3FOQA

Crystal structure of n-acetylglucosamine-1-phosphate uridyltransferase (glmu) from mycobacterium tuberculosis in a cubic space group.
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
473
structure length
439
Chain Sequence
b'MTFPGDTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDRILRTQDHEVMAIVQEVNAGVYAFDIAALRSALSRLYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional protein glmU
publication title Structure of N-acetylglucosamine-1-phosphate uridyltransferase (GlmU) from Mycobacterium tuberculosis in a cubic space group.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 121
structure length 439
sequence length 473
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2008-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3foqA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3foqA01
4E1KA 1LXAA 1H7EA 2BO4A 4EEOA 3U2UA 1FGGA 4MNDA 2ZU9A 4KT7A 2VHEA 3JUKA 2WLFA 4ISXA 2FY7A 3DHOA 4EABA 3IGJA 1GWVA 4J09A 3KWEA 2JCLA 3SX3A 4NAIA 4KPZA 1KWSA 1W55A 4Y62A 4H7OA 2Y4MA 5FV9A 3USRA 5C4EA 3CKJA 2FKOA 4CJCA 4R36A 3FSCA 3U2TA 4N6AA 1G95A 5C3AA 2RIYA 5DG3A 1JYKA 1FXJA 2JCKA 1LL2A 3U0XA 5C4FA 1G2VA 1QRLA 3I3AA 2JF3A 4L41C 5EIYA 2V0HA 2Q4JA 2WLDA 4E75A 1GA8A 1FR8A 4M4KA 5EJZA 4KQLA 4DCLA 1GX0A 2PGVA 1H5TB 3GUEA 2CU2A 4HG6A 4KC1A 1H7LA 1O23B 2D7IA 5JQQA 5E3PA 2DPWA 2E8BA 3V8ZA 5CMJA 3CJ8A 1ZCTA 2WVKA 3DUVA 3QVBA 3OH4A 1OCXA 1H5RA 5F42A 4IRPA 1O7OA 4B5BA 3HSQA 3OC9A 1LZ7A 1ZCVA 3Q80A 4G87A 2AM5A 5AFUU 4NANA 3SX7A 1HM8A 4NALA 1JVGA 1W57A 1ZI4A 5FU0A 5IDTA 2W0WA 1ZJ0A 4FROA 2WLCA 4EGGA 3E25A 4FRQA 1G0RA 3OKRA 1H7QA 3ZF8A 4BMAA 4M2BA 3OH3A 1SSMA 1NWGB 1H4DA 1R7UA 3PMOA 1KHRA 3OUPA 2WAWA 5CQPA 2VSHA 3SX8A 4EA8A 3I0DA 5CMHA 3I0GA 4P02A 4EE4A 1IINA 4BQHA 4G3QA 3V8YA 2ICXA 2E3DA 1GQCA 1ZI5A 3CKOA 2WLGA 3SX5A 1QRFA 1J2ZA 2TDTA 1R80A 3SXEA 1WT0A 1JVDA 4Y6UA 3FSXA 4HCQA 3D98A 2YQSA 2ZU7A 4MYBA 4JISA 1H7GA 1T3DA 2D0JA 3FTTA 3MQHA 4HO8A 2AM3A 1R82A 3EH0A 5DEPA 1TW1A 2FYCB 2X5SA 3R5BA 1G1LA 5CMFX 2Y4KA 2OI5A 3TZTA 3FS8A 4FRHA 1ZJ2A 3K8DA 3VBIA 2PA4A 3BSSA 1FR9A 2AH9A 5C1GA 1YP2A 4B2XA 2OI6A 2RJ4A 2V0LA 1S80A 2VS3A 3U2WA 3KIAA 4EAAA 2XMEA 4IRQA 3I0EA 1XATA 2X65A 5C3BA 4ASYA 2ZU8A 2QGIA 1H4EA 3F1YA 4AAWA 3LW6A 4LW3A 2I5KA 3U2VA 1R7YA 1INJA 4Y6NA 2YQJA 4FRBA 5L6VA 3GVDA 5C4BA 4KNRA 1ZHJA 3V90A 5C1HA 3GOSA 4MZUA 1VZTA 3TQDA 1ZJ1A 1FXOA 1FRWA 3PNNA 2P6WA 2BO7A 5AFUV 1ON6A 4NAKA 1HM9A 5FYEA 1MC3A 3F1XA 1VM8A 1G97A 1SSTA 1FWYA 1KRVA 2QIVX 1SSQA 2RJ5A 2QKXA 2AESA 3VBPA 1MP4A 1NQIB 4IHFA 2A8UA 1HM0A 3CU0A 3SXCA 1KQAA 3NZ2A 1H7TA 1ZDFA 1S4NA 3U2XA 4HUSA 2O1HA 1VGZA 1R7VA 4IHHA 4EA7A 1V83A 2MZBA 1G93A 2FFVA 5C8RA 3D8VA 3R3IA 2O1FA 5C4CA 2GGOA 1H5SB 2FYAA 3OGZA 1MP5A 4XWIA 4HZCA 1LL3A 4K6RA 2OEGA 1WSZA 3OH1A 3R1WA 2APCA 4KC2A 3I0LA 2WVMA 1KGQA 2AECA 4CVHA 3MQGA 1H5RB 3VNPA 3DJ4A 1KK4A 2FYBA 5CMIA 1G9RA 4EEAA 2AM4A 4N6BA 1VICA 5C48A 4EQYA 3I0FA 1LVWA 4KNXA 3V0LA 3V0OA 1V82A 1YP3A 1THJA 1EZIA 1H5TA 4CJ8A 4D11A 3T57A 4E6TA 3R8YA 3EEVA 3V0MA 1MP3A 4Y64A 3I0JA 2FFUA 2VXLA 3R2WA 3TV0A 3IOJA 3RSBA 2VXMA 3R5AA 4Y7GA 2OI7A 1JV1A 3BRKX 5C49A 2QH5A 3IXCA 1QQ0A 1NHEB 1QRGA 2P2OA 3TIOA 1PZTA 2RIXA 4DDZA 5EJ1A 4FRMA 1VGTA 1KK6A 4Y7TA 5C36A 1KRRA 2YQHA 3JTJA 1QGQA 2Y7AA 4EA9A 1G23A 3T7NA 4ZDQA 1ZCUA 1ON8A 2IU9A 1R7TA 1NMMB 1H5SC 2WE9A 1ZJPA 4EEGA 4KPXA 1INIA 2JCOA 2NPOA 2VSIA 1Z90A 4DE7A 3TWDA 1H5SD 4EVWA 1GQ9A 1S4OA 2YCMA 3TISA 1YP4A 2FYDB 2BO6A 2VS5A 4B42A 2RIZA 3FWWA 1O0RA 2RITA 1FO8A 2QIAA 1VZUA 2RJ7A 2RJ0A 1KK5A 4FREA 2BO8A 3Q7UA 1QRMA 2ICYA 2VFZA 3T7OA 4MYOA 2Z86A 1JV3A 1SS9A 4FCEA 1WT2A 3I0CA 5C4DA 5CQOA 1ZJ3A 3SXGA 5AJOA 3V0NA 5I1FA 3FSYA 3R5CA 1VZXA 1XHBA 4B4BA 4AC3A 4YS8A 2RJ6A 1W77A 1ZIZA 3JUJA 5FUHA 5ADXU 4JD0A 1IIMA 1LZJA 5C1LA 5FTSA 3VBMA 4EEMA 4HO0A 1V67A 3N9WA 4IHGA 4E6UA 3VBNA 4FRAA 1OQMB 1VGWA 4EE5A 2O1GA 2RJ9A 1H3MA 3V4EA 3CKVA 5AJNA 1NKHB 5CQNX 4B3UA 4C2SA 1LL0A 2WVLA 4P00A 5C47A 3KWDA 4LW6A 3ZLLA 1JYLA 2AE7A 1QG8A 5BXCA 4HOCA 4D0TA 2YQCA 4DECA 3I0HA 2UX8A 3DK5A 3FOQA 1TW5A 1WT1A 5CQMX 5E3QA 4HO6A 1XZ6A 4HO9A 4D48A 4M9CA 3CKNA 4GBPA 3ZLKA 3V0PA 3R0SA 1OMXA 3RMWA 2XATA 4R37A 1G8OA 4G3SA 4B4MA 2V0KA 3P47A 2V0IA 2RJ8A 3IOIA 3IOHA 4FQWA 3P1BA 1FO9A 2VD4A 5DDVA 2I7BA 1KGTA 4KXOA 1HJLA 3SXDA 2X5ZA 2XMHA 5C38A 1E5KA 1R7XA 4G3PA 2JF2A 2YC5A 3TDTA 1ZI1A 4E79A 1HV9A 1H7HA 5IDSA 3OTZA 1GWWA 4EE3A 2W0VA 2I5EA 1VPAA 3V0QA 1GX4A 1FGXA 3SRTA 3Q4SA 3F1CA 2XWNA 2AGDA 1V84A 2RJ1A 1VGUA 1MR9A 3BSYA 3R3RA 2IUAA 4N27A 1LZIA 1WT3A 2PGYA 3K8EA 3BCVA 2Y6PA 4FCUA 5FU8A 3U0YA 1LZ0A 1OMZA 4B4GA 1H5SA 3CKQA 4FRPA 2VS4A 3R5DA 1ZDGA 1H4CA 2RIJA 1I52A 2A8WA 4HO3A 3USQA 2WGZA 5HS2A 1H7FA 3VBJA 3VBKA 3CGXA 3OH0A 2AQ9A 4Y7VA 1KRUA 3Q1XA 1QREA 3TK8A 1G3LA 4AYJA 5L6SA 4J18A 1MRLA 1ZCYA 1ZJOA 3HL3A 4AYLA 3I3XA 5ADXV 3BXYA 4KC4A 2GGQA 2WLEA 4HURA 1O7QA 2X60A 3RMVA 2Y4JA 3MC4A 1WVCA 2P73A 2PX7A 1V3WA 1FZWA 1S4PA 3I0KA 1TZFA 4M28A 2Y4LA 3EE5A 2YC3A 3OH2A 1YROB 3ECTA 1ZI3A 4B2WA 3VBLA 5CQLX 1TDTA 3OTMA 1XHDA 3D5NA 3O3PA 3POLA 4Y63A 3HJJA 3FSBA 4MFGA 4HZDA 4M98A 5DDTA 5J49A 4Y7UA 2JCJA 4ASJA 3ST8A 4AA7A 2YESA 1QWJA 1K4VA 3ZGFA 3KWCA 2OEFA 2XWLA 5IFYA 4M2AA 3EG4A 4Y9XA 3NGWA 2Z87A 3PKQA 4Y7FA 3BFPA 4ECMA 2IU8A 4D11C 3I0IX 4KRVA 4N69A 3SXBA 5U2KA 1VH1A 2WEEA 1EYRA 4HO5A 3OAMA 1VH3A 1PZYB 1R81A 1NF5B 1FG5N 1HJJA 4HO2A 3BSWA 4HO4A 5CMGX 2D7RA 3E26A 4FRDA 3JQYA 2NXVA 1MR7A 3V91A 4M99A 2V0JA 2IC7A 5FTVA 4R7PA 5DEMA 3PKPA 4FRLA 4CJBA 2P72A 3ZGGA 4D0ZA 3SPTA 1FOAA 3C8VA 4ARWA 3OW5A 5E3RA 2XWMA 1TVYA 3T7MA 1QGSA 3OU9A 4UEGA 3SXAA 5C3DA 5AJPA
chains in the Genus database with same CATH superfamily
4E1KA 1LXAA 1H7EA 2BO4A 4EEOA 3U2UA 1FGGA 4MNDA 2ZU9A 4KT7A 2VHEA 3JUKA 2WLFA 4ISXA 2FY7A 3DHOA 4EABA 3IGJA 1GWVA 4J09A 3KWEA 2JCLA 3SX3A 4NAIA 4KPZA 1KWSA 1W55A 4Y62A 4H7OA 2Y4MA 5FV9A 3USRA 5C4EA 3CKJA 2FKOA 4CJCA 4R36A 3FSCA 3U2TA 4N6AA 1G95A 5C3AA 2RIYA 5DG3A 1JYKA 1FXJA 2JCKA 1LL2A 3U0XA 5C4FA 1L0SA 1G2VA 1QRLA 3I3AA 2JF3A 4L41C 5EIYA 2V0HA 2Q4JA 2WLDA 4E75A 1GA8A 1FR8A 4M4KA 5EJZA 4KQLA 4DCLA 1GX0A 2PGVA 1H5TB 3GUEA 1Z2FA 2CU2A 4HG6A 4KC1A 1H7LA 1O23B 2D7IA 5JQQA 5E3PA 2DPWA 2E8BA 3V8ZA 5CMJA 3CJ8A 1ZCTA 2WVKA 3DUVA 3QVBA 3OH4A 1OCXA 1H5RA 5F42A 4IRPA 3GQ8A 1O7OA 4B5BA 3HSQA 3OC9A 1LZ7A 1ZCVA 3Q80A 4G87A 2AM5A 5AFUU 4NANA 3SX7A 1HM8A 4NALA 1JVGA 1W57A 1ZI4A 5FU0A 5IDTA 2W0WA 1ZJ0A 3SUCA 4FROA 2WLCA 4EGGA 3E25A 4FRQA 1G0RA 3OKRA 1H7QA 3ZF8A 4BMAA 4M2BA 3OH3A 1SSMA 1NWGB 1H4DA 1R7UA 3PMOA 1KHRA 3OUPA 2WAWA 5CQPA 2VSHA 3SX8A 4EA8A 2VK9A 3I0DA 5CMHA 3I0GA 4P02A 4EE4A 1IINA 4BQHA 4G3QA 3V8YA 2ICXA 2E3DA 1GQCA 1ZI5A 3CKOA 2WLGA 3SX5A 1QRFA 1J2ZA 2TDTA 1R80A 3SXEA 1WT0A 1JVDA 4Y6UA 3FSXA 4HCQA 3D98A 2YQSA 2ZU7A 4MYBA 4JISA 1H7GA 1T3DA 2D0JA 3FTTA 3MQHA 4HO8A 2AM3A 1R82A 3EH0A 5DEPA 1TW1A 2FYCB 2X5SA 3R5BA 1G1LA 5CMFX 2Y4KA 2OI5A 3TZTA 3FS8A 4FRHA 1ZJ2A 3K8DA 3VBIA 2PA4A 3BSSA 1FR9A 2AH9A 5C1GA 1YP2A 4B2XA 2OI6A 2RJ4A 2V0LA 1S80A 2VS3A 3U2WA 3KIAA 4EAAA 2XMEA 4IRQA 3I0EA 1XATA 2X65A 5C3BA 4ASYA 2ZU8A 4FIXA 2QGIA 1H4EA 3F1YA 4AAWA 3LW6A 4LW3A 2I5KA 3U2VA 1R7YA 1INJA 4Y6NA 2YQJA 4FRBA 5L6VA 3GVDA 5C4BA 4KNRA 1ZHJA 3V90A 5C1HA 3GOSA 4MZUA 1VZTA 3TQDA 1ZJ1A 1FXOA 1FRWA 3PNNA 2P6WA 2BO7A 5AFUV 1ON6A 4NAKA 1HM9A 5FYEA 1MC3A 3F1XA 1VM8A 1G97A 1SSTA 1FWYA 1KRVA 2QIVX 1SSQA 5D92A 2RJ5A 2QKXA 2AESA 3VBPA 1MP4A 1NQIB 4IHFA 2A8UA 1HM0A 3CU0A 3SXCA 1KQAA 3NZ2A 1H7TA 1ZDFA 1S4NA 3U2XA 4HUSA 2O1HA 1VGZA 1R7VA 4IHHA 4EA7A 1V83A 2MZBA 1G93A 2FFVA 5C8RA 3D8VA 3R3IA 2O1FA 5C4CA 2GGOA 3OGZA 1H5SB 2FYAA 1MP5A 4XWIA 4HZCA 1LL3A 4K6RA 2OEGA 3OH1A 1WSZA 3R1WA 2APCA 4KC2A 3I0LA 2WVMA 1KGQA 2AECA 4CVHA 3MQGA 1H5RB 3VNPA 3DJ4A 1KK4A 2FYBA 5CMIA 1G9RA 4EEAA 2AM4A 4N6BA 1VICA 5C48A 4EQYA 3I0FA 1LVWA 4KNXA 3V0LA 3V0OA 1V82A 1YP3A 1THJA 1EZIA 1H5TA 4CJ8A 4D11A 3T57A 4E6TA 3R8YA 3EEVA 3V0MA 1MP3A 4Y64A 3I0JA 2FFUA 2VXLA 3R2WA 3TV0A 3IOJA 3RSBA 2VXMA 3R5AA 4Y7GA 2OI7A 1JV1A 3BRKX 5C49A 2QH5A 3IXCA 1QQ0A 1NHEB 1QRGA 2P2OA 3TIOA 1PZTA 2RIXA 4DDZA 5EJ1A 4FRMA 1N4IA 1KK6A 1VGTA 4Y7TA 5C36A 1KRRA 2YQHA 3JTJA 1QGQA 2Y7AA 4EA9A 1G23A 3T7NA 4ZDQA 1ZCUA 1ON8A 2IU9A 1R7TA 1NMMB 1H5SC 2WE9A 1ZJPA 4EEGA 3GQ9A 4KPXA 1INIA 2JCOA 2NPOA 2VSIA 1Z90A 4DE7A 3TWDA 1H5SD 4EVWA 1GQ9A 1S4OA 2YCMA 3TISA 1YP4A 2FYDB 2BO6A 2VS5A 4B42A 2RIZA 3FWWA 1O0RA 2RITA 1FO8A 2QIAA 1VZUA 2RJ7A 2RJ0A 1KK5A 4FREA 2BO8A 3Q7UA 1QRMA 2ICYA 2VFZA 3T7OA 4MYOA 2Z86A 1JV3A 1SS9A 4FCEA 1WT2A 3I0CA 5C4DA 5CQOA 1ZJ3A 3SXGA 5AJOA 3V0NA 5I1FA 3FSYA 3R5CA 1VZXA 1XHBA 4B4BA 4AC3A 4YS8A 2RJ6A 1W77A 1ZIZA 3JUJA 5FUHA 5ADXU 4JD0A 1IIMA 1LZJA 5C1LA 5FTSA 3VBMA 4EEMA 4HO0A 1V67A 3N9WA 4IHGA 4E6UA 3VBNA 4FRAA 1OQMB 1VGWA 4EE5A 2O1GA 2RJ9A 1H3MA 3V4EA 3CKVA 5AJNA 1NKHB 5CQNX 4B3UA 4C2SA 1LL0A 2WVLA 4P00A 5C47A 3KWDA 4MIXA 4LW6A 3ZLLA 1JYLA 2AE7A 1QG8A 5BXCA 4HOCA 4D0TA 2YQCA 4DECA 3I0HA 2UX8A 3DK5A 3FOQA 1TW5A 1WT1A 5CQMX 5E3QA 4HO6A 1XZ6A 4HO9A 4D48A 4M9CA 3CKNA 4GBPA 3ZLKA 3V0PA 3R0SA 1OMXA 3RMWA 2XATA 4R37A 1G8OA 4G3SA 4B4MA 2V0KA 3P47A 2V0IA 2RJ8A 3IOIA 1M8NA 3IOHA 4FQWA 3P1BA 1FO9A 2VD4A 5DDVA 2I7BA 1KGTA 4KXOA 1HJLA 3SXDA 2X5ZA 2XMHA 5C38A 1E5KA 1R7XA 4G3PA 2JF2A 2YC5A 3TDTA 1ZI1A 4E79A 1HV9A 1H7HA 5IDSA 3OTZA 1GWWA 4EE3A 2W0VA 2I5EA 1VPAA 3V0QA 1GX4A 1FGXA 3SRTA 3Q4SA 3F1CA 2XWNA 2AGDA 1V84A 2RJ1A 1VGUA 1MR9A 3BSYA 3R3RA 2IUAA 4N27A 1LZIA 1WT3A 2PGYA 3K8EA 3BCVA 2Y6PA 4FCUA 5FU8A 3U0YA 4O6NA 1LZ0A 1OMZA 4B4GA 1H5SA 3CKQA 2J0AA 4FRPA 2VS4A 3R5DA 1ZDGA 1H4CA 2RIJA 5AJPA 1I52A 2A8WA 4HO3A 3USQA 2WGZA 5HS2A 1H7FA 3VBJA 3OH0A 3VBKA 3CGXA 2AQ9A 4Y7VA 1KRUA 3GQ7A 3Q1XA 1QREA 3TK8A 1G3LA 4AYJA 5L6SA 4J18A 1MRLA 1ZCYA 1ZJOA 3HL3A 4AYLA 3I3XA 5ADXV 3BXYA 4KC4A 2GGQA 2WLEA 4HURA 1O7QA 2X60A 3RMVA 2Y4JA 3MC4A 1WVCA 2P73A 2PX7A 1V3WA 1FZWA 1S4PA 3I0KA 1TZFA 4M28A 2Y4LA 3EE5A 2YC3A 4FIYA 3OH2A 1YROB 3ECTA 1ZI3A 4B2WA 3VBLA 3GQAA 5CQLX 1TDTA 3OTMA 1XHDA 3D5NA 3O3PA 3POLA 4Y63A 3HJJA 3FSBA 4MFGA 4HZDA 4M98A 5DDTA 5J49A 4Y7UA 2JCJA 4ASJA 3ST8A 4AA7A 2YESA 5D91A 1QWJA 1K4VA 3ZGFA 3KWCA 2OEFA 2XWLA 5IFYA 4O6MA 4Q7CA 4M2AA 3EG4A 4Y9XA 3NGWA 2Z87A 3PKQA 4Y7FA 3BFPA 1EWWA 4ECMA 2IU8A 4D11C 3I0IX 2C0NA 4KRVA 4N69A 3SXBA 5U2KA 1VH1A 2WEEA 1EYRA 4HO5A 3OAMA 1VH3A 1PZYB 1R81A 1NF5B 1FG5N 1HJJA 4HO2A 3BSWA 4HO4A 5CMGX 2D7RA 3E26A 4FRDA 3JQYA 2NXVA 1MR7A 3V91A 4M99A 2V0JA 2IC7A 5FTVA 4R7PA 5DEMA 3PKPA 4FRLA 4CJBA 2P72A 3ZGGA 4D0ZA 3SPTA 1FOAA 3C8VA 4ARWA 3OW5A 5E3RA 2XWMA 1TVYA 3T7MA 1QGSA 3OU9A 4UEGA 3SXAA 5C3DA 2J0BA
chains in the Genus database with same CATH topology
4E1KA 1LXAA 1H7EA 2BO4A 4EEOA 3U2UA 1FGGA 4MNDA 2ZU9A 4KT7A 2VHEA 3JUKA 2WLFA 4ISXA 2FY7A 3DHOA 4EABA 3IGJA 1GWVA 4J09A 3KWEA 2JCLA 3SX3A 4NAIA 4KPZA 1KWSA 1W55A 4Y62A 4H7OA 2Y4MA 5FV9A 3USRA 5C4EA 3CKJA 2FKOA 4CJCA 4R36A 3FSCA 3U2TA 4N6AA 1G95A 5C3AA 2RIYA 5DG3A 1JYKA 1FXJA 2JCKA 1LL2A 3U0XA 5C4FA 1G2VA 1QRLA 3I3AA 2JF3A 4L41C 5EIYA 2V0HA 2Q4JA 2WLDA 4E75A 1GA8A 1FR8A 4M4KA 5EJZA 4KQLA 4DCLA 1GX0A 2PGVA 1H5TB 3GUEA 2CU2A 4HG6A 4KC1A 1H7LA 1O23B 2D7IA 5JQQA 5E3PA 2DPWA 2E8BA 3V8ZA 5CMJA 3CJ8A 1ZCTA 2WVKA 3DUVA 3QVBA 3OH4A 1OCXA 1H5RA 5F42A 4IRPA 1O7OA 4B5BA 3HSQA 3OC9A 1LZ7A 1ZCVA 3Q80A 4G87A 2AM5A 5AFUU 4NANA 3SX7A 1HM8A 4NALA 1JVGA 1W57A 1ZI4A 5FU0A 5IDTA 2W0WA 1ZJ0A 4FROA 2WLCA 4EGGA 3E25A 4FRQA 1G0RA 3OKRA 1H7QA 3ZF8A 4BMAA 4M2BA 3OH3A 1SSMA 1NWGB 1H4DA 1R7UA 3PMOA 1KHRA 3OUPA 2WAWA 5CQPA 2VSHA 3SX8A 4EA8A 2VK9A 3I0DA 5CMHA 3I0GA 4P02A 4EE4A 1IINA 4BQHA 4G3QA 3V8YA 2ICXA 2E3DA 1GQCA 1ZI5A 3CKOA 2WLGA 3SX5A 1QRFA 1J2ZA 2TDTA 1R80A 3SXEA 1WT0A 1JVDA 4Y6UA 3FSXA 4HCQA 3D98A 2YQSA 2ZU7A 4MYBA 4JISA 1H7GA 1T3DA 2D0JA 3FTTA 3MQHA 4HO8A 2AM3A 1R82A 3EH0A 5DEPA 1TW1A 2FYCB 2X5SA 3R5BA 1G1LA 5CMFX 2Y4KA 2OI5A 3TZTA 3FS8A 4FRHA 1ZJ2A 3K8DA 3VBIA 2PA4A 3BSSA 1FR9A 2AH9A 5C1GA 1YP2A 4B2XA 2OI6A 2RJ4A 2V0LA 1S80A 2VS3A 3U2WA 3KIAA 4EAAA 2XMEA 4IRQA 3I0EA 1XATA 2X65A 5C3BA 4ASYA 2ZU8A 4FIXA 2QGIA 1H4EA 3F1YA 4AAWA 3LW6A 4LW3A 2I5KA 3U2VA 1R7YA 1INJA 4Y6NA 2YQJA 4FRBA 5L6VA 3GVDA 5C4BA 4KNRA 1ZHJA 3V90A 5C1HA 3GOSA 4MZUA 1VZTA 3TQDA 1ZJ1A 1FXOA 1FRWA 3PNNA 2P6WA 2BO7A 5AFUV 1ON6A 4NAKA 1HM9A 5FYEA 1MC3A 3F1XA 1VM8A 1G97A 1SSTA 1FWYA 1KRVA 2QIVX 1SSQA 5D92A 2RJ5A 2QKXA 2AESA 3VBPA 1MP4A 1NQIB 4IHFA 2A8UA 1HM0A 3CU0A 3SXCA 1KQAA 3NZ2A 1H7TA 1ZDFA 1S4NA 3U2XA 4HUSA 2O1HA 1VGZA 1R7VA 4IHHA 4EA7A 1V83A 2MZBA 1G93A 2FFVA 5C8RA 3D8VA 3R3IA 2O1FA 5C4CA 2GGOA 1H5SB 2FYAA 3OGZA 1MP5A 4XWIA 4HZCA 1LL3A 4K6RA 2OEGA 1WSZA 3OH1A 3R1WA 2APCA 4KC2A 3I0LA 2WVMA 1KGQA 2AECA 4CVHA 3MQGA 1H5RB 3VNPA 3DJ4A 1KK4A 2FYBA 5CMIA 1G9RA 4EEAA 2AM4A 4N6BA 1VICA 5C48A 4EQYA 3I0FA 1LVWA 4KNXA 3V0LA 3V0OA 1V82A 1YP3A 1THJA 1EZIA 1H5TA 4CJ8A 4D11A 3T57A 4E6TA 3R8YA 3EEVA 3V0MA 1MP3A 4Y64A 3I0JA 2FFUA 2VXLA 3R2WA 3TV0A 3IOJA 3RSBA 2VXMA 3R5AA 4Y7GA 2OI7A 1JV1A 3BRKX 5C49A 2QH5A 3IXCA 1QQ0A 1NHEB 1QRGA 2P2OA 3TIOA 1PZTA 2RIXA 4DDZA 5EJ1A 4FRMA 1VGTA 1KK6A 4Y7TA 5C36A 1KRRA 2YQHA 3JTJA 1QGQA 2Y7AA 4EA9A 1G23A 3T7NA 4ZDQA 1ZCUA 1ON8A 2IU9A 1R7TA 1NMMB 1H5SC 2WE9A 1ZJPA 4EEGA 4KPXA 1INIA 2JCOA 2NPOA 2VSIA 1Z90A 4DE7A 3TWDA 1H5SD 4EVWA 1GQ9A 1S4OA 2YCMA 3TISA 1YP4A 2FYDB 2BO6A 2VS5A 4B42A 2RIZA 3FWWA 1O0RA 2RITA 1FO8A 2QIAA 1VZUA 2RJ7A 2RJ0A 1KK5A 4FREA 2BO8A 3Q7UA 1QRMA 2ICYA 2VFZA 3T7OA 4MYOA 2Z86A 1JV3A 1SS9A 4FCEA 1WT2A 3I0CA 5C4DA 5CQOA 1ZJ3A 3SXGA 5AJOA 3V0NA 5I1FA 3FSYA 3R5CA 1VZXA 1XHBA 4B4BA 4AC3A 4YS8A 2RJ6A 1W77A 1ZIZA 3JUJA 5FUHA 5ADXU 4JD0A 1IIMA 1LZJA 5C1LA 5FTSA 3VBMA 4EEMA 4HO0A 1V67A 3N9WA 4IHGA 4E6UA 3VBNA 4FRAA 1OQMB 1VGWA 4EE5A 2O1GA 2RJ9A 1H3MA 3V4EA 3CKVA 5AJNA 1NKHB 5CQNX 4B3UA 4C2SA 1LL0A 2WVLA 4P00A 5C47A 3KWDA 4MIXA 4LW6A 3ZLLA 1JYLA 2AE7A 1QG8A 5BXCA 4HOCA 4D0TA 2YQCA 4DECA 3I0HA 2UX8A 3DK5A 3FOQA 1TW5A 1WT1A 5CQMX 5E3QA 4HO6A 1XZ6A 4HO9A 4D48A 4M9CA 3CKNA 4GBPA 3ZLKA 3V0PA 3R0SA 1OMXA 3RMWA 2XATA 4R37A 1G8OA 4G3SA 4B4MA 2V0KA 3P47A 2V0IA 2RJ8A 3IOIA 3IOHA 4FQWA 3P1BA 1FO9A 2VD4A 5DDVA 2I7BA 1KGTA 4KXOA 1HJLA 3SXDA 2X5ZA 2XMHA 5C38A 1E5KA 1R7XA 4G3PA 2JF2A 2YC5A 3TDTA 1ZI1A 4E79A 1HV9A 1H7HA 5IDSA 3OTZA 1GWWA 4EE3A 2W0VA 2I5EA 1VPAA 3V0QA 1GX4A 1FGXA 3SRTA 3Q4SA 3F1CA 2XWNA 2AGDA 1V84A 2RJ1A 1VGUA 1MR9A 3BSYA 3R3RA 2IUAA 4N27A 1LZIA 1WT3A 2PGYA 3K8EA 3BCVA 2Y6PA 4FCUA 5FU8A 3U0YA 4O6NA 1LZ0A 1OMZA 4B4GA 1H5SA 3CKQA 2J0AA 4FRPA 2VS4A 3R5DA 1ZDGA 1H4CA 2RIJA 5AJPA 1I52A 2A8WA 4HO3A 3USQA 2WGZA 5HS2A 1H7FA 3VBJA 3VBKA 3CGXA 3OH0A 2AQ9A 4Y7VA 1KRUA 3Q1XA 1QREA 3TK8A 1G3LA 4AYJA 5L6SA 4J18A 1MRLA 1ZCYA 1ZJOA 3HL3A 4AYLA 3I3XA 5ADXV 3BXYA 4KC4A 2GGQA 2WLEA 4HURA 1O7QA 2X60A 3RMVA 2Y4JA 3MC4A 1WVCA 2P73A 2PX7A 1V3WA 1FZWA 1S4PA 3I0KA 1TZFA 4M28A 2Y4LA 3EE5A 2YC3A 4FIYA 3OH2A 1YROB 3ECTA 1ZI3A 4B2WA 3VBLA 5CQLX 1TDTA 3OTMA 1XHDA 3D5NA 3O3PA 3POLA 4Y63A 3HJJA 3FSBA 4MFGA 4HZDA 4M98A 5DDTA 5J49A 4Y7UA 2JCJA 4ASJA 3ST8A 4AA7A 2YESA 5D91A 1QWJA 1K4VA 3ZGFA 3KWCA 2OEFA 2XWLA 5IFYA 4O6MA 4Q7CA 4M2AA 3EG4A 4Y9XA 3NGWA 2Z87A 3PKQA 4Y7FA 3BFPA 4ECMA 2IU8A 4D11C 3I0IX 2C0NA 4KRVA 4N69A 3SXBA 5U2KA 1VH1A 2WEEA 1EYRA 4HO5A 3OAMA 1VH3A 1PZYB 1R81A 1NF5B 1FG5N 1HJJA 4HO2A 3BSWA 4HO4A 5CMGX 2D7RA 3E26A 4FRDA 3JQYA 2NXVA 1MR7A 3V91A 4M99A 2V0JA 2IC7A 5FTVA 4R7PA 5DEMA 3PKPA 4FRLA 4CJBA 2P72A 3ZGGA 4D0ZA 3SPTA 1FOAA 3C8VA 4ARWA 3OW5A 5E3RA 2XWMA 1TVYA 3T7MA 1QGSA 3OU9A 4UEGA 3SXAA 5C3DA 2J0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E1K A;  1LXA A;  1H7E A;  2BO4 A;  4EEO A;  3U2U A;  1FGG A;  4MND A;  2ZU9 A;  4KT7 A;  2VHE A;  3JUK A;  2WLF A;  4ISX A;  2FY7 A;  3DHO A;  4EAB A;  3IGJ A;  1GWV A;  4J09 A;  3KWE A;  2JCL A;  3SX3 A;  4NAI A;  4KPZ A;  1KWS A;  1W55 A;  4Y62 A;  4H7O A;  2Y4M A;  5FV9 A;  3USR A;  5C4E A;  3CKJ A;  2FKO A;  4CJC A;  4R36 A;  3FSC A;  3U2T A;  4N6A A;  1G95 A;  5C3A A;  2RIY A;  5DG3 A;  1JYK A;  1FXJ A;  2JCK A;  1LL2 A;  3U0X A;  5C4F A;  1G2V A;  1QRL A;  3I3A A;  2JF3 A;  4L41 C;  5EIY A;  2V0H A;  2Q4J A;  2WLD A;  4E75 A;  1GA8 A;  1FR8 A;  4M4K A;  5EJZ A;  4KQL A;  4DCL A;  1GX0 A;  2PGV A;  1H5T B;  3GUE A;  2CU2 A;  4HG6 A;  4KC1 A;  1H7L A;  1O23 B;  2D7I A;  5JQQ A;  5E3P A;  2DPW A;  2E8B A;  3V8Z A;  5CMJ A;  3CJ8 A;  1ZCT A;  2WVK A;  3DUV A;  3QVB A;  3OH4 A;  1OCX A;  1H5R A;  5F42 A;  4IRP A;  1O7O A;  4B5B A;  3HSQ A;  3OC9 A;  1LZ7 A;  1ZCV A;  3Q80 A;  4G87 A;  2AM5 A;  5AFU U;  4NAN A;  3SX7 A;  1HM8 A;  4NAL A;  1JVG A;  1W57 A;  1ZI4 A;  5FU0 A;  5IDT A;  2W0W A;  1ZJ0 A;  4FRO A;  2WLC A;  4EGG A;  3E25 A;  4FRQ A;  1G0R A;  3OKR A;  1H7Q A;  3ZF8 A;  4BMA A;  4M2B A;  3OH3 A;  1SSM A;  1NWG B;  1H4D A;  1R7U A;  3PMO A;  1KHR A;  3OUP A;  2WAW A;  5CQP A;  2VSH A;  3SX8 A;  4EA8 A;  3I0D A;  5CMH A;  3I0G A;  4P02 A;  4EE4 A;  1IIN A;  4BQH A;  4G3Q A;  3V8Y A;  2ICX A;  2E3D A;  1GQC A;  1ZI5 A;  3CKO A;  2WLG A;  3SX5 A;  1QRF A;  1J2Z A;  2TDT A;  1R80 A;  3SXE A;  1WT0 A;  1JVD A;  4Y6U A;  3FSX A;  4HCQ A;  3D98 A;  2YQS A;  2ZU7 A;  4MYB A;  4JIS A;  1H7G A;  1T3D A;  2D0J A;  3FTT A;  3MQH A;  4HO8 A;  2AM3 A;  1R82 A;  3EH0 A;  5DEP A;  1TW1 A;  2FYC B;  2X5S A;  3R5B A;  1G1L A;  5CMF X;  2Y4K A;  2OI5 A;  3TZT A;  3FS8 A;  4FRH A;  1ZJ2 A;  3K8D A;  3VBI A;  2PA4 A;  3BSS A;  1FR9 A;  2AH9 A;  5C1G A;  1YP2 A;  4B2X A;  2OI6 A;  2RJ4 A;  2V0L A;  1S80 A;  2VS3 A;  3U2W A;  3KIA A;  4EAA A;  2XME A;  4IRQ A;  3I0E A;  1XAT A;  2X65 A;  5C3B A;  4ASY A;  2ZU8 A;  2QGI A;  1H4E A;  3F1Y A;  4AAW A;  3LW6 A;  4LW3 A;  2I5K A;  3U2V A;  1R7Y A;  1INJ A;  4Y6N A;  2YQJ A;  4FRB A;  5L6V A;  3GVD A;  5C4B A;  4KNR A;  1ZHJ A;  3V90 A;  5C1H A;  3GOS A;  4MZU A;  1VZT A;  3TQD A;  1ZJ1 A;  1FXO A;  1FRW A;  3PNN A;  2P6W A;  2BO7 A;  5AFU V;  1ON6 A;  4NAK A;  1HM9 A;  5FYE A;  1MC3 A;  3F1X A;  1VM8 A;  1G97 A;  1SST A;  1FWY A;  1KRV A;  2QIV X;  1SSQ A;  2RJ5 A;  2QKX A;  2AES A;  3VBP A;  1MP4 A;  1NQI B;  4IHF A;  2A8U A;  1HM0 A;  3CU0 A;  3SXC A;  1KQA A;  3NZ2 A;  1H7T A;  1ZDF A;  1S4N A;  3U2X A;  4HUS A;  2O1H A;  1VGZ A;  1R7V A;  4IHH A;  4EA7 A;  1V83 A;  2MZB A;  1G93 A;  2FFV A;  5C8R A;  3D8V A;  3R3I A;  2O1F A;  5C4C A;  2GGO A;  1H5S B;  2FYA A;  3OGZ A;  1MP5 A;  4XWI A;  4HZC A;  1LL3 A;  4K6R A;  2OEG A;  1WSZ A;  3OH1 A;  3R1W A;  2APC A;  4KC2 A;  3I0L A;  2WVM A;  1KGQ A;  2AEC A;  4CVH A;  3MQG A;  1H5R B;  3VNP A;  3DJ4 A;  1KK4 A;  2FYB A;  5CMI A;  1G9R A;  4EEA A;  2AM4 A;  4N6B A;  1VIC A;  5C48 A;  4EQY A;  3I0F A;  1LVW A;  4KNX A;  3V0L A;  3V0O A;  1V82 A;  1YP3 A;  1THJ A;  1EZI A;  1H5T A;  4CJ8 A;  4D11 A;  3T57 A;  4E6T A;  3R8Y A;  3EEV A;  3V0M A;  1MP3 A;  4Y64 A;  3I0J A;  2FFU A;  2VXL A;  3R2W A;  3TV0 A;  3IOJ A;  3RSB A;  2VXM A;  3R5A A;  4Y7G A;  2OI7 A;  1JV1 A;  3BRK X;  5C49 A;  2QH5 A;  3IXC A;  1QQ0 A;  1NHE B;  1QRG A;  2P2O A;  3TIO A;  1PZT A;  2RIX A;  4DDZ A;  5EJ1 A;  4FRM A;  1VGT A;  1KK6 A;  4Y7T A;  5C36 A;  1KRR A;  2YQH A;  3JTJ A;  1QGQ A;  2Y7A A;  4EA9 A;  1G23 A;  3T7N A;  4ZDQ A;  1ZCU A;  1ON8 A;  2IU9 A;  1R7T A;  1NMM B;  1H5S C;  2WE9 A;  1ZJP A;  4EEG A;  4KPX A;  1INI A;  2JCO A;  2NPO A;  2VSI A;  1Z90 A;  4DE7 A;  3TWD A;  1H5S D;  4EVW A;  1GQ9 A;  1S4O A;  2YCM A;  3TIS A;  1YP4 A;  2FYD B;  2BO6 A;  2VS5 A;  4B42 A;  2RIZ A;  3FWW A;  1O0R A;  2RIT A;  1FO8 A;  2QIA A;  1VZU A;  2RJ7 A;  2RJ0 A;  1KK5 A;  4FRE A;  2BO8 A;  3Q7U A;  1QRM A;  2ICY A;  2VFZ A;  3T7O A;  4MYO A;  2Z86 A;  1JV3 A;  1SS9 A;  4FCE A;  1WT2 A;  3I0C A;  5C4D A;  5CQO A;  1ZJ3 A;  3SXG A;  5AJO A;  3V0N A;  5I1F A;  3FSY A;  3R5C A;  1VZX A;  1XHB A;  4B4B A;  4AC3 A;  4YS8 A;  2RJ6 A;  1W77 A;  1ZIZ A;  3JUJ A;  5FUH A;  5ADX U;  4JD0 A;  1IIM A;  1LZJ A;  5C1L A;  5FTS A;  3VBM A;  4EEM A;  4HO0 A;  1V67 A;  3N9W A;  4IHG A;  4E6U A;  3VBN A;  4FRA A;  1OQM B;  1VGW A;  4EE5 A;  2O1G A;  2RJ9 A;  1H3M A;  3V4E A;  3CKV A;  5AJN A;  1NKH B;  5CQN X;  4B3U A;  4C2S A;  1LL0 A;  2WVL A;  4P00 A;  5C47 A;  3KWD A;  4LW6 A;  3ZLL A;  1JYL A;  2AE7 A;  1QG8 A;  5BXC A;  4HOC A;  4D0T A;  2YQC A;  4DEC A;  3I0H A;  2UX8 A;  3DK5 A;  3FOQ A;  1TW5 A;  1WT1 A;  5CQM X;  5E3Q A;  4HO6 A;  1XZ6 A;  4HO9 A;  4D48 A;  4M9C A;  3CKN A;  4GBP A;  3ZLK A;  3V0P A;  3R0S A;  1OMX A;  3RMW A;  2XAT A;  4R37 A;  1G8O A;  4G3S A;  4B4M A;  2V0K A;  3P47 A;  2V0I A;  2RJ8 A;  3IOI A;  3IOH A;  4FQW A;  3P1B A;  1FO9 A;  2VD4 A;  5DDV A;  2I7B A;  1KGT A;  4KXO A;  1HJL A;  3SXD A;  2X5Z A;  2XMH A;  5C38 A;  1E5K A;  1R7X A;  4G3P A;  2JF2 A;  2YC5 A;  3TDT A;  1ZI1 A;  4E79 A;  1HV9 A;  1H7H A;  5IDS A;  3OTZ A;  1GWW A;  4EE3 A;  2W0V A;  2I5E A;  1VPA A;  3V0Q A;  1GX4 A;  1FGX A;  3SRT A;  3Q4S A;  3F1C A;  2XWN A;  2AGD A;  1V84 A;  2RJ1 A;  1VGU A;  1MR9 A;  3BSY A;  3R3R A;  2IUA A;  4N27 A;  1LZI A;  1WT3 A;  2PGY A;  3K8E A;  3BCV A;  2Y6P A;  4FCU A;  5FU8 A;  3U0Y A;  1LZ0 A;  1OMZ A;  4B4G A;  1H5S A;  3CKQ A;  4FRP A;  2VS4 A;  3R5D A;  1ZDG A;  1H4C A;  2RIJ A;  1I52 A;  2A8W A;  4HO3 A;  3USQ A;  2WGZ A;  5HS2 A;  1H7F A;  3VBJ A;  3VBK A;  3CGX A;  3OH0 A;  2AQ9 A;  4Y7V A;  1KRU A;  3Q1X A;  1QRE A;  3TK8 A;  1G3L A;  4AYJ A;  5L6S A;  4J18 A;  1MRL A;  1ZCY A;  1ZJO A;  3HL3 A;  4AYL A;  3I3X A;  5ADX V;  3BXY A;  4KC4 A;  2GGQ A;  2WLE A;  4HUR A;  1O7Q A;  2X60 A;  3RMV A;  2Y4J A;  3MC4 A;  1WVC A;  2P73 A;  2PX7 A;  1V3W A;  1FZW A;  1S4P A;  3I0K A;  1TZF A;  4M28 A;  2Y4L A;  3EE5 A;  2YC3 A;  3OH2 A;  1YRO B;  3ECT A;  1ZI3 A;  4B2W A;  3VBL A;  5CQL X;  1TDT A;  3OTM A;  1XHD A;  3D5N A;  3O3P A;  3POL A;  4Y63 A;  3HJJ A;  3FSB A;  4MFG A;  4HZD A;  4M98 A;  5DDT A;  5J49 A;  4Y7U A;  2JCJ A;  4ASJ A;  3ST8 A;  4AA7 A;  2YES A;  1QWJ A;  1K4V A;  3ZGF A;  3KWC A;  2OEF A;  2XWL A;  5IFY A;  4M2A A;  3EG4 A;  4Y9X A;  3NGW A;  2Z87 A;  3PKQ A;  4Y7F A;  3BFP A;  4ECM A;  2IU8 A;  4D11 C;  3I0I X;  4KRV A;  4N69 A;  3SXB A;  5U2K A;  1VH1 A;  2WEE A;  1EYR A;  4HO5 A;  3OAM A;  1VH3 A;  1PZY B;  1R81 A;  1NF5 B;  1FG5 N;  1HJJ A;  4HO2 A;  3BSW A;  4HO4 A;  5CMG X;  2D7R A;  3E26 A;  4FRD A;  3JQY A;  2NXV A;  1MR7 A;  3V91 A;  4M99 A;  2V0J A;  2IC7 A;  5FTV A;  4R7P A;  5DEM A;  3PKP A;  4FRL A;  4CJB A;  2P72 A;  3ZGG A;  4D0Z A;  3SPT A;  1FOA A;  3C8V A;  4ARW A;  3OW5 A;  5E3R A;  2XWM A;  1TVY A;  3T7M A;  1QGS A;  3OU9 A;  4UEG A;  3SXA A;  5C3D A;  5AJP A; 
#chains in the Genus database with same CATH topology
 4E1K A;  1LXA A;  1H7E A;  2BO4 A;  4EEO A;  3U2U A;  1FGG A;  4MND A;  2ZU9 A;  4KT7 A;  2VHE A;  3JUK A;  2WLF A;  4ISX A;  2FY7 A;  3DHO A;  4EAB A;  3IGJ A;  1GWV A;  4J09 A;  3KWE A;  2JCL A;  3SX3 A;  4NAI A;  4KPZ A;  1KWS A;  1W55 A;  4Y62 A;  4H7O A;  2Y4M A;  5FV9 A;  3USR A;  5C4E A;  3CKJ A;  2FKO A;  4CJC A;  4R36 A;  3FSC A;  3U2T A;  4N6A A;  1G95 A;  5C3A A;  2RIY A;  5DG3 A;  1JYK A;  1FXJ A;  2JCK A;  1LL2 A;  3U0X A;  5C4F A;  1L0S A;  1G2V A;  1QRL A;  3I3A A;  2JF3 A;  4L41 C;  5EIY A;  2V0H A;  2Q4J A;  2WLD A;  4E75 A;  1GA8 A;  1FR8 A;  4M4K A;  5EJZ A;  4KQL A;  4DCL A;  1GX0 A;  2PGV A;  1H5T B;  3GUE A;  1Z2F A;  2CU2 A;  4HG6 A;  4KC1 A;  1H7L A;  1O23 B;  2D7I A;  5JQQ A;  5E3P A;  2DPW A;  2E8B A;  3V8Z A;  5CMJ A;  3CJ8 A;  1ZCT A;  2WVK A;  3DUV A;  3QVB A;  3OH4 A;  1OCX A;  1H5R A;  5F42 A;  4IRP A;  3GQ8 A;  1O7O A;  4B5B A;  3HSQ A;  3OC9 A;  1LZ7 A;  1ZCV A;  3Q80 A;  4G87 A;  2AM5 A;  5AFU U;  4NAN A;  3SX7 A;  1HM8 A;  4NAL A;  1JVG A;  1W57 A;  1ZI4 A;  5FU0 A;  5IDT A;  2W0W A;  1ZJ0 A;  3SUC A;  4FRO A;  2WLC A;  4EGG A;  3E25 A;  4FRQ A;  1G0R A;  3OKR A;  1H7Q A;  3ZF8 A;  4BMA A;  4M2B A;  3OH3 A;  1SSM A;  1NWG B;  1H4D A;  1R7U A;  3PMO A;  1KHR A;  3OUP A;  2WAW A;  5CQP A;  2VSH A;  3SX8 A;  4EA8 A;  2VK9 A;  3I0D A;  5CMH A;  3I0G A;  4P02 A;  4EE4 A;  1IIN A;  4BQH A;  4G3Q A;  3V8Y A;  2ICX A;  2E3D A;  1GQC A;  1ZI5 A;  3CKO A;  2WLG A;  3SX5 A;  1QRF A;  1J2Z A;  2TDT A;  1R80 A;  3SXE A;  1WT0 A;  1JVD A;  4Y6U A;  3FSX A;  4HCQ A;  3D98 A;  2YQS A;  2ZU7 A;  4MYB A;  4JIS A;  1H7G A;  1T3D A;  2D0J A;  3FTT A;  3MQH A;  4HO8 A;  2AM3 A;  1R82 A;  3EH0 A;  5DEP A;  1TW1 A;  2FYC B;  2X5S A;  3R5B A;  1G1L A;  5CMF X;  2Y4K A;  2OI5 A;  3TZT A;  3FS8 A;  4FRH A;  1ZJ2 A;  3K8D A;  3VBI A;  2PA4 A;  3BSS A;  1FR9 A;  2AH9 A;  5C1G A;  1YP2 A;  4B2X A;  2OI6 A;  2RJ4 A;  2V0L A;  1S80 A;  2VS3 A;  3U2W A;  3KIA A;  4EAA A;  2XME A;  4IRQ A;  3I0E A;  1XAT A;  2X65 A;  5C3B A;  4ASY A;  2ZU8 A;  4FIX A;  2QGI A;  1H4E A;  3F1Y A;  4AAW A;  3LW6 A;  4LW3 A;  2I5K A;  3U2V A;  1R7Y A;  1INJ A;  4Y6N A;  2YQJ A;  4FRB A;  5L6V A;  3GVD A;  5C4B A;  4KNR A;  1ZHJ A;  3V90 A;  5C1H A;  3GOS A;  4MZU A;  1VZT A;  3TQD A;  1ZJ1 A;  1FXO A;  1FRW A;  3PNN A;  2P6W A;  2BO7 A;  5AFU V;  1ON6 A;  4NAK A;  1HM9 A;  5FYE A;  1MC3 A;  3F1X A;  1VM8 A;  1G97 A;  1SST A;  1FWY A;  1KRV A;  2QIV X;  1SSQ A;  5D92 A;  2RJ5 A;  2QKX A;  2AES A;  3VBP A;  1MP4 A;  1NQI B;  4IHF A;  2A8U A;  1HM0 A;  3CU0 A;  3SXC A;  1KQA A;  3NZ2 A;  1H7T A;  1ZDF A;  1S4N A;  3U2X A;  4HUS A;  2O1H A;  1VGZ A;  1R7V A;  4IHH A;  4EA7 A;  1V83 A;  2MZB A;  1G93 A;  2FFV A;  5C8R A;  3D8V A;  3R3I A;  2O1F A;  5C4C A;  2GGO A;  3OGZ A;  1H5S B;  2FYA A;  1MP5 A;  4XWI A;  4HZC A;  1LL3 A;  4K6R A;  2OEG A;  3OH1 A;  1WSZ A;  3R1W A;  2APC A;  4KC2 A;  3I0L A;  2WVM A;  1KGQ A;  2AEC A;  4CVH A;  3MQG A;  1H5R B;  3VNP A;  3DJ4 A;  1KK4 A;  2FYB A;  5CMI A;  1G9R A;  4EEA A;  2AM4 A;  4N6B A;  1VIC A;  5C48 A;  4EQY A;  3I0F A;  1LVW A;  4KNX A;  3V0L A;  3V0O A;  1V82 A;  1YP3 A;  1THJ A;  1EZI A;  1H5T A;  4CJ8 A;  4D11 A;  3T57 A;  4E6T A;  3R8Y A;  3EEV A;  3V0M A;  1MP3 A;  4Y64 A;  3I0J A;  2FFU A;  2VXL A;  3R2W A;  3TV0 A;  3IOJ A;  3RSB A;  2VXM A;  3R5A A;  4Y7G A;  2OI7 A;  1JV1 A;  3BRK X;  5C49 A;  2QH5 A;  3IXC A;  1QQ0 A;  1NHE B;  1QRG A;  2P2O A;  3TIO A;  1PZT A;  2RIX A;  4DDZ A;  5EJ1 A;  4FRM A;  1N4I A;  1KK6 A;  1VGT A;  4Y7T A;  5C36 A;  1KRR A;  2YQH A;  3JTJ A;  1QGQ A;  2Y7A A;  4EA9 A;  1G23 A;  3T7N A;  4ZDQ A;  1ZCU A;  1ON8 A;  2IU9 A;  1R7T A;  1NMM B;  1H5S C;  2WE9 A;  1ZJP A;  4EEG A;  3GQ9 A;  4KPX A;  1INI A;  2JCO A;  2NPO A;  2VSI A;  1Z90 A;  4DE7 A;  3TWD A;  1H5S D;  4EVW A;  1GQ9 A;  1S4O A;  2YCM A;  3TIS A;  1YP4 A;  2FYD B;  2BO6 A;  2VS5 A;  4B42 A;  2RIZ A;  3FWW A;  1O0R A;  2RIT A;  1FO8 A;  2QIA A;  1VZU A;  2RJ7 A;  2RJ0 A;  1KK5 A;  4FRE A;  2BO8 A;  3Q7U A;  1QRM A;  2ICY A;  2VFZ A;  3T7O A;  4MYO A;  2Z86 A;  1JV3 A;  1SS9 A;  4FCE A;  1WT2 A;  3I0C A;  5C4D A;  5CQO A;  1ZJ3 A;  3SXG A;  5AJO A;  3V0N A;  5I1F A;  3FSY A;  3R5C A;  1VZX A;  1XHB A;  4B4B A;  4AC3 A;  4YS8 A;  2RJ6 A;  1W77 A;  1ZIZ A;  3JUJ A;  5FUH A;  5ADX U;  4JD0 A;  1IIM A;  1LZJ A;  5C1L A;  5FTS A;  3VBM A;  4EEM A;  4HO0 A;  1V67 A;  3N9W A;  4IHG A;  4E6U A;  3VBN A;  4FRA A;  1OQM B;  1VGW A;  4EE5 A;  2O1G A;  2RJ9 A;  1H3M A;  3V4E A;  3CKV A;  5AJN A;  1NKH B;  5CQN X;  4B3U A;  4C2S A;  1LL0 A;  2WVL A;  4P00 A;  5C47 A;  3KWD A;  4MIX A;  4LW6 A;  3ZLL A;  1JYL A;  2AE7 A;  1QG8 A;  5BXC A;  4HOC A;  4D0T A;  2YQC A;  4DEC A;  3I0H A;  2UX8 A;  3DK5 A;  3FOQ A;  1TW5 A;  1WT1 A;  5CQM X;  5E3Q A;  4HO6 A;  1XZ6 A;  4HO9 A;  4D48 A;  4M9C A;  3CKN A;  4GBP A;  3ZLK A;  3V0P A;  3R0S A;  1OMX A;  3RMW A;  2XAT A;  4R37 A;  1G8O A;  4G3S A;  4B4M A;  2V0K A;  3P47 A;  2V0I A;  2RJ8 A;  3IOI A;  1M8N A;  3IOH A;  4FQW A;  3P1B A;  1FO9 A;  2VD4 A;  5DDV A;  2I7B A;  1KGT A;  4KXO A;  1HJL A;  3SXD A;  2X5Z A;  2XMH A;  5C38 A;  1E5K A;  1R7X A;  4G3P A;  2JF2 A;  2YC5 A;  3TDT A;  1ZI1 A;  4E79 A;  1HV9 A;  1H7H A;  5IDS A;  3OTZ A;  1GWW A;  4EE3 A;  2W0V A;  2I5E A;  1VPA A;  3V0Q A;  1GX4 A;  1FGX A;  3SRT A;  3Q4S A;  3F1C A;  2XWN A;  2AGD A;  1V84 A;  2RJ1 A;  1VGU A;  1MR9 A;  3BSY A;  3R3R A;  2IUA A;  4N27 A;  1LZI A;  1WT3 A;  2PGY A;  3K8E A;  3BCV A;  2Y6P A;  4FCU A;  5FU8 A;  3U0Y A;  4O6N A;  1LZ0 A;  1OMZ A;  4B4G A;  1H5S A;  3CKQ A;  2J0A A;  4FRP A;  2VS4 A;  3R5D A;  1ZDG A;  1H4C A;  2RIJ A;  5AJP A;  1I52 A;  2A8W A;  4HO3 A;  3USQ A;  2WGZ A;  5HS2 A;  1H7F A;  3VBJ A;  3OH0 A;  3VBK A;  3CGX A;  2AQ9 A;  4Y7V A;  1KRU A;  3GQ7 A;  3Q1X A;  1QRE A;  3TK8 A;  1G3L A;  4AYJ A;  5L6S A;  4J18 A;  1MRL A;  1ZCY A;  1ZJO A;  3HL3 A;  4AYL A;  3I3X A;  5ADX V;  3BXY A;  4KC4 A;  2GGQ A;  2WLE A;  4HUR A;  1O7Q A;  2X60 A;  3RMV A;  2Y4J A;  3MC4 A;  1WVC A;  2P73 A;  2PX7 A;  1V3W A;  1FZW A;  1S4P A;  3I0K A;  1TZF A;  4M28 A;  2Y4L A;  3EE5 A;  2YC3 A;  4FIY A;  3OH2 A;  1YRO B;  3ECT A;  1ZI3 A;  4B2W A;  3VBL A;  3GQA A;  5CQL X;  1TDT A;  3OTM A;  1XHD A;  3D5N A;  3O3P A;  3POL A;  4Y63 A;  3HJJ A;  3FSB A;  4MFG A;  4HZD A;  4M98 A;  5DDT A;  5J49 A;  4Y7U A;  2JCJ A;  4ASJ A;  3ST8 A;  4AA7 A;  2YES A;  5D91 A;  1QWJ A;  1K4V A;  3ZGF A;  3KWC A;  2OEF A;  2XWL A;  5IFY A;  4O6M A;  4Q7C A;  4M2A A;  3EG4 A;  4Y9X A;  3NGW A;  2Z87 A;  3PKQ A;  4Y7F A;  3BFP A;  1EWW A;  4ECM A;  2IU8 A;  4D11 C;  3I0I X;  2C0N A;  4KRV A;  4N69 A;  3SXB A;  5U2K A;  1VH1 A;  2WEE A;  1EYR A;  4HO5 A;  3OAM A;  1VH3 A;  1PZY B;  1R81 A;  1NF5 B;  1FG5 N;  1HJJ A;  4HO2 A;  3BSW A;  4HO4 A;  5CMG X;  2D7R A;  3E26 A;  4FRD A;  3JQY A;  2NXV A;  1MR7 A;  3V91 A;  4M99 A;  2V0J A;  2IC7 A;  5FTV A;  4R7P A;  5DEM A;  3PKP A;  4FRL A;  4CJB A;  2P72 A;  3ZGG A;  4D0Z A;  3SPT A;  1FOA A;  3C8V A;  4ARW A;  3OW5 A;  5E3R A;  2XWM A;  1TVY A;  3T7M A;  1QGS A;  3OU9 A;  4UEG A;  3SXA A;  5C3D A;  2J0B A; 
#chains in the Genus database with same CATH homology
 4E1K A;  1LXA A;  1H7E A;  2BO4 A;  4EEO A;  3U2U A;  1FGG A;  4MND A;  2ZU9 A;  4KT7 A;  2VHE A;  3JUK A;  2WLF A;  4ISX A;  2FY7 A;  3DHO A;  4EAB A;  3IGJ A;  1GWV A;  4J09 A;  3KWE A;  2JCL A;  3SX3 A;  4NAI A;  4KPZ A;  1KWS A;  1W55 A;  4Y62 A;  4H7O A;  2Y4M A;  5FV9 A;  3USR A;  5C4E A;  3CKJ A;  2FKO A;  4CJC A;  4R36 A;  3FSC A;  3U2T A;  4N6A A;  1G95 A;  5C3A A;  2RIY A;  5DG3 A;  1JYK A;  1FXJ A;  2JCK A;  1LL2 A;  3U0X A;  5C4F A;  1G2V A;  1QRL A;  3I3A A;  2JF3 A;  4L41 C;  5EIY A;  2V0H A;  2Q4J A;  2WLD A;  4E75 A;  1GA8 A;  1FR8 A;  4M4K A;  5EJZ A;  4KQL A;  4DCL A;  1GX0 A;  2PGV A;  1H5T B;  3GUE A;  2CU2 A;  4HG6 A;  4KC1 A;  1H7L A;  1O23 B;  2D7I A;  5JQQ A;  5E3P A;  2DPW A;  2E8B A;  3V8Z A;  5CMJ A;  3CJ8 A;  1ZCT A;  2WVK A;  3DUV A;  3QVB A;  3OH4 A;  1OCX A;  1H5R A;  5F42 A;  4IRP A;  1O7O A;  4B5B A;  3HSQ A;  3OC9 A;  1LZ7 A;  1ZCV A;  3Q80 A;  4G87 A;  2AM5 A;  5AFU U;  4NAN A;  3SX7 A;  1HM8 A;  4NAL A;  1JVG A;  1W57 A;  1ZI4 A;  5FU0 A;  5IDT A;  2W0W A;  1ZJ0 A;  4FRO A;  2WLC A;  4EGG A;  3E25 A;  4FRQ A;  1G0R A;  3OKR A;  1H7Q A;  3ZF8 A;  4BMA A;  4M2B A;  3OH3 A;  1SSM A;  1NWG B;  1H4D A;  1R7U A;  3PMO A;  1KHR A;  3OUP A;  2WAW A;  5CQP A;  2VSH A;  3SX8 A;  4EA8 A;  2VK9 A;  3I0D A;  5CMH A;  3I0G A;  4P02 A;  4EE4 A;  1IIN A;  4BQH A;  4G3Q A;  3V8Y A;  2ICX A;  2E3D A;  1GQC A;  1ZI5 A;  3CKO A;  2WLG A;  3SX5 A;  1QRF A;  1J2Z A;  2TDT A;  1R80 A;  3SXE A;  1WT0 A;  1JVD A;  4Y6U A;  3FSX A;  4HCQ A;  3D98 A;  2YQS A;  2ZU7 A;  4MYB A;  4JIS A;  1H7G A;  1T3D A;  2D0J A;  3FTT A;  3MQH A;  4HO8 A;  2AM3 A;  1R82 A;  3EH0 A;  5DEP A;  1TW1 A;  2FYC B;  2X5S A;  3R5B A;  1G1L A;  5CMF X;  2Y4K A;  2OI5 A;  3TZT A;  3FS8 A;  4FRH A;  1ZJ2 A;  3K8D A;  3VBI A;  2PA4 A;  3BSS A;  1FR9 A;  2AH9 A;  5C1G A;  1YP2 A;  4B2X A;  2OI6 A;  2RJ4 A;  2V0L A;  1S80 A;  2VS3 A;  3U2W A;  3KIA A;  4EAA A;  2XME A;  4IRQ A;  3I0E A;  1XAT A;  2X65 A;  5C3B A;  4ASY A;  2ZU8 A;  4FIX A;  2QGI A;  1H4E A;  3F1Y A;  4AAW A;  3LW6 A;  4LW3 A;  2I5K A;  3U2V A;  1R7Y A;  1INJ A;  4Y6N A;  2YQJ A;  4FRB A;  5L6V A;  3GVD A;  5C4B A;  4KNR A;  1ZHJ A;  3V90 A;  5C1H A;  3GOS A;  4MZU A;  1VZT A;  3TQD A;  1ZJ1 A;  1FXO A;  1FRW A;  3PNN A;  2P6W A;  2BO7 A;  5AFU V;  1ON6 A;  4NAK A;  1HM9 A;  5FYE A;  1MC3 A;  3F1X A;  1VM8 A;  1G97 A;  1SST A;  1FWY A;  1KRV A;  2QIV X;  1SSQ A;  5D92 A;  2RJ5 A;  2QKX A;  2AES A;  3VBP A;  1MP4 A;  1NQI B;  4IHF A;  2A8U A;  1HM0 A;  3CU0 A;  3SXC A;  1KQA A;  3NZ2 A;  1H7T A;  1ZDF A;  1S4N A;  3U2X A;  4HUS A;  2O1H A;  1VGZ A;  1R7V A;  4IHH A;  4EA7 A;  1V83 A;  2MZB A;  1G93 A;  2FFV A;  5C8R A;  3D8V A;  3R3I A;  2O1F A;  5C4C A;  2GGO A;  1H5S B;  2FYA A;  3OGZ A;  1MP5 A;  4XWI A;  4HZC A;  1LL3 A;  4K6R A;  2OEG A;  1WSZ A;  3OH1 A;  3R1W A;  2APC A;  4KC2 A;  3I0L A;  2WVM A;  1KGQ A;  2AEC A;  4CVH A;  3MQG A;  1H5R B;  3VNP A;  3DJ4 A;  1KK4 A;  2FYB A;  5CMI A;  1G9R A;  4EEA A;  2AM4 A;  4N6B A;  1VIC A;  5C48 A;  4EQY A;  3I0F A;  1LVW A;  4KNX A;  3V0L A;  3V0O A;  1V82 A;  1YP3 A;  1THJ A;  1EZI A;  1H5T A;  4CJ8 A;  4D11 A;  3T57 A;  4E6T A;  3R8Y A;  3EEV A;  3V0M A;  1MP3 A;  4Y64 A;  3I0J A;  2FFU A;  2VXL A;  3R2W A;  3TV0 A;  3IOJ A;  3RSB A;  2VXM A;  3R5A A;  4Y7G A;  2OI7 A;  1JV1 A;  3BRK X;  5C49 A;  2QH5 A;  3IXC A;  1QQ0 A;  1NHE B;  1QRG A;  2P2O A;  3TIO A;  1PZT A;  2RIX A;  4DDZ A;  5EJ1 A;  4FRM A;  1VGT A;  1KK6 A;  4Y7T A;  5C36 A;  1KRR A;  2YQH A;  3JTJ A;  1QGQ A;  2Y7A A;  4EA9 A;  1G23 A;  3T7N A;  4ZDQ A;  1ZCU A;  1ON8 A;  2IU9 A;  1R7T A;  1NMM B;  1H5S C;  2WE9 A;  1ZJP A;  4EEG A;  4KPX A;  1INI A;  2JCO A;  2NPO A;  2VSI A;  1Z90 A;  4DE7 A;  3TWD A;  1H5S D;  4EVW A;  1GQ9 A;  1S4O A;  2YCM A;  3TIS A;  1YP4 A;  2FYD B;  2BO6 A;  2VS5 A;  4B42 A;  2RIZ A;  3FWW A;  1O0R A;  2RIT A;  1FO8 A;  2QIA A;  1VZU A;  2RJ7 A;  2RJ0 A;  1KK5 A;  4FRE A;  2BO8 A;  3Q7U A;  1QRM A;  2ICY A;  2VFZ A;  3T7O A;  4MYO A;  2Z86 A;  1JV3 A;  1SS9 A;  4FCE A;  1WT2 A;  3I0C A;  5C4D A;  5CQO A;  1ZJ3 A;  3SXG A;  5AJO A;  3V0N A;  5I1F A;  3FSY A;  3R5C A;  1VZX A;  1XHB A;  4B4B A;  4AC3 A;  4YS8 A;  2RJ6 A;  1W77 A;  1ZIZ A;  3JUJ A;  5FUH A;  5ADX U;  4JD0 A;  1IIM A;  1LZJ A;  5C1L A;  5FTS A;  3VBM A;  4EEM A;  4HO0 A;  1V67 A;  3N9W A;  4IHG A;  4E6U A;  3VBN A;  4FRA A;  1OQM B;  1VGW A;  4EE5 A;  2O1G A;  2RJ9 A;  1H3M A;  3V4E A;  3CKV A;  5AJN A;  1NKH B;  5CQN X;  4B3U A;  4C2S A;  1LL0 A;  2WVL A;  4P00 A;  5C47 A;  3KWD A;  4MIX A;  4LW6 A;  3ZLL A;  1JYL A;  2AE7 A;  1QG8 A;  5BXC A;  4HOC A;  4D0T A;  2YQC A;  4DEC A;  3I0H A;  2UX8 A;  3DK5 A;  3FOQ A;  1TW5 A;  1WT1 A;  5CQM X;  5E3Q A;  4HO6 A;  1XZ6 A;  4HO9 A;  4D48 A;  4M9C A;  3CKN A;  4GBP A;  3ZLK A;  3V0P A;  3R0S A;  1OMX A;  3RMW A;  2XAT A;  4R37 A;  1G8O A;  4G3S A;  4B4M A;  2V0K A;  3P47 A;  2V0I A;  2RJ8 A;  3IOI A;  3IOH A;  4FQW A;  3P1B A;  1FO9 A;  2VD4 A;  5DDV A;  2I7B A;  1KGT A;  4KXO A;  1HJL A;  3SXD A;  2X5Z A;  2XMH A;  5C38 A;  1E5K A;  1R7X A;  4G3P A;  2JF2 A;  2YC5 A;  3TDT A;  1ZI1 A;  4E79 A;  1HV9 A;  1H7H A;  5IDS A;  3OTZ A;  1GWW A;  4EE3 A;  2W0V A;  2I5E A;  1VPA A;  3V0Q A;  1GX4 A;  1FGX A;  3SRT A;  3Q4S A;  3F1C A;  2XWN A;  2AGD A;  1V84 A;  2RJ1 A;  1VGU A;  1MR9 A;  3BSY A;  3R3R A;  2IUA A;  4N27 A;  1LZI A;  1WT3 A;  2PGY A;  3K8E A;  3BCV A;  2Y6P A;  4FCU A;  5FU8 A;  3U0Y A;  4O6N A;  1LZ0 A;  1OMZ A;  4B4G A;  1H5S A;  3CKQ A;  2J0A A;  4FRP A;  2VS4 A;  3R5D A;  1ZDG A;  1H4C A;  2RIJ A;  5AJP A;  1I52 A;  2A8W A;  4HO3 A;  3USQ A;  2WGZ A;  5HS2 A;  1H7F A;  3VBJ A;  3VBK A;  3CGX A;  3OH0 A;  2AQ9 A;  4Y7V A;  1KRU A;  3Q1X A;  1QRE A;  3TK8 A;  1G3L A;  4AYJ A;  5L6S A;  4J18 A;  1MRL A;  1ZCY A;  1ZJO A;  3HL3 A;  4AYL A;  3I3X A;  5ADX V;  3BXY A;  4KC4 A;  2GGQ A;  2WLE A;  4HUR A;  1O7Q A;  2X60 A;  3RMV A;  2Y4J A;  3MC4 A;  1WVC A;  2P73 A;  2PX7 A;  1V3W A;  1FZW A;  1S4P A;  3I0K A;  1TZF A;  4M28 A;  2Y4L A;  3EE5 A;  2YC3 A;  4FIY A;  3OH2 A;  1YRO B;  3ECT A;  1ZI3 A;  4B2W A;  3VBL A;  5CQL X;  1TDT A;  3OTM A;  1XHD A;  3D5N A;  3O3P A;  3POL A;  4Y63 A;  3HJJ A;  3FSB A;  4MFG A;  4HZD A;  4M98 A;  5DDT A;  5J49 A;  4Y7U A;  2JCJ A;  4ASJ A;  3ST8 A;  4AA7 A;  2YES A;  5D91 A;  1QWJ A;  1K4V A;  3ZGF A;  3KWC A;  2OEF A;  2XWL A;  5IFY A;  4O6M A;  4Q7C A;  4M2A A;  3EG4 A;  4Y9X A;  3NGW A;  2Z87 A;  3PKQ A;  4Y7F A;  3BFP A;  4ECM A;  2IU8 A;  4D11 C;  3I0I X;  2C0N A;  4KRV A;  4N69 A;  3SXB A;  5U2K A;  1VH1 A;  2WEE A;  1EYR A;  4HO5 A;  3OAM A;  1VH3 A;  1PZY B;  1R81 A;  1NF5 B;  1FG5 N;  1HJJ A;  4HO2 A;  3BSW A;  4HO4 A;  5CMG X;  2D7R A;  3E26 A;  4FRD A;  3JQY A;  2NXV A;  1MR7 A;  3V91 A;  4M99 A;  2V0J A;  2IC7 A;  5FTV A;  4R7P A;  5DEM A;  3PKP A;  4FRL A;  4CJB A;  2P72 A;  3ZGG A;  4D0Z A;  3SPT A;  1FOA A;  3C8V A;  4ARW A;  3OW5 A;  5E3R A;  2XWM A;  1TVY A;  3T7M A;  1QGS A;  3OU9 A;  4UEG A;  3SXA A;  5C3D A;  2J0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...