3FOWA

Plasmodium purine nucleoside phosphorylase v66i-v73i-y160f mutant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
243
structure length
234
Chain Sequence
NLLRHLKISKEQITPVVLVVGDPGRVDKIKVVCDSYVDLAYNREYKSVECHYKGQKFLCVSHGIGSAGCAICFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHLLIHGDFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMFYPNKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKLVPHQLENMIKIALGACAKLATKYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural determinants of the 5'-methylthioinosine specificity of Plasmodium purine nucleoside phosphorylase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
molecule keywords Uridine phosphorylase, putative
total genus 77
structure length 234
sequence length 243
chains with identical sequence B
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2009-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fowA00
3F8WA 4R2XA 3KVVA 4BMXA 1TCVA 3K8OE 4DA8A 1TGVA 1V41E 3MMSA 4G41A 3PNPA 2QDKA 5JPCA 1A9TA 5F7XA 5IFKA 1G2OA 2QSUA 1YBFA 1Y1QA 1ODJA 1OTYA 1U1CA 1V48A 3NM4A 2QTTA 1OVGA 4YJKA 1RXUA 2A0WA 4GLFA 1V4NA 1LV8A 4UC0A 4BN0A 3ENZA 1VHJA 4OGKA 2P4SA 3UAXA 3KVRA 2QTGA 1VMKA 3KU4A 4DABA 4L5AA 4F1WA 5F78A 1A9PA 1NC3A 1VHWA 4L5CA 4L6IA 4LZWA 4DANA 3OZEA 2I8AA 2GUWA 4QARA 1CB0A 1JP7A 3E9RA 4QEZA 4E1VA 5F73A 3EEIA 4EB8A 1T8SA 1Z34A 2HWUA 4DAEA 3PHBE 4F3KA 5ETJA 1ODIA 1RSZA 2ON6A 5EFOA 1ECPA 4TTJA 3IOMA 4JOSA 4D8VA 1T0UA 3EUFA 1RCTE 3FUCA 2AC7A 4QASA 1OV6A 1T8RA 1Z5NA 1OUMA 4G8JA 1A9RA 1Z5PA 4X24A 4WKPA 1Z36A 5I3CA 4F3CA 3T94A 1M73E 4JWTA 4DA0A 4LNAA 4LNHA 1YQUA 3OOEA 4TXLA 4TS9A 3U40A 4DA7A 4K6OA 1V3QE 4M1EA 2RJ3A 4PNPA 3NM6B 4FFSA 1B8OA 2AI3A 2OXFA 2OC9A 4MARA 2A0YA 1JDTA 1Y1SA 3C74A 3OZCA 5F7JA 1SQ6A 1ZOSA 1K9SA 1RYZA 1ZL2A 1OTXA 2IQ5A 3KVYA 1RT9A 1I80A 5B7PA 1U1DA 1PR5A 3P0FA 1Y6RA 3DF9A 4JP5A 1ULBA 3UAVA 3FNQA 4F2PA 4D8XA 1SD2A 1JDUA 2OC4A 4LDNA 1TGYA 1PK7A 3EMVA 4OEHA 3OZBA 2AI2A 4GMHA 3BL6A 2A8YA 1PR2A 4YO8A 4M3NA 4TXMA 3BSFA 4ECEA 5K1ZA 3KUKA 3DP9A 1FXUA 3EUEA 1B8NA 4YNBA 1U1FA 1YQQA 4YMLA 4L0MA 3FOWA 1YR3A 4TXJA 4D8YA 4D9HA 3K8QA 5CXQA 4LKRA 3OPVA 4DAOA 3O6VA 1ODLA 3UAYA 3QPBA 1Z38A 1T8YA 4MCHA 1C3XA 4TXHA 1RR6A 5F7OA 1PR6A 4BMYA 1A9QA 1JE1A 1Y1TA 2HSWA 3NM5A 4PR3A 1Y1RA 1Z5OA 2I4TA 4DARA 4P54A 4L5YA 1OU4A 3DJFA 1Z35A 5DK6A 2ISCA 1K27A 2A0XA 3O4VA 3MB8A 3OZDA 1WTAA 3FWPA 3P0EA 1JPVA 1JYSA 5F7ZA 4TYMA 1Z33A 3E0QA 4QAQA 2QPLA 3KHSA 3E9ZA 1SD1A 1VFNA 4NY1A 1Z37A 5B7GA 1Q1GA 3IEXA 3PHCA 1RFGE 3GB9A 4OF4A 2H8GA 4GKAA 2HRDA 3DPSA 5KB3A 1PBNA 1A9OA 3UAWA 1JDVA 4R2WA 1ULAA 1YRYE 4TS3A 5CXSA 3LGSA 1ODKA 3D1VA 3DDOA 5CCDA 4OGLA 4EARA 1U1EA 1K3FA 1SJ9A 3ODGA 4I2VA 3LBAA 4WKBA 3TL6A 1U1GA 4TTIA 4WKCA 4NS1A 2Q7OE 4RJ2A 4WKOA 1PWYE 3FB1A 2BSXA 1XE3A 1PW7A 3GGSA 1NW4A 3INYA 1PR0A 1V2HE 1RXSA 1V45E 4TXNA 3LA8A 3NBQA 1TD1A 1LVUA 1PK9A 4BMZA 1A9SA 2B94A 4IP0A 1PF7E 4F2WA 4MCIA 1JDSA 4U2KA 4OY3A 3OCCA 5F77A 5IU6A 5CYFA 1Y6QA 4D98A 1PKEA 3FAZA 3SCZA 3UAZA 3BJEA 1RXCA 1QE5A 1PR4A 4G89A 4OJTA 1Z39A 4WKNA 4NSNA 1LX7A 1N3IA 1T8WA 5CCEA 4TTAA 1A69A 3OF3A 5FAKA 2AI1A 4H1TA 2XRFA 4QATA 1RXYA 4KN5A 1NC1A 5EPUA 5F76A 2OECA 4QFBA 5C80A 1PR1A 3PNSA 3OOHA 5EUBA 1TCUA 3ONVA 3UT6A 4DA6A 4GLJA 1JDZA 5B7NA 5B7QA 4R31A 3BGSA 1CG6A 4M7WA 5CYGA 1JE0A 2PGAA 2HN9A
chains in the Genus database with same CATH superfamily
3E58A 3QEJA 1TYBE 5HEKA 4H9GA 3VZQA 4DLAA 2DCUA 5CB4A 2P11A 1ZU5A 5IH7A 2DWPA 3P32A 2PWZA 3JYNA 3N0WA 1TCVA 4HX9A 4NEHB 1W85A 1WW8A 4XM2A 5CB6A 3CNNA 4DA8A 1DKPA 3SQOA 2GO1A 4IH1A 4MP6A 3TQQA 5FOQA 2D7JA 1N2HA 4Q3AA 2ZI9A 3IGFA 4LY9A 5AO9A 3B70A 2HHCA 3KYIB 2X0JA 1OB5A 2A9JA 3HBLA 3JQRA 3M1LA 5AVKA 5BW5A 4OQYA 1N2GA 1KQPA 5HQJA 3TSAA 3R77A 5JNVA 4J03A 4NXMB 1OBCA 1MUUA 1X3LA 1N5RA 1G2OA 2QSUA 2GWRA 2ZE5A 1HE8B 1W35A 2QE7D 1IOZA 3FFBA 3HDYA 3P9YA 1GSIA 3QENA 3IR6A 3PWKA 2VT6A 2X5JO 1MPXA 3MCTA 1I9GA 4JBYA 5JZMA 1P0FA 2QPOA 1R10A 3UAOA 2A0WA 4EK9A 4GLFA 1YFJA 1BQ3A 2FP3A 3DWIA 3KAPA 4I4TA 3ESYA 5IUNC 5LUAA 2OBFA 1QDEA 4AJPA 4HPWA 4LXTA 4C29A 1T9GS 1Z62A 2P9YA 3MFYA 4JJFA 2NTNA 3IKTA 3CKLA 4TWZA 1OZGA 9ATCA 3KVRA 1HFEL 4G0XA 4BNJA 1EUYA 3DV2A 2HBQA 5D01A 4DDWA 1QG0A 3O26A 3H65A 3WA6A 2Q6KA 4B75A 1UKCA 1DO2A 2WZDA 5CYOA 2HY7A 1P4RA 2QN2A 3L43A 3GMDA 3RVOA 1I4EB 1UZUA 1YA6A 4DNXA 2HQRA 1PDWA 3DR3A 2VDLB 3E15A 3OZEA 4B73A 2QJFA 1XRJA 3E9NA 5JSHA 1Q11A 5BV1A 3C3KA 1B2RA 1WUHS 2GUWA 2P4UA 2R6GA 1YT5A 1Z4IA 4ZU1X 4DYDA 4Q9JA 3P0RA 3M9WA 4JI2B 2JVKA 4HDMA 1F4LA 2ATIA 4IGEA 4LZZA 5FCDA 3HVHA 1QAMA 3EJ6A 1PBTA 1YQXA 1HDXA 1VJTA 3AJ9A 1AUVA 3EQ6A 4MH0R 4W5NA 2KLBA 4L9AA 3EC7A 1LUAA 1DDGA 2CJWA 1KMHA 3EA5A 3IAUA 3M2PA 1E9BA 1S01A 3HYTA 2X8LA 1R8XA 1UDXA 1WB6A 2ON6A 1KEPA 2QTHA 3MS2A 1T25A 2R3SA 1S3IA 3PU6A 4PLGA 3IOMA 1S1MA 1X9HA 4W1SA 5B6PA 1S7CA 4IMRA 3JAKA 1KYXA 1P2GA 5HKLA 3WKDA 2WD7B 1KZYC 3OLWA 4F9TA 2FKAA 5TX7A 1AS0A 1XYVA 1FFEA 3ELBA 5JDCA 1FTYA 4PN7A 2ZWVA 2G7MC 3Q87B 4ZVMA 1AUPA 1C9DB 3NHPA 1YB4A 1CUDA 1NUPA 2DR0A 3MRSA 5F52A 4YCLA 1N0HA 3O4RA 2BYTA 1A9RA 5HIJA 3AESA 3ZCSA 3GEPA 2P0EA 3B5IA 3H2KA 5A5FA 4HZGA 1KQFA 1IY0A 1ODSA 1FRFS 1RFLA 2WG1A 4YFVA 3RGGA 1ACMA 3I58A 4BUZA 3QOFA 1XXHE 2PFSA 1E1RA 3Q40A 3CMMA 4IRXA 4PNHA 2J6CA 2IZ0A 1F2UA 4JKOA 2C4NA 3ONEA 1U9YA 3KDAA 3SR4A 4PHFA 1M73E 5D1NA 4JWTA 1SKQA 2FUG1 2YV5A 3CX4A 4LBWA 4LNAA 1R4NB 5EUQB 4JJEA 1BMQA 3CWCA 3KSRA 4YRSA 4MEJA 3N6XA 3QNMA 4TS9A 3GLGA 3QWHA 4XZ3A 4ZRDA 1P9OA 3S2ZA 5JS7A 5TQ0B 1DFIA 1DZ3A 1KEKA 1N8TA 1XRPA 5DYGA 2OQ2A 1ZH4A 3OZVA 4ED9A 2ZJ7A 5KQSA 4DCPA 1WVGA 4JYAB 3H7AA 3O4HA 2G82A 1VMEA 1PJ4A 1AGYA 2QGFA 2VSOA 1MAVA 3PGA1 3NNNA 2V7BA 3L7CA 2OAP1 2CL5A 2AR9A 5K45A 2NO9A 3ETEA 3NHSA 4HB4A 4HXGA 3HYRA 4R9VA 4ZCPA 5LA6F 4L76A 2H54A 4EO4A 1CR4A 1MENA 4W1QA 3A2MA 1M67A 1XL1A 3L1KA 3N9IA 3I5YA 1I51A 3SJCA 1E9EA 3D0OA 5IVIA 2ZB2A 2VUTA 1JPNA 1NVVR 4EHFA 4LQ4A 1MV5A 4HDSB 2YJ6A 5C8ZA 4UE6A 2GFQA 4DR2B 2Y3IA 3AR2A 3OFSA 3AVOA 3OKPA 1HURA 4DILA 1GGEA 1ZGJA 4Z4IA 5CP8A 2FPGA 4D9FA 1T9KA 1CJBA 5FFNA 5T67A 3P0FA 4JP5A 1JF8A 4X94A 1SVLA 4NPCA 1Z88A 4XYBA 5EESA 3DF7A 5AKKA 3TDMA 3QYJA 1X7WB 1B76A 1PL0A 3T7DA 4DUPA 1QV9A 1XLVA 5K0TA 2QJTA 1CQPA 3X43A 2FP4A 3EF3A 3FZEA 4UU1A 4MPRA 5DYNA 1TGYA 3O38A 3MBIA 2QUIA 3P9CA 4AZVA 4RF2A 5DNCA 1BKYA 1JAHA 3PB3A 2XXAB 3VKHA 2FUCA 2GRJA 2GTPA 3RRJA 1J06A 2XGSA 3GK3A 1Q2XA 2F1IA 3MS7A 1BFDA 1GADO 3QUTA 2E7ZA 3E3MA 1KK2A 2NP7A 3BSFA 3B89A 1ZRMA 1JHZA 3AEKB 3KR2A 3DT8A 3NNDA 3D4IA 3LPLA 4WH0A 2Y0CA 1J2JA 3O8QA 2BE7A 1I6WA 4XB6B 1DEHA 3JQ9C 3E4CA 1FVHA 5ULLA 2O7VA 4IV0A 2A9VA 2I78A 2V7EA 3L0BA 1L1EA 1RS0A 3MOGA 4PHGA 2Q0HA 1F20A 1TX4B 3GXBA 2BC9A 2BELA 2H1RA 2HDHA 2C4UA 2NT4A 3HS3A 3W2IA 1G8KA 4KN8A 3G2KA 4IOLA 1Q7RA 3ICQB 2CJWB 1VL8A 4FOSA 1KSFX 1PYGA 1QV7A 4ZQHA 1R5BA 2WJYA 3DB1A 3RS7A 3UK7A 5HKKA 1Z6ZA 1Y8ZA 1QKJA 2BR3A 3NG1A 1NX6A 3CB4A 4EDHA 1QNFA 4GFDA 3IRUA 5H4HA 3VYUB 1UBJS 5ESDA 3CPJB 3WL6A 1NI4B 1T2VA 3R7LA 1PJTA 3BN3A 4HQRA 4AYTA 1Z38A 4BBZA 1M7GA 1N1MA 1VMAA 1DAIA 3V4RA 5L4NA 2I22A 4RSHA 1SXPA 2LIVA 4CI0B 5IAGA 4M86A 1NJ6A 1C3VA 5DNUA 5EJ7A 5J1SB 3JQ6A 2HO4A 2WTXA 2J7KA 3I23A 1WIWA 1Z3CA 4S24A 3AVQA 3RM3A 1EBUA 1NRIA 1W4ZA 2IODA 2FQYA 2OK7A 3MHPA 5AW3A 1JE1A 1Y1TA 4C7JA 4LA4A 4JFAA 4OHZA 1KF0A 3RGWS 3TLJA 4HVLA 2C8KA 2PRIA 3OQNA 3MB5A 4NEQA 4EA8A 2I54A 2WWVD 2HCJB 1WXEA 4BO7A 4RJKA 1C3OA 1P2DA 4LQDA 2PZAA 1Q57A 3RUCA 1AO0A 2AOTB 3K9GA 2V03A 4HFMA 1OU4A 1HE1C 3IP3A 5AUPB 2PU5A 5IJAA 1AU9A 5TJ9A 4EG6A 1DT3A 4MSUA 2UYHA 1WQ4A 1Z35A 3V4PB 4FXOA 3E7WA 3MAJA 4HH1A 1H6AA 1OFVA 3PFHA 2A0XA 2M6KA 4MZDA 3B9RA 4J2HA 4M60A 4XB2A 4UM9D 4D3SA 4IKOA 4B8WA 3QKUA 4WDRA 3ZD7A 2YN4A 1EM8A 1WSAA 4MW6A 1CU1A 1GVHA 2RGGA 3EZYA 3F3MA 1LBSA 3OZDA 3KKPA 4FKMA 4TKVB 5EZYF 1MQ8B 2C3UA 2IA5A 1Z8FA 1QMPA 2XYHA 3PJDA 1O4WA 1U0JA 1S4MA 2C9OA 3LDUA 3D0QA 3GEHA 1DV1A 2C58A 3TLGA 2JW5A 3LG2A 1QIDA 2EQ5A 3W78A 5M7EA 4CEIB 3T1QA 5HJ5A 2BEWA 2IUFA 3P52A 4EYKA 4WLOA 3PX2A 1WDTA 4KGXA 3OJOA 4KFUA 5EHZA 3HJHA 1UIRA 2Y77A 4AX8A 2G80A 4OHRA 5IDWA 3RVRA 3LZCA 1JLMA 3BGIA 2DQYA 8OHMA 1H9BA 4B6QA 3BGWA 2WQ7A 3TZQA 2KBEA 3G2OA 1DC4A 2FN8A 4IS2A 1ZI9A 4UBMA 1DS6A 2I4NA 1GFZA 1Q1GA 4EG1A 4K86A 1FRQA 3JQBC 1HT2E 1A97A 1OAOC 5ICFA 4Y2PA 3T34A 3SY8A 4M8KA 4Z7NB 5L9AA 4DKJA 2XMZA 4GQIA 2I66A 2XZOA 1AGXA 2CHQA 3UJNA 5CVJA 1MAWA 4ZJPA 3MT9A 1CERA 1CZUA 4NJMA 4RLHA 4L7VA 2FWNA 3WO1A 1INLA 4J0JA 2BUCA 2KB0A 2XJ9A 4NZ9A 3Q1LA 2RD2A 5DM4A 5F3WB 5HA5A 3CPEA 3TB4A 4PU0A 1FCJA 3AVPA 3KKNA 3ZJTA 5DTRA 4KPYA 1I1HA 3AY6A 3D1VA 2JIOA 3NTRA 1YL5A 4I2VA 1D2AA 4LX8A 1RD4A 1QK4A 2WJ4A 1X86B 2RGUA 5DSZA 4ONEA 5DB4A 1DC6A 2FDCA 1QC5B 2Q3LA 3FPSA 4QM7A 1THGA 4A91A 1NYQA 3E8SA 5IJ0B 3OFJA 2VXBA 4Q7LA 5IT0A 2P2DA 2EC5A 4N49A 3IDFA 3FNGA 1U8EA 2HRRA 3EVEA 4WEQA 3LXMA 2F8TA 1G63A 3MUFA 3R5KA 3ZZNA 5FQOA 4UUAA 4BECA 3IEMA 4YXWA 1QFSA 1HYQA 2CDRA 2OQVA 1DEXA 1LLUA 4G1MB 3CG0A 3G7SA 4M99A 2WBLC 2TYSB 5IAAA 1CRPA 1FUKA 3K70B 3I0ZA 1CUXA 1N0VC 3K4QA 1ULTA 3HO6A 4QBKA 2DGDA 2GWHA 2P2SA 5T6BA 3H2YA 3VUEA 4A0FA 2C20A 4EPWA 5A2QA 2JFZA 3NWEA 2M98A 5BVHB 2IT1A 2P0YA 4LJ6A 4W7SA 3S8EA 5DM1A 5KNBH 4LI0A 5DX1A 2WUFA 4NCJA 1TUGA 1SHUX 1DHRA 1WR8A 3CLKA 3EWSA 1ZBQA 1MO5A 3BH6A 3BT7A 3OU6A 3PR3A 1QR2A 4RWZA 5L3ZA 3DYVA 5FADA 1F8XA 1UDRA 1IXZA 3ZKWB 2OKGA 3ZU4A 2OVBA 1TIPA 5IHPA 2FSVC 4QPZA 4RS3A 4RXTA 4GQBA 4O2BA 4NAVA 2QROA 4F2WA 1M6VA 3QEMA 2G72A 4N8EA 3UPUA 3WGMA 2EP5A 2WHYA 4R8MA 5ITSA 2JPDA 2QQ0A 3W6PA 3DBOB 3RADC 4GOLD 4N54A 2PU7A 4YRAA 5HS4A 2FI1A 1GNPA 1K8XB 2ZPAA 2G71A 4NBNA 1M1NA 1AKMA 1SIOA 1WD7A 3E4DA 4HGQA 3KB6A 5IF3A 2ZIUB 2AN9A 1C9EA 3H3XA 4OHWA 3RJZA 3UAZA 1O9HA 3FLBA 3R7FA 4XGKA 4AMZA 1KY4A 5C53B 3IUJA 2YMPA 2GOYA 3AO0B 4OYYA 1NUHA 2RGCA 2Z09A 4DQKA 4E12A 1EESA 3KQTA 1W4CA 2O2EA 1SBNE 1H4SA 4MRSA 3N87A 2G07A 4Z3DA 1Q91A 2QU7A 1H6DA 1E7RA 3BEDA 3C8HA 1M0TA 3LZDA 4KQGA 4NECA 3PDUA 1Z39A 4NU0A 4EG8A 1TIKA 3BA6A 2ZUTA 2QMOA 3ECSA 4US1R 5EKDA 1XEAA 1ZINA 2IWRA 2B61A 3T0FA 4EI2A 2QLNA 1K8QA 1H4TA 4IZOA 1KYYA 4G4GA 4UAGA 5HF6A 4EPYA 4RKFA 3LUPA 1YULA 1C3LA 3ORYA 3OX1A 1IWOA 3P8ZA 1RHKA 5FDFA 2P6MA 4H1TA 4JU8A 1TJ4A 5E38A 4MVJA 4DSOA 5DXFA 3D3WB 4YJDA 4C2TA 3F7OA 1I2BA 3HDJA 3KKKA 2QJRA 4A26A 1E6MA 1E4YA 2OECA 1DTEA 4GP7A 5LBUA 3NIWA 5JDIA 1ZXXA 1PR1A 1L4LA 5EA2A 4RQTA 2JAXA 3C97A 4ERNA 3T9AA 1XN4A 2R6R1 3KLOA 3VR2D 2AFIA 3ZQ4A 1MRZA 1Y81A 2B1IA 3OOHA 4HJRA 3BB4A 4P7FA 3SKVA 4B4DA 1W75A 2WSMA 3THWB 1TCUA 4V2UA 5DCUA 2ZRGA 4AS1A 1E2IA 2A9RA 1ICIA 1J56A 4XIYA 4F7WA 1QH9A 2ECQA 3D0RA 3MWYW 5G0TA 2BCGY 4FWBA 4DA6A 3S6JA 4F5DA 4MS1B 2HSJA 1PT9A 2ZVDA 2ZAMA 1KDYA 5B7NA 2ZR7A 1WXXA 3KQOA 2ZAIA 5ENVA 3LQ2A 5FNVA 2D62A 2A9FA 5GWXA 4GPAA 3EQ2A 1CF2O 1X8LA 4KHPB 3NQ41 1FYXA 4OM7A 4MEAA 1XK7A 4ITRC 4RCZA 3TUIC 1V4VA 4F1JA 1SQ5A 4WZBB 2BHSA 2CNOA 4EKYA 5MGBA 3PHLA 1EAMA 1G9XA 2L69A 3N3BC 5G4KA 2C57A 4RJLA 9MHTA 1HLPA 1XUOA 1X14A 2VJBA 2WUVA 3BWVA 3O73A 3OCUA 4GM1A 4R05A 3RS0A 2CHGA 4OAOA 2C4TA 4L74A 4R2XA 3RS2A 1OLOA 3WGUA 3KVVA 3PHIA 4GHWA 4ZCLA 4RJIA 5IBRA 1SD5A 1OYYA 4DMRA 1G1AA 4KE8A 5G40A 2F4VB 1P18A 2WUEA 2Z6UA 2AG0A 2PL9A 4UZEA 1XPRA 2IHYA 5IM5A 2A33A 4RGBA 3GJXC 2PH3A 1YNSA 3K53A 2F3SA 4UNSA 4H15A 3PNPA 2W2KA 5I7RA 4Q7EA 4QDXA 4ZMSA 1P7CA 3Q8MA 1NP6A 3OTGA 3JVIA 3JAKB 4DCGA 2R8EA 2BFDA 3RYHA 3WLNA 4R83A 3SSAA 4P7KA 5LMZA 3R3ZA 2YDXA 4H4EA 3RAPR 1L1FA 5DTJA 1P17A 2QP9X 1UL1X 3ONWA 1BE6A 1QU3A 5G1NA 5A9RA 4U7PB 1V4BA 4XVHA 2WA2A 4B74A 1GDDA 1UJ5A 1B0AA 3B38A 1GTJ1 1XDGA 1BZYA 4EB0A 4FS8A 4Q3OA 2VG8A 4MUXA 2Q2OA 4ARBA 1CUEA 2B1GA 3AZQA 3HNOA 3M6LA 3B9QA 5ARDA 1IL0A 1UP4A 4KRXA 2ZTSA 1ZO8A 4K2HA 4LOAA 5COQA 1YAJA 4ZAVA 1F2UB 4GE0A 3IQHX 3TG2A 1TQDA 3A3KA 1VMKA 4MYRA 4AW9A 1U8XX 3KT0A 4YI3A 1CY0A 3OF5A 4A4DA 1EA7A 1KVRA 3CPHA 1MB4A 1GD1O 3F7NA 1N2ZA 2HWYA 1RP1A 1VSBA 3F2VA 3I6MA 1PEKE 4GBED 1DAPA 4L5AA 1WXWA 1OHHA 2V4ZA 1V39A 4X6LA 3HKCA 1ZD1A 3IKMB 5ADUS 1H6BA 2RC5A 1CQJB 4XDHA 2LPMA 4J7XA 4RVFA 4FSHA 4KQKA 1YR8A 1E89A 2Q0QA 3FSGA 3KUXA 3DEHA 3HL0A 4F93B 1K7XB 5ISMA 3TYXA 1SKYE 2H1SA 4FHEA 1KK1A 3T1HB 1KFEB 3EGDB 1IOWA 2HCTA 1JDPA 1VCMA 3NAZA 1ZX1A 3CZCA 3V55A 4IQFA 5HUQA 1UQRA 2V7PA 3RTCA 3QEBZ 3OD1A 5A4DA 3Q10A 1NFFA 1RZRA 1QIIA 3BGVA 1IATA 4X8MA 3SS7X 4LHXA 1A9XB 1OYOA 1UBKS 2MR5A 5A3JA 4C4OA 2QSJA 1COWA 4EVQA 3MF4A 2DZDA 2JIRA 5LYYA 4M9RA 3L7YA 3FFWA 3I9MA 4WUVA 3GDHA 2PLFA 3SJZA 3ZVNA 1GPUA 4OD0A 4JP1A 3OG9A 4GX1A 4D8VA 1JJBA 4LJ8A 4C0HA 1WOMA 1C41A 2G5TA 2OXRA 4HEJA 3NOVA 4B3HA 5C1OA 3QY0A 1Q0RA 1Y33E 2H06A 2AC7A 2ZI7A 2FG5A 3FCXA 2M1ZA 3ONDA 3UB3A 5A1TA 5I4KA 1OV6A 3RYCB 2V6BA 4NBUA 4U39A 4HDKA 1KEWA 2QAGA 3GLGE 5EXEA 5L7TA 3E5RA 2VNAA 5EIBC 2JCYA 2QRVA 1G6HA 3MCWA 3AL3A 4B5KA 4CCYA 3NHRA 3RUIA 3RS4A 4IZ6A 3T7EA 4FE7A 1H0HA 3VTAA 1D6MA 4AJIA 3AEQB 3P9PA 2VUSA 3VSBA 3LXRA 3RNOA 3DQPA 4RX1A 5AJWA 4Q00A 4OYRA 1WMEA 4WFJA 1OPRA 2CLDX 1GPBA 1X6VA 2OHJA 2UZ1B 3TCNA 2IZ1A 4LJYA 2GKSA 1TKBA 4F6CA 3QXXA 5HG0A 1D5CA 2INGX 3TE7A 2W37A 2FPXA 5K0FA 2GHTA 3Q8XB 4ZAGA 5KOHA 1KJQA 1KYQA 3W8RA 4TRRA 2CJPA 1DAFA 1XTQA 2COKA 4AL4A 4DMLA 1L7AA 4NK4A 1PP4A 2AI3A 2CFIA 1O96B 1YSCA 4IMIB 2V96A 2A0YA 2OZPA 3AR9A 4LV5B 4R84A 1S02A 1UKAA 2JS7A 3WYCA 2E87A 5MHTA 1DBSA 3GR6A 1FUIA 3IOCA 3VV3A 5A5EA 2COUA 3GP5A 1J25A 1FNSA 4L0CA 2DFKB 2H0AA 3LUGA 2CSUA 4HN4B 1HTWA 2EKBA 3B8EA 1EM6A 1RYZA 3HCBA 4HDQB 4LUCA 4NK5A 4R40A 3EDMA 4ZYWA 1XCJA 3MK31 3L7AA 1OTXA 2VT2A 3WGYA 2ZRFA 2WRZA 1P33A 3S70A 3SS9X 3R09A 1QYCA 3SXUA 2YHSA 1LTQA 3OZGA 1BMDA 1W4BA 3AETA 5C5CA 3IRVA 4YJGA 1O6FA 1O1YA 1GUBA 2C2XA 3AONB 1WB4A 1WSBA 3QYPA 3TD2A 1FPMA 3DTYA 1YVUA 3OX3A 2DBVO 2UZ4A 4BVEA 4G1UC 4DYVA 1ULBA 2D5IA 4HWPA 5C3UA 2AF3C 3LX6A 2BVNA 3PK0A 2PZMA 4PWZA 4RL6A 1ISHA 1KJZA 5DXAA 2XXAA 4URYR 2AOUB 3QX9A 4P5DA 1I4WA 1V9LA 3BD8A 3PNVA 3DAYA 2C4KA 3DOJA 4WGGA 5J5AA 3UUGA 5DHPA 4BAGA 4E4TA 5JZOA 1DQSA 2ZSJA 4K46A 4KWCA 4N01A 2BM0A 3LDHA 8ATCA 2D7CA 5HRCA 4OCZA 2QW1A 5IJ9B 4DV4B 4F9FA 2XB2A 2D2EA 3BL6A 1AB6A 4KPUB 4GZMA 5TV2A 3RB8A 1XZCA 1QBKC 2C2YA 4DSZA 5AJUA 4RK7A 1P5HA 1JZSA 3Q9SA 2F90A 1MJHA 1Y6FA 4WNIA 1XQ1A 4J0FA 2FJ0A 1GQSA 3LYAA 3VR3A 3W4IA 5AQ1A 1E8DA 1X1EA 4BIMA 3RE1A 1SC9A 3OD5A 5A4AA 2QMHA 1O8BA 3AIKA 2ENWA 3O8DA 1QGUB 4H0CA 3ZZUA 4BU1A 1AMNA 1JWBB 2RGXA 3NH6A 2RH4A 3TL3A 3ZHYA 4BEBA 4PZEA 2FU5C 2V98A 1U7HA 3F5QA 2ZB3A 2HA5A 5J2TF 4BGEA 4IJMA 3ZDFA 1P0MA 4FN5A 2ATXA 2BCJQ 1PIWA 3V4OA 3A6JA 2O50A 4FC6A 4QODA 5KJFA 3F97A 4BJHB 4HNTA 3FOWA 1H0KA 1P4HA 2QL5A 3BFVA 4YXFA 4EKGA 3A10A 5CM2Z 4LDJA 5B1IA 5TMDA 1MOZA 4D9HA 3BB3A 2B2CA 2G1AA 2FX5A 4HAXA 2D4AA 4MCJA 4YIHA 5AW6A 3HJNA 4DBZA 3W2EA 2GM4A 2WTNA 2DSTA 5BOSA 1M1XB 3D4PA 4R1MA 4Z7OB 3TVTA 5AVUA 1FDVA 3VOBA 1FTGA 2IXBA 5CX4A 2BF4A 1H23A 1YIOA 2A3RA 1QTNA 1JKIA 3ZWKA 1QZUA 3T3GA 3VJRA 4PPNA 3OI7A 2PRYA 2AX4A 4HWKA 4J1TC 4KIFA 4MP3A 3BHJA 1WETA 1E79D 3MWLA 1M2FA 4UOQA 4O4HF 3FPJA 3ND6A 3E53A 2VZ8A 1ND6A 2F8SA 4LPKA 3ASUA 4HLDA 5DOVA 3WDMA 2XUQA 4NZPA 5EN4A 2QRVB 4MW5A 3DD5A 1UXOA 3ZW8A 2AQ8A 3E61A 5EJIA 5I47A 4LYEA 2WWTA 3C85A 3SWWA 2H92A 4H7PA 3V3KA 4R1NA 2XQJA 3QVGB 1U5BB 1SC1A 4IDCA 4AJLA 2H5EA 1QRTA 5K0NA 1YC2A 3DE5X 4PM4A 1DMRA 2H9IA 1EFRA 2JHAA 2XZTA 4GR5A 4P54A 4P93A 4JLNA 1I3MA 2LZ0A 1BJKA 3ETCA 4WOKA 3RUHA 1XQXA 4X5OA 3W77A 4D5GA 1KJWA 4HDNA 4PG5A 4V3CA 3CVVA 3PNOA 2DB3A 4LSWA 1T2UA 2B20A 1YACA 3ZX5A 5EJMA 5IK2A 4D6XA 4EVIA 3QKSA 3ADCA 4BNIA 2X5NA 2UZ1A 4RETA 2F1JA 3NPMA 2C0PA 1YBMA 3DOCA 4RF5A 4WPGA 5GV8A 5ICSA 5JHHB 3SF8B 4ZMRA 2RHCA 4M4SA 2ZXUA 4RMIA 3EMKA 4L22A 4D0SA 1SG0A 2VRBA 3CH7A 3DR5A 2ATVA 5CLLA 2BMEA 3QWFA 3MB8A 2DMRA 2QT0A 4BNMA 3PUXA 1USKA 3GUYA 1JYSA 4JB3A 2J4CA 4XOIA 1XMPA 3I2YX 2YFHA 1RKUA 4F3YA 4CCSA 1XELA 2REQA 1QNLA 1TMOA 3CZRA 3LL4A 3RF7A 4DY6A 5C52B 1T5IA 4ZVTA 5BSFA 3OIGA 2FPIB 4FLEA 3IT0A 4DXHA 4WFQA 1L5SA 3NEPX 1PFVA 2JIMA 1MQSA 4IPTA 3BOSA 4B3XA 3A3YA 3A9TA 3FPFA 2VUIB 1NFQA 2V58A 2Z0MA 3OT5A 2H16A 5ILGA 4ZYVA 3MTBA 4PPGA 1SD1A 3RHSA 4KR7A 4CM9A 2OMEA 3RC2A 4XKJA 2SKEA 2GX6A 4JOQA 1IE3A 2KW5A 4MKGA 4Y1GA 5FOTA 4GPIB 1ZNZA 4ZRNA 2VPZA 4EECA 4TL8A 5KYWA 3Q7IA 2HK7A 1P0CA 2A7XA 2H52A 1ONSA 3ORSA 4JC8A 3C3DA 2JRLA 3RV4A 2YHIB 2NU9A 2JHFA 5MN5A 5EEGA 4E6PA 1BG6A 5K9ZA 3ISJA 1QDLB 3KQLA 3QV2A 4NZMA 2E4AA 3CUVA 1IC6A 2WYUA 4TS3A 3IXQA 4RFSA 2YQZA 4K1LA 1M2OB 3P4XA 4DR1B 2R8RA 1WPRA 1NRJB 4OSPA 3DOOA 4GYWA 4Q34A 1JW9B 3LBAA 1FZTA 2Q1TA 4H4CA 2GBLA 1LKZA 2CNDA 4FZRA 3NHAA 1AXEA 1EX6A 1OI7A 1UJBA 2DFNA 4S1VA 1FVOA 1R5JA 1WCIB 2YCLA 2O7SA 3GCXA 2PVCA 4J1TA 3MWDA 4KUGA 2VDKB 3QSGA 3O2JA 4I50F 5JWHA 4R2LA 5I9IA 4BCDA 2P6UA 2BFFA 2NZYA 2PPVA 4M0FA 5FTJA 1Z3IX 2PXCA 3V8QA 1N2EA 2QMYA 4M22A 3H2ZA 5A5GA 3V7YA 5LIPA 3U9LA 1ISPA 2CEKA 4JBXA 3NOXA 3I1JA 2RHLA 5ALXA 1CKEA 3DUFA 4D3DA 1DZIA 4N6OA 1ZUHA 3HUTA 5IMBA 4IXMA 1QTQA 1YZGA 3X1WA 2GDJA 2OGWA 3D9QX 3PQ6A 3WLLA 1F2TA 4YMTA 3L6RA 1KH1A 1VZ3A 3HZOA 4RPKA 4OQMA 2W48A 1MIOB 4X1IB 1P31A 4EMUA 1Q7TA 3GPLA 4DR7B 5GZ6A 1ZZEA 5E1OA 3EZ7A 1BU5A 3ANXA 3LLMA 1JU9A 2OLKA 5B6JA 2PWAA 3FDXA 3JALB 3REGA 2GTHA 4FNMA 4QJ3A 5I6DA 2VJYA 4JSTA 5J1TB 3RNLA 1QIMA 3JW8A 5TPZD 4Q4AB 2AQIA 5D3QA 5D87A 1B43A 1XTIA 1TKCA 4MRMB 5JZSA 1ZVVA 2OUKA 2W2QA 3WP0A 4XQ0A 1LNQA 1XA0A 1ZGAA 1OHHD 5GP1A 5GIOE 1A5BB 3CF0A 3K1AB 4BJ1A 1IHDA 5JQGB 4QPPA 2O2CA 4URFA 1EK5A 5EQTA 4BAUA 4I4NA 3EPJA 2WYHA 2CV1A 2C2BA 2W0MA 4MR7B 4OOFA 5C4MA 2JAUA 5HDQA 5BR8B 2PSSA 1U0EA 3BJEA 2CNNA 1CJVC 1LXCA 1DG1G 1RCUA 1U3DA 3QLVC 1WBDA 2V0CA 1JJ7A 3BGDA 3D3QA 5JCJD 1BFKA 3FG9A 2HCRA 3HDGA 4G8BA 4GL4A 3ZI7A 3F6SA 3PNQA 4KPEC 2A4MA 2P1DA 4OJTA 2R8YA 2IV7A 2IZ6A 5JXJA 1EWKA 1TO2E 4E5MA 1E9RA 1QVAA 3RSGA 1E4EA 1N3IA 1RI1A 1ZP6A 1YH3A 2HRZA 3WIVA 4QBFA 3M6IA 3GUCA 3FDZA 2O1EA 2JFBA 3P2JA 1YE3A 2IYNA 3E9YA 2B6HA 3IALA 4UVHA 5DBEX 5T5QA 2AUTA 3C39A 1LSOA 3L7LA 4HRAA 3LYLA 3U16A 4QOSA 3LUJA 3EG5A 1OI4A 7ABPA 2IHTA 2LWIA 3LKVA 1E77A 3SN6A 4CDRA 4PTYA 5IP5A 3EA0A 2YIDA 3IKLA 3KQQA 4PGHA 4AF7A 1KOJA 1H2WA 4HFRA 1ATZA 4NU8X 3J81k 5DTIA 2Z58A 3DOIA 3ANMA 2OFXA 3TS1A 1F0PA 1NPTO 2CF6A 1CUUA 2O7RA 3BH7A 3OTWA 1XEXA 3RIYA 4AO6A 3L06A 2Q5CA 4O6VA 6CHYA 2Q4OA 3BKXA 5F1YA 2I3BA 4WV3A 3ROQA 4HGNA 4O4JF 5IKOA 2CXPA 4DMFA 2NN3C 2XCOA 1N9GA 1BW9A 3UT6A 1CP3A 4BLUA 2CFRA 1YE8A 2K5UA 2VPYA 3TAXA 4AVYA 2GPSA 5EZYA 4LJRA 3FBTA 1C7QA 1XPOA 4J94A 2FZ4A 4REOA 3HZHA 4U2EA 3F71A 5EMKA 3UG6A 2AIRA 3PPXA 4UKDA 2GVZC 3WRYC 5C2JB 1M2JA 3QWBA 3QUSA 2X1VA 2XA9A 3HKCB 3O8RA 3PJRA 1RQ2A 2Y68A 3AQIA 5HCUA 2L0XA 4KE7A 2NAFA 2WFAA 2Y9PB 3BC1A 3HUUA 3M9XA 5IANA 1YZFA 1RWBA 5ITVA 1GPJA 5K5EA 1AQNA 2FYTA 4I3GA 4QDJA 1OWPA 3CRW1 5LDGA 5HRAA 4HMQA 5C8XA 5HSGA 1DBWA 1EXWA 2GJKA 1DOHA 1IEQA 2FMKA 1FF9A 1L8OA 1RAIA 2VJMB 1VYVA 3DE0X 1XCPA 5LQSA 2I6QA 3DLHA 4J16A 3CLHA 1NU6A 4BQNA 1X8JA 1CIVA 2OZKA 3D8HA 4CM8B 2RGEA 4HDRA 3U3ZA 4E2FA 3E8XA 2BTQA 2WM2A 3QF4B 2JAHA 4EGJA 2E89A 3RODA 3CZMA 4QSMA 5H80A 3NASA 1YHZA 2JF0A 1AC5A 2YJ5A 1M76A 3UCFA 2ZBUA 2BFFB 4PGMA 1XP5A 1UANA 2JHGA 2VPIA 4D4MA 1Z73A 1ZMBA 1AS2A 2XUAA 2YWEA 4LXYA 2R79A 4UEJA 1OTYA 4WNAB 2EG5A 1GQYA 2FQXA 3PRJA 4PAQA 2HA7A 2B37A 4F45A 4IGFA 2VPQA 1L5MA 1OVGA 3DE1X 1OFGA 4ESHA 1RXUA 4FBGA 2I29A 3Q7RA 5A7HA 3WAJA 3HCRA 2WNIA 4DMKA 1S4QA 3S5JA 1ECGA 1QFXA 1ZH2A 2IHVA 3KZ1E 1DTWA 3RDPA 2ZE6A 3UB4A 1H2RS 2MSEB 4R51A 1R0BA 4YUVA 4P22A 3D8TA 2EZTA 4CCYB 2I91A 4XDGA 5JYCA 5FHQA 3EBLA 3L82B 4UCQA 3A4TA 3GGJA 4X7RA 1XZJA 3G1WA 3OY7A 2XV1A 3JQEA 5DZSA 4A9AA 3R0XA 1JTFA 2SHKA 4BNDB 5IC4A 1NURA 4C0WA 2OFWA 2ODNA 3NDIA 1S96A 2POQX 1II8A 2NQTA 5DBHX 1TE2A 4O0LA 1P1FA 3E1KA 4Q4AA 1NBME 1VI5A 3UGQA 1DC3A 5IM4A 1GIAA 3LQQA 1EVQA 3DE4X 4DCTA 2PMWB 3UFXB 4EB6B 3LNCA 1FTNA 3SQNA 1CZOA 3GRAA 4PG6A 4QUKA 3THWA 4FCWA 2BIFA 4G0OA 2EF1A 4MW9A 1S2LA 4IKPA 1ZIOA 3DOUA 2WIKA 3DTNA 3KR1A 3WC4A 4AJ9A 1Y34E 2WNSA 2IF0A 5BNWA 5AW8A 4KH0A 3U4AA 1D1PA 2ZBDA 3FVQA 4U7WA 1IM5A 3PEYA 2Q3EA 1NVUQ 1VIVA 5F73A 3PEFA 4KGZA 3F9IA 4NHEA 1SHZA 1T8SA 3AFOA 3CHYA 2JBAA 3E5NA 3U9SA 3WKEA 3ZZ0A 1G20A 4CE6A 1N2CA 5KYUB 4F3KA 1ODIA 1VP9A 2F55A 1D4OA 1SAYA 2W43A 3TTWA 5L3VA 3ET4A 4B0OA 2JK1A 3I2IA 3IDZA 1FFGA 3FDZB 2C59A 4J75A 5A9TA 4U3JA 1K6IA 4FNGA 1GQ2A 3HC7A 1EE2A 3U17A 3IP8A 4EL5A 4PCAA 2UYCA 2YZNA 3SXUB 2YW9A 2PZJA 3KQMA 2I76A 2ANBA 1U6KA 2O6HA 3CNOA 3FF1A 1SVWA 3HYCA 4YAGA 4MLDA 2WUDA 5C1PA 2J9YB 3CLVA 4EVSA 2FCAA 3AW9A 5TPWA 1FP7A 1GPYA 3IIIA 1U2QA 2PBZA 3FGZA 3UUWA 3M89A 3UT5A 1LSUA 4XD7A 3VO2A 3IP9A 3NTQA 2QYOA 2JGEA 4XIIA 1NM5C 3VVLA 5J2TB 2XT9A 3WTBA 3PUWA 4WZBE 1YS1X 4Q9IA 1KEZA 1SCDA 2WJ6A 2AOUA 2ZRDA 3KOUA 1H1LB 4MEBA 4A8PA 5IKMA 2JDIA 2WOJA 2I7TA 3T94A 3IV9A 3KJQA 3ND7A 4ZHQA 5TQVA 5KJCA 2BDUA 3HVUA 4DA0A 1CNMA 2Q6OA 3NHYA 3QY9A 1K6EA 1SC6A 4M8IA 4EZBA 3QP9A 1Q12A 4J0GA 1BH6A 1ZONA 3QVKA 5JG7A 2DH5A 4YRRA 4ZVKA 2QVCA 3L7OA 1O94C 5ANRB 3S29A 2Y1CA 3QE4A 5BQ5A 1QZ3A 1WCWA 4JJGA 4DA7A 3HQ4O 5DX0A 4BB0A 3WGZA 5I5GA 1YBAA 3TECE 4QBTA 3COSA 3D6JA 3F78A 2DPMA 3WAKA 3V1KA 1YGPA 1Q3HA 5H81A 3MVEA 4CLRB 4W5QA 1DKOA 5B57C 2QZJA 2VDOB 5A0TA 4O02B 1RLTA 2EBFX 5TJHA 1LNSA 3VH1A 2F64A 3IHKA 2EBWA 3R3YA 1S8NA 2OC9A 4LDQA 4NYIR 4LZAA 3CRRA 1TUBA 3FCEA 3HH8A 5T8KC 4XVUA 4CM8A 1Y1SA 4O1MA 2XMSA 4M36A 1NYTA 1Q1QA 3C74A 2K2QB 2VZ9A 4PQRA 1KKLA 3EVCA 2PX8A 3OU2A 2ADOA 3KQUA 1ORDA 4EAAA 1UBTS 5FRDA 1KY3A 2HIMA 4AY2A 1PGQA 3VFDA 1TXGA 2WJGA 1VKNA 2ONCA 3H5TA 1L5VA 3LQ1A 2VQEB 1QRRA 2IQ5A 3NT5A 2PUDA 1DAKA 1W30A 2V7XA 3ICOA 1XZFA 1FU4A 1FRNA 3VU3A 1I5RA 4L8FA 1NW7A 1NGSA 4K8RB 1SUCA 4A0RA 2PRKA 3GUZA 1E3LA 2NNLD 4M9QA 2W58A 3FWYA 2YQ5A 4B6PA 5LWHA 2UU9B 3VHQA 3IELA 1T5HX 2Q41A 1G7RA 1RADA 3FBWA 4CU5A 4D4KA 3FNQA 2VLBA 3C3AA 1E1DA 2GEVA 3A1WA 1KOFA 4TZ0A 4N48A 5I7EA 1EZZA 5IDYA 2OC4A 3CR8A 4MQBA 2D74A 2J1LA 4JY7A 3PJFA 3R74A 5HKBA 3HN2A 5JS6A 3I09A 5K0CA 5LBTA 2XBMA 1JT9A 4TV9B 1PZMA 1ACJA 2LXNA 2AJBA 3NBMA 3A31A 1YZ3A 3QUBA 4KQ9A 1VYHA 4N40A 2FOIA 2WSBA 4OEHA 4YDSA 3F5SA 3MJFA 3LQFA 1K9VF 3ROKA 1I4LD 3LUKA 4XWOA 4E5NA 1Q74A 2D8MA 1BEZA 3DGFC 5FBHA 5KKNB 2JK0A 5A9SA 4MKXA 4BKOA 3A1CA 1J42A 4NATA 3EIOA 3H2JA 5K1ZA 2ZWOA 2G6TA 1EWRA 1QGED 3Q9NA 1K7CA 3EUEA 4RADA 4RV4A 4A5OA 4ECAA 5HW0A 5I7UA 2UYQA 1W1UA 2GNAA 4IKEA 1N5KA 1RHMA 1ZGHA 4HPJB 2FN3A 3SPXA 3RS9A 2PD3A 4RM2A 5F3RA 1W96A 2VDUE 3I2KA 4BDTA 4IUDS 4BQPA 1L5WA 1QONA 1DI0A 3V46A 4OLJA 1RC8A 2HMYB 5MFPA 2Z6QA 5F1PA 1SCKA 4CHGA 3I01A 5DGTA 4D8YA 2QVYX 3HB5X 3PQDA 4KR9A 3A3PA 3NV7A 1NASA 3R9KA 5CXQA 2HHHB 5H59A 2WWXA 4UMEA 4AKEA 4N6NA 2GERA 4PYMA 3RTEA 3OX4A 4X8OA 4LQCA 4OAQA 2D5CA 3B1VA 2Y1DA 4NH0A 3LUDA 3KR0A 3SIPA 4FB5A 1E18A 1L7NA 3EGXB 4FPXA 4LF9B 4V0SA 3DW3X 3U7QA 4WXYB 4P08A 1IRXA 2J3EA 3AWIA 5E7IA 5B2EA 3VYTB 4R1QA 3KEMA 4TXHA 4PIPA 5JH7A 1PR9A 1XHFA 1Z4PX 2RGNC 2ZRHA 2NSJA 4NBTA 3ITEA 1K92A 4G5GA 1R4NA 4Y2YA 5EHNA 4EELA 2JFUA 2AZ4A 4P32A 2ZAOA 4FTWA 1LPSA 1KJ9A 5EJ4A 2QTNA 3B3JA 1CLUA 1JHQA 2A59A 3BSSA 4LV6A 2W0SA 2ZW9A 3K09A 4WFIA 1OZAA 4Y67A 3SLRA 3T0IA 3PUZA 1H1LA 1V1RB 1SUIA 3UV6A 4DJFC 5L8VA 1EXDA 1RHJA 5AW5A 4II3A 2BGUA 4PG8A 5KYVA 1EDBA 3UWDA 5KCMA 2D00A 1NNEA 4CMJA 1CJTC 3TTVA 1ZBDA 3VNRA 5EIEA 1FP1D 4KSBA 1M9NA 2OCLA 2Y1LA 1Z0ZA 3M5DA 4U9IS 1GAQA 1RIIA 3HBFA 3M6UA 3ZY6A 3R7WB 2DM6A 2ISCA 1T2NA 4IRMA 3MWDB 2AT1A 4E2YA 4YALA 3STUA 3W9YA 3N3AC 2Z5GA 3LAWA 3BWMA 1L0BA 3D3EA 5KDLA 3WBJA 4D7AA 3HWWA 1Q19A 3WGNA 1G6Q1 1EB8A 4H6XA 3VHRA 2QRLA 1JPVA 1MXFA 5TPZA 5IJ9A 1PZEA 1UODA 1V7PC 3U1BA 1RKQA 3UICA 5AVVA 1PYDA 1G16A 3CVOA 3A2KA 3G0BA 4BV8A 1GWNA 2B8NA 1V35A 3MOSA 2OAQ1 4TMFA 4DT1B 4C5AA 1NXOA 1P45A 2ILTA 1K6MA 1T3GA 5DIZA 4CIVA 4CQLB 2JATA 2XCTB 1L4UA 5HIAA 1VZ2A 1EIZA 2X8AA 2HR1A 1MG0A 5HM6A 4BNXA 1IY9A 2ZBEA 3MD0A 2WMYA 3HZRA 2XBLA 3URKA 1SXIA 3RC3A 3TKAA 3BXPA 1KA9H 3VZDA 1Q0PA 1X87A 5GGXA 1V9CA 1Z0AA 1OPXA 1JVNA 3IVAA 3VI4B 1ZNWA 3B1KA 3G0OA 1UBSB 4GSYA 4HLNA 2YZ2A 3A37A 2QRUA 1CUIA 3EOBI 3CF4G 1QPZA 2I2XB 1YU9A 2OT3B 3IDSA 1OGJA 3RRXA 3WZLA 4A6EA 1LW7A 2FW9A 2X77A 2X15A 2EAUA 2ZR9A 3G7UA 3K5PA 4J7UA 1J07A 3EDYA 3NATA 3UY4A 3TXYA 3J7AC 4II7A 1HX7A 4UCWA 1XMJA 2OV4A 1E1CA 1A2QA 4DPKA 1V95A 4Q01A 1W47A 4ZT5A 2QR5A 5CFMA 4MV1A 1VE6A 3DCIA 1ESNA 4R98A 2AOVA 3DL0A 1ULAA 4QTTB 1IXKA 5CXSA 3AM1A 1NLFA 3A06A 3FHOA 3I8SA 1YS6A 2O5VA 2ZT5A 1AN9A 3RYFB 4CFSA 3P71T 5AJHA 3FR7A 5HJEA 1WVMA 5SYAA 3DWEX 1XGKA 4O8ZA 2OGUA 4B6OA 1TF7A 5C1IA 4DNPA 4BX2A 4DBVO 3F3SA 1Y7HA 3E3AA 2FWRA 1QG6A 3NV9A 4HWSA 4C1NA 4RMJA 4MPDA 4DLRA 1XDSA 5EE0A 2GARA 1T2FA 2PBLA 3QKRB 1VTKA 2VSNA 2X23A 4EF4A 5KYYA 1W6UA 2JGAA 3BS4A 1BQEA 3V7UA 4WKOA 2BTEA 2V7VA 5A02A 2VHWA 3PV0A 5FA8A 4ZCQA 5SZHB 3ZCXA 4A2PA 2FNAA 3H99A 4G07A 2AZDA 1FNBA 4U4AA 3TW4A 1LI5A 4TZTA 4DNQA 1PW7A 1XQ6A 1K75A 2D0OB 4G5OA 2WV7A 3I1IA 4O4LA 4F38A 3ZDBA 1YRBA 3IILA 4K0RA 2A6PA 4BB9A 5LPNA 3MYYA 2QI9C 2AWOA 1V2HE 1KI8A 1Y7IA 5C7YA 2FXVA 1RXSA 1V45E 1VL1A 2H0RA 3NONA 2X9GA 2XQGA 3RSOA 3PF8A 2C8JA 4O29A 5P8WA 1OYWA 4NPHA 3PICA 4IP0A 3P9IA 2X0NA 4FZVA 4RD0A 4B31A 2WKQA 3FZYA 5AT1A 2QLMA 3DFFA 3JWPA 3SVLA 2BFPA 1PG0A 1E4VA 1LTHR 2LUOA 1TYCA 2YHUA 4KL8S 4HV4A 2CFSA 2H63A 3KB2A 4QDZA 1IHXA 2R6ZA 5CB8A 1LWOA 4JUDX 4AJEA 3CEJA 4KXWA 3DFIA 3UXMA 5AJTA 1ECLA 4A0GA 4R69A 4ZJYA 1XCGB 4QBGB 2VDRB 4HDNB 1WJGA 3CTMA 3EZGA 4M9XA 1RAGA 3F8TA 4KACA 3TQTA 5F2KA 5BWOA 1NYRA 5AVXA 1KBOA 5EXPA 1H1TA 3A28A 1U0BB 4CLEA 1DIRA 3CB2A 4L73A 3TQIA 2SKCA 3RVKA 3SYLA 3ZXUB 3DE6X 1SXJD 3DC2A 3HJUA 1QE5A 3MJHA 4V0RA 1G2IA 4DPMA 2C9ZA 5BUSA 3CNEA 5LOVB 1SKAA 4GWKA 3TNLA 1QK5A 2A30A 3CC8A 4AIRA 4KKXB 1V5GA 1O03A 2VAWA 3MGKA 1CW2B 3OWHA 4JLVA 3AJDA 1AE1A 2HUNA 4TLBA 1OH7A 1N5IA 3WYBA 2BL4A 1JJFA 5DNWA 5BWMA 3E35A 4F4CA 5JZVA 3N70A 4D9CA 2FLWA 4DW8A 4MQ5A 2BMVA 1TF2A 3UKDA 1CUCA 1P73A 4O25A 3WYGA 2AKEA 4Y9TA 1QORA 3RKRA 4PX5A 3IA7A 1JGTA 4F6RA 1A1VA 4BP1A 4ZAZA 2VQDA 5AJYA 4AKGA 2JFGA 2IXAA 4MB0A 5J4YA 5GJVC 2PY6A 4XRRA 2CV2A 4FBLA 3IAM1 3RSFA 3K2EA 1LBIA 4FYIA 5BNFA 5ALNA 4UUQA 4G0WA 1YASA 1MB3A 1GR0A 3N28A 1JXQA 2EW8A 3HCFA 4NFYA 1WXFA 3I6QA 3IPLA 4QPDA 2HPZA 3GN1A 5FL7D 3RKUA 1QIEA 2V7QA 1KWGA 2A9KA 3GT3A 1N2JA 5IBPA 3NUGA 1XT6A 1ZIPA 2Q1XA 3AF3A 1FFDA 4TKVA 4MMYB 3VAZA 4C4TA 3Q1KA 5KQLA 3L6CA 2UAGA 3JARB 2BEVB 3GX1A 5JY1A 2I6TA 5JADA 1RWWA 2DSNA 3X1MA 4BGVA 3LJKA 1IDOA 4RBNA 5LWQA 1ABBA 3UGJA 5G4LA 1J33A 2F9MA 4PR0A 3B60A 3CRQA 4GNKA 4DRYA 3WFJA 3GEIA 4H1UA 3T3OA 2VYQA 1E2JA 4UHBA 2PGAA 2GILA 4LJ5A 4YJ3F 5DNDA 3A1DA 5AKYA 2YRXA 4OQPA 4K87A 4A8HA 3KCNA 4IDGA 5IYZF 5KNDH 5FV7A 1V8ZA 3AERA 1MOPA 2WV9A 3I9V6 1Q44A 3W6NA 2W7TA 1KNQA 5DBFA 4CEHA 4GKJB 3T7AA 2BAGA 3KB8A 4M1SA 4BTEA 1E5DA 3E2MA 5BRAA 4ZZ0A 1K88A 2FPPA 4ZDWA 2KPOA 4EQ6A 2OTCA 4DBLE 3TLZA 1BGWA 5DH9A 1QQ7A 4ASUD 2P6OA 2XT6A 5EP4A 4RDCA 1QZZA 4ZI7B 4NONA 3TNDA 2XIJA 4BXOB 2RHGB 2HXSA 2VOEA 3O31A 3L5KA 4CIBA 1ADCA 3WJAA 5IKEA 2OHFA 1LJ8A 4PG4A 3ZHSA 2L18A 4XDZA 2RBKA 2ZYVX 5NULA 2QTTA 1RLJA 2WAOA 2FW1A 4RTNA 2OGTA 5HIMA 1NR5A 2WM9B 2O8FA 4DLTA 4KLNA 3ZJYA 1TIBA 3NVMB 3OFKA 2IU0A 3A14A 5CIWA 3HSKA 1SU7A 1Z15A 5JJIA 3COWA 4LXQA 4QYWA 5AFSA 1NRWA 2D5BA 1C1YA 2B3TA 1XTZA 2YICA 1SUDA 1RJFA 1U8UA 4TTRA 4KRGA 1K7YA 1X1SA 3S4YA 1B41A 3UN1A 1GEGA 5K4AA 1KO7A 1Q0QA 2HMWA 3KRTA 1Z29A 1K1EA 1NZDA 3N7TA 4H3VA 2RHDA 2O2YA 1J24A 3I9JA 4GZLA 4URHA 3VU8A 4TWRA 1P4SA 1UK8A 1DTSA 4EUSA 4F1WA 1EUDA 4JROA 5JPIA 4DSUA 4KFSA 1IQ0A 3Q41A 3UJ6A 3I39X 4L72A 1E1QD 2RGAA 5GAJA 3KLNA 3AFIA 4C3OB 3TZLA 3CBQA 4ZOEA 1X1TA 1IZ0A 2HV9A 5HIIA 5BYAA 1Q1ZA 1XL0A 4MIKA 5LC1A 1OBHA 2RJOA 5BNTA 5A03A 5HKAA 2JNWA 3HXKA 1ZCJA 4C4RA 1TU3A 5KTSA 3G0GA 4TMKA 1EFLA 1NAHA 3AOEC 3WGKA 3NAQA 3NX4A 2QLTA 4CKBB 4EPVA 1K5PA 3DDCA 2MYNA 4YP5A 1OXBB 4DMMA 4DKXA 3UMRA 3OJCA 1B23P 3PBKA 1RWKA 4BFSA 4KXQA 1TQ6A 4JB8A 4AP5A 1DAOA 4U2CA 2NW6A 4LJ7A 2UZAA 1REQB 2PUJA 1G8JA 1W44A 1KI1A 3IC5A 3PNKA 2OMKA 3C1UA 4Y30A 1XZGA 2QG4A 2Q46A 4EPXA 2ACEA 5CK5A 4AKSA 3HR7A 5DI9A 5E2IA 5K0BA 4CG2A 3IMCA 4WZAA 2B5VA 4FU0A 2MINB 3NANA 4JMLA 5AM3A 2J4DA 1FQKA 3IVCA 5EP3A 3QKWA 4PXSA 4F2HA 3BH0A 5FH9A 3EPHA 1M6EX 3RTGA 5LDDC 1EDEA 5G0VA 2FX3A 1YZQA 1BMFA 3E27A 3KIPA 4NYJQ 5AVOA 2KI5A 1J0XO 1V11A 1KSHA 3H2HA 4FCTA 3UCEA 4BMCA 4CLXA 3GJ8A 1JEAA 2AUNA 2F2TA 3ZQJA 4NL4H 5BSRA 5FWYA 2CB0A 4FIZA 1F4PA 4J4HA 5GZ1A 3JAMA 3OZSA 2TMGA 3K2QA 1N7HA 3NEYA 2ZT8A 1CXZA 3R6TA 1U94A 3LE8A 4DDVA 1FJ2A 1FPQA 1K5HA 3OTIA 2FWJA 4H16A 2B7CA 3O03A 4OXXA 1B6RA 2PPLA 4WNAA 3TZEA 4I14A 4GG1A 2GFHA 2HMUA 2P30A 3N0RA 1LGYA 4A36A 1VIMA 1DKNA 3A4LA 1PQPA 2FN9A 2NWQA 3T5DA 3PR1A 3PPWA 4I4LA 1RI3A 4JI6B 4D3ZA 1NI4A 5CT9A 4RO0A 2WG0A 2XT0A 2J7PA 2L82A 1PGNA 2QUBA 1YRWA 3GVHA 4IO1A 5K6AC 3QPCA 4B5LA 1SWVA 5EXSA 3AC0A 3HVKA 3RVPA 4DEXA 4KAAA 1CHDA 1JHOA 3DFMA 4RY8A 3C1TA 1NXPA 4EVRA 3HP4A 4D4JA 3FLMA 3U5TA 4CMAA 2FG6C 5KSZA 3LBHA 4F5YA 3IUPA 1DEOA 3LSYA 4LAFA 2IYTA 3GLUA 3ZJ5A 3ZJ4A 3CFYA 2H4FA 5DNAA 3ETGA 3DC7A 4KDCA 1MF7A 3D7MA 3OY2A 1ZSNA 5LZ5A 3SBXA 2V97A 5CURA 1EVEA 1UEIA 3WGGA 4JQOA 4ARSA 1DX4A 3KE8A 4WCFB 2JJYA 2ACWA 1OZHA 5CDHA 3C6ZA 4YGYA 4CIXA 1Q95A 2Q5QA 3ZZMA 2X6QA 1EVIA 1NWCA 3SFVA 1J5XA 1ZGBA 2EHJA 4C1BA 5BUCA 2XGOA 4ZVRA 1VHLA 3D6HA 1CZRA 4ZU6X 5KTPA 1OLXA 3JD2A 5G53C 2B7LA 4IGKA 3DBLA 5JASA 4FW9A 1USVA 2VYCA 1SC4A 2E6UX 2WSSD 4JI4B 1OOEA 4J7CA 4ZYUA 5IYZA 4HVAA 3WWZA 1HDZA 1N2CB 1SO8A 4EB3A 4DC1A 3A0UA 1CEXA 4DLZA 4KQ2A 1V1MA 3HJGA 3MIZA 2J08A 3U1VA 1ABFA 1NTOA 1Q0TA 1CQXA 2PSEA 3ZLJA 3TOSA 2IKSA 5FUXA 4IJQA 5LQNA 3LWZA 1U8ZA 2WM8A 4INJA 4HZIA 2Y2UA 4BNZA 2XTJA 4BATA 3NBYC 1FYDA 1NMXA 3IAAA 4JCCA 2NV2B 3E7PA 1Q6YA 1D8AA 1NONA 2A3NA 2GDZA 2O6LA 2JASA 3F2IA 4INOA 4YJFB 4Z0PA 4NOMA 3RI3A 4BQOA 2JLAA 2XH8A 3IQEA 1YQWA 1A5SB 4DY4A 1QO7A 3LHDA 5H68A 2IZOA 1U1FA 4H4DA 3WIDA 5AKEA 1WY5A 2FH5B 2HB6A 1M6WA 3JAWB 3K1YA 4XM1A 3WV5A 4CQMD 3D7NA 4D57A 4B35A 3EH2A 4UXJA 4KOAA 3LSTA 4TSFA 4XQ9A 5JCJA 1XBTA 1NMEA 1JQDA 3K0CA 4QDUA 2XUZA 4NDAA 1R9MA 4QA9A 5JD3A 4E22A 3WMEA 3TG8A 4LTNA 4X8HA 4B1FA 4HGOA 3C7KA 5IM4F 1KI2A 2QBYA 4FD3A 2XDYA 3DJYA 4N3AA 1NJ1A 2QAGB 2CJYA 3RC1A 4XFKA 4KTVE 3HGMA 2J59A 4Z49A 5IRCD 3WXBA 3VKWA 3DE2X 1V37A 4R8VA 2YFKA 3OU7A 4EFLA 5ICGA 1T8YA 2EFDB 4DZTA 5FUVA 4HXYA 2QIOA 4OMFG 1K2VN 4X90A 1JLLA 3BFJA 3A8TA 4KQHA 4OQLA 1CIJA 1CY4A 3N0XA 4Y6LA 2XXBA 4FQ8A 5K0LA 4UBIA 4EG5A 1KRWA 2DBRA 1I3CA 2B78A 2W00A 4X6YA 2DETA 2RG1A 3HV0A 2WIJA 1YDMA 1IVNA 4V0NA 3ED5A 1ZIDA 2HSWA 1HTTA 2H2IA 4HWGA 2K7FA 4BLTA 1E2LA 4JL6A 4BX3A 1EP1B 1G8GA 3IP5A 4M88A 1Y4AE 4L5YA 3UOGA 1P5FA 4A10A 1FSFA 4CGZA 3QBVA 3BWXA 4EWLA 4INZA 3RH0A 5JECA 5L4LA 1UC9A 4ITVA 4RZHA 1IB0A 2ICAA 5D7BA 5KPJA 5TLSA 1CR0A 1ZK2A 2A9OA 4FX5A 4OBWA 4OLHA 2FFAA 2QRJA 4RMHA 2FLVA 3BXEA 2V65A 3INTA 1C81A 1JKFA 2AXEA 3K9BA 3DLIA 4MQFB 5DYIA 3D8UA 3MLEA 3NBFA 3RUFA 3UJ9A 3UVEA 2RAPA 1HL3A 3DE3X 3O9ZA 5KYYB 4JZYA 1Q7CA 1DC8A 1FFWA 1LC0A 3B3GA 1H5UA 3U44A 3GJ4A 5C1BA 3BL8A 3GJZA 5T4EA 3I5MA 4GXRA 4LMAA 4S1TA 4V0OA 3M8KA 5ED0A 1J8MF 3RVJA 3ZEIA 1PEAA 1PGOA 4GQAA 3C5VA 3HPQA 4PGGA 4RHCA 4TYMA 2Q0XA 1XU4A 4Q48A 3CY6A 1U02A 1W2WB 2EIXA 2VF4X 4LOIA 1EK1A 1W29A 3C43A 1FFSA 2A88A 3R6LA 1L5YA 3IAS6 1O57A 3QVVA 3DMHA 3DEYX 4I4CA 1DXHA 3X1KA 3IEKA 5HUHA 1X0XA 1OH6A 4MDFA 4PZPA 3SS8A 4CEJA 1CR1A 3D5QA 3C0KA 3N76A 1BVYF 2JIQA 5DYWA 4YH1A 2V9PA 2NVUA 1M34E 1NVBA 1WW2A 1ZJZA 3FTDA 3FF4A 3FWNA 1LPMA 1OFTA 3I5AA 2VQ6A 4ZQBA 2X1MA 5HX7A 5WRFA 3GLIA 2ZCVA 1PD1A 1JFSA 5FF9A 2APJA 3P94A 3S55A 3TLBA 3C45A 1JTVA 4KV7A 1P1IA 1GTMA 3ETHA 5HF5A 16PKA 3TMAA 4JYBA 4AZ0B 3U3OA 2QK4A 1A9OA 1ZA2A 3V1NA 1WKCA 3W79A 5K6TA 3OQHA 3ZOKA 3T52A 3SXPA 1OX6A 3DBVO 3F1LA 3WYNA 4H2DA 1UBRS 4BQIA 3RREA 2C95A 4V1CI 2RH5A 4HUQA 1XTKA 2A5FA 2WDPA 4KLZA 1AV6A 1GL6A 1RE0A 2D1YA 4G2TA 4NENB 3I6YA 3AUKA 3FOCA 2CY0A 3A1UA 3LOUA 3WHLA 5CFPA 4R8KA 3EPPA 2O3RA 3ODGA 1Y89A 4A82A 4Y1FA 4XQCA 2NXNA 3JYPA 1SKUA 5JH7B 4DV1B 1F8YA 2BPOA 4LCEA 3QPAA 2PNJA 4QULA 1ZDMA 4CGYA 4JR1A 1UPCA 5IEBA 4KX3A 3U7IA 1KTIA 3PGKA 1IVSA 1QYXA 4FI3F 4CV2A 5L45A 1HMYA 2I6FA 1QG2A 1GGHA 2Q7OE 3R8XA 5BURA 5FOUA 3QSYA 4YLEA 1NSTA 4AJKA 4I1PA 3A9RA 3QXSA 5E4YA 2QRQA 2ZYGA 3KETA 4TKZA 2HLDD 2QAGC 3FB1A 1MLDA 5H83A 1ELOA 2JLCA 2EQAA 3IIEA 4IVRA 1BDJA 3TXAA 3RYTC 1LF5A 4Y2RA 3W2HA 2PBRA 1HYBA 3UPTA 4Z4GA 4N3CA 4R0NA 4Q37A 2UVPB 1OZFA 4G56A 4I55B 4MPJA 1OVMA 2CMHA 3LLVA 4PW0A 4WVLA 3QX8A 1OH8A 3U3KA 3NBQA 3IURA 4MRPA 5LSAA 3KWFA 4ZODA 5TY0A 1YNOA 3OEHA 3EDRA 4ZZ2A 3BMCA 1E1KA 4RHEA 4DV2B 1DIOB 1VLMA 2B94A 3CPSA 1WA5A 4B4KA 2DR2A 1I5EA 1P1BA 5CK4A 1KJ8A 3P5SA 4UEQA 1UFKA 4IR7A 1GDTA 2ZYDA 1HLFA 1NMSA 3AUYA 4CT4B 1NUQA 3N75A 4CMCA 4EABA 1TZBA 1Z2NX 3PZBA 3HSYA 3KZNA 3TOCA 4H0NA 3MQ4A 3K4HA 4YCCA 3D3JA 2IE0A 1TVCA 4M89A 2O3TA 2H85A 5DKFA 1NDUA 1QIHA 4GZ3A 1XXHA 1GZ4A 5KJEA 2R9VA 5HK9A 1MKYA 4R5HA 3S1LA 4PC2A 2PXXA 2ZANA 3OZRA 3IBTA 2J87A 4WLEA 1EFRD 3LT2A 2ID8A 1YR9A 1S3SA 3QWAA 1CULC 3OSUA 1SUFA 4ENVA 4BFUA 1PR3A 3T4UA 4YMGA 1JV2B 2IKQA 4DDUA 4D82A 3LXXA 2P9TA 2YJ3A 4BP3A 1R9GA 1IZ8A 1DUVG 2XVXA 2O8CA 5IZCC 4LWPA 1G2PA 1QHYA 4TS4A 5K3FB 3DZGA 3Q7EA 3JCZA 2O7QA 1P3JA 3SEAA 4RMGA 2B8JA 3O75A 1Z2OX 4YGXB 4B43A 2AR7A 2JI4A 3AJEA 1V8DA 4Q3KA 1OV4A 1EXNA 2XNKA 1L5KA 5B6IA 5IAKA 2C3MA 4Z8YA 3ULKA 4DCCA 3LHIA 3FMFA 3I0MA 3AINA 4REQA 1VLZA 2XDQA 821PA 1EU1A 2OXCA 2AI1A 3IPCA 3HVRA 1SN7A 1YTUA 1GSHA 4E5PA 2HAEA 3C3WA 2QKYA 2W4QA 3KB1A 1HLDA 3D64A 2PH5A 2BH9A 4I81A 4L4ZA 1A9ZA 1UZNA 4PO9A 2FZVA 4XIFA 5J5VA 2WT4A 4B4WA 4W5TA 1XYGA 1W0CA 3IAM6 3P45A 3ZTYA 2OOKA 4W8GA 2EEZA 3EFOB 3FTFA 2RHTA 3IT1A 3M6VA 4TLLB 1HTBA 1YRQA 3ZYZA 3P9XA 3NYIA 3MCAA 4CM9D 2GT1A 1HNZB 1A8UA 3T5GA 3LOPA 4J0DA 2XGJA 3DVAB 1FUUA 1IPEA 2OAGA 3BICA 4Q4DA 3SSMA 3F3KA 2CDBA 1PFUA 3OMXA 2YWJA 4GS5A 4LSMA 5GINE 3NALA 4QTXA 4DV0B 1P2SA 3LYHA 2P0AA 1O8CA 2DUJA 2GFIA 3KZOA 2CLOB 3ICVA 2ST1A 2AOTA 3ROGA 4Y9RA 2C5HA 1XFDA 1RBQA 1C7IA 1N6HA 5ALTA 3RYFA 2JGIA 4RZXA 2AN4A 2VVTA 3D8BA 1IY8A 2QX4A 4AUKA 4FYXA 2X58A 4WY5A 5J2UA 4PBTA 1ZAYA 4M7WA 1S89A 1NQVA 3SHTA 3WSVA 5TS2A 4PSCA 2AFHA 1X1CA 2WHRA 3EZFA 3F8WA 1UMDB 3I52A 4R68A 4P5PA 5EERA 1DKQA 4J07A 4FMDB 1C5KA 5BV0A 2ZM6B 4XIGS 5CX1A 1WE2A 1PT8A 2YZMA 2ZRKA 1BX1A 4EG0A 2J45A 2WWGA 5DCLA 1Y6JA 1AHIA 1FJGB 2K87A 3ZK9A 2DC1A 4L8WB 3E7DA 1QF7A 3LKZA 1VC2A 3K9NA 1YVRA 3BXZA 1RMQA 1ZOLA 4CG1A 4OQFA 2VPPA 5TQ0A 1ES9A 4EEKA 1KKMA 1VQ1A 1GG2A 3W5VA 3NHLA 1TEHA 1X7XB 5CFRA 4Y2QA 2VF5X 4B48A 1XZAA 1MMFB 1CRWG 3CUKA 1CY1A 1DRVA 1EWVA 5E8RA 3L8GA 1W5EA 2HMTA 3R3SA 4X91A 4M55A 1ORTA 2Z9DA 2ZULA 1T43A 2IU3A 4P8RA 4U02A 4NE9A 3KP1A 1YBHA 2GPNA 2PL1A 3T4EA 2ZTHA 4CF3A 4BVAA 4F60A 3RVBA 1GO2A 3ES9A 2H5IA 1CJCA 4KLAA 4YRIA 1H3EA 2ROQA 3K8ZA 4YUYA 2FFRA 3U61B 1EVYA 3TW8B 2FSFA 1LI4A 3SZLA 4DCVA 3AL0C 2I2FA 4S1NA 3GT4A 1K7FB 4LVNA 3ZJVA 2XMDA 5JNLA 2WUGA 3DYIA 7REQB 2QUAA 2O8NA 4EHDA 2DTEA 1NE2A 5KWJA 2Y99A 3BXHA 1JAIA 3T5AA 2JCGA 5KAMA 1Z2DA 3ZIAD 1WB9A 1HXHA 2X9QA 5E1MA 4KNVA 4PPQA 4EW3A 4DLPA 3N07A 2UUOA 1Y0BA 2P5YA 1GV1A 1QANA 2IEZA 3HXLA 4JX9A 1MNQA 1XRLA 4FFBA 1NY5A 2ZJ5A 3R5JA 4LXXA 4EFMA 4A2WA 3OM1A 2PH1A 3SZGA 1C7EA 3TI9A 1YB1A 2XMRA 2VNJA 3CUYA 4L6IA 4RXUA 4CKWA 1QYVA 3N8NA 2WJPA 1M2EA 3GG9A 3OCJA 1N2SA 1V16B 3MJEA 2YNMA 3PEUA 1ZESA 3FKSA 2AJLI 3L7DA 4I55F 1DFHA 1CUGA 2GBIA 2QL9A 3LI2A 1Q1EA 4JWKA 4KWIA 3SDSA 3SR3A 3UWKA 2JCXA 3CSSA 2FP4B 1QCCA 1T2EA 2ZSFA 4LHWA 3RU3A 4B7CA 1O7JA 3CUWA 4PXYA 2BGKA 4P7BA 5CEEA 2VF2A 2O1XA 3NC4A 1TT5B 3BYZA 4MX8A 2AMVA 2Z1MA 5E6SA 4CQMA 2I6UA 1BWPA 4DHWA 2BH2A 1IN5A 4KJXA 1U3WA 2AQHA 4JS0A 4E33A 5C18A 4NFHA 4TTSA 3DT6A 3TI7A 4IUYA 2HK6A 1RSZA 5EFOA 3RIEA 2D0PB 3B6ZA 1EIWA 1ML4A 3FROA 1V1JA 1TEXA 1A71A 2IPLA 4FGJA 4B2PA 1NJGA 4IJVA 2XIQA 2PRSA 3VR4D 3EC1A 1RQ7A 4HH4A 4E7PA 3EASA 1TTQB 4BRSA 2ZETA 4MWEA 2VTVA 4R71A 1V6CA 3WLJA 4NBVA 4LG1A 2W70A 2R7MA 5HP4A 1UXHA 1FIUA 5EGSA 1QAQA 3DBRB 3LQRA 3RRBA 1UF9A 3IT2A 3OQ1A 2XYPA 1AKYA 1NT2A 1ESEA 2XOKA 1UKZA 1EFVB 2XTMA 2HEIA 1G5FA 2GSDA 3MELA 3ZE0B 5KDOA 3V97A 1XNHA 1A4IA 1Z36A 2CXSA 1V26A 1TJYA 3SC2B 5CA0B 4PBRA 4PZ9A 1X80B 3HB7A 2MYUA 2GBLC 2IYSA 1HUQA 1J0AA 3BK2A 3C7CB 4W8HA 4KMRA 4F3CA 3W2GA 5BV2P 1VOTA 2REXB 3R4VA 3OOJA 4J91A 3RVSA 3DL7A 4CFZA 1BN6A 2ZJ1A 4I9NA 1JEYA 3PC3A 4U9HS 4H6VA 4G24A 3CCCA 3PX3A 3VDRA 3ZN2A 4BNKA 2NADA 5AXDA 4GC9A 3DKIA 4RDXA 4FINA 4NVRA 1QJ4A 1EP3B 3FX2A 1ETHA 4BKUA 3RBVA 3Q8WA 5C9ZA 2B7BA 4CI9A 2X4GA 2OBBA 3SJ7A 2W6IA 3K0FA 2ID9A 3FZNA 1QP0A 4M1EA 5BW6B 2GD2A 3IE1A 4AS3A 2IS1A 4YRBA 1B73A 4R54A 2V6GA 1Z2AA 2FVYA 1UT5A 3BRCA 2XB6A 3GELA 1N6KA 2FPPB 5ITZA 1GARA 3EVNA 2F3UA 3I9LA 4MARA 5CX1B 1NJ2A 1BS9A 2IXEA 4G97A 1FTSA 2J9ZB 3NWPA 3R4CA 4PHHA 3H3JA 3N8IA 2V0GA 2HSEA 3W7VA 2W71A 3WWCA 3KJGA 4TWJA 2ZQYA 2UXCB 4R2IA 1EGAA 1DBRA 3BXGA 4CLOA 3HUDA 5F7JA 1JX6A 1PT7A 2BHRA 1UXGA 4QE3A 1IH8A 4U2DA 4MQUA 2DHCA 3V8RA 1N5DA 1MA0A 1GLGA 4YJHB 3P2KA 4MA0A 4P3YA 2ZB7A 2PQMA 1K7EB 1ZITA 2I65A 1ZXBA 1FSZA 3KSMA 4CR7A 1UXKA 3PT9A 4M9SA 1DFGA 5DWDA 3WK8A 2VXYA 3CZPA 4LISA 4J4TA 3W4JA 1J99A 1B14A 3DF9A 1DIBA 5A5VA 5LQAA 2XVMA 1J2YA 1CJMA 1TT7A 1U9JA 3OE5A 3TRKA 1KYZA 5AK4A 1QAOA 5K01A 1AG9A 2O54A 4B8ZA 4KDEA 2EFGA 5CJ2A 4JLPA 5FQNA 2DECA 3UJ3X 2XRYA 5MFZA 4M1KA 1ARZA 1G98A 4LDNA 4U9UA 3R7AA 4G37A 1U8FO 3QBEA 4C01A 1R4ZA 1NIJA 1C1DB 3BHMA 3N7AA 1VYUA 5F51A 2GZMA 4K6HA 4RKRA 1ISFA 3I6IA 4LYGA 3N39C 2Q07A 4V0ME 3K4PA 3IH5A 1MGPA 5EJ6A 3BZBA 4WJKB 4DCMA 2HJGA 2YZ7A 1FTWA 3GMSA 2I4OA 2VKQA 5KYWB 1SBTA 4CKWB 2C00A 1D2NA 3GVXA 2DY0A 2P1RA 3A6FA 2GRAA 1JKJB 4U7JA 1MX5A 1T6XA 1ZQ1A 3P5BA 4F56A 3D7KA 2HLPA 2IUSA 1Z4QA 2I33A 2Q29A 3PRHA 4MKZA 3I42A 4CODB 5I8PA 3LTNC 5K8UA 1FW8A 4YQZA 1WZUA 3ORQA 4LNUA 4WDQA 3RD5A 1II8B 1DJQA 2JH9A 1PJAA 1TT5A 4MVJH 5E6SB 1RWMA 3GF4A 2WICA 3RHFA 1C8LA 3UJ8A 4XQGA 2Q2QA 4FHZA 4ZEWA 4MJ3A 4PYLA 5ADWA 4QOHA 1XQVA 1VJ1A 1W1WA 1Z7EA 4PYOA 1QYIA 4GRIA 4EZEA 1ML3A 4Y7DA 3TH5A 3BFKA 4LKRA 4AJJA 1W5AA 1Z0IA 3CWQA 4MB6A 1LQ2A 2GYVA 2VWPA 3KOZA 4URXR 3FGPA 4QVKA 3T12A 4P7GA 2HJ9A 2JD0A 2VRNA 5HOQA 4NI5A 5AK0A 3VR1A 1JFFB 3TR6A 2WT8A 2ZBFA 4AY4A 2ZUFA 4BX8A 5KYXB 4X54A 3C14C 3N2IA 4O59O 1QVRA 2XGGA 1W5BA 3LA6A 3TQCA 1FMFA 1G4UR 4GL2A 1DADA 3SGLA 1G4HA 1KZHA 4BNDA 5BPFA 1QFMA 2K7ZA 5U9CA 4S3MA 1CCWA 3NP7A 4M0PA 2I34A 4RANA 3QIVA 3UKOA 5CA0A 2CFCA 2NVBA 2PMEA 3GRYA 1JYEA 1KFKB 4B2LA 4JQZA 3WDLA 1CUJA 5HIKA 1VSTA 1DO0A 3HR4A 5EIBD 5C8YA 4G0QA 3MFQA 4OHOA 1SUSA 4HPXB 5CU7A 3V48A 5HHTA 4DJDC 3A1FA 3NVKI 2VDPB 4R7TA 4IXNA 4OFZA 4DQ0A 2GVNA 3HKEA 4IEIA 3L1VA 3O3MB 4OO3A 3EGOA 4IWYA 5GOZA 1UC5B 1ZU4A 3O21A 2ZCJA 1DGQA 4D74A 3KZCA 4IX9A 3OEHD 4ZCTA 5BSKA 4L8GA 4LN1A 1P74A 1DVRA 1UKYA 1G4AE 4HEA6 2IELA 4Q7JB 4G0UA 4KO2S 1LBHA 1SA0A 4YDHB 3KPYA 1JH8A 3RSQA 3O3NB 5EE1A 2OAEA 1D04A 4X85A 4OATA 4C2BA 1CETA 1WTAA 3DS8A 2JFOA 3ENKA 4Y7CA 1GL3A 2P9BA 2O06A 4KVZA 1X94A 4RVSA 3ZXXA 1D2EA 1I6MA 2VHVA 1JPUA 4F4FA 4AI6A 5TT1A 4ID3A 3B5EA 1CD5A 4J0QA 2W6JD 3PGJA 3EFBA 4HC4A 1OLUA 3GXOA 4QAQA 1UBNA 1NMQA 1NFRA 4UHCA 3MMPA 1OLXB 1L4EA 5BN3A 5TR9A 3FRIA 2IYAA 2B2NA 4WZAE 3UWOA 1ZNYA 3CM0A 2VJPA 3E7FA 1E6UA 3GLTA 4G36A 3VPBA 2EZUA 5A3RA 5BUZA 1DE0A 5DHUA 5KNCH 2JG3A 1F7UA 4PO3X 4DXDA 1L8AA 3K9WA 1T0JB 4KQ1A 3PNBA 1T26A 4IDDA 4TMYA 4P4GA 3UT5B 4RLSA 3WK4A 3ZNPA 4FBMA 3EIWA 1M1YB 4D3XA 4LQLA 1Q15A 5B7GA 3HY6A 3FGNA 3ZCQA 3OJ0A 1WBJB 4QXQA 1AUQA 3GBPA 2ETXA 3DPSA 3WY9A 3O3CA 3IQXA 1R0CA 4MWDA 1OWLA 1LRLA 3FYCA 1E2KA 5CT5A 2F3QA 2O48X 2CXXA 1CVLA 3GNQA 4QQNA 4REMA 5CVEA 3RAJA 2Q8PA 3RIGA 3THSA 2FFHA 4JFRA 1RC1A 1K6JA 4UNPA 4MIEA 3LGSA 2JLWA 3EXHB 3B6KA 1SXJE 5CNMA 4EARA 2QLFA 4ER3A 1VBMA 5KHOC 2VH2A 1GPKA 1QHHB 4DYHA 3M0EA 4EG7A 4XGQA 3VTZA 1JFTA 5H3HA 1DLIA 1PJ8A 4FOTA 2Q62A 5EZYB 2J3DA 2IEIA 1M6VB 3QEMB 4OHKA 1GL7A 5M34A 3TBHA 3EX7C 4YMUA 2G4VA 4BLVA 1BEEA 3PJEA 4X97A 3RRMA 3RBZA 5DLPA 4EHBA 1JTEA 1YZTA 4FONA 2QBYB 1WXQA 1G0OA 1JG3A 1SPBS 1UOOA 3QEOA 5BR1A 2Q5OA 2H57A 3OMWA 4JR0A 2FN4A 3AI3A 2C2ZA 4Z0TA 4BEVA 4BU0A 4HH0A 1TTHA 3IBFA 5HKOA 2IS4A 3DEZA 2IP2A 4Q1BA 3R2JA 4B82A 1L4YA 4KO8A 4HVTA 5HILA 1QYRA 3T5PA 1ULSA 3HI6A 4GX5A 5FAXA 3Q7PA 4LC1A 3PKIA 2VJMA 2V1XA 3JRXA 3GZNA 1F4VA 1LPPA 1VCOA 1W93A 3HRIA 1E0DA 2AEFA 3RT9A 1PK9A 2EVWX 2I2DA 5CEFA 5JQWA 4BO0A 3PHJA 1ZWLA 4NZOA 3T3IA 1N77A 2BI8A 5I9MA 1PV1A 5HBRA 1S9HA 1C8VB 3LWDA 3S68A 5KVVA 2GCIA 4MITA 2FTKE 1XTRA 2JAQA 4NICA 4MCIA 4JBNA 1YK1A 3WLSA 4AQDA 4YXWD 1YV9A 3OCCA 4K2AA 4QG7A 5IN5A 2I1LA 3OQIB 3IP1A 1M2NA 2P4EA 3BIOA 1VJGA 3C6BA 5E0OA 1UDBA 3SEQA 1U4SA 1WY7A 2NSHA 1TMKA 1W36B 4KRYA 2XE8A 2FEPA 3KHTA 2CVPA 3QVLA 3V8PA 1KRHA 2OLJA 1W2HA 1BU8A 2P9GA 3RKSA 3S28A 3H5LA 2P75A 3PD7A 4OJMX 5CXXA 3WMGA 1RVV1 2WU3A 4QU9A 3WYFA 1PDVA 2DULA 3DXYA 3UMVA 1I7PA 1TU4A 2X76A 3GJRA 4IEEA 5FJIA 5NLLA 1KMNA 4YAOA 2FZKA 3DG9A 1FX0A 1UT6A 2Z5LA 2XODA 4JEUA 3KNZA 4UUBA 1QGUA 5REQA 2XF2A 1JG6A 5E6UA 4BVJA 4X44A 1YUMA 2EOAA 2HA6A 1YXMA 2PMKA 4G89A 1CR6A 4HAYA 3TEMA 2OWEA 1TO1E 1T6YA 4IEFB 1DQRA 3ZTTA 5A5DA 4TX1A 2BR4A 3M5PA 3ESBA 4NCIA 4NSNA 5JXHA 3TZHA 3RARA 2XF8A 1CQJA 5FYQA 2O5RA 4XWTA 1SA0B 2FHSA 1YQTA 1AKTA 2ASEA 3EIFA 2QSZA 2RHJA 4KNWA 3JY6A 4LCBA 1L6IA 3PE3A 4MVWA 4G0PA 4Z53A 2XNSA 3CR3C 5BT8A 1B6TA 5THXA 4NDNE 2YKGA 3ER6A 1PHRA 4CLDA 3O5AA 1X7YB 2WMNB 2R00A 3FTNA 4FFNA 3NYWA 4L28A 4AK9A 5C80A 3LW8A 3HGTA 1IBLB 3ECAA 2VKTA 2CE7A 4O4IA 4GE3A 4ZCRA 2ZBQA 4L51A 1IXRC 3GFSA 1MTZA 1C30A 1JR2A 2XUOA 1FMTA 3IESA 3L40A 3L8FA 1RI4A 4HXEB 4INPA 2FX2A 4ROTA 4UBJA 2AJDA 4JT8A 1ULZA 3RF6A 4KAFA 4E1VA 2R62A 3ORHA 5EHIA 5DLYA 1UT8A 4TS1A 3QELB 2P9JA 4P6VF 4MRRA