3FOPA

A triangular cytochrome b562 superstructure mediated by ni coordination - hexagonal form
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMCDFAAGFHILVGQIDDALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A superprotein triangle driven by nickel(II) coordination: exploiting non-natural metal ligands in protein self-assembly.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
molecule keywords Soluble cytochrome b562
total genus 46
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3fopA00
2YLGA 3HNLA 1E86A 4U9DA 4JEAA 2XL6A 1S05A 256BA 3C62A 4CJGA 3NMKA 2XLMA 4WGZA 1QQ3A 1LM3B 3M15A 3L1MA 5JRAA 3ZQVA 3DE9A 3VRCA 1YYJA 4JE9A 4U9EA 1APCA 2YL7A 4CDAA 1QPUA 3U8PA 4D4NA 5JT4A 1E84A 4N6HA 4CX9A 4ER9A 2YLIA 3NMJA 1E83A 1CGNA 4L6RA 3HNJA 3NMIA 5JUAA 5AGFA 1EKYA 5JVEA 3ZTMA 1A7VA 5B3IA 2J8WA 1YZAA 5JP7A 3ZQYA 3M4CA 3QW1A 3HNIA 2YL0A 1NBBA 2XLDA 2XLVA 3FOPA 4CDVA 2XLHA 4CIPA 1RCPA 1YYXA 4JEBA 2XLEA 4ULVA 2QLAA 4CDYA 4N4WA 1BBHA 1YZCA 2CCYA 1M6TA 2XLOA 2YLDA 4CJOA 3DE8A 4WGYA 3C63A 2YL3A 3IQ6A 3M4BA 3ZWIA 3QVZA 1E85A 2YL1A 4EIYA 4D4XA 5JS5A 3TOLA 2XM0A 1CPQA 1JAFA 3TOMA 5JSLA 2J9BA 3M79A 2YKZA 2XLWA 2XL8A 3HNKA 4IAQA 3FOOA 1GQAA 5JLIA 1CGOA 4IB4A 1CPRA 4NC3A 3ZTZA 2BC5A 3QW0A 3IQ5A 3QVYA 1MQVA 4IARA 2XM4A 4JKVA
chains in the Genus database with same CATH superfamily
2YLGA 5KYXA 1VLSA 2XLMA 4WGZA 1MMGA 5L0IA 3LLIA 4E7SA 1QQ3A 1TKNA 2VASA 1C02A 2XXAB 3F47A 4U5HA 3OWTA 1B68A 1LM3B 4O6YA 5KYUA 4I3MA 3VM6A 1TFKB 5JRAA 3EQLF 3RQFA 2R7SA 2HKVA 2P61A 4J30B 3I4UA 3RQGA 3V5ZA 2HUJA 1G4US 4ZLDA 3QZCA 3VYWA 5F5HA 2EILC 1I4ZA 4NY3A 3JYYA 2V3CC 3PHF2 4H54A 3U8PA 1WTYA 1YDIA 3PCVA 4PJJA 2EPLX 1RKEA 3DAFA 2XSEA 2HMQA 2GA0A 3A9CA 3KH2A 3B0UX 2AWYA 2O9XA 1HW1A 4E0HA 2CYDA 2CW0F 4YJWA 4JZAA 1Z6AA 3MYIA 1ZW3A 3C8GB 4WABA 5B1AC 2Y39A 4BEMJ 2L6HA 3L8JA 1TWCA 2LIGA 3AGUA 5D92A 4YT5A 4G7ZF 2KC3A 3EH1A 3UMHA 3HNJA 2R7OA 3O55A 2Q3TA 5AGFA 2C03A 3ABKC 2WZGA 2NG1A 3SXKA 4CBEA 3CEXA 2A6HF 2IXNA 2VCBA 5DS4A 5JVEA 2ZXWC 3DMDA 4MVOA 3AOUA 5CIVA 1L7CA 1Q0KA 1A7VA 2KW3C 4P9TA 4F4BA 5A69A 5KYWA 3DXJF 2OQMA 1OCCC 1BDJB 2J8WA 2Y3HA 3IQTA 4ZLCA 3GANA 5GPGB 3FMSA 1H9GA 1XZQA 4X0RA 5DVWA 3SYNA 3TJ5A 2YL0A 4JCHA 2CNWD 1NBBA 1RJ9A 1OXBA 1RXQA 5COMA 5DS6A 5HSWA 4JC7A 4JTAB 4DXWA 2R7UA 2A0BA 3LNMB 3MX3A 2A1DD 2DYSC 2QNLA 2Y3BA 2YHSA 4ULVA 4NCQA 5L0CA 2R7XA 4CDYA 2P7VA 4AK9A 4N4WA 2Y3GA 3L0IA 1N1CA 2JD3A 1PCXA 3B9QA 3ZDLA 4AL1A 3AJMA 1JOGA 3NYLA 4XLPF 2FFHA 2P1AA 2XLOA 5CI9A 3G4XA 2A69F 2PX0A 3M1CB 4IGGA 3AGTA 3AQBA 2YEVA 1FMVA 3LUTB 3M4BA 4YT2A 3FXHA 2VB6A 1EQ1A 1VYIA 1ST6A 4KNWA 2DI3A 3KL4A 4QI0A 2QY9A 3S9OA 3JZ0A 4U5DE 1C17M 2W4MA 1SMYF 1OXKA 3EFOA 3LJBA 4D4XA 4EIYA 5EHHA 1IW7F 4PK4A 5JS5A 1CPQA 1LI5A 3SP1A 3A11A 3U2LA 5HV9A 4CSAC 1QSPA 4WJ0A 4YK5A 5JSLA 2J45A 1YLMA 5B3SC 3SXZA 3C8GA 2XS8A 2H8AA 4JVSA 1W2WA 2PF4E 3DM9B 3KMIA 4K7BA 4KBLA 3L8IA 3TJ6A 2A0UA 1ZYRF 5CI8A 3G50A 4MW3A 4CIHA 1RKEB 4Q5SF 2OJED 1YA7O 2ICWG 2PNOA 2ASRA 1NG1A 4J7TA 4AX2A 4MNDA 1PD1A 4YT4A 4I44A 1J8YF 2ETSA 2OJQA 1LI7A 2J46A 4Q4ZF 5EGYA 3ABMC 5D91A 4GEHA 4XPWA 3RQEA 3G4ZA 1ZZPA 2WB7A 4IARA 4BJ5A 3POVA 1SF8A 2IXOA 2HMZA 2QUPA 1Z5ZA 2XM4A 4NTAA 4RDAA 1QVXA 4GYTA 1H9TA 2YVKA 1Q0DA 2Q00A 1TR2A 2XL6A 4G78A 1S05A 1DOWA 1JPJA 1PD0A 3N0TA 4JEAA 3GEEA 3C8ZA 4YL3A 4CJGA 4DOZA 1LIHA 3JRMO 2HSBA 1V74B 4W8KA 4OIOF 1Z3IX 4Q7CA 3Q7LA 2L6GA 1K05A 1D1AA 1WWPA 4XEVA 4JTCB 3W2WA 2H7BA 1T9KA 3ZIBA 4A2NB 2X0CA 1FR0A 4G7OF 2Z15A 1APCA 4HEAJ 5BQGA 2Q4FA 2LSEA 1XZPA 1HMOA 2OKUA 2HJ3A 1HY5A 3LLKA 3NKEA 4D4NA 5IY5C 5JT4A 1E84A 2AVKA 1K04A 1FTSA 2WZFA 3SXMA 3ASNC 1LPEA 2HV7A 4DVZA 4CS8C 4CX9A 2C04A 3I5QA 2IBFA 5T3TA 5A6BD 2DB4A 3TULA 1WOLA 4LLCA 4O7GA 4AL0A 3US6A 2R7VA 3U3FA 1CGNA 3NRHA 4JRZA 3PDMP 3B0VC 4PJNA 4JJGA 1Q0MA 1V54C 3IEEA 3HTKC 3LESA 5BUOA 3HJCA 5JUAA 2R7TA 5KYNA 2DGJA 1FFHA 2J9VA 2L6FA 4JW1A 2W9YA 1WASA 2GFHA 4E18A 2I15A 4BPMA 1QKRA 3SXYA 3MFNA 1YZAA 3GWLA 4LACB 4CSAA 3NYMA 3EG9B 4PR9A 1UG7A 3DJNB 4LERA 3QW1A 2L81A 4U5EE 1HMDA 3Q6NA 2LFDA 3T9OA 1Y6DA 1VB5A 1OCOC 2LP4A 2WL8A 2XLDA 2XLVA 3E70C 3FOPA 1M56C 3SZRA 1SYQA 3H2UA 4JEBA 1D0XA 2R9RB 2XLEA 1FNTc 1DOVA 3V7OA 3JYHA 1ORSC 2AU5A 4E17A 1C03A 3V5YA 3B71A 1BBHA 1G4WR 1MMAA 2LK4A 4LDKA 1HE9A 4EHPA 1MNDA 3IHUA 1YZCA 4XQ1A 2MHRA 3ZVRA 2J7PD 3NDBB 2BL2A 3EGXB 1J8MF 2KYHA 3EHMA 2Q9BA 3QVZA 2IYLD 5COFA 3U2MA 1Y4CA 1LS4A 1YAUO 3GEIA 1WATA 3O10A 2CDQA 1E85A 1Z7Qc 1LKXA 4DBQA 4FWVA 2Y3DA 2VC9A 3GORA 3S90A 1AUEA 2IXPA 3EFOB 2YWAA 3UNGC 4K0DA 3GM1A 1AVOB 1V4AA 4C3DA 2OEVA 4PFOA 1I5NA 1M57C 2D4UA 4IAOA 4U5CE 3UMKA 4EBKA 3EHNA 1H7IA 1Z23A 3FVYA 3CAXA 4IWBA 2PBEA 2R02A 3FAJA 3RKOF 3WHNA 1Z63A 3VAYA 1EI7A 2CGEA 2GWWA 2RD9A 3EGDA 4CS9C 1H6GA 3L34A 3R7CA 3DAGA 2X51A 1FAPB 5KYYB 3UGPA 2J0XA 2WVNA 2GDCA 3AG2C 1RMVA 1OCRC 3ASOC 1AEPA 2J9WA 2XL8A 4JURI 3JTLO 4IAQA 2UUIA 3RH3A 3DWWA 1GQAA 1G8XA 1CGOA 1CPRA 1A7DA 1GGQA 2LFFA 4OIQF 3TD7A 1ZW2A 2KQ9A 4DJ9A 2NSGA 4JIOA 2HV6A 3K66A 3GWNA 3GM2A 4IJJA 5AC5A 3B29A 1OCZC 2B0JA 1L3PA 1E86A 1YARO 4O6MA 4MTOA 4C7OA 5F28E 2AWCA 1O5HA 2VH3A 2KJGA 5L0DA 5KYWB 1A0BA 2FGYA 3KYJA 3ZG1A 2IM8A 3RIPA 5FCLA 1D1CA 1HE1A 4DBRA 2ZXOA 2OOCA 4U5GA 4JJFA 4KI2A 1Q0GA 3U0CA 3RF3A 1FFTC 3KPHA 1VOMA 4CDAA 2FAPB 4NQFA 2EINC 4FAPB 4YWQA 2MWQA 3AG3C 2R7WA 3F46A 5A6KA 1O87A 1QPUA 3NG1A 1QLEC 3W8IA 3SNHA 3CQZA 4N6HA 3HLZA 1NLXA 1VYKA 4EKWA 2QE9A 1TQGA 1ORJA 2OCCC 1TWAA 2QTVA 3T4RA 4MQ9F 3RYLA 5L0JA 2I8BA 1ZHWA 4OIPF 4I1OB 2HFIA 1E83A 2L9JA 3GODA 2NUTA 3W8HA 5DQZA 3N2ZB 5DLJA 1U0BB 3N24A 4DRIB 4LLEA 1F1MA 2G3VA 3U8VA 1UFBA 4LDRA 1RJ9B 1YVIA 2OEXA 4YT8A 1OW7A 1QZXA 2G62A 3K6BA 3CSKA 4HFFB 2M4EA 1U89A 2W45A 4BJ6C 1WN0A 5B3IA 2KSFA 2BE5F 1LE4A 4MVRA 3OEOA 2PFDA 4U5FE 1TWHA 3U5SA 4R32A 3X2QC 4EUKB 5T3WA 4G7HF 4OD5A 5BQIA 1EA8A 3U9MA 5BQHA 4CDVA 1BR2A 2EIMC 2RSEB 4NTBA 4CIPA 1SR2A 1TFOB 4N6CA 1YYXA 3RVZA 3LEOA 5KYUB 1K40A 2QLAA 5E33A 1T6UA 2E87A 1T6IA 4JCZA 4YL1A 3EGDB 4XPYA 1MMDA 2YRFA 4JTDB 3DZAA 1O3UA 3JCUQ 1M6TA 1JRAA 2YLDA 3S28A 5L3VA 4W8PA 1KU2A 1M2OA 1VLTA 2ZXRA 3C63A 3IQ6A 3Q7GA 3S27A 1NSGB 2EPMX 3K33A 3UMIA 2XXAA 3AG1C 3EJNA 2A68F 4YN0B 4MVZA 4CS7A 3AG4C 2WVOA 2KGOA 4MVUA 4ONSA 3X1OA 4BJ5C 2D5RB 2XS1A 4E0IA 2CNWA 4LDQA 3EH2A 3TOLA 2XM0A 1JAFA 4MS2A 5B1BC 1LS1A 1D0YA 3W2VA 3JSEO 2A6EF 4EWCA 1XWJA 2EPKX 2WZLA 1OKKD 2PP4A 3LNRA 2J9BA 2H7OA 2LQGA 3WODF 1ORYA 4DRJB 3EG9A 4BJ1A 4PACA 3ITFA 4NTFA 1WGWA 3RFYA 1R4TA 3MBGA 2EPOA 1S7ZA 4KNVA 3S84A 4C7OB 4MTGA 1KTMA 5DQTA 4G0HA 4IB4A 3C18A 5COGA 4NC3A 3ZTZA 1GM5A 2XL4A 5F5FA 3TK0A 4PFPA 4K1OA 3S0XA 1NFNA 3C7JA 3QW0A 3IQ5A 3LAYA 4H4KC 1BR1A 2J7PA 4HFKB 1JMWA 4XTKA 4P6IC 4CS8A 5EK0A 3U3BA 3U9JA 4C3BA 1JPNA 1U6HA 2J0WA 4JKVA 1JR8A 3HNLA 1E2XA 4XEKA 4XWJA 4U9DA 3JRTA 4KC9A 4O79A 1ZHZA 256BA 3C62A 2IXMA 2R03A 3NMKA 1CGME 1TWGA 3K1IA 3AQCA 4MVQA 1NZEA 3M15A 3L1MA 1IZMA 3FAPB 4IRUA 4QI2A 3B0PA 2LCHA 2R7RA 3ZQVA 3DE9A 2ZPAA 1OQCA 3VRCA 4Z9HA 1YYJA 4JE9A 3T6BA 2JPUA 3T6JA 4U9EA 1ZHTA 3ECSA 3WAQA 2YL7A 3E9VA 4E7ZA 2HSQA 5DS5A 2JX0A 3EPVA 2VCCA 3BEHA 4GQHA 1RKCA 2EIJC 3S29A 2KNHA 1KNYA 4ER9A 2TMVP 2YLIA 1HW2A 3DI5A 3NMJA 4MVSA 4OD4A 5TJ5E 1Q0FA 5K0IA 3DM5A 3O6XA 2ZD9A 3K1IC 3J06A 4HE8D 4PJLA 4MTFA 4BG0A 1OR2A 2NSFA 2Y69C 4Z9JA 1R5ID 1NU7D 3C8GD 1M2VA 4BEJA 1OKKA 1FMWA 2PX3A 4L6RA 2M64A 5A6BA 2KK1A 3UR3C 3WG7C 3NMIA 3QTHA 4UDVA 1NFOA 3JSZA 4A4AA 4MW8A 4PJMA 1EKYA 2R7QA 4XLNF 2J9UA 3NYJA 2P0NA 3LS1A 1YA9A 4J7YA 2GAQA 3ZTMA 3LEVA 4BJ6A 1ZHXA 4ANJA 3JT1A 5E3CA 4EBJA 1OR3A 3H2VA 4B6IA 5L0FA 1ZU5A 2F22A 5JP7A 3ZQYA 3EZHA 3M4CA 2DYRC 1BZ4A 3MLGA 4RBNA 3DD7A 2AP3A 3R2PA 3IPMO 3HNIA 1MNEA 1VMAA 4OINF 1VK5A 4Z9IA 1D0ZA 5KYXB 1LE2A 1GS9A 2XLHA 3EGXA 1RCPA 3PMRA 2IOQA 3DJUB 3QMKA 4OIRF 4MVMA 2UUHA 3TQOA 3ZSUA 2R25A 2YZSA 3SEOA 1M2VB 2MYSA 4XPXA 2L7AA 3ZC4A 2XRHA 2G3KA 2Q9CA 4CS9A 3K7DA 3FHDA 4EBBA 2WVQA 3DKAA 3OA1A 3RVYA 1VTMP 1PV3A 2P6VA 3V5XA 2CCYA 1SZIA 3Q6MA 2NUPB 4CJOA 2EPNA 3DE8A 3O39A 4WGYA 5E3AA 2YL3A 2OG2A 3ZWIA 1ZU4A 2HS5A 2NUTB 3ABLC 4I1MA 4RD9A 5E2QA 1OW8A 2NPUA 2V26A 4M63A 1OW6A 3GM3A 3W4YA 3K1HA 2YL1A 1T5OA 3KKBA 3IQCA 4YL0A 2B0HA 4ULWA 1YJGA 3GEHA 1LVKA 3RW0A 2YQYA 2VCAA 5A6AA 1V55C 3FDQA 4N06A 4DVYP 4AE4B 3CZ6A 4J32B 1ZHYA 3TOMA 4C3EA 5L0HA 1G5ZA 2HJMA 2EIKC 1MMNA 3EZIA 2Q7RA 3H65A 2W4BA 4XEFA 3MYFA 1D1BA 4P9FA 2ZXPA 3ATPA 3M79A 1NU9C 5KYYA 3LS0A 4O6NA 1A7EA 1BR4A 2R05A 2OU6A 2YKZA 3UGOA 4QDLA 2LD6A 3KYIA 4U5BE 4AE4A 4DRHB 2XLWA 3HNKA 5T1DB 3FOOA 5L0GA 2HZ8A 5JLIA 5L3QA 4FESA 3VF0A 2BC5A 3I5PA 1T6QA 2Q9AA 3NKDA 4FX5A 4BJTA 1I4YA 5A6JA 3QVYA 1MQVA 5AC4A 3HKKA 2H7VC 3BRJA 1A41A 5FZTA 3T6GB 1T01A 1ZVZA 2NUPA
chains in the Genus database with same CATH topology
2YLGA 3HNLA 1E86A 4U9DA 4JEAA 2XL6A 1S05A 256BA 3C62A 4CJGA 3NMKA 2XLMA 4WGZA 1QQ3A 1LM3B 3M15A 3L1MA 5JRAA 3ZQVA 3DE9A 3VRCA 1YYJA 4JE9A 4U9EA 1APCA 2YL7A 4CDAA 1QPUA 3U8PA 4D4NA 5JT4A 1E84A 4N6HA 4CX9A 4ER9A 2YLIA 3NMJA 1E83A 1CGNA 4L6RA 3HNJA 3NMIA 5JUAA 5AGFA 1EKYA 5JVEA 3ZTMA 1A7VA 5B3IA 2J8WA 1YZAA 5JP7A 3ZQYA 3M4CA 3QW1A 3HNIA 2YL0A 1NBBA 2XLDA 2XLVA 3FOPA 4CDVA 2XLHA 4CIPA 1RCPA 1YYXA 4JEBA 2XLEA 4ULVA 2QLAA 4CDYA 4N4WA 1BBHA 1YZCA 2CCYA 1M6TA 2XLOA 2YLDA 4CJOA 3DE8A 4WGYA 3C63A 2YL3A 3IQ6A 3M4BA 3ZWIA 3QVZA 1E85A 2YL1A 4EIYA 4D4XA 5JS5A 3TOLA 2XM0A 1CPQA 1JAFA 3TOMA 5JSLA 2J9BA 3M79A 2YKZA 2XLWA 2XL8A 3HNKA 4IAQA 3FOOA 1GQAA 5JLIA 1CGOA 4IB4A 1CPRA 4NC3A 3ZTZA 2BC5A 3QW0A 3IQ5A 3QVYA 1MQVA 4IARA 2XM4A 4JKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YLG A;  3HNL A;  1E86 A;  4U9D A;  4JEA A;  2XL6 A;  1S05 A;  256B A;  3C62 A;  4CJG A;  3NMK A;  2XLM A;  4WGZ A;  1QQ3 A;  1LM3 B;  3M15 A;  3L1M A;  5JRA A;  3ZQV A;  3DE9 A;  3VRC A;  1YYJ A;  4JE9 A;  4U9E A;  1APC A;  2YL7 A;  4CDA A;  1QPU A;  3U8P A;  4D4N A;  5JT4 A;  1E84 A;  4N6H A;  4CX9 A;  4ER9 A;  2YLI A;  3NMJ A;  1E83 A;  1CGN A;  4L6R A;  3HNJ A;  3NMI A;  5JUA A;  5AGF A;  1EKY A;  5JVE A;  3ZTM A;  1A7V A;  5B3I A;  2J8W A;  1YZA A;  5JP7 A;  3ZQY A;  3M4C A;  3QW1 A;  3HNI A;  2YL0 A;  1NBB A;  2XLD A;  2XLV A;  3FOP A;  4CDV A;  2XLH A;  4CIP A;  1RCP A;  1YYX A;  4JEB A;  2XLE A;  4ULV A;  2QLA A;  4CDY A;  4N4W A;  1BBH A;  1YZC A;  2CCY A;  1M6T A;  2XLO A;  2YLD A;  4CJO A;  3DE8 A;  4WGY A;  3C63 A;  2YL3 A;  3IQ6 A;  3M4B A;  3ZWI A;  3QVZ A;  1E85 A;  2YL1 A;  4EIY A;  4D4X A;  5JS5 A;  3TOL A;  2XM0 A;  1CPQ A;  1JAF A;  3TOM A;  5JSL A;  2J9B A;  3M79 A;  2YKZ A;  2XLW A;  2XL8 A;  3HNK A;  4IAQ A;  3FOO A;  1GQA A;  5JLI A;  1CGO A;  4IB4 A;  1CPR A;  4NC3 A;  3ZTZ A;  2BC5 A;  3QW0 A;  3IQ5 A;  3QVY A;  1MQV A;  4IAR A;  2XM4 A;  4JKV A; 
#chains in the Genus database with same CATH topology
 2YLG A;  5KYX A;  1VLS A;  2XLM A;  4WGZ A;  1MMG A;  5L0I A;  3LLI A;  4E7S A;  1QQ3 A;  1TKN A;  2VAS A;  1C02 A;  2XXA B;  3F47 A;  4U5H A;  3OWT A;  1B68 A;  1LM3 B;  4O6Y A;  5KYU A;  4I3M A;  3VM6 A;  1TFK B;  5JRA A;  3EQL F;  3RQF A;  2R7S A;  2HKV A;  2P61 A;  4J30 B;  3I4U A;  3RQG A;  3V5Z A;  2HUJ A;  1G4U S;  4ZLD A;  3QZC A;  3VYW A;  5F5H A;  2EIL C;  1I4Z A;  4NY3 A;  3JYY A;  2V3C C;  3PHF 2;  4H54 A;  3U8P A;  1WTY A;  1YDI A;  3PCV A;  4PJJ A;  2EPL X;  1RKE A;  3DAF A;  2XSE A;  2HMQ A;  2GA0 A;  3A9C A;  3KH2 A;  3B0U X;  2AWY A;  2O9X A;  1HW1 A;  4E0H A;  2CYD A;  2CW0 F;  4YJW A;  4JZA A;  1Z6A A;  3MYI A;  1ZW3 A;  3C8G B;  4WAB A;  5B1A C;  2Y39 A;  4BEM J;  2L6H A;  3L8J A;  1TWC A;  2LIG A;  3AGU A;  5D92 A;  4YT5 A;  4G7Z F;  2KC3 A;  3EH1 A;  3UMH A;  3HNJ A;  2R7O A;  3O55 A;  2Q3T A;  5AGF A;  2C03 A;  3ABK C;  2WZG A;  2NG1 A;  3SXK A;  4CBE A;  3CEX A;  2A6H F;  2IXN A;  2VCB A;  5DS4 A;  5JVE A;  2ZXW C;  3DMD A;  4MVO A;  3AOU A;  5CIV A;  1L7C A;  1Q0K A;  1A7V A;  2KW3 C;  4P9T A;  4F4B A;  5A69 A;  5KYW A;  3DXJ F;  2OQM A;  1OCC C;  1BDJ B;  2J8W A;  2Y3H A;  3IQT A;  4ZLC A;  3GAN A;  5GPG B;  3FMS A;  1H9G A;  1XZQ A;  4X0R A;  5DVW A;  3SYN A;  3TJ5 A;  2YL0 A;  4JCH A;  2CNW D;  1NBB A;  1RJ9 A;  1OXB A;  1RXQ A;  5COM A;  5DS6 A;  5HSW A;  4JC7 A;  4JTA B;  4DXW A;  2R7U A;  2A0B A;  3LNM B;  3MX3 A;  2A1D D;  2DYS C;  2QNL A;  2Y3B A;  2YHS A;  4ULV A;  4NCQ A;  5L0C A;  2R7X A;  4CDY A;  2P7V A;  4AK9 A;  4N4W A;  2Y3G A;  3L0I A;  1N1C A;  2JD3 A;  1PCX A;  3B9Q A;  3ZDL A;  4AL1 A;  3AJM A;  1JOG A;  3NYL A;  4XLP F;  2FFH A;  2P1A A;  2XLO A;  5CI9 A;  3G4X A;  2A69 F;  2PX0 A;  3M1C B;  4IGG A;  3AGT A;  3AQB A;  2YEV A;  1FMV A;  3LUT B;  3M4B A;  4YT2 A;  3FXH A;  2VB6 A;  1EQ1 A;  1VYI A;  1ST6 A;  4KNW A;  2DI3 A;  3KL4 A;  4QI0 A;  2QY9 A;  3S9O A;  3JZ0 A;  4U5D E;  1C17 M;  2W4M A;  1SMY F;  1OXK A;  3EFO A;  3LJB A;  4D4X A;  4EIY A;  5EHH A;  1IW7 F;  4PK4 A;  5JS5 A;  1CPQ A;  1LI5 A;  3SP1 A;  3A11 A;  3U2L A;  5HV9 A;  4CSA C;  1QSP A;  4WJ0 A;  4YK5 A;  5JSL A;  2J45 A;  1YLM A;  5B3S C;  3SXZ A;  3C8G A;  2XS8 A;  2H8A A;  4JVS A;  1W2W A;  2PF4 E;  3DM9 B;  3KMI A;  4K7B A;  4KBL A;  3L8I A;  3TJ6 A;  2A0U A;  1ZYR F;  5CI8 A;  3G50 A;  4MW3 A;  4CIH A;  1RKE B;  4Q5S F;  2OJE D;  1YA7 O;  2ICW G;  2PNO A;  2ASR A;  1NG1 A;  4J7T A;  4AX2 A;  4MND A;  1PD1 A;  4YT4 A;  4I44 A;  1J8Y F;  2ETS A;  2OJQ A;  1LI7 A;  2J46 A;  4Q4Z F;  5EGY A;  3ABM C;  5D91 A;  4GEH A;  4XPW A;  3RQE A;  3G4Z A;  1ZZP A;  2WB7 A;  4IAR A;  4BJ5 A;  3POV A;  1SF8 A;  2IXO A;  2HMZ A;  2QUP A;  1Z5Z A;  2XM4 A;  4NTA A;  4RDA A;  1QVX A;  4GYT A;  1H9T A;  2YVK A;  1Q0D A;  2Q00 A;  1TR2 A;  2XL6 A;  4G78 A;  1S05 A;  1DOW A;  1JPJ A;  1PD0 A;  3N0T A;  4JEA A;  3GEE A;  3C8Z A;  4YL3 A;  4CJG A;  4DOZ A;  1LIH A;  3JRM O;  2HSB A;  1V74 B;  4W8K A;  4OIO F;  1Z3I X;  4Q7C A;  3Q7L A;  2L6G A;  1K05 A;  1D1A A;  1WWP A;  4XEV A;  4JTC B;  3W2W A;  2H7B A;  1T9K A;  3ZIB A;  4A2N B;  2X0C A;  1FR0 A;  4G7O F;  2Z15 A;  1APC A;  4HEA J;  5BQG A;  2Q4F A;  2LSE A;  1XZP A;  1HMO A;  2OKU A;  2HJ3 A;  1HY5 A;  3LLK A;  3NKE A;  4D4N A;  5IY5 C;  5JT4 A;  1E84 A;  2AVK A;  1K04 A;  1FTS A;  2WZF A;  3SXM A;  3ASN C;  1LPE A;  2HV7 A;  4DVZ A;  4CS8 C;  4CX9 A;  2C04 A;  3I5Q A;  2IBF A;  5T3T A;  5A6B D;  2DB4 A;  3TUL A;  1WOL A;  4LLC A;  4O7G A;  4AL0 A;  3US6 A;  2R7V A;  3U3F A;  1CGN A;  3NRH A;  4JRZ A;  3PDM P;  3B0V C;  4PJN A;  4JJG A;  1Q0M A;  1V54 C;  3IEE A;  3HTK C;  3LES A;  5BUO A;  3HJC A;  5JUA A;  2R7T A;  5KYN A;  2DGJ A;  1FFH A;  2J9V A;  2L6F A;  4JW1 A;  2W9Y A;  1WAS A;  2GFH A;  4E18 A;  2I15 A;  4BPM A;  1QKR A;  3SXY A;  3MFN A;  1YZA A;  3GWL A;  4LAC B;  4CSA A;  3NYM A;  3EG9 B;  4PR9 A;  1UG7 A;  3DJN B;  4LER A;  3QW1 A;  2L81 A;  4U5E E;  1HMD A;  3Q6N A;  2LFD A;  3T9O A;  1Y6D A;  1VB5 A;  1OCO C;  2LP4 A;  2WL8 A;  2XLD A;  2XLV A;  3E70 C;  3FOP A;  1M56 C;  3SZR A;  1SYQ A;  3H2U A;  4JEB A;  1D0X A;  2R9R B;  2XLE A;  1FNT c;  1DOV A;  3V7O A;  3JYH A;  1ORS C;  2AU5 A;  4E17 A;  1C03 A;  3V5Y A;  3B71 A;  1BBH A;  1G4W R;  1MMA A;  2LK4 A;  4LDK A;  1HE9 A;  4EHP A;  1MND A;  3IHU A;  1YZC A;  4XQ1 A;  2MHR A;  3ZVR A;  2J7P D;  3NDB B;  2BL2 A;  3EGX B;  1J8M F;  2KYH A;  3EHM A;  2Q9B A;  3QVZ A;  2IYL D;  5COF A;  3U2M A;  1Y4C A;  1LS4 A;  1YAU O;  3GEI A;  1WAT A;  3O10 A;  2CDQ A;  1E85 A;  1Z7Q c;  1LKX A;  4DBQ A;  4FWV A;  2Y3D A;  2VC9 A;  3GOR A;  3S90 A;  1AUE A;  2IXP A;  3EFO B;  2YWA A;  3UNG C;  4K0D A;  3GM1 A;  1AVO B;  1V4A A;  4C3D A;  2OEV A;  4PFO A;  1I5N A;  1M57 C;  2D4U A;  4IAO A;  4U5C E;  3UMK A;  4EBK A;  3EHN A;  1H7I A;  1Z23 A;  3FVY A;  3CAX A;  4IWB A;  2PBE A;  2R02 A;  3FAJ A;  3RKO F;  3WHN A;  1Z63 A;  3VAY A;  1EI7 A;  2CGE A;  2GWW A;  2RD9 A;  3EGD A;  4CS9 C;  1H6G A;  3L34 A;  3R7C A;  3DAG A;  2X51 A;  1FAP B;  5KYY B;  3UGP A;  2J0X A;  2WVN A;  2GDC A;  3AG2 C;  1RMV A;  1OCR C;  3ASO C;  1AEP A;  2J9W A;  2XL8 A;  4JUR I;  3JTL O;  4IAQ A;  2UUI A;  3RH3 A;  3DWW A;  1GQA A;  1G8X A;  1CGO A;  1CPR A;  1A7D A;  1GGQ A;  2LFF A;  4OIQ F;  3TD7 A;  1ZW2 A;  2KQ9 A;  4DJ9 A;  2NSG A;  4JIO A;  2HV6 A;  3K66 A;  3GWN A;  3GM2 A;  4IJJ A;  5AC5 A;  3B29 A;  1OCZ C;  2B0J A;  1L3P A;  1E86 A;  1YAR O;  4O6M A;  4MTO A;  4C7O A;  5F28 E;  2AWC A;  1O5H A;  2VH3 A;  2KJG A;  5L0D A;  5KYW B;  1A0B A;  2FGY A;  3KYJ A;  3ZG1 A;  2IM8 A;  3RIP A;  5FCL A;  1D1C A;  1HE1 A;  4DBR A;  2ZXO A;  2OOC A;  4U5G A;  4JJF A;  4KI2 A;  1Q0G A;  3U0C A;  3RF3 A;  1FFT C;  3KPH A;  1VOM A;  4CDA A;  2FAP B;  4NQF A;  2EIN C;  4FAP B;  4YWQ A;  2MWQ A;  3AG3 C;  2R7W A;  3F46 A;  5A6K A;  1O87 A;  1QPU A;  3NG1 A;  1QLE C;  3W8I A;  3SNH A;  3CQZ A;  4N6H A;  3HLZ A;  1NLX A;  1VYK A;  4EKW A;  2QE9 A;  1TQG A;  1ORJ A;  2OCC C;  1TWA A;  2QTV A;  3T4R A;  4MQ9 F;  3RYL A;  5L0J A;  2I8B A;  1ZHW A;  4OIP F;  4I1O B;  2HFI A;  1E83 A;  2L9J A;  3GOD A;  2NUT A;  3W8H A;  5DQZ A;  3N2Z B;  5DLJ A;  1U0B B;  3N24 A;  4DRI B;  4LLE A;  1F1M A;  2G3V A;  3U8V A;  1UFB A;  4LDR A;  1RJ9 B;  1YVI A;  2OEX A;  4YT8 A;  1OW7 A;  1QZX A;  2G62 A;  3K6B A;  3CSK A;  4HFF B;  2M4E A;  1U89 A;  2W45 A;  4BJ6 C;  1WN0 A;  5B3I A;  2KSF A;  2BE5 F;  1LE4 A;  4MVR A;  3OEO A;  2PFD A;  4U5F E;  1TWH A;  3U5S A;  4R32 A;  3X2Q C;  4EUK B;  5T3W A;  4G7H F;  4OD5 A;  5BQI A;  1EA8 A;  3U9M A;  5BQH A;  4CDV A;  1BR2 A;  2EIM C;  2RSE B;  4NTB A;  4CIP A;  1SR2 A;  1TFO B;  4N6C A;  1YYX A;  3RVZ A;  3LEO A;  5KYU B;  1K40 A;  2QLA A;  5E33 A;  1T6U A;  2E87 A;  1T6I A;  4JCZ A;  4YL1 A;  3EGD B;  4XPY A;  1MMD A;  2YRF A;  4JTD B;  3DZA A;  1O3U A;  3JCU Q;  1M6T A;  1JRA A;  2YLD A;  3S28 A;  5L3V A;  4W8P A;  1KU2 A;  1M2O A;  1VLT A;  2ZXR A;  3C63 A;  3IQ6 A;  3Q7G A;  3S27 A;  1NSG B;  2EPM X;  3K33 A;  3UMI A;  2XXA A;  3AG1 C;  3EJN A;  2A68 F;  4YN0 B;  4MVZ A;  4CS7 A;  3AG4 C;  2WVO A;  2KGO A;  4MVU A;  4ONS A;  3X1O A;  4BJ5 C;  2D5R B;  2XS1 A;  4E0I A;  2CNW A;  4LDQ A;  3EH2 A;  3TOL A;  2XM0 A;  1JAF A;  4MS2 A;  5B1B C;  1LS1 A;  1D0Y A;  3W2V A;  3JSE O;  2A6E F;  4EWC A;  1XWJ A;  2EPK X;  2WZL A;  1OKK D;  2PP4 A;  3LNR A;  2J9B A;  2H7O A;  2LQG A;  3WOD F;  1ORY A;  4DRJ B;  3EG9 A;  4BJ1 A;  4PAC A;  3ITF A;  4NTF A;  1WGW A;  3RFY A;  1R4T A;  3MBG A;  2EPO A;  1S7Z A;  4KNV A;  3S84 A;  4C7O B;  4MTG A;  1KTM A;  5DQT A;  4G0H A;  4IB4 A;  3C18 A;  5COG A;  4NC3 A;  3ZTZ A;  1GM5 A;  2XL4 A;  5F5F A;  3TK0 A;  4PFP A;  4K1O A;  3S0X A;  1NFN A;  3C7J A;  3QW0 A;  3IQ5 A;  3LAY A;  4H4K C;  1BR1 A;  2J7P A;  4HFK B;  1JMW A;  4XTK A;  4P6I C;  4CS8 A;  5EK0 A;  3U3B A;  3U9J A;  4C3B A;  1JPN A;  1U6H A;  2J0W A;  4JKV A;  1JR8 A;  3HNL A;  1E2X A;  4XEK A;  4XWJ A;  4U9D A;  3JRT A;  4KC9 A;  4O79 A;  1ZHZ A;  256B A;  3C62 A;  2IXM A;  2R03 A;  3NMK A;  1CGM E;  1TWG A;  3K1I A;  3AQC A;  4MVQ A;  1NZE A;  3M15 A;  3L1M A;  1IZM A;  3FAP B;  4IRU A;  4QI2 A;  3B0P A;  2LCH A;  2R7R A;  3ZQV A;  3DE9 A;  2ZPA A;  1OQC A;  3VRC A;  4Z9H A;  1YYJ A;  4JE9 A;  3T6B A;  2JPU A;  3T6J A;  4U9E A;  1ZHT A;  3ECS A;  3WAQ A;  2YL7 A;  3E9V A;  4E7Z A;  2HSQ A;  5DS5 A;  2JX0 A;  3EPV A;  2VCC A;  3BEH A;  4GQH A;  1RKC A;  2EIJ C;  3S29 A;  2KNH A;  1KNY A;  4ER9 A;  2TMV P;  2YLI A;  1HW2 A;  3DI5 A;  3NMJ A;  4MVS A;  4OD4 A;  5TJ5 E;  1Q0F A;  5K0I A;  3DM5 A;  3O6X A;  2ZD9 A;  3K1I C;  3J06 A;  4HE8 D;  4PJL A;  4MTF A;  4BG0 A;  1OR2 A;  2NSF A;  2Y69 C;  4Z9J A;  1R5I D;  1NU7 D;  3C8G D;  1M2V A;  4BEJ A;  1OKK A;  1FMW A;  2PX3 A;  4L6R A;  2M64 A;  5A6B A;  2KK1 A;  3UR3 C;  3WG7 C;  3NMI A;  3QTH A;  4UDV A;  1NFO A;  3JSZ A;  4A4A A;  4MW8 A;  4PJM A;  1EKY A;  2R7Q A;  4XLN F;  2J9U A;  3NYJ A;  2P0N A;  3LS1 A;  1YA9 A;  4J7Y A;  2GAQ A;  3ZTM A;  3LEV A;  4BJ6 A;  1ZHX A;  4ANJ A;  3JT1 A;  5E3C A;  4EBJ A;  1OR3 A;  3H2V A;  4B6I A;  5L0F A;  1ZU5 A;  2F22 A;  5JP7 A;  3ZQY A;  3EZH A;  3M4C A;  2DYR C;  1BZ4 A;  3MLG A;  4RBN A;  3DD7 A;  2AP3 A;  3R2P A;  3IPM O;  3HNI A;  1MNE A;  1VMA A;  4OIN F;  1VK5 A;  4Z9I A;  1D0Z A;  5KYX B;  1LE2 A;  1GS9 A;  2XLH A;  3EGX A;  1RCP A;  3PMR A;  2IOQ A;  3DJU B;  3QMK A;  4OIR F;  4MVM A;  2UUH A;  3TQO A;  3ZSU A;  2R25 A;  2YZS A;  3SEO A;  1M2V B;  2MYS A;  4XPX A;  2L7A A;  3ZC4 A;  2XRH A;  2G3K A;  2Q9C A;  4CS9 A;  3K7D A;  3FHD A;  4EBB A;  2WVQ A;  3DKA A;  3OA1 A;  3RVY A;  1VTM P;  1PV3 A;  2P6V A;  3V5X A;  2CCY A;  1SZI A;  3Q6M A;  2NUP B;  4CJO A;  2EPN A;  3DE8 A;  3O39 A;  4WGY A;  5E3A A;  2YL3 A;  2OG2 A;  3ZWI A;  1ZU4 A;  2HS5 A;  2NUT B;  3ABL C;  4I1M A;  4RD9 A;  5E2Q A;  1OW8 A;  2NPU A;  2V26 A;  4M63 A;  1OW6 A;  3GM3 A;  3W4Y A;  3K1H A;  2YL1 A;  1T5O A;  3KKB A;  3IQC A;  4YL0 A;  2B0H A;  4ULW A;  1YJG A;  3GEH A;  1LVK A;  3RW0 A;  2YQY A;  2VCA A;  5A6A A;  1V55 C;  3FDQ A;  4N06 A;  4DVY P;  4AE4 B;  3CZ6 A;  4J32 B;  1ZHY A;  3TOM A;  4C3E A;  5L0H A;  1G5Z A;  2HJM A;  2EIK C;  1MMN A;  3EZI A;  2Q7R A;  3H65 A;  2W4B A;  4XEF A;  3MYF A;  1D1B A;  4P9F A;  2ZXP A;  3ATP A;  3M79 A;  1NU9 C;  5KYY A;  3LS0 A;  4O6N A;  1A7E A;  1BR4 A;  2R05 A;  2OU6 A;  2YKZ A;  3UGO A;  4QDL A;  2LD6 A;  3KYI A;  4U5B E;  4AE4 A;  4DRH B;  2XLW A;  3HNK A;  5T1D B;  3FOO A;  5L0G A;  2HZ8 A;  5JLI A;  5L3Q A;  4FES A;  3VF0 A;  2BC5 A;  3I5P A;  1T6Q A;  2Q9A A;  3NKD A;  4FX5 A;  4BJT A;  1I4Y A;  5A6J A;  3QVY A;  1MQV A;  5AC4 A;  3HKK A;  2H7V C;  3BRJ A;  1A41 A;  5FZT A;  3T6G B;  1T01 A;  1ZVZ A;  2NUP A; 
#chains in the Genus database with same CATH homology
 2YLG A;  3HNL A;  1E86 A;  4U9D A;  4JEA A;  2XL6 A;  1S05 A;  256B A;  3C62 A;  4CJG A;  3NMK A;  2XLM A;  4WGZ A;  1QQ3 A;  1LM3 B;  3M15 A;  3L1M A;  5JRA A;  3ZQV A;  3DE9 A;  3VRC A;  1YYJ A;  4JE9 A;  4U9E A;  1APC A;  2YL7 A;  4CDA A;  1QPU A;  3U8P A;  4D4N A;  5JT4 A;  1E84 A;  4N6H A;  4CX9 A;  4ER9 A;  2YLI A;  3NMJ A;  1E83 A;  1CGN A;  4L6R A;  3HNJ A;  3NMI A;  5JUA A;  5AGF A;  1EKY A;  5JVE A;  3ZTM A;  1A7V A;  5B3I A;  2J8W A;  1YZA A;  5JP7 A;  3ZQY A;  3M4C A;  3QW1 A;  3HNI A;  2YL0 A;  1NBB A;  2XLD A;  2XLV A;  3FOP A;  4CDV A;  2XLH A;  4CIP A;  1RCP A;  1YYX A;  4JEB A;  2XLE A;  4ULV A;  2QLA A;  4CDY A;  4N4W A;  1BBH A;  1YZC A;  2CCY A;  1M6T A;  2XLO A;  2YLD A;  4CJO A;  3DE8 A;  4WGY A;  3C63 A;  2YL3 A;  3IQ6 A;  3M4B A;  3ZWI A;  3QVZ A;  1E85 A;  2YL1 A;  4EIY A;  4D4X A;  5JS5 A;  3TOL A;  2XM0 A;  1CPQ A;  1JAF A;  3TOM A;  5JSL A;  2J9B A;  3M79 A;  2YKZ A;  2XLW A;  2XL8 A;  3HNK A;  4IAQ A;  3FOO A;  1GQA A;  5JLI A;  1CGO A;  4IB4 A;  1CPR A;  4NC3 A;  3ZTZ A;  2BC5 A;  3QW0 A;  3IQ5 A;  3QVY A;  1MQV A;  4IAR A;  2XM4 A;  4JKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...