5 A;  2R7Q A;  4N6C A;  2PX3 A;  1YA7 O;  2HZ8 A;  5T3T A;  4C7O B;  3R7C A;  1MMG A;  1Z6A A;  2J0W A;  4OIO F;  2W4B A;  3VAY A;  4IB4 A;  4KBL A;  3DKA A;  4CSA C;  4JZA A;  4E0I A;  1OQC A;  2KJG A;  2R7O A;  1IW7 F;  1C17 M;  2RD9 A;  1Y4C A;  3C8G D;  1FFT C;  3IPM O;  3ZTZ A;  1QPU A;  3F47 A;  3I4U A;  2WB7 A;  3L34 A;  3DE9 A;  3L1M A;  1B68 A;  4Q4Z F;  4MW3 A;  3DWW A;  3O10 A;  3SZR A;  1VTM P;  1E84 A;  1AUE A;  5L0H A;  5BQH A;  4HE8 D;  4A4A A;  5A6J A;  1YZA A;  3U2M A;  1JRA A;  1VYI A;  2M64 A;  3NKD A;  4DVZ A;  3UMK A;  5A6A A;  3A9C A;  4XEK A;  1Z23 A;  2DYS C;  4XPW A;  3HJC A;  1O87 A;  3U9M A;  5GPG B;  4G7Z F;  4OIR F;  4O79 A;  2CGE A;  2H7V C;  1K05 A;  3SYN A;  2XXA B;  1G5Z A;  2V26 A;  3DD7 A;  2FGY A;  3H65 A;  3MYI A;  4CSA A;  1TWA A;  3RW0 A;  3L0I A;  4GEH A;  4MVQ A;  3IQ6 A;  1J8Y F;  3AGT A;  3GM3 A;  3SXM A;  3X2Q C;  1EKY A;  3NMJ A;  3W2V A;  4OIP F;  3UGO A;  1FR0 A;  2QE9 A;  2J7P D;  4P6I C;  1YJG A;  3FMS A;  2V3C C;  2XL8 A;  3PCV A;  2ZXO A;  3E70 C;  2D5R B;  3DJU B;  1LE4 A;  1LPE A;  5COM A;  5KYY A;  1PD0 A;  1I4Z A;  4U5H A;  4W8P A;  3RYL A;  2XSE A;  4O6M A;  3GOD A;  3IQC A;  3UMI A;  3ZDL A;  2AU5 A;  2PFD A;  3FOO A;  3DXJ F;  1WAT A;  2AWC A;  3O6X A;  4DXW A;  4IRU A;  4NQF A;  1ZHT A;  2OJE D;  2R7X A;  2R7R A;  1VYK A;  2L6H A;  3V5Z A;  3FDQ A;  5AC5 A;  4EIY A;  2OJQ A;  2AP3 A;  3BEH A;  4DRI B;  1OXK A;  4E0H A;  1C03 A;  2YHS A;  5E3A A;  1APC A;  3HLZ A;  1YYJ A;  2J45 A;  3UMH A;  2XS1 A;  4JVS A;  4NCQ A;  4YT5 A;  2PX0 A;  1YLM A;  3ABM C;  3Q7G A;  5CI8 A;  2EIN C;  5E2Q A;  5AC4 A;  4CDY A;  1C02 A;  4QI2 A;  1JOG A;  3KMI A;  1OW7 A;  1UFB A;  5CI9 A;  2HSQ A;  3SXY A;  2Q9A A;  1HE9 A;  3M4C A;  1LI7 A;  2R25 A;  5EK0 A;  1VMA A;  4NC3 A;  3MYF A;  3JTL O;  3RIP A;  2A6E F;  2GAQ A;  2CW0 F;  3RVY A;  1HE1 A;  3N24 A;  2R7S A;  3S84 A;  4I44 A;  1TWG A;  3DZA A;  1M2V A;  1HMO A;  5L0D A;  2FFH A;  4WGY A;  4PJM A;  3LEV A;  5L3V A;  2JX0 A;  2L9J A;  4BJ6 C;  2UUI A;  3GAN A;  4GYT A;  4IWB A;  2LFD A;  4R32 A;  1XZQ A;  4JIO A;  1VK5 A;  4MVZ A;  3U8V A;  3GWN A;  3R2P A;  2XLW A;  4MVU A;  4MTF A;  5L3Q A;  1V74 B;  1PCX A;  1HY5 A;  4B6I A;  5KYN A;  1VOM A;  1YVI A;  2VB6 A;  2HJ3 A;  1H9T A;  2VH3 A;  3V5X A;  3EFO B;  2R7V A;  1F1M A;  1ZHW A;  2Q4F A;  1GM5 A;  1T9K A;  2FAP B;  3C18 A;  1FFH A;  1ORS C;  2QLA A;  2J46 A;  4MTG A;  5DVW A;  2XLD A;  4RDA A;  2XLH A;  3QW1 A;  3HKK A;  4U5E E;  4XPX A;  1AVO B;  2YL7 A;  4D4N A;  4CDA A;  2IXN A;  5JLI A;  2VCA A;  3QMK A;  1OKK D;  1Q0G A;  4K0D A;  4M63 A;  4ULV A;  2O9X A;  3ZTM A;  1DOW A;  5A6K A;  1RKE A;  4KC9 A;  2IXP A;  4MVM A;  1PD1 A;  1Q0D A;  2UUH A;  2VCB A;  3RQE A;  4DOZ A;  3EG9 A;  4YL3 A;  5DQZ A;  3ABK C;  3B0U X;  4CS8 A;  5DS5 A;  4N4W A;  2HJM A;  3W4Y A;  4JTD B;  5D92 A;  5KYX A;  4F4B A;  5EGY A;  4OIQ F;  1L3P A;  4HFF B;  2BC5 A;  1R4T A;  4Z9H A;  1UG7 A;  5JS5 A;  5L0I A;  4J32 B;  1ZYR F;  1CPQ A;  256B A;  2IYL D;  2J8W A;  3FHD A;  5B3S C;  1IZM A;  3JCU Q;  1L7C A;  3CAX A;  1RJ9 B;  2XLE A;  2YQY A;  5T3W A;  1H6G A;  1MMA A;  2P0N A;  3W8H A;  3M79 A;  2J0X A;  2OCC C;  3EHN A;  1JAF A;  5D91 A;  3SEO A;  3TJ5 A;  2KW3 C;  3U5S A;  3CEX A;  2ZD9 A;  5FCL A;  4JW1 A;  2A68 F;  4H4K C;  1VB5 A;  4NTA A;  2IM8 A;  1ZHZ A;  3AJM A;  3DM9 B;  3ASO C;  1T5O A;  3JSZ A;  2Y3B A;  3S0X A;  2NPU A;  1OCZ C;  3EZH A;  3L8J A;  2XL6 A;  3N2Z B;  4PK4 A;  1NU9 C;  3HNK A;  3DMD A;  5TJ5 E;  3V5Y A;  2QUP A;  1OR3 A;  4XLP F;  2Y3D A;  2VAS A;  3VRC A;  3RQF A;  1SMY F;  3T4R A;  4E17 A;  4LLC A;  2W4M A;  2WVQ A;  4CDV A;  4XPY A;  2LIG A;  3F46 A;  3O55 A;  4KNV A;  2ZPA A;  3EFO A;  2A6H F;  3HNI A;  3MLG A;  4AE4 A;  1Z7Q c;  2Y3H A;  3K1I A;  3OA1 A;  3PHF 2;  4CS9 A;  4U9E A;  1WGW A;  4BG0 A;  1HW2 A;  3ZQV A;  2AVK A;  4PAC A;  1TQG A;  2Q00 A;  3DAF A;  3LNR A;  3NYJ A;  4HFK B;  3Q6N A;  2CNW D;  3GEI A;  3T6J A;  1GS9 A;  1GGQ A;  5BQI A;  3B29 A;  3QVY A;  2E87 A;  3ABL C;  3JYH A;  4XEV A;  1RKC A;  2Q7R A;  2YL0 A;  3X1O A;  2IXM A;  3J06 A;  4JEB A;  1VLS A;  3I5P A;  3NMI A;  2TMV P;  1RKE B;  3GM1 A;  2XLM A;  4GQH A;  3VM6 A;  4EBB A;  3L8I A;  4NTF A;  4MND A;  2EIL C;  2YLI A;  1MQV A;  4RD9 A;  4I1O B;  3HNJ A;  2YWA A;  2OOC A;  3K1I C;  5T1D B;  3NRH A;  3FVY A;  4EWC A;  2YLD A;  4LDR A;  2GA0 A;  4E7S A;  2EPN A;  3AOU A;  1NLX A;  3T6G B;  1J8M F;  2PP4 A;  3S9O A;  2NUP A;  1RJ9 A;  1ZU4 A;  3ZC4 A;  4MVO A;  3RQG A;  1CGN A;  2GWW A;  4CS9 C;  4I1M A;  3NMK A;  3LJB A;  5E33 A;  3C8G B;  1ZU5 A;  4NY3 A;  3I5Q A;  5COG A;  2R05 A;  3T6B A;  2OU6 A;  4A2N B;  4Q5S F;  1JPJ A;  4I3M A;  1A7E A;  2ASR A;  1XZP A;  4IGG A;  3RH3 A;  3AQC A;  1Z3I X;  1Q0K A;  4L6R A;  2CCY A;  3JRT A;  2Z15 A;  3LLK A;  3QVZ A;  4AL1 A;  4CJG A;  1CPR A;  4P9T A;  2YRF A;  4QI0 A;  4YT4 A;  1JPN A;  3EJN A;  5AGF A;  2I15 A;  3N0T A;  1E86 A;  2XRH A;  3WAQ A;  1K40 A;  4Z9I A;  4CIH A;  3B0V C;  2GFH A;  2H7B A;  3U3F A;  2Q9C A;  4AE4 B;  1D1A A;  4OD5 A;  1G4U S;  2B0J A;  2LQG A;  3M4B A;  4XQ1 A;  1XWJ A;  2LP4 A;  3EGD A;  1NSG B;  4OIN F;  5F5F A;  4JUR I;  5B1A C;  4MS2 A;  4PJL A;  3LLI A;  3OWT A;  2A0B A;  5DLJ A;  5IY5 C;  3SNH A;  3TJ6 A;  4FX5 A;  5A6B A;  5KYU A;  3UNG C;  2J9W A;  1QKR A;  1M2O A;  3QTH A;  1CGO A;  5HV9 A;  3DE8 A;  3MBG A;  3ZQY A;  1MMN A;  2WZG A;  4IAR A;  3U9J A;  3GWL A;  3S90 A;  3AG1 C;  3HTK C;  4K1O A;  4U5D E;  3DI5 A;  3FOP A;  4JJF A;  4PFP A;  2BL2 A;  3ASN C;  1KNY A;  2GDC A;  3RF3 A; 
#chains in the Genus database with same CATH homology
 2BC5 A;  5JS5 A;  4JEA A;  1E84 A;  1CPQ A;  256B A;  2J8W A;  1YZA A;  2XLE A;  4CX9 A;  3M79 A;  1JAF A;  3M15 A;  4U9D A;  3QW0 A;  4D4X A;  3IQ6 A;  2XL6 A;  3HNK A;  3ZWI A;  1EKY A;  4CIP A;  3VRC A;  3NMJ A;  3TOL A;  5JP7 A;  1E83 A;  5JUA A;  4CDV A;  1YZC A;  4WGZ A;  2XL8 A;  3HNI A;  2J9B A;  4U9E A;  3ZQV A;  2XM0 A;  3U8P A;  3QVY A;  4JKV A;  3C63 A;  3FOO A;  2YKZ A;  1LM3 B;  2YL0 A;  4JEB A;  3NMI A;  5JSL A;  2XLM A;  4EIY A;  5B3I A;  2YLI A;  1MQV A;  1APC A;  3HNJ A;  1RCP A;  1YYJ A;  1QQ3 A;  2YLD A;  1YYX A;  4IAQ A;  4CDY A;  1NBB A;  1CGN A;  3M4C A;  2YL3 A;  5JRA A;  4NC3 A;  2XLV A;  2YL1 A;  1M6T A;  1GQA A;  4N6H A;  4CJO A;  4WGY A;  3IQ5 A;  4L6R A;  2CCY A;  3QVZ A;  4CJG A;  1CPR A;  2XM4 A;  5AGF A;  2XLW A;  1E86 A;  3HNL A;  1E85 A;  2XLO A;  4ER9 A;  3M4B A;  1A7V A;  5JVE A;  2QLA A;  3C62 A;  2XLD A;  2XLH A;  3QW1 A;  3TOM A;  1BBH A;  2YL7 A;  4D4N A;  4CDA A;  4JE9 A;  1S05 A;  5JLI A;  1CGO A;  3DE8 A;  3ZQY A;  4ULV A;  3ZTM A;  4IB4 A;  5JT4 A;  4IAR A;  2YLG A;  4N4W A;  3ZTZ A;  3FOP A;  1QPU A;  3NMK A;  3DE9 A;  3L1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...