3FOQA

Crystal structure of n-acetylglucosamine-1-phosphate uridyltransferase (glmu) from mycobacterium tuberculosis in a cubic space group.
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
473
structure length
439
Chain Sequence
MTFPGDTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDRILRTQDHEVMAIVQEVNAGVYAFDIAALRSALSRLYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional protein glmU
publication title Structure of N-acetylglucosamine-1-phosphate uridyltransferase (GlmU) from Mycobacterium tuberculosis in a cubic space group.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 121
structure length 439
sequence length 473
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2008-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3foqA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3foqA01
1KK5A 2YQJA 2AM5A 3FS8A 1V67A 3SX7A 1LXAA 4AA7A 1R7TA 3DJ4A 2YESA 5EIYA 2I7BA 4MNDA 1ZI4A 4N27A 3R5CA 1JV3A 5C4CA 3ZLLA 4H7OA 4KPZA 4KQLA 1V84A 4D0ZA 2YQCA 2RIJA 4B4MA 1ZJ2A 4M2AA 2IUAA 4R37A 2AECA 3HSQA 3Q1XA 3DHOA 3I0GA 4M4KA 3CKNA 1ZI5A 4ARWA 1FO8A 4XWIA 3FSBA 4KPXA 3BSYA 1G97A 3BSWA 1S4NA 1KRUA 4E75A 5IFYA 4K6RA 1G23A 4GBPA 4EA7A 1FR8A 4HZDA 4B4BA 5E3QA 2OI5A 2WE9A 1G9RA 4KT7A 3R3RA 4N69A 2QH5A 1SSMA 3LW6A 2NXVA 3R3IA 5L6VA 2RJ6A 1VZUA 2RJ1A 3OAMA 3JTJA 3OH2A 2WEEA 3I0JA 3O3PA 3RMWA 3FSXA 3RSBA 4LW6A 1G1LA 4EVWA 1QRLA 4D48A 4NAIA 4Y9XA 4LW3A 4JD0A 3VBMA 1ZJ1A 4M99A 3E25A 1G0RA 3I0IX 3R1WA 1KK4A 3TV0A 3DK5A 5C36A 3QVBA 4N6AA 3ST8A 1TW5A 2RJ5A 2VS5A 1V82A 4FCUA 3V0NA 1XZ6A 1LL3A 5CMIA 1QQ0A 2RIXA 2WVMA 2RJ9A 4Y63A 1WT3A 3I0CA 4CJBA 3E26A 2JF3A 4AYLA 5DEMA 3VBJA 4M2BA 4IRQA 3MQGA 4DDZA 5EJ1A 1H5SB 1MP4A 2WLEA 3Q4SA 3I3XA 4KNXA 3SXGA 3U0XA 3EH0A 4FRHA 3T7OA 2XWLA 4FCEA 2CU2A 3V8ZA 4Y7GA 3I0LA 1SSTA 5CMFX 2OI7A 4IHHA 4M9CA 3NGWA 3NZ2A 3ZLKA 1T3DA 2RJ7A 2WAWA 1R7VA 3SXBA 1LVWA 3R8YA 4HO0A 5AFUV 5CQPA 1KRVA 1KHRA 1H7GA 1VGWA 1ZCUA 2WLGA 1GWWA 4B3UA 3TK8A 2ICYA 1V83A 2VHEA 5CQLX 1R82A 5CQMX 5CMJA 3BFPA 3PNNA 5C4DA 2GGOA 1FXOA 3K8EA 3Q80A 4IHGA 1FZWA 1PZYB 4P00A 2YC3A 2JCOA 1MC3A 2P72A 1ZCTA 1XHDA 1KRRA 2A8WA 2RJ8A 5C48A 3U0YA 2QGIA 4ISXA 4G3QA 2A8UA 2APCA 1YP2A 2VS4A 3I0DA 4MYBA 1TW1A 2Y7AA 2WVKA 2O1GA 3TISA 4AAWA 4BQHA 1WT1A 1ZHJA 1H7QA 1LZ7A 4EABA 3I0EA 5E3RA 5C3AA 1ON6A 3F1YA 1VGUA 3VBIA 1S4PA 2FYDB 2Z87A 5U2KA 5CQNX 1INJA 2BO8A 2Y6PA 4FRMA 1LL2A 1R7XA 5C49A 4KC2A 1G2VA 3CKJA 4Y62A 5AJPA 3USQA 2WLFA 1IIMA 1E5KA 2BO7A 1QRFA 1ZCVA 3GUEA 1H5TA 4EA8A 1TZFA 1W57A 2MZBA 3V8YA 1O7QA 3F1CA 4DE7A 2YC5A 3D8VA 3V0QA 4J18A 3T57A 3TZTA 5FTVA 2YQHA 4NAKA 1ZJOA 3RMVA 4FRQA 1LZJA 4Y7VA 2Y4MA 5DEPA 1WSZA 3SXCA 1H5RA 2NPOA 4ZDQA 2I5KA 5C8RA 5C4FA 5FYEA 3IOJA 3SXEA 3U2WA 3OKRA 1JVDA 2V0JA 2E3DA 4R36A 1FR9A 2RIZA 5AJOA 1GX0A 1GQ9A 1OQMB 3OH4A 4J09A 1THJA 3U2XA 1J2ZA 4MZUA 3GOSA 1JV1A 3KWDA 1IINA 3SX3A 5EJZA 1KQAA 2OEGA 2QKXA 2ZU8A 5AFUU 1NMMB 4FREA 2WLDA 3C8VA 2XWMA 1H7EA 1ZI3A 4FRAA 2P73A 3V0PA 2IU8A 2AQ9A 1H4CA 3V0LA 2RJ4A 2AESA 4EA9A 1O23B 4E1KA 4UEGA 3U2UA 1G8OA 3BRKX 4KXOA 3P1BA 3R5DA 4C2SA 4M98A 2X60A 4Y7UA 4KNRA 1O7OA 1W55A 4Y7FA 5AJNA 4HO4A 4DECA 1ZDGA 1FO9A 1GQCA 2P2OA 2XMHA 2BO4A 1HJJA 3SX8A 1R80A 3BXYA 1MR9A 3HJJA 3FWWA 2FFUA 1FG5N 2TDTA 1H7LA 2VFZA 3V0MA 4L41C 4HURA 5L6SA 2FFVA 3CJ8A 3KIAA 4IRPA 4HO2A 5C1LA 5FTSA 5I1FA 3OW5A 5IDTA 1FOAA 2V0LA 3VBPA 4MYOA 4HO3A 2Y4LA 3TQDA 4E79A 1SS9A 3GVDA 3CKVA 1EYRA 1MP5A 3FOQA 2RJ0A 3CKQA 2AGDA 1XHBA 1H7FA 2ZU7A 3R2WA 2Q4JA 1VPAA 3SX5A 3P47A 2JCKA 3IOIA 3FSYA 3OUPA 3R5BA 1HV9A 1NHEB 2JCJA 1ZI1A 4FRLA 4E6TA 5DDVA 2VXLA 4HO6A 3EE5A 3JQYA 5C4EA 1H4DA 4ECMA 2RIYA 1FGXA 2IC7A 1JVGA 3SRTA 3F1XA 2VSHA 3HL3A 4BMAA 5J49A 3CGXA 1TDTA 4KRVA 2FKOA 3BSSA 1G3LA 4EEOA 1OCXA 4CVHA 2VS3A 2PA4A 3TIOA 2QIAA 5E3PA 1K4VA 1KGQA 3V90A 4ASJA 4HOCA 3T7MA 1HJLA 1WT2A 2X5ZA 1HM0A 1H5RB 1VZXA 1NF5B 4HO9A 2W0WA 4B42A 2ZU9A 2FYCB 3JUJA 2VD4A 1QWJA 5IDSA 2O1FA 3VBLA 1NKHB 4EE4A 2P6WA 3IGJA 3ZGGA 1G93A 1HM8A 1ON8A 4FRBA 1G95A 2IU9A 1NWGB 4CJ8A 3KWCA 3PMOA 1NQIB 3V4EA 3PKPA 1ZJ3A 4G3PA 4ASYA 1H7TA 4E6UA 1KGTA 1WT0A 4Y7TA 2V0IA 1H3MA 3OH0A 2YQSA 1S4OA 1TVYA 5JQQA 3CU0A 2I5EA 2DPWA 5C38A 5F42A 3OH3A 4FROA 2GGQA 2O1HA 1XATA 4HCQA 1O0RA 4MFGA 1QGQA 1MRLA 3ECTA 4EEAA 1GWVA 1W77A 2UX8A 3POLA 1FXJA 1S80A 4JISA 3OU9A 3I0HA 4EE3A 1LZ0A 2AE7A 4YS8A 2XWNA 2ICXA 3IXCA 5FU0A 5HS2A 1VM8A 5ADXV 3OH1A 1VH1A 1LL0A 2PGYA 3USRA 1V3WA 4HG6A 1MR7A 3SXDA 3BCVA 4N6BA 3I0FA 4R7PA 1MP3A 3I0KA 3R5AA 1H4EA 2X65A 1H5SD 1KWSA 2QIVX 4DCLA 1VICA 1VZTA 1VGTA 1VH3A 2FY7A 2WLCA 1YP3A 3OC9A 3FSCA 4B2XA 2BO6A 1QRMA 1R7UA 1ZDFA 5C4BA 4Y6NA 2RITA 2XMEA 2E8BA 3SXAA 5DDTA 2FYBA 1ZJ0A 2V0HA 3Q7UA 4P02A 5CQOA 1QGSA 2VSIA 3D5NA 1PZTA 4G87A 1OMXA 1ZCYA 3DUVA 5BXCA 4AYJA 1SSQA 3KWEA 4NALA 2V0KA 1LZIA 3I3AA 3VBKA 3JUKA 4EEGA 3TWDA 3ZGFA 1KK6A 1GX4A 1JYKA 1Z90A 2WVLA 3VNPA 1ZJPA 4B5BA 3ZF8A 4AC3A 3V0OA 2D0JA 2VXMA 4KC1A 3FTTA 2X5SA 1YP4A 4G3SA 3OTZA 1JYLA 2Z86A 1HM9A 3OGZA 4M28A 3U2VA 2Y4KA 1QG8A 5FUHA 3IOHA 2W0VA 1YROB 3N9WA 4FRPA 4EAAA 1FRWA 4HUSA 5C3BA 4HZCA 1H7HA 4Y64A 4EEMA 2AM4A 3TDTA 2WGZA 2OI6A 1VGZA 3T7NA 1I52A 1H5SA 1WVCA 3MC4A 3SPTA 5CMHA 1R81A 3V91A 4B4GA 1QREA 3U2TA 3K8DA 2PGVA 1H5SC 4EE5A 1H5TB 2AH9A 2D7IA 1ZIZA 2FYAA 5CMGX 1EZIA 4KC4A 2OEFA 2Y4JA 4CJCA 4HO8A 3EEVA 1INIA 3VBNA 1FWYA 5C1GA 5DG3A 3PKQA 4D0TA 1OMZA 4NANA 2XATA 1QRGA 4IHFA 4EQYA 1FGGA 4FRDA 4D11A 1R7YA 2JF2A 2JCLA 2YCMA 4FQWA 3MQHA 5C1HA 4EGGA 5FV9A 4HO5A 4D11C 2D7RA 5C3DA 3EG4A 4B2WA 2AM3A 1GA8A 2PX7A 3CKOA 3OTMA 5C47A 5FU8A 3D98A 5ADXU 4Y6UA 3R0SA
chains in the Genus database with same CATH superfamily
1KK5A 2YQJA 2AM5A 3FS8A 1V67A 3SX7A 1LXAA 4AA7A 1R7TA 3DJ4A 2YESA 5EIYA 2I7BA 4MNDA 1ZI4A 4N27A 3R5CA 1JV3A 5C4CA 3ZLLA 4H7OA 4KPZA 4KQLA 1V84A 4D0ZA 2YQCA 2RIJA 4B4MA 1ZJ2A 4M2AA 2IUAA 4R37A 2AECA 3HSQA 3Q1XA 3DHOA 3I0GA 4M4KA 3CKNA 1ZI5A 4ARWA 1FO8A 4XWIA 3FSBA 4KPXA 3BSYA 1G97A 3BSWA 1S4NA 1KRUA 1L0SA 4E75A 5IFYA 4K6RA 1G23A 4GBPA 4EA7A 1FR8A 4HZDA 4B4BA 5E3QA 2OI5A 2WE9A 1G9RA 4KT7A 3R3RA 4N69A 2QH5A 1SSMA 3LW6A 5D92A 2NXVA 3R3IA 5L6VA 2RJ6A 1VZUA 2RJ1A 3OAMA 3JTJA 3OH2A 2WEEA 3I0JA 3O3PA 3RMWA 3FSXA 3RSBA 4LW6A 1G1LA 4EVWA 1QRLA 4D48A 4NAIA 4Y9XA 4LW3A 4JD0A 3VBMA 1ZJ1A 4M99A 3E25A 1G0RA 3I0IX 3R1WA 1KK4A 3GQ7A 3TV0A 3DK5A 5C36A 3QVBA 4N6AA 3ST8A 1TW5A 2RJ5A 2VS5A 1V82A 4FCUA 3V0NA 1XZ6A 1LL3A 5CMIA 1QQ0A 2RIXA 2WVMA 2RJ9A 4Y63A 1WT3A 3I0CA 4CJBA 3E26A 2JF3A 4AYLA 5DEMA 3VBJA 4M2BA 4IRQA 3MQGA 4DDZA 5EJ1A 1H5SB 1MP4A 2WLEA 3Q4SA 3I3XA 4KNXA 3SXGA 3U0XA 3EH0A 4FRHA 3T7OA 2XWLA 4FCEA 2CU2A 3V8ZA 4Y7GA 3I0LA 1SSTA 5CMFX 2OI7A 1N4IA 4IHHA 4M9CA 3NGWA 3NZ2A 3ZLKA 1T3DA 2RJ7A 2WAWA 1R7VA 3SXBA 1LVWA 3R8YA 4HO0A 5AFUV 3GQ9A 5CQPA 1KRVA 1KHRA 1H7GA 1VGWA 1ZCUA 2WLGA 1GWWA 4B3UA 3TK8A 2ICYA 1V83A 2VHEA 5CQLX 1R82A 5CQMX 5CMJA 3BFPA 3PNNA 5C4DA 2GGOA 1FXOA 3K8EA 3Q80A 4IHGA 1FZWA 1PZYB 4P00A 2YC3A 2JCOA 1MC3A 2P72A 4Q7CA 1ZCTA 1XHDA 1KRRA 2A8WA 2RJ8A 5C48A 3U0YA 2QGIA 4ISXA 4G3QA 2A8UA 2APCA 1YP2A 2VS4A 3I0DA 4MYBA 1TW1A 2Y7AA 2WVKA 2O1GA 3TISA 4AAWA 4BQHA 1WT1A 1ZHJA 1H7QA 1LZ7A 4EABA 3I0EA 5E3RA 5C3AA 1ON6A 3F1YA 1VGUA 3VBIA 1S4PA 2FYDB 2Z87A 5U2KA 5CQNX 1INJA 2BO8A 2Y6PA 4FRMA 1LL2A 1R7XA 5C49A 5D91A 4KC2A 1G2VA 4O6MA 3CKJA 4Y62A 5AJPA 3USQA 2WLFA 1IIMA 1E5KA 2BO7A 2C0NA 1QRFA 1ZCVA 1M8NA 3GUEA 1H5TA 4EA8A 1TZFA 1W57A 2MZBA 4FIYA 1O7QA 3F1CA 3V8YA 4DE7A 2YC5A 3D8VA 3V0QA 4J18A 3T57A 3TZTA 3GQ8A 5FTVA 2YQHA 4NAKA 1ZJOA 3RMVA 4FRQA 1LZJA 4Y7VA 2Y4MA 5DEPA 1WSZA 3SXCA 1H5RA 2NPOA 4ZDQA 2I5KA 5C8RA 5C4FA 5FYEA 3IOJA 3SXEA 3U2WA 3OKRA 1JVDA 2V0JA 2E3DA 4R36A 1FR9A 2RIZA 5AJOA 1GX0A 3OH4A 1GQ9A 1OQMB 4J09A 1THJA 3U2XA 1J2ZA 4MZUA 3GOSA 1JV1A 3KWDA 1IINA 4O6NA 3SX3A 5EJZA 1KQAA 2OEGA 2QKXA 2ZU8A 5AFUU 1NMMB 4FREA 2WLDA 3C8VA 2XWMA 1H7EA 1ZI3A 4FRAA 2P73A 3V0PA 2IU8A 2AQ9A 1H4CA 3V0LA 2RJ4A 2AESA 3SUCA 4EA9A 1O23B 4E1KA 2VK9A 4UEGA 3U2UA 1G8OA 3BRKX 4KXOA 3P1BA 3R5DA 4C2SA 4M98A 2X60A 4Y7UA 4KNRA 1O7OA 1W55A 4Y7FA 5AJNA 4HO4A 4DECA 1ZDGA 1FO9A 1GQCA 2P2OA 2XMHA 2BO4A 1HJJA 3SX8A 1R80A 3BXYA 1MR9A 3HJJA 3FWWA 2FFUA 1FG5N 2TDTA 1H7LA 2VFZA 3V0MA 4L41C 4HURA 5L6SA 2FFVA 3CJ8A 3KIAA 4IRPA 4HO2A 5C1LA 5FTSA 5I1FA 3OW5A 5IDTA 1FOAA 2V0LA 3VBPA 4MYOA 4HO3A 2Y4LA 3TQDA 4E79A 1SS9A 3GVDA 3CKVA 1EYRA 1MP5A 3FOQA 2RJ0A 3CKQA 2AGDA 1XHBA 1H7FA 2ZU7A 3R2WA 2Q4JA 1VPAA 3SX5A 3P47A 2JCKA 3IOIA 3FSYA 3OUPA 3R5BA 1HV9A 1NHEB 2JCJA 1ZI1A 4FRLA 4E6TA 5DDVA 2VXLA 4HO6A 3EE5A 3JQYA 5C4EA 1H4DA 4ECMA 2RIYA 1FGXA 2IC7A 1JVGA 3SRTA 3F1XA 1EWWA 2VSHA 3HL3A 4BMAA 5J49A 3CGXA 1TDTA 4KRVA 2FKOA 3BSSA 1G3LA 4EEOA 1OCXA 4CVHA 2VS3A 2PA4A 3TIOA 2QIAA 5E3PA 1K4VA 1KGQA 3V90A 4ASJA 4HOCA 3T7MA 1HJLA 1WT2A 2X5ZA 1HM0A 1H5RB 1VZXA 1NF5B 4HO9A 2W0WA 4B42A 2ZU9A 2FYCB 3JUJA 2VD4A 1QWJA 5IDSA 2O1FA 3VBLA 1NKHB 4EE4A 2P6WA 3IGJA 3ZGGA 1G93A 1HM8A 1ON8A 4FRBA 1G95A 2IU9A 1NWGB 4CJ8A 3KWCA 3PMOA 1NQIB 3V4EA 3PKPA 1ZJ3A 4G3PA 4ASYA 1H7TA 4E6UA 1KGTA 1WT0A 4Y7TA 2V0IA 1H3MA 3OH0A 2YQSA 1S4OA 1TVYA 5JQQA 3CU0A 2I5EA 2DPWA 5C38A 5F42A 3OH3A 4FROA 2GGQA 2O1HA 1XATA 4HCQA 1O0RA 4MFGA 1QGQA 1MRLA 3ECTA 4EEAA 1GWVA 1W77A 2UX8A 3POLA 1FXJA 1S80A 4JISA 3OU9A 3I0HA 4EE3A 1LZ0A 2AE7A 4YS8A 2XWNA 2ICXA 3IXCA 5FU0A 5HS2A 1VM8A 5ADXV 3OH1A 1VH1A 1LL0A 2PGYA 3USRA 1V3WA 4HG6A 1MR7A 3SXDA 3BCVA 4N6BA 3I0FA 4R7PA 1MP3A 3I0KA 3R5AA 1H4EA 2X65A 1H5SD 1KWSA 2QIVX 4DCLA 1VICA 1VZTA 1VGTA 1VH3A 2FY7A 2WLCA 1YP3A 3OC9A 3FSCA 4B2XA 2BO6A 1QRMA 1R7UA 1ZDFA 5C4BA 4Y6NA 2RITA 2XMEA 2E8BA 3SXAA 5DDTA 2FYBA 1ZJ0A 2V0HA 3Q7UA 4P02A 5CQOA 1QGSA 2VSIA 3D5NA 1PZTA 4G87A 1OMXA 1ZCYA 2J0BA 3DUVA 5BXCA 4AYJA 1SSQA 3KWEA 4NALA 2V0KA 1LZIA 3I3AA 3VBKA 3JUKA 4EEGA 3TWDA 3ZGFA 1KK6A 1GX4A 1JYKA 1Z90A 2WVLA 3VNPA 1ZJPA 4B5BA 3ZF8A 4AC3A 3V0OA 2D0JA 2VXMA 4KC1A 3FTTA 2X5SA 1YP4A 4G3SA 3OTZA 1JYLA 2Z86A 1HM9A 3OGZA 4M28A 3U2VA 2Y4KA 1QG8A 5FUHA 3IOHA 2W0VA 1YROB 3N9WA 4FRPA 4EAAA 1FRWA 4HUSA 5C3BA 4HZCA 1H7HA 4Y64A 4EEMA 2AM4A 3TDTA 2WGZA 3GQAA 2OI6A 1VGZA 3T7NA 1I52A 1H5SA 1WVCA 3MC4A 3SPTA 5CMHA 1R81A 4MIXA 3V91A 4B4GA 1QREA 3U2TA 3K8DA 2PGVA 1H5SC 4EE5A 1H5TB 2AH9A 2D7IA 1ZIZA 2FYAA 5CMGX 1EZIA 4KC4A 2OEFA 2Y4JA 2J0AA 4CJCA 1Z2FA 4HO8A 3EEVA 1INIA 3VBNA 1FWYA 5C1GA 5DG3A 3PKQA 4D0TA 1OMZA 4NANA 2XATA 1QRGA 4IHFA 4EQYA 1FGGA 4FRDA 4D11A 1R7YA 2JF2A 2JCLA 2YCMA 4FQWA 3MQHA 5C1HA 4EGGA 5FV9A 4HO5A 4D11C 2D7RA 5C3DA 3EG4A 4B2WA 2AM3A 1GA8A 2PX7A 3CKOA 3OTMA 4FIXA 5C47A 5FU8A 3D98A 5ADXU 4Y6UA 3R0SA
chains in the Genus database with same CATH topology
1KK5A 2YQJA 2AM5A 3FS8A 1V67A 3SX7A 1LXAA 4AA7A 1R7TA 3DJ4A 2YESA 5EIYA 2I7BA 4MNDA 1ZI4A 4N27A 3R5CA 1JV3A 5C4CA 3ZLLA 4H7OA 4KPZA 4KQLA 1V84A 4D0ZA 2YQCA 2RIJA 4B4MA 1ZJ2A 4M2AA 2IUAA 4R37A 2AECA 3HSQA 3Q1XA 3DHOA 3I0GA 4M4KA 3CKNA 1ZI5A 4ARWA 1FO8A 4XWIA 3FSBA 4KPXA 3BSYA 1G97A 3BSWA 1S4NA 1KRUA 4E75A 5IFYA 4K6RA 1G23A 4GBPA 4EA7A 1FR8A 4HZDA 4B4BA 5E3QA 2OI5A 2WE9A 1G9RA 4KT7A 3R3RA 4N69A 2QH5A 1SSMA 3LW6A 5D92A 2NXVA 3R3IA 5L6VA 2RJ6A 1VZUA 2RJ1A 3OAMA 3JTJA 3OH2A 2WEEA 3I0JA 3O3PA 3RMWA 3FSXA 3RSBA 4LW6A 1G1LA 4EVWA 1QRLA 4D48A 4NAIA 4Y9XA 4LW3A 4JD0A 3VBMA 1ZJ1A 4M99A 3E25A 1G0RA 3I0IX 3R1WA 1KK4A 3TV0A 3DK5A 5C36A 3QVBA 4N6AA 3ST8A 1TW5A 2RJ5A 2VS5A 1V82A 4FCUA 3V0NA 1XZ6A 1LL3A 5CMIA 1QQ0A 2RIXA 2WVMA 2RJ9A 4Y63A 1WT3A 3I0CA 4CJBA 3E26A 2JF3A 4AYLA 5DEMA 3VBJA 4M2BA 4IRQA 3MQGA 4DDZA 5EJ1A 1H5SB 1MP4A 2WLEA 3Q4SA 3I3XA 4KNXA 3SXGA 3U0XA 3EH0A 4FRHA 3T7OA 2XWLA 4FCEA 2CU2A 3V8ZA 4Y7GA 3I0LA 1SSTA 5CMFX 2OI7A 4IHHA 4M9CA 3NGWA 3NZ2A 3ZLKA 1T3DA 2RJ7A 2WAWA 1R7VA 3SXBA 1LVWA 3R8YA 4HO0A 5AFUV 5CQPA 1KRVA 1KHRA 1H7GA 1VGWA 1ZCUA 2WLGA 1GWWA 4B3UA 3TK8A 2ICYA 1V83A 2VHEA 5CQLX 1R82A 5CQMX 5CMJA 3BFPA 3PNNA 5C4DA 2GGOA 1FXOA 3K8EA 3Q80A 4IHGA 1FZWA 1PZYB 4P00A 2YC3A 2JCOA 1MC3A 2P72A 4Q7CA 1ZCTA 1XHDA 1KRRA 2A8WA 2RJ8A 5C48A 3U0YA 2QGIA 4ISXA 4G3QA 2A8UA 2APCA 1YP2A 2VS4A 3I0DA 4MYBA 1TW1A 2Y7AA 2WVKA 2O1GA 3TISA 4AAWA 4BQHA 1WT1A 1ZHJA 1H7QA 1LZ7A 4EABA 3I0EA 5E3RA 5C3AA 1ON6A 3F1YA 1VGUA 3VBIA 1S4PA 2FYDB 2Z87A 5U2KA 5CQNX 1INJA 2BO8A 2Y6PA 4FRMA 1LL2A 1R7XA 5C49A 5D91A 4KC2A 1G2VA 4O6MA 3CKJA 4Y62A 5AJPA 3USQA 2WLFA 1IIMA 1E5KA 2BO7A 2C0NA 1QRFA 1ZCVA 3GUEA 1H5TA 4EA8A 1TZFA 1W57A 2MZBA 4FIYA 1O7QA 3F1CA 3V8YA 4DE7A 2YC5A 3D8VA 3V0QA 4J18A 3T57A 3TZTA 5FTVA 2YQHA 4NAKA 1ZJOA 3RMVA 4FRQA 1LZJA 4Y7VA 2Y4MA 5DEPA 1WSZA 3SXCA 1H5RA 2NPOA 4ZDQA 2I5KA 5C8RA 5C4FA 5FYEA 3IOJA 3SXEA 3U2WA 3OKRA 1JVDA 2V0JA 2E3DA 4R36A 1FR9A 2RIZA 5AJOA 1GX0A 1GQ9A 1OQMB 3OH4A 4J09A 1THJA 3U2XA 1J2ZA 4MZUA 3GOSA 1JV1A 3KWDA 1IINA 4O6NA 3SX3A 5EJZA 1KQAA 2OEGA 2QKXA 2ZU8A 5AFUU 1NMMB 4FREA 2WLDA 3C8VA 2XWMA 1H7EA 1ZI3A 4FRAA 2P73A 3V0PA 2IU8A 2AQ9A 1H4CA 3V0LA 2RJ4A 2AESA 4EA9A 1O23B 4E1KA 2VK9A 4UEGA 3U2UA 1G8OA 3BRKX 4KXOA 3P1BA 3R5DA 4C2SA 4M98A 2X60A 4Y7UA 4KNRA 1O7OA 1W55A 4Y7FA 5AJNA 4HO4A 4DECA 1ZDGA 1FO9A 1GQCA 2P2OA 2XMHA 2BO4A 1HJJA 3SX8A 1R80A 3BXYA 1MR9A 3HJJA 3FWWA 2FFUA 1FG5N 2TDTA 1H7LA 2VFZA 3V0MA 4L41C 4HURA 5L6SA 2FFVA 3CJ8A 3KIAA 4IRPA 4HO2A 5C1LA 5FTSA 5I1FA 3OW5A 5IDTA 1FOAA 2V0LA 3VBPA 4MYOA 4HO3A 2Y4LA 3TQDA 4E79A 1SS9A 3GVDA 3CKVA 1EYRA 1MP5A 3FOQA 2RJ0A 3CKQA 2AGDA 1XHBA 1H7FA 2ZU7A 3R2WA 2Q4JA 1VPAA 3SX5A 3P47A 2JCKA 3IOIA 3FSYA 3OUPA 3R5BA 1HV9A 1NHEB 2JCJA 1ZI1A 4FRLA 4E6TA 5DDVA 2VXLA 4HO6A 3EE5A 3JQYA 5C4EA 1H4DA 4ECMA 2RIYA 1FGXA 2IC7A 1JVGA 3SRTA 3F1XA 2VSHA 3HL3A 4BMAA 5J49A 3CGXA 1TDTA 4KRVA 2FKOA 3BSSA 1G3LA 4EEOA 1OCXA 4CVHA 2VS3A 2PA4A 3TIOA 2QIAA 5E3PA 1K4VA 1KGQA 3V90A 4ASJA 4HOCA 3T7MA 1HJLA 1WT2A 2X5ZA 1HM0A 1H5RB 1VZXA 1NF5B 4HO9A 2W0WA 4B42A 2ZU9A 2FYCB 3JUJA 2VD4A 1QWJA 5IDSA 2O1FA 3VBLA 1NKHB 4EE4A 2P6WA 3IGJA 3ZGGA 1G93A 1HM8A 1ON8A 4FRBA 1G95A 2IU9A 1NWGB 4CJ8A 3KWCA 3PMOA 1NQIB 3V4EA 3PKPA 1ZJ3A 4G3PA 4ASYA 1H7TA 4E6UA 1KGTA 1WT0A 4Y7TA 2V0IA 1H3MA 3OH0A 2YQSA 1S4OA 1TVYA 5JQQA 3CU0A 2I5EA 2DPWA 5C38A 5F42A 3OH3A 4FROA 2GGQA 2O1HA 1XATA 4HCQA 1O0RA 4MFGA 1QGQA 1MRLA 3ECTA 4EEAA 1GWVA 1W77A 2UX8A 3POLA 1FXJA 1S80A 4JISA 3OU9A 3I0HA 4EE3A 1LZ0A 2AE7A 4YS8A 2XWNA 2ICXA 3IXCA 5FU0A 5HS2A 1VM8A 5ADXV 3OH1A 1VH1A 1LL0A 2PGYA 3USRA 1V3WA 4HG6A 1MR7A 3SXDA 3BCVA 4N6BA 3I0FA 4R7PA 1MP3A 3I0KA 3R5AA 1H4EA 2X65A 1H5SD 1KWSA 2QIVX 4DCLA 1VICA 1VZTA 1VGTA 1VH3A 2FY7A 2WLCA 1YP3A 3OC9A 3FSCA 4B2XA 2BO6A 1QRMA 1R7UA 1ZDFA 5C4BA 4Y6NA 2RITA 2XMEA 2E8BA 3SXAA 5DDTA 2FYBA 1ZJ0A 2V0HA 3Q7UA 4P02A 5CQOA 1QGSA 2VSIA 3D5NA 1PZTA 4G87A 1OMXA 1ZCYA 2J0BA 3DUVA 5BXCA 4AYJA 1SSQA 3KWEA 4NALA 2V0KA 1LZIA 3I3AA 3VBKA 3JUKA 4EEGA 3TWDA 3ZGFA 1KK6A 1GX4A 1JYKA 1Z90A 2WVLA 3VNPA 1ZJPA 4B5BA 3ZF8A 4AC3A 3V0OA 2D0JA 2VXMA 4KC1A 3FTTA 2X5SA 1YP4A 4G3SA 3OTZA 1JYLA 2Z86A 1HM9A 3OGZA 4M28A 3U2VA 2Y4KA 1QG8A 5FUHA 3IOHA 2W0VA 1YROB 3N9WA 4FRPA 4EAAA 1FRWA 4HUSA 5C3BA 4HZCA 1H7HA 4Y64A 4EEMA 2AM4A 3TDTA 2WGZA 2OI6A 1VGZA 3T7NA 1I52A 1H5SA 1WVCA 3MC4A 3SPTA 5CMHA 1R81A 4MIXA 3V91A 4B4GA 1QREA 3U2TA 3K8DA 2PGVA 1H5SC 4EE5A 1H5TB 2AH9A 2D7IA 1ZIZA 2FYAA 5CMGX 1EZIA 4KC4A 2OEFA 2Y4JA 2J0AA 4CJCA 4HO8A 3EEVA 1INIA 3VBNA 1FWYA 5C1GA 5DG3A 3PKQA 4D0TA 1OMZA 4NANA 2XATA 1QRGA 4IHFA 4EQYA 1FGGA 4FRDA 4D11A 1R7YA 2JF2A 2JCLA 2YCMA 4FQWA 3MQHA 5C1HA 4EGGA 5FV9A 4HO5A 4D11C 2D7RA 5C3DA 3EG4A 4B2WA 2AM3A 1GA8A 2PX7A 3CKOA 3OTMA 4FIXA 5C47A 5FU8A 3D98A 5ADXU 4Y6UA 3R0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KK5 A;  2YQJ A;  2AM5 A;  3FS8 A;  1V67 A;  3SX7 A;  1LXA A;  4AA7 A;  1R7T A;  3DJ4 A;  2YES A;  5EIY A;  2I7B A;  4MND A;  1ZI4 A;  4N27 A;  3R5C A;  1JV3 A;  5C4C A;  3ZLL A;  4H7O A;  4KPZ A;  4KQL A;  1V84 A;  4D0Z A;  2YQC A;  2RIJ A;  4B4M A;  1ZJ2 A;  4M2A A;  2IUA A;  4R37 A;  2AEC A;  3HSQ A;  3Q1X A;  3DHO A;  3I0G A;  4M4K A;  3CKN A;  1ZI5 A;  4ARW A;  1FO8 A;  4XWI A;  3FSB A;  4KPX A;  3BSY A;  1G97 A;  3BSW A;  1S4N A;  1KRU A;  4E75 A;  5IFY A;  4K6R A;  1G23 A;  4GBP A;  4EA7 A;  1FR8 A;  4HZD A;  4B4B A;  5E3Q A;  2OI5 A;  2WE9 A;  1G9R A;  4KT7 A;  3R3R A;  4N69 A;  2QH5 A;  1SSM A;  3LW6 A;  2NXV A;  3R3I A;  5L6V A;  2RJ6 A;  1VZU A;  2RJ1 A;  3OAM A;  3JTJ A;  3OH2 A;  2WEE A;  3I0J A;  3O3P A;  3RMW A;  3FSX A;  3RSB A;  4LW6 A;  1G1L A;  4EVW A;  1QRL A;  4D48 A;  4NAI A;  4Y9X A;  4LW3 A;  4JD0 A;  3VBM A;  1ZJ1 A;  4M99 A;  3E25 A;  1G0R A;  3I0I X;  3R1W A;  1KK4 A;  3TV0 A;  3DK5 A;  5C36 A;  3QVB A;  4N6A A;  3ST8 A;  1TW5 A;  2RJ5 A;  2VS5 A;  1V82 A;  4FCU A;  3V0N A;  1XZ6 A;  1LL3 A;  5CMI A;  1QQ0 A;  2RIX A;  2WVM A;  2RJ9 A;  4Y63 A;  1WT3 A;  3I0C A;  4CJB A;  3E26 A;  2JF3 A;  4AYL A;  5DEM A;  3VBJ A;  4M2B A;  4IRQ A;  3MQG A;  4DDZ A;  5EJ1 A;  1H5S B;  1MP4 A;  2WLE A;  3Q4S A;  3I3X A;  4KNX A;  3SXG A;  3U0X A;  3EH0 A;  4FRH A;  3T7O A;  2XWL A;  4FCE A;  2CU2 A;  3V8Z A;  4Y7G A;  3I0L A;  1SST A;  5CMF X;  2OI7 A;  4IHH A;  4M9C A;  3NGW A;  3NZ2 A;  3ZLK A;  1T3D A;  2RJ7 A;  2WAW A;  1R7V A;  3SXB A;  1LVW A;  3R8Y A;  4HO0 A;  5AFU V;  5CQP A;  1KRV A;  1KHR A;  1H7G A;  1VGW A;  1ZCU A;  2WLG A;  1GWW A;  4B3U A;  3TK8 A;  2ICY A;  1V83 A;  2VHE A;  5CQL X;  1R82 A;  5CQM X;  5CMJ A;  3BFP A;  3PNN A;  5C4D A;  2GGO A;  1FXO A;  3K8E A;  3Q80 A;  4IHG A;  1FZW A;  1PZY B;  4P00 A;  2YC3 A;  2JCO A;  1MC3 A;  2P72 A;  1ZCT A;  1XHD A;  1KRR A;  2A8W A;  2RJ8 A;  5C48 A;  3U0Y A;  2QGI A;  4ISX A;  4G3Q A;  2A8U A;  2APC A;  1YP2 A;  2VS4 A;  3I0D A;  4MYB A;  1TW1 A;  2Y7A A;  2WVK A;  2O1G A;  3TIS A;  4AAW A;  4BQH A;  1WT1 A;  1ZHJ A;  1H7Q A;  1LZ7 A;  4EAB A;  3I0E A;  5E3R A;  5C3A A;  1ON6 A;  3F1Y A;  1VGU A;  3VBI A;  1S4P A;  2FYD B;  2Z87 A;  5U2K A;  5CQN X;  1INJ A;  2BO8 A;  2Y6P A;  4FRM A;  1LL2 A;  1R7X A;  5C49 A;  4KC2 A;  1G2V A;  3CKJ A;  4Y62 A;  5AJP A;  3USQ A;  2WLF A;  1IIM A;  1E5K A;  2BO7 A;  1QRF A;  1ZCV A;  3GUE A;  1H5T A;  4EA8 A;  1TZF A;  1W57 A;  2MZB A;  3V8Y A;  1O7Q A;  3F1C A;  4DE7 A;  2YC5 A;  3D8V A;  3V0Q A;  4J18 A;  3T57 A;  3TZT A;  5FTV A;  2YQH A;  4NAK A;  1ZJO A;  3RMV A;  4FRQ A;  1LZJ A;  4Y7V A;  2Y4M A;  5DEP A;  1WSZ A;  3SXC A;  1H5R A;  2NPO A;  4ZDQ A;  2I5K A;  5C8R A;  5C4F A;  5FYE A;  3IOJ A;  3SXE A;  3U2W A;  3OKR A;  1JVD A;  2V0J A;  2E3D A;  4R36 A;  1FR9 A;  2RIZ A;  5AJO A;  1GX0 A;  1GQ9 A;  1OQM B;  3OH4 A;  4J09 A;  1THJ A;  3U2X A;  1J2Z A;  4MZU A;  3GOS A;  1JV1 A;  3KWD A;  1IIN A;  3SX3 A;  5EJZ A;  1KQA A;  2OEG A;  2QKX A;  2ZU8 A;  5AFU U;  1NMM B;  4FRE A;  2WLD A;  3C8V A;  2XWM A;  1H7E A;  1ZI3 A;  4FRA A;  2P73 A;  3V0P A;  2IU8 A;  2AQ9 A;  1H4C A;  3V0L A;  2RJ4 A;  2AES A;  4EA9 A;  1O23 B;  4E1K A;  4UEG A;  3U2U A;  1G8O A;  3BRK X;  4KXO A;  3P1B A;  3R5D A;  4C2S A;  4M98 A;  2X60 A;  4Y7U A;  4KNR A;  1O7O A;  1W55 A;  4Y7F A;  5AJN A;  4HO4 A;  4DEC A;  1ZDG A;  1FO9 A;  1GQC A;  2P2O A;  2XMH A;  2BO4 A;  1HJJ A;  3SX8 A;  1R80 A;  3BXY A;  1MR9 A;  3HJJ A;  3FWW A;  2FFU A;  1FG5 N;  2TDT A;  1H7L A;  2VFZ A;  3V0M A;  4L41 C;  4HUR A;  5L6S A;  2FFV A;  3CJ8 A;  3KIA A;  4IRP A;  4HO2 A;  5C1L A;  5FTS A;  5I1F A;  3OW5 A;  5IDT A;  1FOA A;  2V0L A;  3VBP A;  4MYO A;  4HO3 A;  2Y4L A;  3TQD A;  4E79 A;  1SS9 A;  3GVD A;  3CKV A;  1EYR A;  1MP5 A;  3FOQ A;  2RJ0 A;  3CKQ A;  2AGD A;  1XHB A;  1H7F A;  2ZU7 A;  3R2W A;  2Q4J A;  1VPA A;  3SX5 A;  3P47 A;  2JCK A;  3IOI A;  3FSY A;  3OUP A;  3R5B A;  1HV9 A;  1NHE B;  2JCJ A;  1ZI1 A;  4FRL A;  4E6T A;  5DDV A;  2VXL A;  4HO6 A;  3EE5 A;  3JQY A;  5C4E A;  1H4D A;  4ECM A;  2RIY A;  1FGX A;  2IC7 A;  1JVG A;  3SRT A;  3F1X A;  2VSH A;  3HL3 A;  4BMA A;  5J49 A;  3CGX A;  1TDT A;  4KRV A;  2FKO A;  3BSS A;  1G3L A;  4EEO A;  1OCX A;  4CVH A;  2VS3 A;  2PA4 A;  3TIO A;  2QIA A;  5E3P A;  1K4V A;  1KGQ A;  3V90 A;  4ASJ A;  4HOC A;  3T7M A;  1HJL A;  1WT2 A;  2X5Z A;  1HM0 A;  1H5R B;  1VZX A;  1NF5 B;  4HO9 A;  2W0W A;  4B42 A;  2ZU9 A;  2FYC B;  3JUJ A;  2VD4 A;  1QWJ A;  5IDS A;  2O1F A;  3VBL A;  1NKH B;  4EE4 A;  2P6W A;  3IGJ A;  3ZGG A;  1G93 A;  1HM8 A;  1ON8 A;  4FRB A;  1G95 A;  2IU9 A;  1NWG B;  4CJ8 A;  3KWC A;  3PMO A;  1NQI B;  3V4E A;  3PKP A;  1ZJ3 A;  4G3P A;  4ASY A;  1H7T A;  4E6U A;  1KGT A;  1WT0 A;  4Y7T A;  2V0I A;  1H3M A;  3OH0 A;  2YQS A;  1S4O A;  1TVY A;  5JQQ A;  3CU0 A;  2I5E A;  2DPW A;  5C38 A;  5F42 A;  3OH3 A;  4FRO A;  2GGQ A;  2O1H A;  1XAT A;  4HCQ A;  1O0R A;  4MFG A;  1QGQ A;  1MRL A;  3ECT A;  4EEA A;  1GWV A;  1W77 A;  2UX8 A;  3POL A;  1FXJ A;  1S80 A;  4JIS A;  3OU9 A;  3I0H A;  4EE3 A;  1LZ0 A;  2AE7 A;  4YS8 A;  2XWN A;  2ICX A;  3IXC A;  5FU0 A;  5HS2 A;  1VM8 A;  5ADX V;  3OH1 A;  1VH1 A;  1LL0 A;  2PGY A;  3USR A;  1V3W A;  4HG6 A;  1MR7 A;  3SXD A;  3BCV A;  4N6B A;  3I0F A;  4R7P A;  1MP3 A;  3I0K A;  3R5A A;  1H4E A;  2X65 A;  1H5S D;  1KWS A;  2QIV X;  4DCL A;  1VIC A;  1VZT A;  1VGT A;  1VH3 A;  2FY7 A;  2WLC A;  1YP3 A;  3OC9 A;  3FSC A;  4B2X A;  2BO6 A;  1QRM A;  1R7U A;  1ZDF A;  5C4B A;  4Y6N A;  2RIT A;  2XME A;  2E8B A;  3SXA A;  5DDT A;  2FYB A;  1ZJ0 A;  2V0H A;  3Q7U A;  4P02 A;  5CQO A;  1QGS A;  2VSI A;  3D5N A;  1PZT A;  4G87 A;  1OMX A;  1ZCY A;  3DUV A;  5BXC A;  4AYJ A;  1SSQ A;  3KWE A;  4NAL A;  2V0K A;  1LZI A;  3I3A A;  3VBK A;  3JUK A;  4EEG A;  3TWD A;  3ZGF A;  1KK6 A;  1GX4 A;  1JYK A;  1Z90 A;  2WVL A;  3VNP A;  1ZJP A;  4B5B A;  3ZF8 A;  4AC3 A;  3V0O A;  2D0J A;  2VXM A;  4KC1 A;  3FTT A;  2X5S A;  1YP4 A;  4G3S A;  3OTZ A;  1JYL A;  2Z86 A;  1HM9 A;  3OGZ A;  4M28 A;  3U2V A;  2Y4K A;  1QG8 A;  5FUH A;  3IOH A;  2W0V A;  1YRO B;  3N9W A;  4FRP A;  4EAA A;  1FRW A;  4HUS A;  5C3B A;  4HZC A;  1H7H A;  4Y64 A;  4EEM A;  2AM4 A;  3TDT A;  2WGZ A;  2OI6 A;  1VGZ A;  3T7N A;  1I52 A;  1H5S A;  1WVC A;  3MC4 A;  3SPT A;  5CMH A;  1R81 A;  3V91 A;  4B4G A;  1QRE A;  3U2T A;  3K8D A;  2PGV A;  1H5S C;  4EE5 A;  1H5T B;  2AH9 A;  2D7I A;  1ZIZ A;  2FYA A;  5CMG X;  1EZI A;  4KC4 A;  2OEF A;  2Y4J A;  4CJC A;  4HO8 A;  3EEV A;  1INI A;  3VBN A;  1FWY A;  5C1G A;  5DG3 A;  3PKQ A;  4D0T A;  1OMZ A;  4NAN A;  2XAT A;  1QRG A;  4IHF A;  4EQY A;  1FGG A;  4FRD A;  4D11 A;  1R7Y A;  2JF2 A;  2JCL A;  2YCM A;  4FQW A;  3MQH A;  5C1H A;  4EGG A;  5FV9 A;  4HO5 A;  4D11 C;  2D7R A;  5C3D A;  3EG4 A;  4B2W A;  2AM3 A;  1GA8 A;  2PX7 A;  3CKO A;  3OTM A;  5C47 A;  5FU8 A;  3D98 A;  5ADX U;  4Y6U A;  3R0S A; 
#chains in the Genus database with same CATH topology
 1KK5 A;  2YQJ A;  2AM5 A;  3FS8 A;  1V67 A;  3SX7 A;  1LXA A;  4AA7 A;  1R7T A;  3DJ4 A;  2YES A;  5EIY A;  2I7B A;  4MND A;  1ZI4 A;  4N27 A;  3R5C A;  1JV3 A;  5C4C A;  3ZLL A;  4H7O A;  4KPZ A;  4KQL A;  1V84 A;  4D0Z A;  2YQC A;  2RIJ A;  4B4M A;  1ZJ2 A;  4M2A A;  2IUA A;  4R37 A;  2AEC A;  3HSQ A;  3Q1X A;  3DHO A;  3I0G A;  4M4K A;  3CKN A;  1ZI5 A;  4ARW A;  1FO8 A;  4XWI A;  3FSB A;  4KPX A;  3BSY A;  1G97 A;  3BSW A;  1S4N A;  1KRU A;  1L0S A;  4E75 A;  5IFY A;  4K6R A;  1G23 A;  4GBP A;  4EA7 A;  1FR8 A;  4HZD A;  4B4B A;  5E3Q A;  2OI5 A;  2WE9 A;  1G9R A;  4KT7 A;  3R3R A;  4N69 A;  2QH5 A;  1SSM A;  3LW6 A;  5D92 A;  2NXV A;  3R3I A;  5L6V A;  2RJ6 A;  1VZU A;  2RJ1 A;  3OAM A;  3JTJ A;  3OH2 A;  2WEE A;  3I0J A;  3O3P A;  3RMW A;  3FSX A;  3RSB A;  4LW6 A;  1G1L A;  4EVW A;  1QRL A;  4D48 A;  4NAI A;  4Y9X A;  4LW3 A;  4JD0 A;  3VBM A;  1ZJ1 A;  4M99 A;  3E25 A;  1G0R A;  3I0I X;  3R1W A;  1KK4 A;  3GQ7 A;  3TV0 A;  3DK5 A;  5C36 A;  3QVB A;  4N6A A;  3ST8 A;  1TW5 A;  2RJ5 A;  2VS5 A;  1V82 A;  4FCU A;  3V0N A;  1XZ6 A;  1LL3 A;  5CMI A;  1QQ0 A;  2RIX A;  2WVM A;  2RJ9 A;  4Y63 A;  1WT3 A;  3I0C A;  4CJB A;  3E26 A;  2JF3 A;  4AYL A;  5DEM A;  3VBJ A;  4M2B A;  4IRQ A;  3MQG A;  4DDZ A;  5EJ1 A;  1H5S B;  1MP4 A;  2WLE A;  3Q4S A;  3I3X A;  4KNX A;  3SXG A;  3U0X A;  3EH0 A;  4FRH A;  3T7O A;  2XWL A;  4FCE A;  2CU2 A;  3V8Z A;  4Y7G A;  3I0L A;  1SST A;  5CMF X;  2OI7 A;  1N4I A;  4IHH A;  4M9C A;  3NGW A;  3NZ2 A;  3ZLK A;  1T3D A;  2RJ7 A;  2WAW A;  1R7V A;  3SXB A;  1LVW A;  3R8Y A;  4HO0 A;  5AFU V;  3GQ9 A;  5CQP A;  1KRV A;  1KHR A;  1H7G A;  1VGW A;  1ZCU A;  2WLG A;  1GWW A;  4B3U A;  3TK8 A;  2ICY A;  1V83 A;  2VHE A;  5CQL X;  1R82 A;  5CQM X;  5CMJ A;  3BFP A;  3PNN A;  5C4D A;  2GGO A;  1FXO A;  3K8E A;  3Q80 A;  4IHG A;  1FZW A;  1PZY B;  4P00 A;  2YC3 A;  2JCO A;  1MC3 A;  2P72 A;  4Q7C A;  1ZCT A;  1XHD A;  1KRR A;  2A8W A;  2RJ8 A;  5C48 A;  3U0Y A;  2QGI A;  4ISX A;  4G3Q A;  2A8U A;  2APC A;  1YP2 A;  2VS4 A;  3I0D A;  4MYB A;  1TW1 A;  2Y7A A;  2WVK A;  2O1G A;  3TIS A;  4AAW A;  4BQH A;  1WT1 A;  1ZHJ A;  1H7Q A;  1LZ7 A;  4EAB A;  3I0E A;  5E3R A;  5C3A A;  1ON6 A;  3F1Y A;  1VGU A;  3VBI A;  1S4P A;  2FYD B;  2Z87 A;  5U2K A;  5CQN X;  1INJ A;  2BO8 A;  2Y6P A;  4FRM A;  1LL2 A;  1R7X A;  5C49 A;  5D91 A;  4KC2 A;  1G2V A;  4O6M A;  3CKJ A;  4Y62 A;  5AJP A;  3USQ A;  2WLF A;  1IIM A;  1E5K A;  2BO7 A;  2C0N A;  1QRF A;  1ZCV A;  1M8N A;  3GUE A;  1H5T A;  4EA8 A;  1TZF A;  1W57 A;  2MZB A;  4FIY A;  1O7Q A;  3F1C A;  3V8Y A;  4DE7 A;  2YC5 A;  3D8V A;  3V0Q A;  4J18 A;  3T57 A;  3TZT A;  3GQ8 A;  5FTV A;  2YQH A;  4NAK A;  1ZJO A;  3RMV A;  4FRQ A;  1LZJ A;  4Y7V A;  2Y4M A;  5DEP A;  1WSZ A;  3SXC A;  1H5R A;  2NPO A;  4ZDQ A;  2I5K A;  5C8R A;  5C4F A;  5FYE A;  3IOJ A;  3SXE A;  3U2W A;  3OKR A;  1JVD A;  2V0J A;  2E3D A;  4R36 A;  1FR9 A;  2RIZ A;  5AJO A;  1GX0 A;  3OH4 A;  1GQ9 A;  1OQM B;  4J09 A;  1THJ A;  3U2X A;  1J2Z A;  4MZU A;  3GOS A;  1JV1 A;  3KWD A;  1IIN A;  4O6N A;  3SX3 A;  5EJZ A;  1KQA A;  2OEG A;  2QKX A;  2ZU8 A;  5AFU U;  1NMM B;  4FRE A;  2WLD A;  3C8V A;  2XWM A;  1H7E A;  1ZI3 A;  4FRA A;  2P73 A;  3V0P A;  2IU8 A;  2AQ9 A;  1H4C A;  3V0L A;  2RJ4 A;  2AES A;  3SUC A;  4EA9 A;  1O23 B;  4E1K A;  2VK9 A;  4UEG A;  3U2U A;  1G8O A;  3BRK X;  4KXO A;  3P1B A;  3R5D A;  4C2S A;  4M98 A;  2X60 A;  4Y7U A;  4KNR A;  1O7O A;  1W55 A;  4Y7F A;  5AJN A;  4HO4 A;  4DEC A;  1ZDG A;  1FO9 A;  1GQC A;  2P2O A;  2XMH A;  2BO4 A;  1HJJ A;  3SX8 A;  1R80 A;  3BXY A;  1MR9 A;  3HJJ A;  3FWW A;  2FFU A;  1FG5 N;  2TDT A;  1H7L A;  2VFZ A;  3V0M A;  4L41 C;  4HUR A;  5L6S A;  2FFV A;  3CJ8 A;  3KIA A;  4IRP A;  4HO2 A;  5C1L A;  5FTS A;  5I1F A;  3OW5 A;  5IDT A;  1FOA A;  2V0L A;  3VBP A;  4MYO A;  4HO3 A;  2Y4L A;  3TQD A;  4E79 A;  1SS9 A;  3GVD A;  3CKV A;  1EYR A;  1MP5 A;  3FOQ A;  2RJ0 A;  3CKQ A;  2AGD A;  1XHB A;  1H7F A;  2ZU7 A;  3R2W A;  2Q4J A;  1VPA A;  3SX5 A;  3P47 A;  2JCK A;  3IOI A;  3FSY A;  3OUP A;  3R5B A;  1HV9 A;  1NHE B;  2JCJ A;  1ZI1 A;  4FRL A;  4E6T A;  5DDV A;  2VXL A;  4HO6 A;  3EE5 A;  3JQY A;  5C4E A;  1H4D A;  4ECM A;  2RIY A;  1FGX A;  2IC7 A;  1JVG A;  3SRT A;  3F1X A;  1EWW A;  2VSH A;  3HL3 A;  4BMA A;  5J49 A;  3CGX A;  1TDT A;  4KRV A;  2FKO A;  3BSS A;  1G3L A;  4EEO A;  1OCX A;  4CVH A;  2VS3 A;  2PA4 A;  3TIO A;  2QIA A;  5E3P A;  1K4V A;  1KGQ A;  3V90 A;  4ASJ A;  4HOC A;  3T7M A;  1HJL A;  1WT2 A;  2X5Z A;  1HM0 A;  1H5R B;  1VZX A;  1NF5 B;  4HO9 A;  2W0W A;  4B42 A;  2ZU9 A;  2FYC B;  3JUJ A;  2VD4 A;  1QWJ A;  5IDS A;  2O1F A;  3VBL A;  1NKH B;  4EE4 A;  2P6W A;  3IGJ A;  3ZGG A;  1G93 A;  1HM8 A;  1ON8 A;  4FRB A;  1G95 A;  2IU9 A;  1NWG B;  4CJ8 A;  3KWC A;  3PMO A;  1NQI B;  3V4E A;  3PKP A;  1ZJ3 A;  4G3P A;  4ASY A;  1H7T A;  4E6U A;  1KGT A;  1WT0 A;  4Y7T A;  2V0I A;  1H3M A;  3OH0 A;  2YQS A;  1S4O A;  1TVY A;  5JQQ A;  3CU0 A;  2I5E A;  2DPW A;  5C38 A;  5F42 A;  3OH3 A;  4FRO A;  2GGQ A;  2O1H A;  1XAT A;  4HCQ A;  1O0R A;  4MFG A;  1QGQ A;  1MRL A;  3ECT A;  4EEA A;  1GWV A;  1W77 A;  2UX8 A;  3POL A;  1FXJ A;  1S80 A;  4JIS A;  3OU9 A;  3I0H A;  4EE3 A;  1LZ0 A;  2AE7 A;  4YS8 A;  2XWN A;  2ICX A;  3IXC A;  5FU0 A;  5HS2 A;  1VM8 A;  5ADX V;  3OH1 A;  1VH1 A;  1LL0 A;  2PGY A;  3USR A;  1V3W A;  4HG6 A;  1MR7 A;  3SXD A;  3BCV A;  4N6B A;  3I0F A;  4R7P A;  1MP3 A;  3I0K A;  3R5A A;  1H4E A;  2X65 A;  1H5S D;  1KWS A;  2QIV X;  4DCL A;  1VIC A;  1VZT A;  1VGT A;  1VH3 A;  2FY7 A;  2WLC A;  1YP3 A;  3OC9 A;  3FSC A;  4B2X A;  2BO6 A;  1QRM A;  1R7U A;  1ZDF A;  5C4B A;  4Y6N A;  2RIT A;  2XME A;  2E8B A;  3SXA A;  5DDT A;  2FYB A;  1ZJ0 A;  2V0H A;  3Q7U A;  4P02 A;  5CQO A;  1QGS A;  2VSI A;  3D5N A;  1PZT A;  4G87 A;  1OMX A;  1ZCY A;  2J0B A;  3DUV A;  5BXC A;  4AYJ A;  1SSQ A;  3KWE A;  4NAL A;  2V0K A;  1LZI A;  3I3A A;  3VBK A;  3JUK A;  4EEG A;  3TWD A;  3ZGF A;  1KK6 A;  1GX4 A;  1JYK A;  1Z90 A;  2WVL A;  3VNP A;  1ZJP A;  4B5B A;  3ZF8 A;  4AC3 A;  3V0O A;  2D0J A;  2VXM A;  4KC1 A;  3FTT A;  2X5S A;  1YP4 A;  4G3S A;  3OTZ A;  1JYL A;  2Z86 A;  1HM9 A;  3OGZ A;  4M28 A;  3U2V A;  2Y4K A;  1QG8 A;  5FUH A;  3IOH A;  2W0V A;  1YRO B;  3N9W A;  4FRP A;  4EAA A;  1FRW A;  4HUS A;  5C3B A;  4HZC A;  1H7H A;  4Y64 A;  4EEM A;  2AM4 A;  3TDT A;  2WGZ A;  3GQA A;  2OI6 A;  1VGZ A;  3T7N A;  1I52 A;  1H5S A;  1WVC A;  3MC4 A;  3SPT A;  5CMH A;  1R81 A;  4MIX A;  3V91 A;  4B4G A;  1QRE A;  3U2T A;  3K8D A;  2PGV A;  1H5S C;  4EE5 A;  1H5T B;  2AH9 A;  2D7I A;  1ZIZ A;  2FYA A;  5CMG X;  1EZI A;  4KC4 A;  2OEF A;  2Y4J A;  2J0A A;  4CJC A;  1Z2F A;  4HO8 A;  3EEV A;  1INI A;  3VBN A;  1FWY A;  5C1G A;  5DG3 A;  3PKQ A;  4D0T A;  1OMZ A;  4NAN A;  2XAT A;  1QRG A;  4IHF A;  4EQY A;  1FGG A;  4FRD A;  4D11 A;  1R7Y A;  2JF2 A;  2JCL A;  2YCM A;  4FQW A;  3MQH A;  5C1H A;  4EGG A;  5FV9 A;  4HO5 A;  4D11 C;  2D7R A;  5C3D A;  3EG4 A;  4B2W A;  2AM3 A;  1GA8 A;  2PX7 A;  3CKO A;  3OTM A;  4FIX A;  5C47 A;  5FU8 A;  3D98 A;  5ADX U;  4Y6U A;  3R0S A; 
#chains in the Genus database with same CATH homology
 1KK5 A;  2YQJ A;  2AM5 A;  3FS8 A;  1V67 A;  3SX7 A;  1LXA A;  4AA7 A;  1R7T A;  3DJ4 A;  2YES A;  5EIY A;  2I7B A;  4MND A;  1ZI4 A;  4N27 A;  3R5C A;  1JV3 A;  5C4C A;  3ZLL A;  4H7O A;  4KPZ A;  4KQL A;  1V84 A;  4D0Z A;  2YQC A;  2RIJ A;  4B4M A;  1ZJ2 A;  4M2A A;  2IUA A;  4R37 A;  2AEC A;  3HSQ A;  3Q1X A;  3DHO A;  3I0G A;  4M4K A;  3CKN A;  1ZI5 A;  4ARW A;  1FO8 A;  4XWI A;  3FSB A;  4KPX A;  3BSY A;  1G97 A;  3BSW A;  1S4N A;  1KRU A;  4E75 A;  5IFY A;  4K6R A;  1G23 A;  4GBP A;  4EA7 A;  1FR8 A;  4HZD A;  4B4B A;  5E3Q A;  2OI5 A;  2WE9 A;  1G9R A;  4KT7 A;  3R3R A;  4N69 A;  2QH5 A;  1SSM A;  3LW6 A;  5D92 A;  2NXV A;  3R3I A;  5L6V A;  2RJ6 A;  1VZU A;  2RJ1 A;  3OAM A;  3JTJ A;  3OH2 A;  2WEE A;  3I0J A;  3O3P A;  3RMW A;  3FSX A;  3RSB A;  4LW6 A;  1G1L A;  4EVW A;  1QRL A;  4D48 A;  4NAI A;  4Y9X A;  4LW3 A;  4JD0 A;  3VBM A;  1ZJ1 A;  4M99 A;  3E25 A;  1G0R A;  3I0I X;  3R1W A;  1KK4 A;  3TV0 A;  3DK5 A;  5C36 A;  3QVB A;  4N6A A;  3ST8 A;  1TW5 A;  2RJ5 A;  2VS5 A;  1V82 A;  4FCU A;  3V0N A;  1XZ6 A;  1LL3 A;  5CMI A;  1QQ0 A;  2RIX A;  2WVM A;  2RJ9 A;  4Y63 A;  1WT3 A;  3I0C A;  4CJB A;  3E26 A;  2JF3 A;  4AYL A;  5DEM A;  3VBJ A;  4M2B A;  4IRQ A;  3MQG A;  4DDZ A;  5EJ1 A;  1H5S B;  1MP4 A;  2WLE A;  3Q4S A;  3I3X A;  4KNX A;  3SXG A;  3U0X A;  3EH0 A;  4FRH A;  3T7O A;  2XWL A;  4FCE A;  2CU2 A;  3V8Z A;  4Y7G A;  3I0L A;  1SST A;  5CMF X;  2OI7 A;  4IHH A;  4M9C A;  3NGW A;  3NZ2 A;  3ZLK A;  1T3D A;  2RJ7 A;  2WAW A;  1R7V A;  3SXB A;  1LVW A;  3R8Y A;  4HO0 A;  5AFU V;  5CQP A;  1KRV A;  1KHR A;  1H7G A;  1VGW A;  1ZCU A;  2WLG A;  1GWW A;  4B3U A;  3TK8 A;  2ICY A;  1V83 A;  2VHE A;  5CQL X;  1R82 A;  5CQM X;  5CMJ A;  3BFP A;  3PNN A;  5C4D A;  2GGO A;  1FXO A;  3K8E A;  3Q80 A;  4IHG A;  1FZW A;  1PZY B;  4P00 A;  2YC3 A;  2JCO A;  1MC3 A;  2P72 A;  4Q7C A;  1ZCT A;  1XHD A;  1KRR A;  2A8W A;  2RJ8 A;  5C48 A;  3U0Y A;  2QGI A;  4ISX A;  4G3Q A;  2A8U A;  2APC A;  1YP2 A;  2VS4 A;  3I0D A;  4MYB A;  1TW1 A;  2Y7A A;  2WVK A;  2O1G A;  3TIS A;  4AAW A;  4BQH A;  1WT1 A;  1ZHJ A;  1H7Q A;  1LZ7 A;  4EAB A;  3I0E A;  5E3R A;  5C3A A;  1ON6 A;  3F1Y A;  1VGU A;  3VBI A;  1S4P A;  2FYD B;  2Z87 A;  5U2K A;  5CQN X;  1INJ A;  2BO8 A;  2Y6P A;  4FRM A;  1LL2 A;  1R7X A;  5C49 A;  5D91 A;  4KC2 A;  1G2V A;  4O6M A;  3CKJ A;  4Y62 A;  5AJP A;  3USQ A;  2WLF A;  1IIM A;  1E5K A;  2BO7 A;  2C0N A;  1QRF A;  1ZCV A;  3GUE A;  1H5T A;  4EA8 A;  1TZF A;  1W57 A;  2MZB A;  4FIY A;  1O7Q A;  3F1C A;  3V8Y A;  4DE7 A;  2YC5 A;  3D8V A;  3V0Q A;  4J18 A;  3T57 A;  3TZT A;  5FTV A;  2YQH A;  4NAK A;  1ZJO A;  3RMV A;  4FRQ A;  1LZJ A;  4Y7V A;  2Y4M A;  5DEP A;  1WSZ A;  3SXC A;  1H5R A;  2NPO A;  4ZDQ A;  2I5K A;  5C8R A;  5C4F A;  5FYE A;  3IOJ A;  3SXE A;  3U2W A;  3OKR A;  1JVD A;  2V0J A;  2E3D A;  4R36 A;  1FR9 A;  2RIZ A;  5AJO A;  1GX0 A;  1GQ9 A;  1OQM B;  3OH4 A;  4J09 A;  1THJ A;  3U2X A;  1J2Z A;  4MZU A;  3GOS A;  1JV1 A;  3KWD A;  1IIN A;  4O6N A;  3SX3 A;  5EJZ A;  1KQA A;  2OEG A;  2QKX A;  2ZU8 A;  5AFU U;  1NMM B;  4FRE A;  2WLD A;  3C8V A;  2XWM A;  1H7E A;  1ZI3 A;  4FRA A;  2P73 A;  3V0P A;  2IU8 A;  2AQ9 A;  1H4C A;  3V0L A;  2RJ4 A;  2AES A;  4EA9 A;  1O23 B;  4E1K A;  2VK9 A;  4UEG A;  3U2U A;  1G8O A;  3BRK X;  4KXO A;  3P1B A;  3R5D A;  4C2S A;  4M98 A;  2X60 A;  4Y7U A;  4KNR A;  1O7O A;  1W55 A;  4Y7F A;  5AJN A;  4HO4 A;  4DEC A;  1ZDG A;  1FO9 A;  1GQC A;  2P2O A;  2XMH A;  2BO4 A;  1HJJ A;  3SX8 A;  1R80 A;  3BXY A;  1MR9 A;  3HJJ A;  3FWW A;  2FFU A;  1FG5 N;  2TDT A;  1H7L A;  2VFZ A;  3V0M A;  4L41 C;  4HUR A;  5L6S A;  2FFV A;  3CJ8 A;  3KIA A;  4IRP A;  4HO2 A;  5C1L A;  5FTS A;  5I1F A;  3OW5 A;  5IDT A;  1FOA A;  2V0L A;  3VBP A;  4MYO A;  4HO3 A;  2Y4L A;  3TQD A;  4E79 A;  1SS9 A;  3GVD A;  3CKV A;  1EYR A;  1MP5 A;  3FOQ A;  2RJ0 A;  3CKQ A;  2AGD A;  1XHB A;  1H7F A;  2ZU7 A;  3R2W A;  2Q4J A;  1VPA A;  3SX5 A;  3P47 A;  2JCK A;  3IOI A;  3FSY A;  3OUP A;  3R5B A;  1HV9 A;  1NHE B;  2JCJ A;  1ZI1 A;  4FRL A;  4E6T A;  5DDV A;  2VXL A;  4HO6 A;  3EE5 A;  3JQY A;  5C4E A;  1H4D A;  4ECM A;  2RIY A;  1FGX A;  2IC7 A;  1JVG A;  3SRT A;  3F1X A;  2VSH A;  3HL3 A;  4BMA A;  5J49 A;  3CGX A;  1TDT A;  4KRV A;  2FKO A;  3BSS A;  1G3L A;  4EEO A;  1OCX A;  4CVH A;  2VS3 A;  2PA4 A;  3TIO A;  2QIA A;  5E3P A;  1K4V A;  1KGQ A;  3V90 A;  4ASJ A;  4HOC A;  3T7M A;  1HJL A;  1WT2 A;  2X5Z A;  1HM0 A;  1H5R B;  1VZX A;  1NF5 B;  4HO9 A;  2W0W A;  4B42 A;  2ZU9 A;  2FYC B;  3JUJ A;  2VD4 A;  1QWJ A;  5IDS A;  2O1F A;  3VBL A;  1NKH B;  4EE4 A;  2P6W A;  3IGJ A;  3ZGG A;  1G93 A;  1HM8 A;  1ON8 A;  4FRB A;  1G95 A;  2IU9 A;  1NWG B;  4CJ8 A;  3KWC A;  3PMO A;  1NQI B;  3V4E A;  3PKP A;  1ZJ3 A;  4G3P A;  4ASY A;  1H7T A;  4E6U A;  1KGT A;  1WT0 A;  4Y7T A;  2V0I A;  1H3M A;  3OH0 A;  2YQS A;  1S4O A;  1TVY A;  5JQQ A;  3CU0 A;  2I5E A;  2DPW A;  5C38 A;  5F42 A;  3OH3 A;  4FRO A;  2GGQ A;  2O1H A;  1XAT A;  4HCQ A;  1O0R A;  4MFG A;  1QGQ A;  1MRL A;  3ECT A;  4EEA A;  1GWV A;  1W77 A;  2UX8 A;  3POL A;  1FXJ A;  1S80 A;  4JIS A;  3OU9 A;  3I0H A;  4EE3 A;  1LZ0 A;  2AE7 A;  4YS8 A;  2XWN A;  2ICX A;  3IXC A;  5FU0 A;  5HS2 A;  1VM8 A;  5ADX V;  3OH1 A;  1VH1 A;  1LL0 A;  2PGY A;  3USR A;  1V3W A;  4HG6 A;  1MR7 A;  3SXD A;  3BCV A;  4N6B A;  3I0F A;  4R7P A;  1MP3 A;  3I0K A;  3R5A A;  1H4E A;  2X65 A;  1H5S D;  1KWS A;  2QIV X;  4DCL A;  1VIC A;  1VZT A;  1VGT A;  1VH3 A;  2FY7 A;  2WLC A;  1YP3 A;  3OC9 A;  3FSC A;  4B2X A;  2BO6 A;  1QRM A;  1R7U A;  1ZDF A;  5C4B A;  4Y6N A;  2RIT A;  2XME A;  2E8B A;  3SXA A;  5DDT A;  2FYB A;  1ZJ0 A;  2V0H A;  3Q7U A;  4P02 A;  5CQO A;  1QGS A;  2VSI A;  3D5N A;  1PZT A;  4G87 A;  1OMX A;  1ZCY A;  2J0B A;  3DUV A;  5BXC A;  4AYJ A;  1SSQ A;  3KWE A;  4NAL A;  2V0K A;  1LZI A;  3I3A A;  3VBK A;  3JUK A;  4EEG A;  3TWD A;  3ZGF A;  1KK6 A;  1GX4 A;  1JYK A;  1Z90 A;  2WVL A;  3VNP A;  1ZJP A;  4B5B A;  3ZF8 A;  4AC3 A;  3V0O A;  2D0J A;  2VXM A;  4KC1 A;  3FTT A;  2X5S A;  1YP4 A;  4G3S A;  3OTZ A;  1JYL A;  2Z86 A;  1HM9 A;  3OGZ A;  4M28 A;  3U2V A;  2Y4K A;  1QG8 A;  5FUH A;  3IOH A;  2W0V A;  1YRO B;  3N9W A;  4FRP A;  4EAA A;  1FRW A;  4HUS A;  5C3B A;  4HZC A;  1H7H A;  4Y64 A;  4EEM A;  2AM4 A;  3TDT A;  2WGZ A;  2OI6 A;  1VGZ A;  3T7N A;  1I52 A;  1H5S A;  1WVC A;  3MC4 A;  3SPT A;  5CMH A;  1R81 A;  4MIX A;  3V91 A;  4B4G A;  1QRE A;  3U2T A;  3K8D A;  2PGV A;  1H5S C;  4EE5 A;  1H5T B;  2AH9 A;  2D7I A;  1ZIZ A;  2FYA A;  5CMG X;  1EZI A;  4KC4 A;  2OEF A;  2Y4J A;  2J0A A;  4CJC A;  4HO8 A;  3EEV A;  1INI A;  3VBN A;  1FWY A;  5C1G A;  5DG3 A;  3PKQ A;  4D0T A;  1OMZ A;  4NAN A;  2XAT A;  1QRG A;  4IHF A;  4EQY A;  1FGG A;  4FRD A;  4D11 A;  1R7Y A;  2JF2 A;  2JCL A;  2YCM A;  4FQW A;  3MQH A;  5C1H A;  4EGG A;  5FV9 A;  4HO5 A;  4D11 C;  2D7R A;  5C3D A;  3EG4 A;  4B2W A;  2AM3 A;  1GA8 A;  2PX7 A;  3CKO A;  3OTM A;  4FIX A;  5C47 A;  5FU8 A;  3D98 A;  5ADX U;  4Y6U A;  3R0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...