3FOPA

A triangular cytochrome b562 superstructure mediated by ni coordination - hexagonal form
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMCDFAAGFHILVGQIDDALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title A superprotein triangle driven by nickel(II) coordination: exploiting non-natural metal ligands in protein self-assembly.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 46
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3fopA00
2YKZA 2YLGA 4CJOA 4U9DA 4NC3A 4D4XA 1EKYA 1LM3B 3M79A 4JEAA 4CJGA 5JRAA 4IB4A 2YL0A 1YZAA 2XL8A 1NBBA 5AGFA 5JUAA 1CGOA 2XLVA 4IAQA 4CX9A 4WGZA 3QW0A 1E84A 4JE9A 4JKVA 3C62A 2XM0A 4JEBA 2XLHA 3NMKA 3VRCA 3DE9A 5B3IA 3HNJA 5JSLA 1GQAA 1E86A 4CDYA 2YLIA 3NMIA 5JLIA 2XLEA 1YZCA 1CPRA 3ZQYA 1E85A 5JP7A 3NMJA 2YLDA 2J9BA 3DE8A 2J8WA 4CDVA 1S05A 1CPQA 2YL3A 4L6RA 4EIYA 3C63A 4ULVA 3M4CA 3M15A 1M6TA 3L1MA 4WGYA 1YYJA 3TOMA 4IARA 3HNIA 2BC5A 1E83A 4D4NA 1CGNA 2XLOA 1BBHA 3U8PA 2XLWA 2XL6A 1QQ3A 3M4BA 3QVYA 1YYXA 3ZTZA 5JVEA 1APCA 3FOPA 2XLMA 4CIPA 3QW1A 3ZTMA 3IQ5A 256BA 5JT4A 2YL1A 3HNKA 2CCYA 1JAFA 1A7VA 1QPUA 5JS5A 4CDAA 4U9EA 2XM4A 4N4WA 2XLDA 2YL7A 4ER9A 3ZWIA 1RCPA 3QVZA 1MQVA 3TOLA 3FOOA 3IQ6A 3HNLA 4N6HA 2QLAA 3ZQVA
chains in the Genus database with same CATH superfamily
4ANJA 2WVQA 4CJOA 4U9DA 1FMVA 1KNYA 1EKYA 1LM3B 1A41A 3C7JA 2QUPA 2J46A 3M79A 3VF0A 3AQBA 3ZIBA 4EBJA 2OJQA 5L0GA 4JTDB 3LESA 3AJMA 1A0BA 4MNDA 3TQOA 2YL0A 4G78A 1U6HA 2XL8A 3DXJF 3B29A 4Q7CA 4U5GA 5COGA 1G4WR 2EINC 5AGFA 2EILC 1ORSC 2GWWA 4KC9A 4CS8C 1CGOA 2XSEA 5KYXB 1T9KA 4ULWA 4FAPB 4IAQA 4YT4A 4BJ5A 1D1CA 3UR3C 4DJ9A 3AGTA 3KH2A 2DI3A 2KQ9A 5DS6A 5EGYA 2A69F 2B0JA 3V7OA 1OKKD 1JPNA 3DJNB 3FVYA 3EHMA 4WGZA 4JE9A 4BJ6C 3U5SA 1HE9A 2YEVA 4J30B 2XL4A 1XZQA 1TWHA 4K7BA 4JEBA 4RDAA 5KYUA 3NMKA 2EIJC 1OCRC 2J7PA 4U5HA 5DLJA 4CBEA 1KTMA 4A4AA 4OINF 4EUKB 2OQMA 2KC3A 4I44A 1D0YA 1D1BA 2OOCA 2AP3A 3KKBA 1M2OA 3IQTA 3UMHA 5E3CA 2Y3HA 5CI9A 2Z15A 3LS1A 1U0BB 1VB5A 2HSQA 2H7OA 2ZXRA 1TWAA 3EQLF 1ORYA 3CAXA 3IQCA 1YZCA 2JD3A 1WASA 3EZHA 2KJGA 3SZRA 1E85A 5KYWB 1WATA 3JT1A 3S29A 3K6BA 2FAPB 1UG7A 1EA8A 2R7QA 3DE8A 3GORA 3I4UA 2KGOA 1S05A 4O7GA 4CDVA 2V3CC 2HJ3A 3ABLC 2YL3A 4OIRF 4I3MA 4L6RA 4BPMA 4DXWA 2NSGA 1OQCA 3FHDA 4XEVA 4EIYA 1HW1A 2PF4E 4MTFA 4BJ1A 4ZLDA 3UMKA 1LI7A 1WGWA 4ULVA 4E0IA 1M6TA 1ZYRF 4B6IA 4CS8A 1JOGA 3ZC4A 3WHNA 2ICWG 2C03A 3C8GA 4W8PA 3BEHA 2Y3DA 2CGEA 4Z9JA 1D1AA 4MVRA 4YL1A 2J9VA 3GWLA 4QI0A 3O55A 2G62A 3MFNA 5A69A 2QY9A 2DYSC 2AWCA 1M56C 2LQGA 1ZZPA 2HKVA 1J8YF 2XL6A 2XLWA 4MVOA 2LK4A 2EIKC 2LFFA 1V55C 3TJ6A 1LS4A 2R03A 3EGDA 2B0HA 3FOPA 3IEEA 3N2ZB 4WJ0A 3QW1A 1VK5A 4FWVA 5L0HA 1HY5A 1K04A 1TWCA 1Y4CA 1JMWA 1N1CA 3ATPA 3SXYA 1CGME 4E17A 3TK0A 3H65A 3A11A 4KNWA 2R02A 4E18A 1QZXA 2R7WA 5FZTA 4NQFA 2HMZA 4RD9A 3HTKC 4JCHA 5JS5A 3NKEA 3AQCA 3FXHA 3GODA 3WAQA 1Z3IX 1RJ9A 2PP4A 2J0XA 1BDJB 3LJBA 4JZAA 3JTLO 1OW7A 2QTVA 2UUIA 4XTKA 1WWPA 2H7VC 2YL7A 3T6GB 4ER9A 2PFDA 3U2LA 5KYXA 2DYRC 3EFOB 3K7DA 2QNLA 3QZCA 2NSFA 3QVZA 3TOLA 3U2MA 3FOOA 2R7RA 4FESA 3IHUA 1YVIA 1RXQA 2GAQA 4OD4A 4QDLA 3RFYA 1NLXA 3LAYA 3KMIA 3HNLA 4XPYA 5T3TA 4N6HA 1DOVA 5CIVA 4MVQA 2X0CA 2QLAA 3W8HA 4D4NA 2EPOA 1C03A 2YKZA 2YLGA 5B1BC 1SYQA 4NTFA 4J7TA 2Y69C 1M2VB 1JR8A 3NRHA 1BR4A 3C8GD 1OCCC 3CQZA 2QE9A 1FTSA 3LLKA 4IJJA 4IRUA 1ZU4A 2WZLA 3RYLA 4DVZA 2IXPA 2Q00A 4I1OB 3QTHA 1NBBA 2D5RB 1HE1A 4YL0A 4C3DA 5JUAA 3EPVA 2XLVA 4NY3A 3S90A 1LE4A 5EHHA 2LIGA 3U9MA 3ASOC 3ZG1A 2OG2A 2VC9A 4ONSA 5A6BA 4MW8A 3S0XA 1I4ZA 1BR2A 1A7EA 2AU5A 4JJFA 3SYNA 3U9JA 3TJ5A 3AOUA 3B0PA 1LKXA 3QW0A 1E84A 2XRHA 4AK9A 4EWCA 4BJ6A 2P6VA 4LDRA 2VCBA 2A6HF 1FFHA 2HSBA 3KYJA 4U5FE 3VRCA 5B3IA 1LE2A 2Q3TA 3CEXA 4E0HA 4IGGA 2OEVA 4W8KA 1RKCA 1TKNA 2Y3GA 3HNJA 3RQGA 1SMYF 3L8JA 3G4XA 1Q0KA 4LACB 3T9OA 5KYWA 3SNHA 2FFHA 4MQ9F 3O10A 3H2VA 4DOZA 1G4US 3F46A 1OCZC 1CPRA 2NUTB 3ZQYA 5L0FA 3JSZA 4K0DA 1TFOB 2ZXWC 1T5OA 5L3VA 3X2QC 2ZPAA 1SZIA 1I5NA 3OA1A 4O6NA 2R7OA 5BQGA 3W4YA 1FR0A 2RD9A 2G3VA 2J9BA 1Z7Qc 3WG7C 2J8WA 4JVSA 3B9QA 3DM9B 4JW1A 3RIPA 2VASA 1J8MF 4OD5A 2IOQA 2JPUA 1QKRA 2XS8A 2YQYA 1LPEA 2IBFA 3KPHA 3G50A 3L1MA 5BQIA 4WGYA 4E7SA 1IZMA 1YYJA 3UGPA 2HUJA 2J9WA 3NYLA 3WODF 3FAJA 4AL0A 3NYJA 1FMWA 3UGOA 2KW3C 3HNIA 1XZPA 2G3KA 3CZ6A 2LFDA 3U3FA 3ZDLA 3AGUA 2VB6A 2WVOA 3DM5A 4E7ZA 3FDQA 3DAFA 1Q0FA 2TMVP 1CGNA 4UDVA 5F5FA 2KYHA 1NZEA 3JSEO 5L0CA 1WN0A 2WL8A 3LNMB 1ORJA 4JRZA 3ZSUA 3M4BA 4JIOA 5A6BD 2LP4A 1APCA 4J7YA 3A9CA 3PMRA 5A6JA 3U8VA 2R7TA 2HJMA 2CDQA 4CIPA 2NUPB 1VLTA 3GANA 3EJNA 5E33A 1AVOB 4KI2A 3TULA 1Q0GA 5D92A 4XEFA 1FAPB 5A6AA 3TD7A 5JT4A 2J9UA 4YL3A 1MMNA 1V54C 1G5ZA 1ZU5A 3E9VA 3LEVA 1A7VA 2A68F 3N0TA 4MS2A 3LUTB 3EGXA 5IY5C 2HS5A 4PJMA 4PFPA 4EBBA 1R5ID 2CNWA 4U5CE 2CYDA 4P6IC 4AL1A 4A2NB 1GM5A 3EFOA 3R7CA 1Z6AA 4IWBA 1NFOA 3DJUB 2R7SA 1RCPA 4X0RA 4XLNF 1T6UA 3RQFA 3JZ0A 2V26A 3MYFA 3R2PA 2HMQA 1YA9A 2KK1A 4JTCB 5L0IA 3US6A 1MMDA 2LD6A 1M2VA 3I5PA 1H9TA 4C3EA 5F28E 3EZIA 1OCOC 2J0WA 2L9JA 3EG9B 3SXKA 2J7PD 3POVA 2EPNA 2A6EF 3RF3A 4AX2A 2ZD9A 4CJGA 2PX0A 4YN0B 4IB4A 1JRAA 5JRAA 2HZ8A 1NSGB 4JJGA 4HE8D 5AC4A 3T6BA 1YZAA 4MVZA 3AG1C 4NTBA 2M64A 2GFHA 4MVUA 3OEOA 5KYYA 1ST6A 2R7XA 2R05A 4O6YA 3SEOA 2LCHA 4YT8A 4GEHA 3EGXB 1YA7O 2AWYA 4F4BA 4O6MA 3ABKC 4XLPF 3EH1A 4PK4A 3DKAA 3PCVA 5HSWA 3LLIA 4KBLA 2XS1A 2VCCA 1A7DA 4ZLCA 1QLEC 4JKVA 2Q4FA 2YZSA 5L0JA 1YDIA 4OIOF 2Y3BA 2XM0A 1TWGA 3NKDA 4Q5SF 2XLHA 1PCXA 1XWJA 3DE9A 5E2QA 1GGQA 1OR2A 2F22A 2OCCC 4XWJA 4EBKA 3AG2C 2NUTA 1L7CA 3Q6NA 4LLEA 3MLGA 1K05A 1MMGA 3VM6A 1E86A 3T6JA 1UFBA 2CNWD 3S84A 2YLIA 3U3BA 2DGJA 5JLIA 3K66A 1VOMA 1NU7D 1B68A 1OW8A 3JYYA 3JYHA 3NMJA 1V4AA 4JC7A 3U0CA 1ZW3A 1LS1A 2P61A 3V5XA 2Q9BA 1OR3A 3LS0A 4LDKA 1L3PA 1NFNA 1OKKA 1OXKA 1PD0A 1WTYA 2M4EA 3AG3C 4N06A 4WABA 1U89A 5KYYB 3B0VC 3GWNA 1H7IA 3C63A 2MWQA 3DMDA 3K1HA 3RKOF 2I15A 2L6GA 3M15A 1VTMP 4XEKA 3MX3A 4YWQA 1D0XA 1TFKB 3H2UA 3L0IA 5T3WA 4J32B 4Q4ZF 3G4ZA 2IXNA 3KYIA 2VCAA 1Z5ZA 2YWAA 4PJNA 3RQEA 3AG4C 5L3QA 4CSAC 5COFA 3T4RA 3K1IC 4P9TA 1AEPA 3EH2A 4O79A 3S28A 2BC5A 1E83A 2D4UA 2WZGA 2ZXOA 2XLOA 1SR2A 2IM8A 4YT5A 1IW7F 1BBHA 3U8PA 2NUPA 2IXMA 4CS7A 1EI7A 3OWTA 3RH3A 3ZTZA 2BE5F 1YAUO 1LI5A 3SP1A 2R7VA 3MBGA 4YK5A 5F5HA 1NU9C 2GDCA 1BZ4A 3RVYA 4AE4A 2A1DD 2OJED 4MW3A 2P1AA 2H7BA 2WZFA 3LEOA 1ZHWA 256BA 3GM3A 3GEEA 3HJCA 2ETSA 3J06A 2EPMX 2YL1A 2CCYA 1I4YA 1VYIA 1RKEB 4EHPA 1QPUA 3LNRA 4H4KC 4CS9C 2EPKX 4XPXA 1H9GA 2XM4A 2J45A 4PJJA 1E2XA 1ZHZA 4IAOA 3L8IA 3Q7GA 1FNTc 1C02A 1YLMA 4G0HA 1EQ1A 1O87A 3ZWIA 2OKUA 4LERA 4HFKB 3W8IA 1PV3A 3GEHA 1DOWA 1NG1A 3EG9A 4DRJB 2O9XA 4CSAA 4MTGA 3B71A 3S27A 2DB4A 2Q9CA 3ZVRA 3UMIA 1Q0MA 1BR1A 1T6IA 3K1IA 5D91A 1JAFA 2MHRA 3FAPB 5A6KA 2YHSA 3ZQVA 5TJ5E 3EHNA 4PFOA 4Z9IA 4CIHA 2E87A 4YT2A 2W45A 4NC3A 1KU2A 2L81A 4D4XA 3PHF2 3KL4A 4JEAA 3V5ZA 4AE4B 5DQZA 1RMVA 3ABMC 2P0NA 3I5QA 3SXMA 1TQGA 1C17M 3QMKA 3RW0A 5FCLA 4GYTA 3M1CB 3RVZA 1ZHXA 4EKWA 4DBRA 3C18A 3N24A 3X1OA 3DZAA 3Q6MA 1FFTC 3O39A 1Z23A 1GS9A 4CX9A 1ZHTA 2P7VA 5CI8A 2L6HA 3NMIA 3VAYA 4U5EE 3NDBB 3K33A 3C62A 2PNOA 1ZHYA 4XQ1A 2R7UA 1MMAA 1AUEA 4JCZA 3SXZA 4CS9A 5B3SC 4KNVA 4PJLA 1QVXA 5DVWA 3VYWA 1VMAA 1JPJA 2HV6A 5COMA 5JSLA 2HFIA 2WVNA 2JX0A 1GQAA 2RSEB 3JRTA 5KYUB 2ASRA 2CW0F 1PD1A 3FMSA 3V5YA 4YJWA 1ZVZA 1Z63A 4CDYA 2IYLD 2KSFA 2KNHA 3E70C 4C7OA 1YJGA 2XLEA 1MNEA 4PR9A 1LIHA 1VLSA 2FGYA 1H6GA 4BG0A 5E3AA 2W9YA 4R32A 5JP7A 5DQTA 2Q7RA 2YLDA 3BRJA 4C3BA 2A0UA 2IXOA 4DRHB 1OW6A 3ECSA 2NG1A 4DBQA 4LDQA 4LLCA 1HMDA 2R9RB 3UNGC 5HV9A 1CPQA 3HLZA 4FX5A 2A0BA 5EK0A 1LVKA 4MTOA 5DS5A 3M4CA 2R25A 4RBNA 1Y6DA 4Z9HA 1ZW2A 2UUHA 3MYIA 3TOMA 5GPGB 4IARA 4HFFB 3W2WA 2W4MA 2ZXPA 5AC5A 2X51A 3W2VA 3NG1A 1YARO 4QI2A 4NTAA 4DVYP 1M57C 2W4BA 1K40A 4I1MA 3C8GB 1HW2A 1W2WA 4MVSA 1G8XA 2Q9AA 5L0DA 1OXBA 1QQ3A 1O3UA 2C04A 3ITFA 3NYMA 3QVYA 2EIMC 1YYXA 5JVEA 2MYSA 3S9OA 4C7OB 3JCUQ 2XXAA 1T01A 4JTAB 3GM2A 1S7ZA 2XLMA 4JURI 4OIPF 2VH3A 5BQHA 4M63A 3PDMP 3HKKA 3ZTMA 2HV7A 4PACA 1RKEA 3B0UX 4BJ5C 3DD7A 3EGDB 3F47A 2PBEA 3IQ5A 5B1AC 2LSEA 3Q7LA 4XPWA 1VYKA 2NPUA 4P9FA 3DWWA 4BJTA 1R4TA 1F1MA 3HNKA 1TR2A 4U5DE 1Q0DA 3ASNC 3CSKA 2PX3A 4N6CA 1WOLA 2H8AA 3JRMO 5T1DB 5K0IA 3IPMO 4NCQA 1HMOA 2AVKA 4CDAA 5BUOA 4U9EA 2WB7A 3DAGA 1SF8A 2L6FA 4N4WA 2GA0A 2I8BA 2YRFA 4HEAJ 4BEMJ 1V74B 3C8ZA 2XLDA 2OEXA 1O5HA 4G7ZF 4K1OA 4U5BE 4MVMA 3L34A 4OIQF 2BL2A 3O6XA 4DRIB 1RJ9B 1MQVA 1T6QA 2OU6A 3IQ6A 4BEJA 2L7AA 1MNDA 1QSPA 3GM1A 3GEIA 4G7HF 1D0ZA 2EPLX 2Y39A 5DS4A 3DI5A 5KYNA 4G7OF 4H54A 2YVKA 4GQHA 2XXAB
chains in the Genus database with same CATH topology
2YKZA 2YLGA 4CJOA 4U9DA 4NC3A 4D4XA 1EKYA 1LM3B 3M79A 4JEAA 4CJGA 5JRAA 4IB4A 2YL0A 1YZAA 2XL8A 1NBBA 5AGFA 5JUAA 1CGOA 2XLVA 4IAQA 4CX9A 4WGZA 3QW0A 1E84A 4JE9A 4JKVA 3C62A 2XM0A 4JEBA 2XLHA 3NMKA 3VRCA 3DE9A 5B3IA 3HNJA 5JSLA 1GQAA 1E86A 4CDYA 2YLIA 3NMIA 5JLIA 2XLEA 1YZCA 1CPRA 3ZQYA 1E85A 5JP7A 3NMJA 2YLDA 2J9BA 3DE8A 2J8WA 4CDVA 1S05A 1CPQA 2YL3A 4L6RA 4EIYA 3C63A 4ULVA 3M4CA 3M15A 1M6TA 3L1MA 4WGYA 1YYJA 3TOMA 4IARA 3HNIA 2BC5A 1E83A 4D4NA 1CGNA 2XLOA 1BBHA 3U8PA 2XLWA 2XL6A 1QQ3A 3M4BA 3QVYA 1YYXA 3ZTZA 5JVEA 1APCA 3FOPA 2XLMA 4CIPA 3QW1A 3ZTMA 3IQ5A 256BA 5JT4A 2YL1A 3HNKA 2CCYA 1JAFA 1A7VA 1QPUA 5JS5A 4CDAA 4U9EA 2XM4A 4N4WA 2XLDA 2YL7A 4ER9A 3ZWIA 1RCPA 3QVZA 1MQVA 3TOLA 3FOOA 3IQ6A 3HNLA 4N6HA 2QLAA 3ZQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YKZ A;  2YLG A;  4CJO A;  4U9D A;  4NC3 A;  4D4X A;  1EKY A;  1LM3 B;  3M79 A;  4JEA A;  4CJG A;  5JRA A;  4IB4 A;  2YL0 A;  1YZA A;  2XL8 A;  1NBB A;  5AGF A;  5JUA A;  1CGO A;  2XLV A;  4IAQ A;  4CX9 A;  4WGZ A;  3QW0 A;  1E84 A;  4JE9 A;  4JKV A;  3C62 A;  2XM0 A;  4JEB A;  2XLH A;  3NMK A;  3VRC A;  3DE9 A;  5B3I A;  3HNJ A;  5JSL A;  1GQA A;  1E86 A;  4CDY A;  2YLI A;  3NMI A;  5JLI A;  2XLE A;  1YZC A;  1CPR A;  3ZQY A;  1E85 A;  5JP7 A;  3NMJ A;  2YLD A;  2J9B A;  3DE8 A;  2J8W A;  4CDV A;  1S05 A;  1CPQ A;  2YL3 A;  4L6R A;  4EIY A;  3C63 A;  4ULV A;  3M4C A;  3M15 A;  1M6T A;  3L1M A;  4WGY A;  1YYJ A;  3TOM A;  4IAR A;  3HNI A;  2BC5 A;  1E83 A;  4D4N A;  1CGN A;  2XLO A;  1BBH A;  3U8P A;  2XLW A;  2XL6 A;  1QQ3 A;  3M4B A;  3QVY A;  1YYX A;  3ZTZ A;  5JVE A;  1APC A;  3FOP A;  2XLM A;  4CIP A;  3QW1 A;  3ZTM A;  3IQ5 A;  256B A;  5JT4 A;  2YL1 A;  3HNK A;  2CCY A;  1JAF A;  1A7V A;  1QPU A;  5JS5 A;  4CDA A;  4U9E A;  2XM4 A;  4N4W A;  2XLD A;  2YL7 A;  4ER9 A;  3ZWI A;  1RCP A;  3QVZ A;  1MQV A;  3TOL A;  3FOO A;  3IQ6 A;  3HNL A;  4N6H A;  2QLA A;  3ZQV A; 
#chains in the Genus database with same CATH topology
 4ANJ A;  2WVQ A;  4CJO A;  4U9D A;  1FMV A;  1KNY A;  1EKY A;  1LM3 B;  1A41 A;  3C7J A;  2QUP A;  2J46 A;  3M79 A;  3VF0 A;  3AQB A;  3ZIB A;  4EBJ A;  2OJQ A;  5L0G A;  4JTD B;  3LES A;  3AJM A;  1A0B A;  4MND A;  3TQO A;  2YL0 A;  4G78 A;  1U6H A;  2XL8 A;  3DXJ F;  3B29 A;  4Q7C A;  4U5G A;  5COG A;  1G4W R;  2EIN C;  5AGF A;  2EIL C;  1ORS C;  2GWW A;  4KC9 A;  4CS8 C;  1CGO A;  2XSE A;  5KYX B;  1T9K A;  4ULW A;  4FAP B;  4IAQ A;  4YT4 A;  4BJ5 A;  1D1C A;  3UR3 C;  4DJ9 A;  3AGT A;  3KH2 A;  2DI3 A;  2KQ9 A;  5DS6 A;  5EGY A;  2A69 F;  2B0J A;  3V7O A;  1OKK D;  1JPN A;  3DJN B;  3FVY A;  3EHM A;  4WGZ A;  4JE9 A;  4BJ6 C;  3U5S A;  1HE9 A;  2YEV A;  4J30 B;  2XL4 A;  1XZQ A;  1TWH A;  4K7B A;  4JEB A;  4RDA A;  5KYU A;  3NMK A;  2EIJ C;  1OCR C;  2J7P A;  4U5H A;  5DLJ A;  4CBE A;  1KTM A;  4A4A A;  4OIN F;  4EUK B;  2OQM A;  2KC3 A;  4I44 A;  1D0Y A;  1D1B A;  2OOC A;  2AP3 A;  3KKB A;  1M2O A;  3IQT A;  3UMH A;  5E3C A;  2Y3H A;  5CI9 A;  2Z15 A;  3LS1 A;  1U0B B;  1VB5 A;  2HSQ A;  2H7O A;  2ZXR A;  1TWA A;  3EQL F;  1ORY A;  3CAX A;  3IQC A;  1YZC A;  2JD3 A;  1WAS A;  3EZH A;  2KJG A;  3SZR A;  1E85 A;  5KYW B;  1WAT A;  3JT1 A;  3S29 A;  3K6B A;  2FAP B;  1UG7 A;  1EA8 A;  2R7Q A;  3DE8 A;  3GOR A;  3I4U A;  2KGO A;  1S05 A;  4O7G A;  4CDV A;  2V3C C;  2HJ3 A;  3ABL C;  2YL3 A;  4OIR F;  4I3M A;  4L6R A;  4BPM A;  4DXW A;  2NSG A;  1OQC A;  3FHD A;  4XEV A;  4EIY A;  1HW1 A;  2PF4 E;  4MTF A;  4BJ1 A;  4ZLD A;  3UMK A;  1LI7 A;  1WGW A;  4ULV A;  4E0I A;  1M6T A;  1ZYR F;  4B6I A;  4CS8 A;  1JOG A;  3ZC4 A;  3WHN A;  2ICW G;  2C03 A;  3C8G A;  4W8P A;  3BEH A;  2Y3D A;  2CGE A;  4Z9J A;  1D1A A;  4MVR A;  4YL1 A;  2J9V A;  3GWL A;  4QI0 A;  3O55 A;  2G62 A;  3MFN A;  5A69 A;  2QY9 A;  2DYS C;  2AWC A;  1M56 C;  2LQG A;  1ZZP A;  2HKV A;  1J8Y F;  2XL6 A;  2XLW A;  4MVO A;  2LK4 A;  2EIK C;  2LFF A;  1V55 C;  3TJ6 A;  1LS4 A;  2R03 A;  3EGD A;  2B0H A;  3FOP A;  3IEE A;  3N2Z B;  4WJ0 A;  3QW1 A;  1VK5 A;  4FWV A;  5L0H A;  1HY5 A;  1K04 A;  1TWC A;  1Y4C A;  1JMW A;  1N1C A;  3ATP A;  3SXY A;  1CGM E;  4E17 A;  3TK0 A;  3H65 A;  3A11 A;  4KNW A;  2R02 A;  4E18 A;  1QZX A;  2R7W A;  5FZT A;  4NQF A;  2HMZ A;  4RD9 A;  3HTK C;  4JCH A;  5JS5 A;  3NKE A;  3AQC A;  3FXH A;  3GOD A;  3WAQ A;  1Z3I X;  1RJ9 A;  2PP4 A;  2J0X A;  1BDJ B;  3LJB A;  4JZA A;  3JTL O;  1OW7 A;  2QTV A;  2UUI A;  4XTK A;  1WWP A;  2H7V C;  2YL7 A;  3T6G B;  4ER9 A;  2PFD A;  3U2L A;  5KYX A;  2DYR C;  3EFO B;  3K7D A;  2QNL A;  3QZC A;  2NSF A;  3QVZ A;  3TOL A;  3U2M A;  3FOO A;  2R7R A;  4FES A;  3IHU A;  1YVI A;  1RXQ A;  2GAQ A;  4OD4 A;  4QDL A;  3RFY A;  1NLX A;  3LAY A;  3KMI A;  3HNL A;  4XPY A;  5T3T A;  4N6H A;  1DOV A;  5CIV A;  4MVQ A;  2X0C A;  2QLA A;  3W8H A;  4D4N A;  2EPO A;  1C03 A;  2YKZ A;  2YLG A;  5B1B C;  1SYQ A;  4NTF A;  4J7T A;  2Y69 C;  1M2V B;  1JR8 A;  3NRH A;  1BR4 A;  3C8G D;  1OCC C;  3CQZ A;  2QE9 A;  1FTS A;  3LLK A;  4IJJ A;  4IRU A;  1ZU4 A;  2WZL A;  3RYL A;  4DVZ A;  2IXP A;  2Q00 A;  4I1O B;  3QTH A;  1NBB A;  2D5R B;  1HE1 A;  4YL0 A;  4C3D A;  5JUA A;  3EPV A;  2XLV A;  4NY3 A;  3S90 A;  1LE4 A;  5EHH A;  2LIG A;  3U9M A;  3ASO C;  3ZG1 A;  2OG2 A;  2VC9 A;  4ONS A;  5A6B A;  4MW8 A;  3S0X A;  1I4Z A;  1BR2 A;  1A7E A;  2AU5 A;  4JJF A;  3SYN A;  3U9J A;  3TJ5 A;  3AOU A;  3B0P A;  1LKX A;  3QW0 A;  1E84 A;  2XRH A;  4AK9 A;  4EWC A;  4BJ6 A;  2P6V A;  4LDR A;  2VCB A;  2A6H F;  1FFH A;  2HSB A;  3KYJ A;  4U5F E;  3VRC A;  5B3I A;  1LE2 A;  2Q3T A;  3CEX A;  4E0H A;  4IGG A;  2OEV A;  4W8K A;  1RKC A;  1TKN A;  2Y3G A;  3HNJ A;  3RQG A;  1SMY F;  3L8J A;  3G4X A;  1Q0K A;  4LAC B;  3T9O A;  5KYW A;  3SNH A;  2FFH A;  4MQ9 F;  3O10 A;  3H2V A;  4DOZ A;  1G4U S;  3F46 A;  1OCZ C;  1CPR A;  2NUT B;  3ZQY A;  5L0F A;  3JSZ A;  4K0D A;  1TFO B;  2ZXW C;  1T5O A;  5L3V A;  3X2Q C;  2ZPA A;  1SZI A;  1I5N A;  3OA1 A;  4O6N A;  2R7O A;  5BQG A;  3W4Y A;  1FR0 A;  2RD9 A;  2G3V A;  2J9B A;  1Z7Q c;  3WG7 C;  2J8W A;  4JVS A;  3B9Q A;  3DM9 B;  4JW1 A;  3RIP A;  2VAS A;  1J8M F;  4OD5 A;  2IOQ A;  2JPU A;  1QKR A;  2XS8 A;  2YQY A;  1LPE A;  2IBF A;  3KPH A;  3G50 A;  3L1M A;  5BQI A;  4WGY A;  4E7S A;  1IZM A;  1YYJ A;  3UGP A;  2HUJ A;  2J9W A;  3NYL A;  3WOD F;  3FAJ A;  4AL0 A;  3NYJ A;  1FMW A;  3UGO A;  2KW3 C;  3HNI A;  1XZP A;  2G3K A;  3CZ6 A;  2LFD A;  3U3F A;  3ZDL A;  3AGU A;  2VB6 A;  2WVO A;  3DM5 A;  4E7Z A;  3FDQ A;  3DAF A;  1Q0F A;  2TMV P;  1CGN A;  4UDV A;  5F5F A;  2KYH A;  1NZE A;  3JSE O;  5L0C A;  1WN0 A;  2WL8 A;  3LNM B;  1ORJ A;  4JRZ A;  3ZSU A;  3M4B A;  4JIO A;  5A6B D;  2LP4 A;  1APC A;  4J7Y A;  3A9C A;  3PMR A;  5A6J A;  3U8V A;  2R7T A;  2HJM A;  2CDQ A;  4CIP A;  2NUP B;  1VLT A;  3GAN A;  3EJN A;  5E33 A;  1AVO B;  4KI2 A;  3TUL A;  1Q0G A;  5D92 A;  4XEF A;  1FAP B;  5A6A A;  3TD7 A;  5JT4 A;  2J9U A;  4YL3 A;  1MMN A;  1V54 C;  1G5Z A;  1ZU5 A;  3E9V A;  3LEV A;  1A7V A;  2A68 F;  3N0T A;  4MS2 A;  3LUT B;  3EGX A;  5IY5 C;  2HS5 A;  4PJM A;  4PFP A;  4EBB A;  1R5I D;  2CNW A;  4U5C E;  2CYD A;  4P6I C;  4AL1 A;  4A2N B;  1GM5 A;  3EFO A;  3R7C A;  1Z6A A;  4IWB A;  1NFO A;  3DJU B;  2R7S A;  1RCP A;  4X0R A;  4XLN F;  1T6U A;  3RQF A;  3JZ0 A;  2V26 A;  3MYF A;  3R2P A;  2HMQ A;  1YA9 A;  2KK1 A;  4JTC B;  5L0I A;  3US6 A;  1MMD A;  2LD6 A;  1M2V A;  3I5P A;  1H9T A;  4C3E A;  5F28 E;  3EZI A;  1OCO C;  2J0W A;  2L9J A;  3EG9 B;  3SXK A;  2J7P D;  3POV A;  2EPN A;  2A6E F;  3RF3 A;  4AX2 A;  2ZD9 A;  4CJG A;  2PX0 A;  4YN0 B;  4IB4 A;  1JRA A;  5JRA A;  2HZ8 A;  1NSG B;  4JJG A;  4HE8 D;  5AC4 A;  3T6B A;  1YZA A;  4MVZ A;  3AG1 C;  4NTB A;  2M64 A;  2GFH A;  4MVU A;  3OEO A;  5KYY A;  1ST6 A;  2R7X A;  2R05 A;  4O6Y A;  3SEO A;  2LCH A;  4YT8 A;  4GEH A;  3EGX B;  1YA7 O;  2AWY A;  4F4B A;  4O6M A;  3ABK C;  4XLP F;  3EH1 A;  4PK4 A;  3DKA A;  3PCV A;  5HSW A;  3LLI A;  4KBL A;  2XS1 A;  2VCC A;  1A7D A;  4ZLC A;  1QLE C;  4JKV A;  2Q4F A;  2YZS A;  5L0J A;  1YDI A;  4OIO F;  2Y3B A;  2XM0 A;  1TWG A;  3NKD A;  4Q5S F;  2XLH A;  1PCX A;  1XWJ A;  3DE9 A;  5E2Q A;  1GGQ A;  1OR2 A;  2F22 A;  2OCC C;  4XWJ A;  4EBK A;  3AG2 C;  2NUT A;  1L7C A;  3Q6N A;  4LLE A;  3MLG A;  1K05 A;  1MMG A;  3VM6 A;  1E86 A;  3T6J A;  1UFB A;  2CNW D;  3S84 A;  2YLI A;  3U3B A;  2DGJ A;  5JLI A;  3K66 A;  1VOM A;  1NU7 D;  1B68 A;  1OW8 A;  3JYY A;  3JYH A;  3NMJ A;  1V4A A;  4JC7 A;  3U0C A;  1ZW3 A;  1LS1 A;  2P61 A;  3V5X A;  2Q9B A;  1OR3 A;  3LS0 A;  4LDK A;  1L3P A;  1NFN A;  1OKK A;  1OXK A;  1PD0 A;  1WTY A;  2M4E A;  3AG3 C;  4N06 A;  4WAB A;  1U89 A;  5KYY B;  3B0V C;  3GWN A;  1H7I A;  3C63 A;  2MWQ A;  3DMD A;  3K1H A;  3RKO F;  2I15 A;  2L6G A;  3M15 A;  1VTM P;  4XEK A;  3MX3 A;  4YWQ A;  1D0X A;  1TFK B;  3H2U A;  3L0I A;  5T3W A;  4J32 B;  4Q4Z F;  3G4Z A;  2IXN A;  3KYI A;  2VCA A;  1Z5Z A;  2YWA A;  4PJN A;  3RQE A;  3AG4 C;  5L3Q A;  4CSA C;  5COF A;  3T4R A;  3K1I C;  4P9T A;  1AEP A;  3EH2 A;  4O79 A;  3S28 A;  2BC5 A;  1E83 A;  2D4U A;  2WZG A;  2ZXO A;  2XLO A;  1SR2 A;  2IM8 A;  4YT5 A;  1IW7 F;  1BBH A;  3U8P A;  2NUP A;  2IXM A;  4CS7 A;  1EI7 A;  3OWT A;  3RH3 A;  3ZTZ A;  2BE5 F;  1YAU O;  1LI5 A;  3SP1 A;  2R7V A;  3MBG A;  4YK5 A;  5F5H A;  1NU9 C;  2GDC A;  1BZ4 A;  3RVY A;  4AE4 A;  2A1D D;  2OJE D;  4MW3 A;  2P1A A;  2H7B A;  2WZF A;  3LEO A;  1ZHW A;  256B A;  3GM3 A;  3GEE A;  3HJC A;  2ETS A;  3J06 A;  2EPM X;  2YL1 A;  2CCY A;  1I4Y A;  1VYI A;  1RKE B;  4EHP A;  1QPU A;  3LNR A;  4H4K C;  4CS9 C;  2EPK X;  4XPX A;  1H9G A;  2XM4 A;  2J45 A;  4PJJ A;  1E2X A;  1ZHZ A;  4IAO A;  3L8I A;  3Q7G A;  1FNT c;  1C02 A;  1YLM A;  4G0H A;  1EQ1 A;  1O87 A;  3ZWI A;  2OKU A;  4LER A;  4HFK B;  3W8I A;  1PV3 A;  3GEH A;  1DOW A;  1NG1 A;  3EG9 A;  4DRJ B;  2O9X A;  4CSA A;  4MTG A;  3B71 A;  3S27 A;  2DB4 A;  2Q9C A;  3ZVR A;  3UMI A;  1Q0M A;  1BR1 A;  1T6I A;  3K1I A;  5D91 A;  1JAF A;  2MHR A;  3FAP B;  5A6K A;  2YHS A;  3ZQV A;  5TJ5 E;  3EHN A;  4PFO A;  4Z9I A;  4CIH A;  2E87 A;  4YT2 A;  2W45 A;  4NC3 A;  1KU2 A;  2L81 A;  4D4X A;  3PHF 2;  3KL4 A;  4JEA A;  3V5Z A;  4AE4 B;  5DQZ A;  1RMV A;  3ABM C;  2P0N A;  3I5Q A;  3SXM A;  1TQG A;  1C17 M;  3QMK A;  3RW0 A;  5FCL A;  4GYT A;  3M1C B;  3RVZ A;  1ZHX A;  4EKW A;  4DBR A;  3C18 A;  3N24 A;  3X1O A;  3DZA A;  3Q6M A;  1FFT C;  3O39 A;  1Z23 A;  1GS9 A;  4CX9 A;  1ZHT A;  2P7V A;  5CI8 A;  2L6H A;  3NMI A;  3VAY A;  4U5E E;  3NDB B;  3K33 A;  3C62 A;  2PNO A;  1ZHY A;  4XQ1 A;  2R7U A;  1MMA A;  1AUE A;  4JCZ A;  3SXZ A;  4CS9 A;  5B3S C;  4KNV A;  4PJL A;  1QVX A;  5DVW A;  3VYW A;  1VMA A;  1JPJ A;  2HV6 A;  5COM A;  5JSL A;  2HFI A;  2WVN A;  2JX0 A;  1GQA A;  2RSE B;  3JRT A;  5KYU B;  2ASR A;  2CW0 F;  1PD1 A;  3FMS A;  3V5Y A;  4YJW A;  1ZVZ A;  1Z63 A;  4CDY A;  2IYL D;  2KSF A;  2KNH A;  3E70 C;  4C7O A;  1YJG A;  2XLE A;  1MNE A;  4PR9 A;  1LIH A;  1VLS A;  2FGY A;  1H6G A;  4BG0 A;  5E3A A;  2W9Y A;  4R32 A;  5JP7 A;  5DQT A;  2Q7R A;  2YLD A;  3BRJ A;  4C3B A;  2A0U A;  2IXO A;  4DRH B;  1OW6 A;  3ECS A;  2NG1 A;  4DBQ A;  4LDQ A;  4LLC A;  1HMD A;  2R9R B;  3UNG C;  5HV9 A;  1CPQ A;  3HLZ A;  4FX5 A;  2A0B A;  5EK0 A;  1LVK A;  4MTO A;  5DS5 A;  3M4C A;  2R25 A;  4RBN A;  1Y6D A;  4Z9H A;  1ZW2 A;  2UUH A;  3MYI A;  3TOM A;  5GPG B;  4IAR A;  4HFF B;  3W2W A;  2W4M A;  2ZXP A;  5AC5 A;  2X51 A;  3W2V A;  3NG1 A;  1YAR O;  4QI2 A;  4NTA A;  4DVY P;  1M57 C;  2W4B A;  1K40 A;  4I1M A;  3C8G B;  1HW2 A;  1W2W A;  4MVS A;  1G8X A;  2Q9A A;  5L0D A;  1OXB A;  1QQ3 A;  1O3U A;  2C04 A;  3ITF A;  3NYM A;  3QVY A;  2EIM C;  1YYX A;  5JVE A;  2MYS A;  3S9O A;  4C7O B;  3JCU Q;  2XXA A;  1T01 A;  4JTA B;  3GM2 A;  1S7Z A;  2XLM A;  4JUR I;  4OIP F;  2VH3 A;  5BQH A;  4M63 A;  3PDM P;  3HKK A;  3ZTM A;  2HV7 A;  4PAC A;  1RKE A;  3B0U X;  4BJ5 C;  3DD7 A;  3EGD B;  3F47 A;  2PBE A;  3IQ5 A;  5B1A C;  2LSE A;  3Q7L A;  4XPW A;  1VYK A;  2NPU A;  4P9F A;  3DWW A;  4BJT A;  1R4T A;  1F1M A;  3HNK A;  1TR2 A;  4U5D E;  1Q0D A;  3ASN C;  3CSK A;  2PX3 A;  4N6C A;  1WOL A;  2H8A A;  3JRM O;  5T1D B;  5K0I A;  3IPM O;  4NCQ A;  1HMO A;  2AVK A;  4CDA A;  5BUO A;  4U9E A;  2WB7 A;  3DAG A;  1SF8 A;  2L6F A;  4N4W A;  2GA0 A;  2I8B A;  2YRF A;  4HEA J;  4BEM J;  1V74 B;  3C8Z A;  2XLD A;  2OEX A;  1O5H A;  4G7Z F;  4K1O A;  4U5B E;  4MVM A;  3L34 A;  4OIQ F;  2BL2 A;  3O6X A;  4DRI B;  1RJ9 B;  1MQV A;  1T6Q A;  2OU6 A;  3IQ6 A;  4BEJ A;  2L7A A;  1MND A;  1QSP A;  3GM1 A;  3GEI A;  4G7H F;  1D0Z A;  2EPL X;  2Y39 A;  5DS4 A;  3DI5 A;  5KYN A;  4G7O F;  4H54 A;  2YVK A;  4GQH A;  2XXA B; 
#chains in the Genus database with same CATH homology
 2YKZ A;  2YLG A;  4CJO A;  4U9D A;  4NC3 A;  4D4X A;  1EKY A;  1LM3 B;  3M79 A;  4JEA A;  4CJG A;  5JRA A;  4IB4 A;  2YL0 A;  1YZA A;  2XL8 A;  1NBB A;  5AGF A;  5JUA A;  1CGO A;  2XLV A;  4IAQ A;  4CX9 A;  4WGZ A;  3QW0 A;  1E84 A;  4JE9 A;  4JKV A;  3C62 A;  2XM0 A;  4JEB A;  2XLH A;  3NMK A;  3VRC A;  3DE9 A;  5B3I A;  3HNJ A;  5JSL A;  1GQA A;  1E86 A;  4CDY A;  2YLI A;  3NMI A;  5JLI A;  2XLE A;  1YZC A;  1CPR A;  3ZQY A;  1E85 A;  5JP7 A;  3NMJ A;  2YLD A;  2J9B A;  3DE8 A;  2J8W A;  4CDV A;  1S05 A;  1CPQ A;  2YL3 A;  4L6R A;  4EIY A;  3C63 A;  4ULV A;  3M4C A;  3M15 A;  1M6T A;  3L1M A;  4WGY A;  1YYJ A;  3TOM A;  4IAR A;  3HNI A;  2BC5 A;  1E83 A;  4D4N A;  1CGN A;  2XLO A;  1BBH A;  3U8P A;  2XLW A;  2XL6 A;  1QQ3 A;  3M4B A;  3QVY A;  1YYX A;  3ZTZ A;  5JVE A;  1APC A;  3FOP A;  2XLM A;  4CIP A;  3QW1 A;  3ZTM A;  3IQ5 A;  256B A;  5JT4 A;  2YL1 A;  3HNK A;  2CCY A;  1JAF A;  1A7V A;  1QPU A;  5JS5 A;  4CDA A;  4U9E A;  2XM4 A;  4N4W A;  2XLD A;  2YL7 A;  4ER9 A;  3ZWI A;  1RCP A;  3QVZ A;  1MQV A;  3TOL A;  3FOO A;  3IQ6 A;  3HNL A;  4N6H A;  2QLA A;  3ZQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...