3FOZA

Structure of e. coli isopentenyl-trna transferase in complex with e. coli trna(phe)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
305
structure length
305
Chain Sequence
ASLPKAIFLMGPTASGKTALAIELRKILPVELISVDSALIYKGMDIGTAKPNAEELLAAPHRLLDIRDPSQAYSAADFRRDALAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTELTQTSGDALPYQVHQFAIAPASRELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPEQARDEVLQVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA-Protein Mutually Induced Fit: STRUCTURE OF ESCHERICHIA COLI ISOPENTENYL-tRNA TRANSFERASE IN COMPLEX WITH tRNA(Phe).
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transferase/rna
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
total genus 101
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2009-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fozA01
3VKGA 2QQEA 2O8FA 4MUBA 3F0TA 2WSMA 3BOSA 4G0NA 5FTJA 1A7JA 3S1AB 3KUDA 5C4GB 4Q4HA 3VMFA 1XU4A 4B43A 1T0JB 3AF2A 2TMKA 3TUZC 2FMXA 1F6BA 1XEFA 3FPAA 1G7SA 3ICEA 1FMLA 1K8RA 1JJ7A 2ZRLA 3BERA 3EAQA 3G0HA 1DAKA 4GSYA 5KDLA 2GJKA 4P3YA 1G19A 3EPLA 2J45A 1GAJA 2X2EA 2YWGA 2ZE6A 4Z8YA 3EX7C 2GZAA 4C0BA 3IKJA 5LB4A 1KNXA 1ZW6A 2IXGA 3NEYA 1KOFA 1GFIA 1XCGB 1KGDA 1KMQA 2PLFA 4Q4AB 3W8RA 2JIZD 3X1DA 4BE7B 1Z47A 2AFHE 4C0AC 3KKQA 3V9PA 5FBVB 3LX8A 3OZXA 2J0UB 3P26A 4TLEA 1N6KA 4DZZA 4PHTA 3VQTA 3LW7A 4Q01A 4A6PA 1N6NA 1SXJE 1R5OA 3BB3A 1G7RA 2ZRCA 1ZJ6A 1SVMA 2PEZA 2ZETA 4LBYA 1FNNA 1ZM9A 3D31A 1J7KA 3EIHA 3PUZA 4O0MA 4W5HA 3T5DA 5CK4A 3THXB 1HV8A 4DDTA 1Q3TA 1NIJA 6Q21A 1IHUA 2QPAA 2LKCA 1ZRHA 1LY1A 2V55B 2CHVA 4KV9A 4MDFA 3SYLA 2IYSA 1PLKA 1SKYB 5L3QA 1SHZA 1M8PA 1NG1A 1CIPA 1FL9A 1OV4A 1GILA 4CEHA 4JBWA 1E2FA 3ZVNA 1OXVA 2F1IA 4IFEA 4OK6A 2PT7A 2YJTD 2A30A 2V8OA 2C8VA 4I1VA 5L3SA 1XJCA 2UKDA 2VP4A 4NYIQ 4CRWB 3LAWA 1FOEB 4GBMA 3HR7A 4B3FX 3KUCA 3TW8B 1H8HD 3C5HA 4BLPA 4V02A 2V7QA 1G41A 2B92A 3GQBA 1FZQA 5HR5A 3ONWA 3O8RA 1DG1G 2RGNC 4URWR 1W49A 1E2HA 3X2SA 4HLUA 2D2EA 5GVRA 4X8HA 1NSTA 3QY0A 4Q1EA 5JLJA 5KDOA 4DB4A 2WWHA 4JYCA 1DAIA 4MA4A 2ZS9A 3MWYW 2QI9C 4JL8A 2QN6A 2AK2A 1GKUB 4V03A 3QKTA 1UKVY 2JLQA 3E5HA 3MJRA 4XIGS 2ZU6A 2JA1A 1MO4A 2VH5R 2WVJA 3ZVRA 3QSYA 4UJ5A 2RMKA 4MGKR 2AWOA 5F3WB 3SI7A 4R71A 2WWYA 221PA 2PEYA 2WPDD 4IFBA 5KDDA 1KJZA 4Z54A 2OEPA 3AKEA 3SDZA 5AUOB 4JJZA 4XD7A 4HLCA 1OXXK 4V0MA 1IOZA 1P5ZB 3QEJA 5HE8A 5B30A 1OT3A 4DWJA 2IYUA 4KFTA 4Q4HB 2ZRDA 2IF0A 1RE0A 2GZDA 1XMJA 4NKRA 5CDFA 3U7FB 3D6TB 4M2LA 1NJGA 1G8GA 4A4DA 2ERXA 3B1XA 3GLHE 3K8YA 1XD8A 4JMPA 2G1JA 2BEKA 2R9VA 2ZI3A 4XH9B 3OEHD 2PL3A 3ZD6A 2FFAA 3DM5A 1AQYA 4F4JA 4WZBE 4DLSA 4GOXA 4ESHA 3K70D 1JAHA 1JALA 4JT4A 5E3HA 4C3ZA 4W5JA 3QQ5A 3OAAA 1DAFA 3IQXA 3RLFA 2D7DA 2HV8A 3BS4A 4AKIA 4G5RA 1D5CA 2QBYA 1SVKA 5JFGA 4M1TA 3W6NA 3UIEA 1XXHA 2VP6A 1H8EA 3MCAA 1EFTA 3GLHA 1TF7A 4EDHA 2UZIR 4ZV4A 2IWRA 3N70A 4QL3A 1HE8B 4D6PA 3PEWA 5CJ2A 1JI0A 3OEHA 1U90A 3D3QA 3DOFA 4IVPA 4TYPA 4CIDA 4OQXA 2WICA 1S1CA 4LJ8A 4MKIA 1IAQA 5LPNA 1V5WA 4TMWA 4BFWA 2FDCA 2QGNA 1EX6A 5E95A 3THOA 1COWD 4Q66C 1VYTA 1FPMA 5DIFA 4IXNA 4A8JA 4B35A 3MJHA 4WXPA 4G5QA 2IYQA 3B1YA 2OO7A 1XRJA 2WBLC 3HYRA 4XTRA 2VL7A 2PMKA 1BMFA 2IEZA 1N25A 3QENA 2KE5A 5UKDA 1X8LA 4AURA 1CTQA 1U98A 2WIAA 3KTAA 5TVKA 1T5LA 2YVUA 5CJPA 5B58C 3U60B 3NEJA 4EPTA 3U61B 1DBSA 5BN5A 1MR3F 4PSAA 2ZTSA 2VTKA 1NVUQ 4EFLA 1SXJD 1I4DD 1LW7A 1JXOA 4AG5A 5JS7A 3RDPA 3Q7QA 1T3HA 4MKFA 3X1WA 2VA8A 1J8MF 4GRAA 2D06A 1RRFA 1ZUNB 3U6KA 4OHYA 2EWWA 4ZKEA 1B0UA 2V54A 1JPNA 5ELXA 5F9HA 1E79D 3RS3A 4AIIA 2AFIE 5FI1B 3DMDA 4G3XA 4JVMA 3WXMA 2F3RA 2Q9AA 4ITRC 2G88A 2IYLD 2CMKA 2CVFA 3DZ8A 3TVDA 3VR6A 3GLFA 4PO8A 3SNHA 3K09A 4M1SA 1II9A 1N5JA 3FKSD 2ZM5A 1G1MA 4UNNA 1JEDA 4WOPA 2OESA 4Q4JB 2FU5C 3TIFA 4M9QA 2C77A 1BOFA 1TAGA 3B9PA 4HAXA 1IXZA 3FWYA 4Q1CA 4D4LA 4GPTA 4B32A 4M4SA 3JZAA 2F9LA 4TLAA 1ZM7A 3LO5A 3CW2A 3BFXA 4RFVA 1SKYE 3Q72A 4IOJA 4PPGA 3R9IA 5KSYA 3I5YA 1FP6A 1KZGB 1Z2CA 2C9CA 3CR7A 5FTNA 5JCPA 4X8OA 4HI0E 5DISB 5K8LA 5KUTA 1GDDA 2B8TA 3RRNA 1KO4A 1G20E 1E9DA 3TBKA 3HWSA 4M9SA 2ZRJA 2QP9X 4OHWA 1NMXA 3THXA 1XPRA 1IY0A 5IF9A 4CZ2A 3K9HA 4JBYA 4AKEA 2XJ9A 1AGPA 4QGAA 5CLQA 3REFA 3PUWA 2OT3B 2V4ZA 2JGNA 2D7CA 2OCYC 3OAAD 4IOKA 3T12A 4FI3C 1E2MA 3HDTA 2MSDB 4BRUA 4RCZA 2Z4RA 3BBPA 2WWIA 4UXHA 1E69A 2ZJYA 2BEJA 4QC2A 1G5PA 2RGXA 3J81k 3C41J 2J5XA 4FMBB 4MYCA 2AN9A 5TXGA 2QRNA 2QY9A 2NGRA 4CEIA 5C2JB 4XWOA 4GP6A 1P62B 1V43A 1FTSA 4YDSA 2ZPTX 2J0VA 2DFLA 3K0EA 1JBKA 3T61A 1G7CA 1WCV1 1NY5A 4ZDJA 2PCJA 3KX2A 2QROA 1YU9A 4R2IA 3ZYCA 1IXSB 3UXMA 4V0NA 3GLGB 3ZD7A 3DL0A 3WP1B 4B6EA 3ETLA 3RNLA 2OBMA 3AF4A 4BZQA 4F91B 4H1VA 5F2EA 1OKKA 1X3SA 1XF9A 4URUR 2RHDA 2YV5A 2O52A 3UK6A 3WNDA 3NBYC 4MUAA 3HPQA 3W8NA 2ZRBA 3K0CC 4P4UA 2QPOA 3QKSB 2OCPA 2JLVA 2B6HA 5HPYB 1VCIA 2AXPA 4LYFA 2QAJA 521PA 2V1XA 2Q3FA 3GJ4A 2DB3A 4I99A 3AVUA 2FV8A 4AY2A 3DO6A 4E22A 5K8TA 1GL9B 4B44A 2D3WA 2R6FA 4MRNA 4JVNA 4IKEA 2IYYA 4L8GA 2FOLA 2PJZA 1UJ2A 5CM9C 3LY5A 3DKVA 1MABA 4FMCF 4PHHA 1EFUA 1G18A 2OILA 4MITA 3EASA 3OE7D 1KJWA 2BMEA 4U5XA 4AD8A 5J47A 1KI3A 2GBLA 1XJQA 1AIPA 4NDZA 5J40A 1Z63A 3BRWD 3REGA 1YR9A 4DUGA 2ZRGA 3THYB 5D3QA 1FQKA 3C4JA 1OYYA 5DYIA 3BK7A 3C14C 2ZYUX 3TAHA 1PLLA 2OE2A 2BJVA 2F1RA 4XJXA 2OLKA 3OFNA 1SVIA 4A2PA 2OCBA 4ZIRB 2Q3MA 3ZLJA 2DFTA 2YYZA 1UBEA 2YOHA 3TUIC 1Z07A 4RY2A 2C04A 5DGXA 1GIAA 3BB1A 2NIPA 3LRPA 4NCHA 3RS5A 2XNSA 5FBRB 3UG6A 1UM8A 1IM2A 1AZSC 2WWFA 1DAMA 4PHFA 4JVLA 4PFSA 2ZYTX 4LV6A 5FH9A 3VNVA 4KU4A 5GVSA 4GDFA 4O2RA 3WRXC 1QF9A 3CH4B 1F48A 2JEOA 2ZUBA 3AVQA 3HU3A 3QI2A 4NYJR 1N6LA 1VG9B 1E2JA 4AWXA 4II7A 2O8CB 1A1VA 2W6ID 3CUEF 1TQ4A 1W0JD 3ECCA 621PA 2D62A 2ZEJA 5FUYA 3H84A 2ORWA 3QXJA 1J70A 2PZGA 2HT1A 2AD5A 1FTNA 2VP0A 2ZRHA 1EFRA 3TAUA 2O8BB 4M22A 1YE8A 4DLVA 3ZIAD 4HB2A 1UADA 1K5GA 3EARA 4QBGB 2ZI6A 5LDDC 3BORA 2ERYA 3K9GA 2GJ9A 4P31A 2MMCA 1S8FA 3I4LA 3LVRE 4QRHA 1ZBDA 2DY1A 3QKRA 1F2TA 1VG0B 4ZCMA 3VR3A 2AR7A 2EFHB 2OBLA 4IDPA 1U0JA 3AQ4A 2G0NA 5FPYA 1KYIA 5DN6A 3TSZA 1ETUA 1KI2A 2YKGA 2IK8A 3TGPA 1GTVA 1ZP6A 3H1TA 3KJGA 2EW1A 1BKDR 2IEYA 1FMJA 4B3GA 4OQLA 1TU3A 4GZMA 1J2JA 2H8KA 3IGFA 5DH9A 3AF3A 1KAGA 5EUQB 4JJKA 1XD2B 3SQXA 1DAHA 1W4AA 1EK0A 3JVUA 2GHIA 3BE4A 4FCWA 3GLFB 4P4TA 3I92A 2EU8A 2QA5A 3Q9LA 4LV8B 3FMPB 3PITA 1FX0A 2I3BA 2VHUA 3AVYA 2G83A 3THWB 2JJ1A 5AUNB 4W7SA 1UKEA 1TPZA 1KKLA 1T91A 1COWA 1R10A 1YRAA 2CLCX 2FZLA 1WQ1R 3IILA 4P4SA 1M34E 4DCVA 4B3CA 4OI0A 1X8JA 1W7AA 2QP3A 3UATA 1P4SA 5HCNA 4C0KA 4LJYA 3SBEA 2PLRA 2DPXA 5CDFE 2J0QA 2BMDA 5A4JA 3IIMA 3LLUA 4LJ6A 2EWVA 2GTPA 4KSCA 1HY3A 2W00A 2ZJ5A 4Q7MB 1OXSC 1Z3IX 1P9RA 4Q18A 4BQSA 4YMSA 2XX3A 4OI2A 4QHYA 1UBFA 1LF0A 5IRCD 3QXXA 1AK2A 4LPSA 4URYR 8OHMA 2Q9BA 4PZLA 1ZC3A 3U3RA 1EWRA 2WTUA 3LV8A 3HYTA 4LRWA 1CJTC 3GLIA 5G53C 2F1HA 1I4TD 3NH6A 1XD9A 2QG6A 3LQRA 4WVFA 1VDZA 3T35A 2ZYVX 1CJUC 3TQCA 2XJ4A 2IYWA 3PEUA 3OIWA 2OSBA 2OAP1 4B71A 2CBZA 1JQLB 2WKRA 1E98A 1SZPA 1XWIA 2DCUA 3B9QA 3BB4A 4RD1A 2FEMA 3SJBA 3TSWA 2XB4A 4F38A 4E5UA 1OH8A 1XTQA 5DI3A 2NOAA 2J3EA 4WXRA 4HUTA 3KKPA 4LJAA 4HAYA 1LFDB 4K81B 3CH5A 2J9RA 3C8UA 3EZ2A 3L82B 3Q85A 4KXFB 2WAXA 2ONKA 1GRRA 2EVWX 3MLEA 1E2PA 4LHYA 3TE6A 2IUSA 3AB3A 2O0KA 3RANA 1UBGA 3VU9A 4MGIR 4A8JC 3QKSA 4F93B 3QKUA 4KAXA 4QJ5A 3CWZA 1DEKA 3LFUA 4TL6A 1SXJB 2CLSA 5JZVA 2Q21A 1Z6XA 1GM5A 1G8PA 4B6FA 3KJEA 2X2FA 2FNAA 2O0HA 3JVVA 4EPVA 4TMKA 4XVRA 3TW4A 3NG1A 4TZ0A 3Q5EA 4US2R 4EFMA 3K09C 2CLDX 5CYOA 2ZRPA 3FYHA 1GVNB 1JAIA 1GSIA 5H8WA 5H68A 5EP1A 4KLZA 3D7MA 1MO3A 2Z5FA 1BMFD 4QNMA 3DZDA 5H70A 1WBBA 1XXHB 5IDVA 4J0QA 4JT2A 4TLDA 5JEEA 4B47A 3ND9A 4FD2A 4NH0A 4EPWA 5AK0A 1DAGA 1BIFA 4PQFA 4QHSA 4R9UC 2FPKA 1WE2A 4WAUA 3B2EA 5FUWA 4LWZA 5JHHB 2V1UA 4GNKA 2Z83A 1VCNA 2H92A 4DT1A 3TK1A 1O3YA 3CM0A 1E99A 2ZUCA 3C16C 2IYXA 2VSXA 2WJIA 3N2EA 2N42A 4QBHA 1ELOA 3KQHA 4MKGA 4CVNA 1E9CA 2FFHA 3KB2A 5A5GA 4UJ3A 4NU0A 3U6BA 2J7KA 1EFRD 1U9IC 4CT5A 4Z1MA 4F92B 5KU1A 1N3BA 1IN6A 3QF7A 4PZYA 1CRPA 3SN6A 2V9PA 3LDAA 4HDOB 5BYKA 2QMOA 3VTKA 1U8ZA 1X86B 3RRYA 5F98A 4C7OA 5HZKA 2ZROA 1SVLA 3IEUA 4QGGA 3LQQA 1ZNWA 4QBFA 3UWOA 4PX9A 3W90A 5AUPB 1HYQA 1D2EA 1N5KA 1QG4A 1XX6A 5BQ5A 1W48A 4WBSA 4LYHA 4X8LA 2ZYWX 3ZZ0A 1LNZA 2J0SA 3R9WA 2QZ4A 4MDEA 5EP2A 2A7QA 2ZUDA 1P2VA 2FN4A 4IDQA 1HE1C 4XTCS 4DB2A 4LK2A 3HU1A 4HB0A 3TR5A 2C03A 2WSSD 1GUAA 1DTSA 3OE7A 2J7PD 4TL7A 4DLWA 3KJHA 5EE5B 1W44A 1SVOA 2GNOA 1BYIA 1WRBA 3NHAA 1E0SA 4ZI3A 2ZSEA 4TYWA 4LPKA 4LJ9A 5KSOA 4UQOA 4LC0A 2YC2C 5JEDA 2CJWB 5B57C 3EC1A 4Q19A 5L8VA 3L43A 2F7SA 5G3ZA 4NL4H 3K0AB 2DBYA 1N2CE 1FFHA 2NZJA 2XEXA 2NO7A 2ZITA 3F5FA 1CLUA 4OKSA 1A2BA 3K53A 1HURA 2Z0MA 1R0WA 1LS1A 1NLYA 1P75A 1Z0IA 4RZ2A 3E1SA 1R8QA 5AJZA 2HCBA 3M1IA 4B76A 5GJBA 2ANBA 3G82C 3CNOA 3QG1A 2P6NA 2EYUA 2XTNA 2RB4A 3FOZA 3PXGA 4B75A 2J7PA 1KTVA 1E79A 4HB3A 3RC8A 3PVSA 1Z8FA 2RKOA 3THWA 4RD2A 4NCIA 3IPXA 2XOKD 4Y0AA 2J41A 1Q1BA 3G5UA 5JJKA 2NPIA 2N1BA 1KY3A 1W0KD 3P1JA 3T1QA 4NZYA 1RJ9B 2GF9A 1G8YA 1IJEA 3QPUA 3ZQJA 4DSTA 4M1WA 5JS8A 2RGGA 5JRZA 3CO5A 3EPJA 3AVWA 4TZ6A 4RSGA 2P0EA 1AGRA 4OQMA 4TL9A 5AJXA 2W0SA 5FOXA 3GJ3A 3EIQA 3R8CA 4QXAA 1RVDA 4QOSA 3LXRA 4ASUA 1OE0A 2F6RA 4JKIA 3IUYA 3RSOA 4D0NA 1QDEA 2REBA 2BHRA 2LKDA 2XSZA 4KI0A 4CT4B 1N0VC 3IO3A 1ZYUA 2GCOA 2G3YA 2VF8A 2ZSBA 3KTAB 3EZFA 2X77A 4MRVA 2CEAA 2BCJQ 3MWKA 3U44A 1CR0A 4ARZA 1CS4C 1KDRA 1OSNA 5J4KA 5EXTA 1YKSA 2BMJA 2J87A 4UNSA 3ZS8A 3MRSA 2IXFA 2QM8A 1Z0AA 3V00A 4P0TA 4JL6A 1UKZA 3KKNA 4XOIA 4A92A 4ON9A 1W4RA 2QU8A 1KNQA 4JIMA 1ODFA 2W2VA 5E4FA 2VHQA 1KSJA 2AX4A 1C9KA 3QOFA 2V6JA 2NPFA 4B2LA 1VPLA 3UMFA 3CRMA 4QFMA 1IN8A 4Q9IA 5KHOC 1Z28A 4ZDWA 1Q1QA 2ZRNA 1M7GA 4TLBA 4LSGA 2XSZD 1ZINA 4US1R 3DM9B 4BECA 1G9XA 2BWJA 2O0JA 3EPKA 4AKHA 1X1RA 1P6XA 3AV0B 3BH7A 3W3AA 3KKOA 1HH4A 2QORA 2H18A 2VIIA 1II8B 1N5IA 3RYTC 3DMNA 1SXJA 3RS7A 5JECA 1OJLA 3EC2A 2O5VA 3PUXA 4JLDA 4L9SA 4B2IA 1E0AA 1QG2A 4NMMA 3VU9B 1Z0DA 1N6OA 3I32A 3WNCA 2HXSA 2B8WA 3T34A 5HCIA 2VYFA 4BFUA 3QXSA 4BLRA 4B34A 4UXIA 2PX3A 1XXHE 4YXWA 1R5BA 4KJZA 5CB6A 2IUTA 5CIQA 4B73A 2O8DA 2VHTA 2JDID 1UF9A 4OK3A 4TMZA 4KITB 2PCLA 2JJ2D 3SZRA 2P67A 1P2UA 1E9EA 3U7GA 3K0AA 2P5SA 1S0UA 2VP9A 3W5JA 2P2LA 1W36C 4RD6A 2WOJA 4HLDA 1M7HA 2QGZA 4ACAA 4W9MC 3WMGA 2ZS8A 3PV0A 4V0ME 4OHXA 3UWKA 1Y3AA 4GL2A 3FB4A 1KDTA 3W5IA 4A0GA 3PUYA 1L7VC 3B1WA 1E32A 1TUEA 2W83A 4M8NE 1E9FA 4QGFA 4AG6A 4Q9LA 3B13B 1EFHA 1Z6GA 2DWQA 2RGBA 4EQ6B 2CE2X 1G291 5SZHB 1GNRA 4M1YA 3R20A 3X1YA 3R7WA 3BFKA 3WNBA 1R7RA 1R4AA 1JR3E 2DR3A 1E1RD 3GJ6A 3AKYA 1IJFA 1XPOA 5KPJA 1BH2A 5JCZA 2JLUA 2JDIA 3EPHA 3VNUA 2FH5B 4DUGD 2V3CC 4D82A 1PLJA 2ZIAA 1GOTA 4TL8A 1QVAA 2HYDA 2VSFA 2R65A 1XTIA 4D4JA 3SC3A 2FX3A 1PZNA 2C98A 4GOKA 4YONB 1FUUA 3LA6A 4JKYA 1QVRA 1E9BA 5EP3A 1U8AA 4TQUS 4FMDF 4JLAA 4TQAA 1G3RA 2RGCA 2ZXUA 1L2TA 1XMVA 1ZNYA 3DHWC 4D26A 4G5SA 1RRGA 3BGWA 4HAUA 1T3SA 3KL4A 1M74A 2J59A 2ZRKA 3IO5A 2C78A 1TUIA 1ZAKA 1QHGA 3EA5A 2KB0A 1S2MA 3F3YA 3ZQ6A 1Z2AA 4B48A 5FOSA 3VX4A 4YMVA 3CNLA 2RAPA 1P61B 1DO0A 2W2XA 2ZRIA 3Q7PA 1DPFA 4YMUA 5HKKD 1NMZA 4ZI2A 1TNDA 3PJRA 1CR2A 3I8XA 4NCNA 3DVLA 3AGQA 2X8AA 2PH1A 4MGZR 1S3SA 4KYIB 5FBWB 2CXXA 4A1FA 1W0KA 3KQUA 2O8BA 2Y8EA 4OI4A 1CKEA 2IYTA 2VF7A 3X1ZA 3VR1A 1P73A 1OFHA 4XWKA 1W5SA 4WA7A 3NXSA 4HSEA 1WP9A 1K5DA 5DHFA 1XMSA 3A58B 1RPZA 2OCAA 1E2DA 2XITA 3X1XA 4HUQA 2CHQA 4MRRA 5FL7D 4A2WA 4DCNA 1G5TA 2DWPA 2FE4A 3HPRA 1BS1A 2B7CA 4DRZA 2JAQA 3KQNA 3AUYA 3A6PC 4EJSA 1EX7A 2YWHA 1ZNZA 3UANA 1N6HA 1RFLA 3LD9A 1KJYA 4XD7D 3QJYA 1YHNA 5BW8A 1Z22A 1VMAA 1JJVA 2BIFA 2WWGA 3B5JA 4KVAA 1PUJA 4UNPA 1VTKA 2BBOA 2WKQA 4Q4LA 3WHKA 2E87A 2JJ1D 1F2UA 2XGJA 1II8A 1KO8A 5JJLA 3AVTA 3LBIA 1JNYA 1KAOA 1WF3A 3U7EB 2NZ8A 2GJAA 2Q3HA 2VEDA 3ZVLA 1D9ZA 4Z51A 2A2ZA 1US8B 2VHJA 4JZKA 5P21A 1OH7A 3UKDA 5FPSA 3TQFA 5EZ6B 3KFVA 5FUVA 2CNWA 2ORVA 1L4UA 3W9YA 1NVXQ 4ZCIA 3I5XA 2IYZA 4RZUA 1J8YF 2GK6A 1JR3D 3VKWA 3WRYC 3FHOA 1KMHB 2KWIA 1HQCA 2XNDD 4OJKA 4ZO4A 1XMIA 5FBLB 1LS6A 5FOVA 4RCYA 2KBFA 4C0JA 1XZQA 1W2HA 4DLTA 2Q9CA 2RH5A 4ZKDA 1GP2A 1J99A 2C5LA 1ZIOA 4URVR 1AKEA 3VR5A 5TMPA 3ZVMA 3LNCA 3TVTA 1TQDA 2YC4C 1IQPA 2QAGA 3B82A 3A4NA 3K0FB 2H7VA 4MGYR 3A4MA 3AP1A 4CYMA 3CRW1 2JIZA 2ZI7A 3T5GA 5GJCA 4LJ4A 1RJ9A 3GLIB 1S96A 2DYKA 3BAFA 4TSFA 1E4YA 1RYFA 5DYGA 4O3MA 1W36D 2IUUA 4PQYA 3OIUA 2OFWA 2FSGA 1G7TA 3KFXA 1R8SA 3EW9A 1JR3A 4G5OA 1U9IA 2WOOA 4HZIA 5FFMA 2CK3A 3OESA 4BLOA 3SFZA 2KJQA 4HLQB 3FMIA 3BH0A 3CRQA 1QHSA 4EJSC 4PC3A 2ODWA 2OBNA 3O47A 2D4HA 1LV7A 3ASYA 4LY6A 2R8RA 1X1SA 2WHXA 2GK7A 4IHQA 1SXJC 1TEXA 4Q21A 2GBLC 3OHMA 2L0XA 4U02A 1S4QA 3FGNA 1ZCAA 3QE0A 1XP8A 2QT1A 5KYKA 1NVVR 4N0DA 2HEIA 4TSFD 1CP2A 1KK0A 3TSOA 2GAAA 3W6PA 4G5GA 1TL7C 2A9KA 2MSEB 4I81A 4Q1FA 1OIVA 1OKKD 2C95A 3N5CA 2BM0A 2C9OA 4KODA 3W6OA 4ERNA 2RHMA 1YZQA 3FMOB 2AL7A 4RVCA 4PC1A 2H1LA 4Q9KA 3PQCA 4BFZA 4Q7KA 5CITA 2CK3D 3OIYA 3NBFA 4C9BA 3GJ0A 1G3MA 1HT1E 3IIJA 4LJ5A 4TYYA 1R0XA 4HAWA 1I2MA 3LH5A 1OYWA 4PSKA 2I1QA 1XTSA 1Q1ZA 2JLRA 1NN1A 4D81A 3FFBA 3I72A 4LHZA 4PAOA 2X19A 1ZMXA 1G6HA 2BJWA 2HJGA 4P4SB 5HZHA 4MRPA 3BJIC 4D80A 1KI1A 5EUMA 2GKSA 1TF5A 2OFXA 2P65A 2PZFA 5KPDA 2R62A 1F2TB 3CZQA 3AF0A 1JXMA 4YXWD 1TF2A 4TQ9A 3ADCA 4U00A 1G16A 4TN1A 3CR8A 4L16A 2Q0HA 1G5RA 1TEVA 2XOKA 2IF2A 1YR6A 1P2TA 4HLUC 2GCNA 1E1QD 1OFTA 3UG7A 2QM7A 3MWLA 1CJMA 1FP7A 2IYRA 2VBCA 3CWQA 2IHBA 1YZKA 1Z0FA 2FWRA 2ZJZA 3MD0A 3SR0A 2QAGB 1OIXA 2BBSA 2ONJA 3AM1A 1YR7A 4BFYA 3WMFA 1Z0JA 1OXUA 1P7CA 2F3TA 3T15A 4MKHA 4FMDB 2JLWA 2CDNA 2GXSA 3U3JA 2FSIA 5CYPA 4YQFA 1NI3A 2HLDA 2ZQ5A 3GJ8A 1FW6A 4LGMA 3L0OA 2VLIA 2NMVA 2WWWA 2WJVA 2JLZA 3GFOA 1XPUA 1NL3A 2EQBA 2YINC 1KO1A 3H2YA 5F9FA 2ZS7A 1X6VA 2VP5A 2W0MA 4AI6A 4HZUB 1KZ7B 4I1UA 1G8HA 4M1MA 5KSZA 1U8YA 1F60A 2PJRA 2CCGA 2QAGC 1XJ0A 2ODEA 2P5TB 3GCGA 4US0R 4EUNA 1E2KA 1XZPA 3KJIA 1NN3A 3ASZA 3GP8A 1CR4A 1Z6TA 2BKUA 2IW3A 5SZJA 3ADBA 1U94A 5FOTA 3SHFA 2OUKA 4K46A 4RD4A 1GNPA 5FPKA 3QVVA 3SFVA 5DN6D 3DPUA 5E7MA 4FCTA 4BFTA 2GXUA 5DI3B 4JLJA 3C5CA 1HEIA 3ZGXA 3FMFA 1SHKA 1NNEA 4IVQA 4AK9A 2QSZA 5AWFC 1MH1A 3DDCA 3TMKA 4O25A 1DO2A 1SQ5A 4CW7A 2G1KA 4HAZA 1RC8A 1GG2A 1A5TA 4BUJA 4IJMA 3EXAA 4EPXA 1JB1A 3EZ6A 1VIYA 4XVUA 4DEYA 1KI8A 2XB2A 2WM9B 1MABB 4RJLA 1ESNA 5JI3E 2FFQA 2OV2A 4NCKA 4OYHA 1N6PA 3I61A 4Q5IA 1DE0A 5EXXA 5C18A 4DC9A 3GLGA 4BLQA 3TKLA 3FHTA 4KBGA 1KO7A 4DCTA 2VP2A 4V0OA 3SJZA 1T4GA 4DBLC 1D2NA 1TQ2A 3GPLA 1QHHA 5L3RA 1TADA 1GITA 3BD9A 4JBXA 5GJVC 3CF6R 3RS4A 5HE9A 3GLIE 1M7BA 3AVXA 1Q22A 2ZE5A 4X8MA 3T1OA 5K8IA 1IN5A 4ZPXA 2EFCB 1EG7A 4M9XA 1DARA 2YWFA 2A5JA 3SOPA 1RRCA 3MWJA 3HP1A 4C30A 1NF3A 4P33A 2VRWA 2BKEA 3IEVA 2W6IA 1Q44A 2QE7A 4OBEA 1KK2A 4GI7A 4Q1BA 3EWSA 4URZR 5BN4A 5BYJA 3QNUA 3K70B 1NIPA 3SEAA 1TMKA 821PA 3ZZUA 1ZNXA 2CHGA 3L2OB 5J4VA 3K9LA 2P6UA 1JQJC 4UKDA 3O8BA 1VHLA 121PA 1BYUA 2ZREA 3P27A 4L9WA 4BWYA 4Q7JB 1UEIA 5EE0A 3DKPA 2GILA 2NG1A 3MGCA 5SZKB 3NH9A 2OHFA 2N46A 2XZLA 3R9XA 1YJ5A 2C2HA 1NSFA 4Q1AA 1Q1EA 1TQ6A 1KK3A 3EWAA 2K5UA 3U5ZB 1LF5A 1WA5A 3AVVA 3TLXA 3N2IA 3C15C 4DCUA 2GXAA 4LI0A 2BM1A 4TT3A 4C2UA 3RC3A 1VYVA 2UVQA 1UFQA 3BWDD 3A1SA 4BASA 1MRNA 4FN5A 3IPYA 1H8HA 3QXCA 1OW3B 4Q4JA 3A1TA 3BXZA 1AQUA 1RKBA 1W4CA 3WBJA 3AP3A 2CL7X 1VYUA 1QZXA 1Z06A 4A6XA 4DSOA 4ESVA 1Z6YA 1DG3A 2ZI4A 4KO8A 2P3SA 3U4QA 1XEXB 4LUCA 1OHHD 4OK5A 3WHLA 1XBTA 4JL5A 1CEEA 3B7GA 4XSHA 1E1RA 1NBMD 4E07A 5H1YA 1VCMA 1E9AA 5C46F 5EZ5A 1XTJA 2QL6A 3FDIA 1XCPA 2ZR7A 4M1KA 5IT5A 4A15A 3NVAA 3R7WB 1E94E 4GFDA 4TWZA 2IS2A 1G64A 1YZTA 2ZRMA 3WYGA 1ZU4A 3GEIA 1C1YA 2IBMA 3A36A 3I8SA 1U99A 2XZOA 2QMEA 4AYWA 4OQNA 4KFUA 1NVVQ 1KY2A 1LTQA 2QNRA 4IVRA 4CEJA 4KYUA 2RGNA 1NKSA 1QHHB 4Q02A 3Q3JB 5EQTA 1N0WA 3S1AA 2DFKB 1XCMA 3C7KA 1M1YE 1YVDA 1QHYA 2VQSA 4QG7A 4BEBA 5KNCA 5HKKA 4YMWA 4D0LB 5DE3A 2NO6A 2ZJ2A 4HEJA 4PPFA 2FJUA 3IBGA 3LVQE 3RHFA 5KTYA 3K70C 4LHWA 1NVWQ 3THYA 3PR1A 4QHTA 3OFND 2GXQA 3AGPA 2GAOA 5EXPA 2IS6A 2ZI5A 1M6NA 2VSOA 4A82A 1IN7A 1NBME 2AWNA 4JLBA 4CF7A 4H9GA 3PIRA 4PR0A 1R2QA 421PA 3AF1A 2IC5A 3M0EA 4ARZB 4LYAA 2A5DA 3U44B 2DFNA 2A78A 5FL3A 4AC9A 3U3KA 2OM2A 1IY1A 1MT0A 4HATA 1ZC4A 2AHOA 4EKDA 5FTKA 1AM4D 1AKYA 5FPHA 2GDJA 4PO1A 1I2DA 4PANA 1MO6A 4KFSA 2WZQA 1US8A 2QMUA 1CU1A 2QQ0A 2OAQ1 5JRJA 1E96A 1LB1B 3P4YA 4KCGA 1VECA 5JBQA 4YLGA 2RGAA 1HUQA 2PBRA 2WWXA 1A4RA 3CRRA 2EFDB 1T5IA 2A3RA 2BBTA 4EIWA 4DLXA 3Q5DA 1WDTA 2XXAB 1OF1A 1G6OA 1VKJA 4B2PA 4DIEA 1KI9A 1D6JA 1RRPA 5LD2C 3TJZA 2ECKA 3SQWA 4MYUA 3IBYA 5EE9A 2F55A 2WPDA 3VHXA 5L3SB 1OFUX 2F1JA 2Q6TA 3RSLA 5IK2A 5FPTA 5FR1A 3LXXA 3I73A 3PEVA 3AVOA 4C4PA 2C96A 3RWOA 4A36A 1UEJA 3LBHA 3CIOA 1YZGA 4N0EA 1NRJB 1G4UR 4FXPA 4IDNA 3ZS9A 4QM6A 1Z6AA 3QVUA 5JHGB 2ZSDA 3T1TA 1FQJA 5J4LA 2HXYA 1CR1A 2HF9A 4RD3A 1RYHA 2E1RA 2WJYA 3CF0A 1SKQA 2HDNB 4S35A 1MO5A 2O8EB 1ZM4A 2ODNA 4OQFA 4Z8XA 3E70C 1L4YA 4KSBA 5E7JA 2LCFA 2H57A 1XEWY 3CX8A 5AR1A 4CEJB 4ASUD 1RZ3A 3CPJB 2ZE7A 5ANRB 2IWHA 1G3QA 1XEWX 3D8BA 1KSFX 4BEJA 4LZZA 3GEHA 2REXB 4BZPA 3CX7A 3AKDA 4YDHB 5AJWA 4PPQA 2BVNA 1CF4A 4NCJA 3U2QA 1E2NA 5FI0B 5A0FA 1E2LA 2OLJA 4D4KA 4MYHA 3ZDQA 1W46A 2W2TA 1ZD8A 4M0LA 4Y0VA 4RKEA 3TR0A 5KO2A 1R0YA 3KKMA 3PUVA 4I1SA 3K1JA 3V4RA 4PAQA 4MQBA 2F9MA 2QTHA 2GWHA 4M9ZA 3B78A 1NMYA 4DLYA 4IW3B 3TRFA 2QTVB 5AJVB 1T8TA 3LW8A 4ZDIA 3EA0A 1R5NA 3QKRB 3SS8A 3MG9A 4V0LA 3CPHA 3WYAA 3PFIA 3A37A 5SZIA 3PG5A 3GLFE 4F7WA 1SULA 4IEIA 4PHGA 4JSYA 2FEOA 2O8CA 1I4LD 3K0SA 2GVZC 3EZ7A 4MH0R 3QIAA 5DI9A 2JLSA 2ZRAA 5EXSA 3K9NA 3FHCB 1EWQA 4Q00A 4I4LA 2IYVA 2FG5A 5G3YA 2QRZA 3NWJA 5B64A 3NDBB 4P32A 2R2AA 4OHVA 5E7IA 5TDHA 1EGAA 4DLZA 2F43A 4DHEA 3UPUA 2JASA 2IHYA 3VAAA 1AZTA 1ZUIA 1UDXA 4DVGA 4FW9A 1FNMA 2XXAA 5CK5A 5JWHA 1DS6A 2HF8A 2R6CA 4E09A 1KKMA 2H17A 3NDPA 2WJJA 2HUPA 2IL1A 4DLUA 2D2FA 1KIMA 3SU8A 2KI5A 4AKGA 1SVSA 4EFNA 4Q03A 1X8KA 3OIVA 1R6BX 2JCSA 4KVGA 1VG8A 2WJGA 5DO9A 1VIAA 2FFBA 3MAAC 2O8DB 3L8YA 1NN0A 3VR2A 4LBWA 1KI6B 4PO9A 2JLXA 2MMGA 4XVQA 2QMHA 4FWTA 2A5GA 4IDOA 1II0A 4C0HA 4RD0A 3P4XA 4RZ3A 4QJ4A 4W5WA 4DT1B 3I62A 3GD7A 4FIDA 3ZH9B 1Q57A 4D2IA 2I1VB 4OJQA 4F4CA 1EFCA 5FBQB 2B21A 4A0HA 4DIDA 3H4MA 4FCVA 4DSUA 2FPLA 3GLHB 3EIEA 2ZU0C 3M4YA 4YMTA 4G1UC 4LBZA 3ICQB 4M21A 3O8DA 1XTRA 3SHWA 3SE0A 1R0ZA 2W6JD 3IHLA 2XTMA 1ESMA 1Q20A 4A0FA 4JLOA 3CNNA 4R2HA 3LWNA 3KZ1E 1IY2A 1TU4A 5HTKA 3RVBA 1G17A 4GZLA 2C9YA 3IDQA 1H65A 2GRJA 3I1FA 1ZCBA 2AXNA 1U2RA 2ATXA 5G40A 4CEIB 3TNFA 1HT2E 4RFSB 2IXEA 3DOEA 4LX0A 2CNWD 2GEUA 1P3JA 4NONA 4A2QA 1KSHA 3FKQA 4AYXA 2NO0A 1E9RA 2QT0A 2WKPA 2UZ3A 1Q0UA 3L0SA 1P72A 2CCKA 3CLVA 1E3MA 5CIWA 1OFIA 4GMDA 3WY9A 3NBXX 2F43B 1A2KC 1G3UA 3B1ZA 2AK3A 2IS4A 3B85A 2KBEA 5GADl 4JLNA 4EPYA 5CLLA 3GJ7A 4GT1A 1M2OB 5CB8A 1Z83A 3JZMA 1GZSA 2KSQA 5CM8B 1TTTA 1WXQA 3CPEA 3SYKA 3KDSE 2NO9A 2AD1A 1BO6A 1OXTA 1ZU5A 1W1WA 3U3MA 1F3OA 1MV5A 2JJ2A 3QG5A 1UDWA 5BWMA 4TMXA 1U0HC 1LVGA 2FPMA 5TARA 4BZXA 3MFYA 1YQTA 1UKYA 2JJ8A 4PZZA 1QBKC 1K6MA 1QRAA 1UPTA 2CE7A 3I3SR 2G6BA 2PX0A 3A8TA 1PV4A 4D4MA 1YR8A 2GA8A 4C0QC 5KSPA 2FZ4A 3L0PA 3IQWA 2ZVPX 1AA9A 1GNQA 1HTWA 5KNBA 4XSGA 1OIWA 2FSFA 3AVPA 1P2SA 2RGDA 3OEED 2GETA 2QUZA 5LBIA 2HJVA 4LJ7A 1XD2A 4L15A 2ZJBA 5TY0A 1AN0A 4HUQB 3CX6A 4PC2A 4Q9HA 4JLVA 5EJEA 1KO5A 3LLMA 4IRUB 1G8FA 2Z6VA 2CJWA 4JVSB 4JLMA 1E1QA 1N6IA 1O87A 4FINA 3PCRB 4BFXA 1DAEA 4DJTA 2IT1A 2R6AA 4TMVA 1G3IA 1C4OA 4UNRA 1E2GA 3EG5A 4GOJA 3NC1C 4GP7A 3SJAA 5K8UA 4PAMA 1GL6A 3KXLA 4AYTA 3U4QB 1U0LA 3RWMB 2XTZA 2YOFA 4TTRA 1PVOA 2J0UA 3EZ9A 1S1MA 2EFEB 5FR2A 2GEDA 1JEEA 3A1WA 1B23P 4OI1A 1N0UA 1AS2A 5DHAA 3SJCA 2HLDD 1HQYE 1GKYA 5EE3A 3RRZA 5BN3A 2J46A 1T8UA 1KSGA 2Z43A 3U3OA 2P6RA 1P60A 3LBNA 5LB2A 4RKFA 4LOAA 1DELA 3CBQA 4LC1A 1NG9A 3HJNA 1E4VA 2NO1A 3L8ZA 3LX5A 4WW0A 3FKSA 3KXKA 1G4AE 1KI7A 5L3QB 4LHXA 2ZSFA 2ZJAA 4Q9JA 4ZCLA 3NHBA 1E6CA 2A5FA 1QHXA 2PMDA 2A5YB 4KHZA 3GMTA 3NC0C 5TV2A 4L4UA 5LD2B 1H8ED 4ACBA 4EQ6A 1WB9A 4URXR 4DEXA 721PA 1UBCA 3P32A 3RS0A 3BFVA 4ZIRA 4NE2A 2G0TA 4U7DA 4BRWA 3FVQA 2H16A 1CBUA 2O8EA 1KDOA 4QNRA 4BGDA 5JJIA 2GJSA 4DDUA 3RRMA 3BC1A 1Z0KA 4Q1DA 4E03A 2GJ8A 4G01B 3NTUA 4DKXA 3GFTA 5D3MB 3TH5A 1Y63A 4PC6A 4WZ6A 4IOMA 3SYNA 3IHWA 3WMEA 3GFPA 4POAA 4K8OA 1D9XA 4JLPA 1IBRA 4D0GA 4B3BA 4TYNA 4Q48A 2ZRFA 3BIFA 3MMPA 4WZAE 1T9HA 3B1VA 1T6NA 2BV3A 1DVRA 4OHZA 3PENA 1YZNA 2FSHA 4IEEA 4DSNA 1GL7A 2FGKA 3GJXC 5J5CA 4B3XA 3A1UA 4JYBA 1J90A 5JSZB 1OH5A 1ZD1A 1HA3A 2DWOA 2VHCA 1FUKA 2B7BA 1CJVC 1IONA 3QBVA 3MUFA 5DNYB 4QM7A 1L8QA 1OHHA 1NLFA 4H1UA 1AJEA 1Z29A 2OZEA 2GF0A 1OB5A 2GEVA 2VO1A 2QE7D 5BXQC 1OPXA 4I1OA 1JR6A 1GKIA 1D2MA 2CCJA 2ZI9A 2E9SA 2XZPA 3QEOA 2ZVQX 3H86A 4JS0A 1VHTA 1YZUA 4MRSA 4PTLA 1CJKC 1S3GA 2BOVA 3W34A 5EE1A 3CKLA 3P20A 2FGJA 3CZPA 5EP4A 4PC7A 2ASEA 4F4IA 2ZAOA 2AKYA 1P9WA 1DADA 1EXMA 1NLZA 4LCBA 2C99A 4B3DA 3B60A 1UAAA 1ZM2A 2R6GA 1QHNA 1RW4A 2ATVA 1CXZA 2EFGA 3E2IA 1ZVQA 2ZJ8A 4UXJA 4M53A 4EJSB 1DOAA 2G77B 5M04A 1W47A 4NPHA 2CVHA 3H0KA 3HU2A 4KBFA 5KNDA 2YOGA 3PEYA 4R98A 1E0JA 3DEFA 4TT3D 1ZD9A 3M6AA 2GCOB 1A82A 1W0JA 1N6RA 1D8TA 3T1VA 2H5EA 1JPJA 2BBWA 2V6IA 5D3MA 4ABYA 2NQ2C 5C4MA 2BMFA 5FUXA 1KHTA 3A1VA 3R8FA 2WAYA 4KLNA 1KI6A 5AUQA 4DLRA 1XEXA 2R6DA 3ADKA 2NTYC 3UMSA 3ZIAA 2I4IA 3L0IB 5DLQC 3ZZTA 3NKVA 1E2QA 3QF4A 3QPVA 4A0RA 2VPPA 3MSXA 3BH6A 4QBIA 3VX3A 4V0KA 2BCGY 4TMTA 3W3ZB 4DDWA 1RIFA 3CB4A 4UNQA 4HDCA 5AJYA 3RS2A 4HYYA 2GCPA 1Q12A 3CONA 1PUIA 2BC9A 4NYJQ 1T0HB 4S2EA 1PJRA 2OFOA 1VG1A 2ZANA 1ZUHA 1E0KA 1W4BA 2XNDA 2HCJB 4ZDKA 5DSZA 4NTZA 1GRQA 2OG2A 4CEHB 2BDTA 1AS3A 4BFVA 1KK1A 4ILEA 2W6JA 2WMNB 4LDJA 1Z5ZA 3QXHA 1ZIPA 2OXRA 2IA5A 1MKYA 4O2LA 1FX0B 2MSCB 2QTFA 1F5NA 2YWEA 4MYTA 2IX3A 3QUSA 3AP2A 3RAPR 3HR8A 3SBDA 1Q3HA 4LV5B 2ZJOA 4BFSA 1XB2A 2J1LA 4IDHA 5JWRA 1S9DA 1VCOA 2ZR0A 1SVWA 3KQLA 1NY6A 2QSYA 1Q21A 1W2GA 3VKHA 4JLKA 2PT5A 2OXCA 1W5TA 3UMRA 3B6EA 5FL7A 3FTQA 5GJWC 1OB2A 1E2EA 3AKCA 3WP0A 4B33A 3O8CA 1N5LA 1NKTA 3AUXA 4Q7LA 3ZJYA 4B74A 1KI4A 2FF7A 3GEEA 2AKAB 1GRNA 2WJHA 4NYMR 1P9NA 2ZSAA 1W36B 3CRVA 2XAUA 4DXAA 3OF5A 2V7QD 1NJFA 3QBTA 4RZXA 2JLYA 1NN5A 4M1OA 1MRSA 2RGEA 5JI2E 4TTQA 2WV9A 4NP6A 4C0SA 3ADDA 1OLOA 3VR4A 2PZEA 4N3NA 2ANCA 2ODBA 1NP6A 3QF4B 2D74A 4XWAA 1IN4A 4C7OB 3RABA 3AH8A 5FTMA 1YRBA 3Q8XB 1CRQA 5KOYA 4PQRA 4PPNA 2GESA 3NIBA 4HB4A 2ORIA 3KXIA 4R7ZA 4YC7A 4A8JB 1TX4B 4IXMA 1JECA 4PSVA 4EPRA 4Z1MD 1KDPA 1NBMA 5G41A 4IOLA 2JATA 4Q4AA 3K0FA 4FMCB 1ANKA 3VFDA 1EESA 2RCNA 2QPTA 1XDBA 2SHKA 2O8FB 2HT6A 3F8TA 1WMSA 4HDQB 4JSTA 3B8HA 4NYMQ 4HAVA 5JMTA 1GWNA 1SGWA 3OEEA 1CULC 3IIKA 3GLGE 2QBYB 4KFRA 1T3LA 3VHLB 1KMHA 2X1VA 3WYFA 1S9HA 1E2IA 1G21E 2QENA 2REOA 4DCSA 1IXRC 1AS0A 1E9SA 2EYQA 2HYIC 4BPBA 5TB5A 3QPWA 4OL0A 3V4FA 1Z08A 3NBZC 1QHIA 2ZAMA 4L5BA 4RFSA 4GMXA 3ND8A 2WSSA 3TUJC 5IK2D 1XFAA 3KB1A 5FOWA 5J4YA 3CF2A 2ZR9A 2W58A 4N1AA 4LBVA 4EAQA 4FWIB 1XTKA 3T06B 4Q47A 4TYQA 5J4HA 2Z4SA 2YZ2A 4WIAA 5FOUA 2GVDC 4QKQA 4DDVA 3K0CA 4LYJA 2R44A 2GZHA 4HZUA 4A9AA 4C2TA 2QP4A 2ZE8A 3GJ5A 1WBDA 2LWIA 4LHVA 4TTPA 5L3VA 2YHSA 4NYIR 4CDGA 2YNMA 1YZLA 5FTLA 5JSZA 4NHOA 4D25A 1U81A 1F2UB 4BLTA 1XNJA 2DHRA 2G9NA 3A4LA 5B2ZA 2FA9A 4PXAA 4CGZA 4C0LA 4QJ3A 2WMOB 2CL6X 5IHPA 5JWOA 3WBKA 2QEQA 3AEZA 5C1BA 1ONBA 3FFAA 4QGHA 1OH6A 1MOZA 4BLSA 3FE2A 3U7HB 3KQKA 2WIBA 2IS1A 4TLCA 2CL0X 1ZM3A 4NBSA
chains in the Genus database with same CATH superfamily
4EVSA 2C5EA 5EXEA 5PGMA 1YC2A 3R75A 3X43A 2RK6A 2X3YA 2WSMA 4G0NA 1XI2A 3HEMA 5FTJA 4S2UA 4XGKA 1F0PA 1A7JA 1MV8A 3R4VA 4Q4HA 3C6ZA 1XU4A 4DN6A 4LS3A 1MAVA 3AF2A 1NI4B 1SVUA 4E7OA 2TMKA 4WGFA 1O77A 1F6BA 4X1KA 4YMIA 1G7SA 1FJHA 1FMLA 1K8RA 5DSTA 2ZRLA 1RLMA 2ZKIA 2UAGA 2P79A 3GLSA 3LKDA 4HEA1 4M8SA 1QMGA 1XKLA 1MAHA 4LXQA 2GFHA 1RZRA 4H7HA 1NDHA 2ZB8A 5CR9A 1Z36A 4ZVRA 3L49A 3A27A 3SBOA 1GAJA 4Z8YA 2ZE6A 1J0DA 1RI1A 2GZAA 3W78A 3HYNA 1PKEA 4JI6B 3ORFA 3X0DA 1E62A 3C7TA 1GA6A 2BFNA 3IKJA 1KNXA 1ZOIA 3MJVA 2I7VA 1ZW6A 4RZSA 4W82A 3TOCA 5B36A 5K9ZA 4YB8A 1F2VA 1MC8A 1HLPA 1QQ5A 1XCGB 2BHNA 2PRKA 2C5BA 2ZSIA 3QU9A 2AC4A 3DOCA 2X0DA 4FYIA 4REMA 3X1DA 1QH0A 3GB9A 4MV7A 1Q0ZA 1VE9A 2JAXA 5FBVB 2WHQA 1JBEA 1LPNA 3LX8A 3RV3A 2J0UB 3OOHA 1R0SA 3CVOA 1FY2A 1A27A 1MFPA 2Q07A 4PHTA 4FP9A 4EY7A 1JKXA 2SCUB 1J8FA 4A6PA 1M10A 1ZEJA 3BB3A 2AFRA 1X7ZA 2LGJA 3WIDA 6LDHA 5JCJD 1QLWA 2BY4A 2EKDA 2ODPA 4DA9A 1SVMA 2ZETA 4RELA 4LBYA 1WUTA 1ZM9A 4DJEC 1MENA 3F2IA 1HV8A 4ZT4A 3U13A 3P2MA 4F0JA 1Q3TA 4DV2B 2XHEA 4UATA 6Q21A 3N8DA 4JOBA 1LY1A 2V55B 3DL4A 4KV9A 1Z4NA 2AUMA 1NLMA 3K1AA 1KZ6A 2IYSA 5B1IA 1E9VA 2JI6A 2DPLA 2QD2A 1PT6A 3KVNA 4MUEA 5KVCA 1CIPA 1GILA 2RI1A 4JBWA 4K6OA 3ZVNA 1A2OA 2CKDA 3RBXA 2PT7A 4N76A 5ALMA 1A8UA 1BVHA 3SLKA 1BWSA 5L3SA 1XJCA 5LUBA 3TZCA 3FH0A 3VZPA 4NYIQ 3LAWA 1A9ZA 1CJBA 3UICA 1GNTA 1ZOSA 1KZYC 3SS9X 1O57A 3RASA 1H8HD 3C45A 3BL5A 2QX4A 4RHXA 4ANFA 4AX8A 3N39C 1G41A 1JYEA 1DBQA 3IAM6 2J3HA 5U9CA 1EESA 1DG1G 1ZD3A 3QU7A 5CA0F 1IK4A 4MV0A 4RBNA 5CH5A 1E2HA 5F1KA 3X2SA 4YJGA 2BMAA 4HLUA 4RXTA 4Q1EA 5E8RA 1QH1A 1YVEI 2ID7A 2IDZA 1OWMA 2JFXA 5EHZA 5IFLA 5KYYB 1DAIA 1L5WA 5ALPA 5F1OA 5DM70 2F8SA 3AR3A 1QGAA 1Z0SA 1NE7A 4EW1A 2QI9C 1T5OA 2GAFA 1PGQA 2FUCA 4V03A 5EIOA 3NTVA 3Q40A 3QKTA 4JOCA 2VAXA 2SKCA 2JLQA 1JHMA 4M86A 2XDQB 3ZQUA 1MO4A 2VH5R 2WVJA 3N8KA 3QSYA 3HKCA 1C0KA 2RMKA 4MGKR 1RMYA 4Z0TA 4CKCB 3A1CA 3SI7A 2WWYA 1NXOA 4I9GA 2PEYA 2XVAA 3H5RA 1KJZA 2OEPA 4GKAA 2C1XA 3V8RA 4YP7A 2ZJ4A 1Y3CE 1M1NB 2HWWA 4JJZA 4PQGA 4NBUA 4HLCA 1OXXK 2B83A 4XD7A 2XQKA 3TQOA 1IOZA 1P5ZB 2VJAA 1OI3A 2YMQA 3NT5A 4OKIA 4WZAB 4ALJA 5B6PA 4EG4A 2I29A 3EIOA 1Y8AA 2IF0A 4GOND 4MUIA 4LF8B 5DM1A 2C00A 3U7FB 4M2LA 1JKIA 1G8GA 1NJGA 3CTPA 3P9KA 3GOQA 4CTJA 4MHOA 1JA9A 1CYDA 1IC6A 3GLHE 3D0QA 1U3VA 4B4UA 4JMPA 2G1JA 2BEKA 4MZXA 5DEIA 3ZLVA 4AO7A 2F8TA 4KHPB 2O1EA 4HYQA 5A5DA 1N2ZA 4IO1A 1Q84A 3MERA 1B26A 1KOLA 3L79A 5CGQB 1GUYA 1P1CA 3UUFA 2V65A 3H1FA 1JAHA 4OGFA 3OU7A 4JT4A 5KQPA 1SIBE 1Y9ZA 4PW0A 3RSCA 3ZHYA 2XQIA 2OPHA 4W5JA 5IW8A 4X91A 3TMYA 1DAFA 3SZUA 4M0MA 3JD0A 4QOFA 2D7DA 1HC7A 1TUBA 3SSMA 3MAJA 4B7AA 1ZR4A 3P2EA 4XAQA 1JFFB 2IV3A 5ERGB 4EL5A 4NX2A 3W6NA 2P5YA 5I9BA 3UIEA 3UK1A 2B1RA 1LLUA 1WETA 1IVYA 1EFTA 5BSFA 4AF8A 1XEAA 4PG8A 1JSLA 3QNWA 3WHIA 3IAHA 4E2WA 3DT6A 1JP7A 3K1TA 4M7WA 1AHPA 3R0ZA 1KQOA 1NUPA 5FB3A 2Q4OA 5CHEA 1HE8B 2V6BA 3KZXA 1JI0A 3F7TA 2J3JA 1U90A 3OEHA 3P9PA 1FRQA 1WKBA 3DZKA 1CUZA 4OCZA 4OQXA 4YRGA 4PBSA 3IQGX 4KE7A 3FCYA 1I7QB 4ZPJA 2PFKA 3I45A 1BROA 1OZGA 3Q7EA 1L4HA 5HMLA 4H4EA 3PWSA 4TMWA 1NXVA 2UUPA 2VPWA 1MFZA 4UMVA 6NULA 2FDCA 2CWWA 5E95A 1AU9A 1Z5WA 4Q66C 3ONFA 5HM6A 4KC0A 1PZXA 4AZWA 1IY9A 1N2BA 3AHHA 3B1YA 2OO7A 4FHGA 4JUFA 3HYRA 3SEFA 3O4JA 3OTGA 3U56A 2H2IA 2IEZA 3HO8A 1RBMA 1N25A 4K9SA 4EARA 3QRWA 2JS7A 5IFKA 1JTVA 1CTQA 4NOJA 4U2KA 3KWMA 4EECA 1RZRD 2OHVA 2WIAA 1S2DA 3C6BA 1UUFA 3DEHA 4AUEA 4EHBA 1T5LA 2YWDA 3U60B 5IVIA 4NQRA 1IM5A 1SOWA 1ECCA 5E1MA 4EZEA 2B8NA 3HI6A 3RUPA 2Y1WA 1K0UA 1P8AA 1SWWA 4EFLA 1ZGAA 2A33A 4B6SA 2SKDA 2Y0BA 4AG5A 1EP2B 4R40A 3RDPA 3H3FA 5EPUA 2IHTA 3B89A 2ECQA 2D5LA 1RRFA 1ZKDA 5EIAA 2QF7A 5AHRA 2VDPB 4DV7B 2V54A 1NLUA 1E79D 4PGGA 5F9HA 4AIIA 3R09A 1DLJA 4FFDA 1OGJA 3JQ8A 4JVMA 2FP4B 2OENG 3IOEA 3WXMA 2HWUA 4OP2A 4H31A 4GGOA 5DXAA 3ZWPA 3T9CA 4EKNB 3GDFA 3DZ8A 5DCYA 1XALA 4MR9A 3JR3A 5GINE 2HH9A 4KZKA 4N7JA 3SNHA 1NM5A 2IOFK 1BVYF 3FPCA 1N5JA 4UNNA 3U39A 3OY7A 3TIFA 2C77A 1YRLA 3B9PA 3OLQA 4D8XA 4HAXA 4D5GA 1W94A 3HFSA 4QJBA 1KEWA 4B32A 2H4JA 1UKBA 1WY5A 2WINI 3JZAA 4E4TA 3EOBI 3SYMA 1ZIXA 2J33A 1Q92A 1Z6PA 3D5QA 3D4OA 3BFXA 4LFBB 1XHFA 3UJ3X 3ZDXB 3R9IA 3VR0A 2RGUA 5AOCA 5K05A 2OXEA 1Z2CA 5FTNA 1ZFNA 3CR7A 3NANA 4X8OA 1E5QA 4D9EA 2WIFA 2X13A 5DISB 4DIFA 2IEDA 5K8LA 5KX5A 3V42A 2OTCA 3A4YA 1YD7A 2B8TA 3ED1A 4WK4B 4D97A 3QU5A 3E7XA 4FGWA 5LJLA 4XB1A 1P80A 2BKLA 2PGIA 1KEPA 1LDNA 3ESAA 3IUEA 3OJEA 4KXXA 3PVCA 1Q7CA 4JBYA 1CNEA 5F7XA 4QGAA 4BB6A 5CLQA 4NCBA 3RFCA 3WIBA 3GVIA 3L4JA 3AIIA 2JGNA 1JG6A 1YBMA 2DH5A 3TB4A 1ITZA 5H81A 3AR4A 4TWJA 2JBAA 3DFIA 3WLFA 2X8JB 4BRUA 1X7YB 2Z4RA 3BBPA 3MUEA 5K4HA 2I33A 3QTTA 4UXHA 1I4EB 2QU7A 3PQ6A 3BJRA 4LTDA 3P9SA 3WYEA 4WBNF 1T3TA 3RHZA 2Z6AA 1QTRA 2CT8A 2J5XA 1UBKS 2BI8A 4ZEVA 3GF4A 2KMLA 2QY9A 2VC2B 2JGDB 1V25A 4FFRA 3VSBA 4Z7OB 2VNHA 3K8ZA 3QYPA 1V0JA 4ZAWA 3VSCA 1JU4A 2J0VA 4F5WA 2DFLA 1JBKA 3E61A 1L4LA 4BMVA 4YTEA 1P2GA 2AW3A 5L7WA 2E6KA 3K5HA 1NY5A 2XNKA 1ZRSA 2ORED 4R2IA 5U4XA 1DUIA 4WK0B 2WSYB 3DL0A 4DSZA 5CFNA 2NN3C 3FYUB 3DPIA 3DMFA 3QUBA 4XGRA 4G0WA 2OBMA 3OEYA 2Q29A 4F91B 1WPGA 1BMTA 2CXQA 2OK7A 1USVA 3V1UA 1CDEA 3QLEA 4XB6B 1OKKA 4URUR 3N2NA 4JELA 2RHDA 4RE6A 2Q99A 2NT3A 2A7XA 1BEZA 3UHOA 2YV5A 1CHNA 3D54D 3QTBA 4R3NA 4DY6A 1KP9A 3GIWA 1UK8A 1BXGA 2VRBA 4F2HA 4L9RA 3U1BA 4OAQA 4A0QA 2JFGA 3AXSA 4EKGA 2F3PA 1YQUA 3SX0A 2ZRBA 3L6BA 3K0CC 4MV1A 2GM5A 4P4UA 1QG0A 2GD2A 4PLCA 1HXHA 4RPIA 3I6QA 5H7XA 1Y8CA 1WZCA 1F4PA 2E4WA 4MPJA 3ESDA 3T7EA 1PFWA 3H1PA 4YRIA 6REQA 4QYXA 2V1XA 1HDEA 2Q3FA 4K26A 1ZH0A 4I99A 2D13A 2FV8A 4HDRB 4ZYXA 3G1WA 2Y1DA 3DO6A 2XZTA 3AHJA 4QUAA 1Z8HA 4M99A 4EYKA 4XASA 1EM8B 1KFEB 3NALA 2YMLA 2Q8PA 1FLDA 2CFOA 1UJ2A 1SCDA 1MABA 4R1SA 1TEZA 2H07A 3RRJA 4MITA 3K0KA 2DU8A 3OE7D 3MUOA 2EHJA 1AGXA 2H31A 1XJQA 1AIPA 3AOEC 3WQHA 2XADA 3BRWD 5BSTA 2ZQYA 1RJFA 1YR9A 2QXUA 2ZRGA 3W9BA 4ND4A 5D3QA 2DKOA 3H6GA 5BV8A 1VPEA 2ZYUX 3W2GA 4XJXA 3VNAA 3OSZA 3IEKA 3OFNA 5IABA 1SVIA 3EA4A 3KYBA 5BSMA 3PKJA 3AR6A 5BW4A 3U1TA 2YYZA 2JI4A 2WT8A 2YOHA 2HBYA 1AKTA 1T5DX 1QYVA 2EL7A 2J3QA 1CUWA 2X0NA 2XUZA 4IQGA 5EYPB 5A4DA 1IFXA 3OT4A 4P1ZA 4ND3A 2JBWA 4NCHA 4R31A 2P77A 3ILYA 1L8LA 3UG6A 2JAHA 1UM8A 3MQ2A 1WPRA 4PHFA 1RKXA 5EWJA 3TRJA 2ZYTX 4LV6A 3N0XA 1P2DA 4KU4A 4YUYA 5LZ2A 1QQAA 3CH4B 1ZJJA 1ENZA 3M83A 1F48A 5JCOC 4PWYA 4L5CA 3F5QA 3HU3A 3IHTA 1X1QA 1TW2A 3HP4A 3QI2A 5EHXA 2RHBA 4NH4A 1T1RA 4BNFA 2ZTVA 3FAZA 3KB8A 3G2KA 3KSBC 1OBFO 1W0JD 5A2GA 3ECCA 4YMLA 4U9UA 5DMXA 1D2AA 4LXXA 1NT2A 2ORWA 1K5PA 1SKUA 2FEWB 1T5SA 3HEBA 3PNSA 2AD5A 3V8VA 4A1OA 5JNUA 2VP0A 2OV6A 3VR4A 4AZ3A 2O5RA 3FSGD 3NBQA 1DO8A 3ESXA 3AHGA 3T5BA 2ZIEA 1RQXA 1YE8A 4EZIA 2ET6A 4HB2A 4N48A 1L5MA 1JLLA 3S1LA 4Y2QA 4NE7A 1KJ8A 2NSLA 3K72B 5A2QA 2PKQP 1Z2NX 3I4LA 3LVRE 4K7JA 2KYRA 4MDYA 4X5OA 3W9SA 5I7EA 3AM3A 1ZBQA 4GEGA 4GQAA 5DM4A 3RD5A 1VG0B 2AR7A 1W8DA 3HWX1 3A10A 3ABZA 2OBLA 5FV4A 5EIWA 3AQ4A 1ZDMA 2B25A 2YXPX 2Z3VA 3DCNA 5EMMA 5HM8A 2H4WA 3TSZA 5IJZA 1B74A 2YKGA 1PFKA 4GI1A 4LKRA 1ZA2A 3I4CA 3BMCB 3UAXA 2JI9A 1VJDA 2BZ0A 2IEYA 3A1EA 1FMJA 4IDFA 3AY7A 5AKEA 4H7JA 1SUAA 1PDVA 3AF3A 1UXOA 3TD6A 2PMFA 4DMFA 3ED5A 1V5IA 4QYMA 2CJYA 3RFFA 3DJYA 4BX9A 4UEWA 4KR2A 3ZV3A 2EU8A 2H7CA 3QPAA 2QA5A 3RQSA 1O95C 3WQBA 4B3IA 2ZT8A 1VJCA 5F12A 1FX0A 5CTAA 4W9NC 4RX1A 1SPBS 2WJ4A 4OIFA 2CWDA 2JJ1A 4X62B 4XYEA 3UH0A 1V4NA 1UBLS 1L7MA 5C8DA 2X9VA 2JFVA 2H4FA 4JXKA 2X23A 3D7LA 1A5SB 3B3QA 1P17A 1QYXA 2AEEA 2BEUA 3E5MA 3LF2A 4UEJA 2HSJA 3RTGA 4DCVA 4BNIA 4WVLA 1P4SA 3GFBA 4C0KA 3PEFA 3SBEA 2PLRA 4C88A 1L8AA 1TGYA 2VHYA 4E94A 5ERXA 1GZ7A 1G5IA 2GTPA 2Y2VA 4I5EA 2DTEA 1TT5B 3FOBA 5K6RA 2CHFA 1RTTA 3WKCA 5M34A 2VAWA 3NATA 4YMSA 2Q7OE 7AT1A 4OI2A 1G2OA 2ZSHA 5K0ZA 3JAWB 4OBBA 1DIOB 1KR2A 1UBFA 5KU1A 1FJGB 3WL7A 1OQAA 1GGMA 2G5PA 3G68A 1EBFA 1H6BA 1B43A 4L7QA 4LGVA 3TLZA 1JYSA 3FXAA 2I7XA 4JJ8A 1KPGA 3DCJA 4ME6A 4OU4A 4UTOA 3SS7X 5JIBA 3LV8A 3HVRA 1REQB 4DCOA 5HUJA 1QVWA 2C7QA 4N12A 2F1HA 5G53C 5BXYA 1I4TD 3PICA 2QVCA 4I5GA 2BUCA 1ARZA 1XD9A 2I4NA 2Y9MB 3ML1A 3HVIA 3WJ1A 3LT4A 4WNAB 2ZYVX 5EQDA 2P90A 3T35A 4BIMA 2XJ4A 1YNOA 5C1IA 1E1KA 1AURA 2QW1A 2OSBA 3PFNA 4B71A 5JE8A 1JQLB 2WKRA 1Z4IA 3O75A 1SC1A 4IHJF 4TVBA 3BB4A 4RD1A 1FQOA 4BVFA 3VHXB 3VTZA 3REQB 1DJNA 3DE6X 1QGED 5LOVB 3KWLA 4F38A 1V3TA 4Y98A 2Z2ZA 4B1FA 1OR8A 2J9FA 4L0DA 5KU7A 3C97A 3FTPA 2NOAA 4WXRA 4HUTA 1H9CA 2QRVB 3KKPA 4HAYA 2HA3A 3DAFA 3CH5A 2J9RA 1V5EA 3C8UA 3K0BA 3Q85A 2Z3WA 5AM5A 1ENPA 1LQTA 3OZTA 3TPCA 2ONKA 3ZV6A 4OGWA 3SSOA 3TE6A 2B78A 1TM1E 3K8QA 2IUSA 3AB3A 3U7JA 2DKFA 3S2UA 4O2BF 2GVNA 3RANA 3VU9A 1T5BA 4MGIR 4IJVA 4A8JC 5BPFA 3QKSA 3QKUA 4QJ5A 3IBSA 3CWZA 2GHRA 5HZMA 3WL4A 3ZN2A 4ENVA 1R88A 1Z6XA 1TW3A 1G8PA 3H83A 3MELA 1GM5A 1K3UB 4KK4A 1X7HA 5ALRA 1BDMA 4OAPA 2FNAA 5ELLA 3TS1A 2OVBA 3M3DA 1U1IA 4TMKA 4XVRA 3TW4A 2P35A 4UHKA 3TLEA 5JNTA 4US2R 3BCUA 2I7CA 2CLDX 5DMHA 3KQOA 1ZL0A 3V4VB 3FYHA 6ABPA 3HYCA 5ALQA 4ESEA 4ZU1X 1AQNA 1GSIA 5K45A 5H8WA 3WLHA 4QD3A 2G1PA 4UZSA 4JB8A 3TNYA 3VISA 5BY2A 4QBTA 4PNEA 2FCAA 4Y6SA 3R9KA 1G8KA 4DYHA 1BRTA 1RC0A 4RDHA 1CZOA 1XXHB 4JT2A 1LI4A 5H3HA 5JVDF 5CVCA 4B47A 3ND9A 3PYLA 5DNVA 2YCBA 1DAGA 2P9CA 1KYXA 1XYYA 2MWMA 3DP9A 3PLRA 3W8EA 4PQFA 4QHSA 4AN0A 4W1QA 2FPKA 1WE2A 2AGVA 3S2ZA 5FUWA 5JCJA 2X6QA 4OHCA 1K1EA 3NIFB 4AULA 4LWZA 1M66A 2V1UA 1XQXA 1Z2OX 4PCUA 1NVKA 2E4UA 1NI5A 1EZ4A 1O3YA 4GM4A 3CUWA 3ZE0B 5LMNB 1NE2A 2IYXA 2VSXA 3AR7A 4P7GA 2FCRA 3FCAA 4MKGA 4CVNA 4D9MA 4TLMB 2WE8A 1MLDA 2GBFA 4IDCA 1ZSYA 4B7CA 5A5GA 5BT8A 4V1CI 4EHAA 3IV6A 3U6BA 2J7KA 5LYYA 4F92B 5KX5F 2JVKA 2G8LA 1V5GA 3BX1A 4Q39A 3OY2A 2X6RA 2XTJA 2O05A 3BRQA 1C3OB 4QOEA 4DMUB 4DRXB 3FGPA 3H05A 1X1TA 1NA5A 2I1LA 2QJRA 4DG8A 4P7BA 1NBEA 1YBAA 1X39A 5ADVA 5AUPB 5JVDA 4FZJA 3JAWA 1N5KA 4ATNA 3E9NA 1CUCA 2D3TA 1FS4A 1GUZA 1I5EA 4X8LA 4UDNA 3JQFA 2BFFB 5A5EA 3NBAA 2QZ4A 1PR9A 4UHEA 2A7QA 4PSCA 1P2VA 4AW9A 4DB2A 1UJ4A 3FPFA 3QXGA 4PICA 4YRDA 4F3RA 4TN5A 1YE5A 3HU1A 3WFJA 4B7XA 5F5NA 1KA9H 2WIKA 3CUSA 2C03A 3GP5A 3R5HA 5LLTA 3FUXA 1DTSA 1RWOA 4DLWA 1N8KA 1JHXA 1J22A 3PFGA 1EUDB 2DUWA 1DKLA 1WW2A 4DQKA 2WJAA 3EULA 3PIIA 1GGEA 1X7WA 3NHAA 2H6EA 4JWKA 2WF9A 3WLSA 4YO7A 2B35A 4IUBS 1SOAA 4GF5A 4KRGA 5DTRA 2K7FA 4TYWA 4UCFA 1RT9A 1DBPA 2ONYA 3GNQA 1WULS 3GUYA 1OGIA 5AM4A 5KJCA 1DBWA 2M1ZA 3L43A 5L8VA 1XQVA 1K8ZB 5G3ZA 3PRYA 2FSPA 3KWFA 4EJ6A 2JAPA 3IBFA 1UZUA 4DIUA 4ZYZA 5BXQC 1CLUA 1I8TA 1MP0A 3K20A 3K53A 1ZNQO 3MT9A 2Z0MA 5JDCC 4BBJA 1LS1A 5AVTA 1P75A 3C1UA 4Y9UA 3E1SA 3HJAA 1R8QA 1E20A 3M3HA 3M1IA 2DFPA 2FWNA 2A4MA 4LXUA 4C4ZA 1UXIA 2ANBA 3DBOB 4MVJI 3CNOA 4TV8F 4Z2YA 4N5MA 3P0JA 5F21A 3WOVA 2XTNA 4DUYB 3T3MB 2JFOA 4B75A 2QUKA 2Z2IA 1UQTA 5DSXA 5L51A 2RKOA 2AMVA 2HMTA 2J3IA 2BFCB 5DGTA 3UV7A 4AZ3B 1I3NA 1WZ2A 3NV9A 3IQIX 3Q88A 5CVJA 5ALGA 1IQ0A 3G5UA 3GGPA 2XUDA 1ZOLA 1NVTA 2JKYA 3P1JA 2AI2A 4CM9D 5FI3A 4NZYA 5JD5A 3RHSA 1MOSA 2GF9A 1UJ5A 4WX2B 1G8YA 3ZQJA 3NO4A 2HU7A 5CA0B 4RPHA 1O9HA 1SD2A 3GA7A 3CO5A 3KQPA 4CL0A 5KYTA 3HBAA 2VQ6A 3R7AA 4OQMA 2IV2X 3W5SA 2IU6A 4J91A 3JYOA 3TMAA 3GJ3A 4YRBA 1NXTA 1WNFA 2O07A 4U7FA 5G1NA 3DD5A 1ULTA 2Z5LA 4R16A 1ODTC 4J16C 1V48A 1EGVB 2BHRA 1SCJA 2LKDA 1MG0A 2XSZA 3GJRA 4EVQA 1N0VC 1GCGA 3IO3A 2GCOA 4YJ3B 4WXEA 1CUHA 4RA6B 3OKCA 2D1FA 3T4XA 1HG0A 2V74B 1HEYA 1U1FA 1EVJA 1VI6A 4ARZA 1TA0A 3O83A 4I6JA 3DEAA 3SEZA 2J87A 1KRXA 3NEPX 3D81A 1VIMA 1Z0AA 3LC0A 4J0HA 4P0TA 3V00A 1I2AA 4A8TA 1C7QA 2OORA 1K68A 3N0RA 3OFVA 1KNQA 1NVDA 2QZSA 5KBYA 1ADFA 1QJCA 1YMVA 1S5PA 2CUNA 2DHQA 2ZWMA 3FETA 4Z0PA 5LA6A 3VM6A 5DNCA 5JPDA 1OTYA 4RVOA 1ZMOA 3I2HA 3CRMA 1RLJA 1WD5A 3IUJA 1IN8A 1OU4A 4Z4EA 2X4LA 3EGVA 3L41A 4ZDWA 1BMDA 4KRFA 4XSVA 3PKZA 2R11A 3HV2A 5J2TB 4HGQA 3MMZA 2EBWA 3M2PA 3DM9B 1G9XA 2I6QA 1E5TA 2VUTA 3GC6A 3HUTA 4TTVA 4XIJA 3AKZA 1Z7YA 4JNKA 5I4IA 2YJGA 4AKHA 1RBZA 1X1RA 4E5DA 3KVRA 2FEAA 3W3AA 3KKOA 2EGGA 2VIIA 3OMWA 1II8B 2RHWA 3ACDA 4OBWA 4BJ3A 4N18A 2WD7B 4XDYA 4QARA 3NWEA 4I9NA 1NW6A 4REQB 4JLDA 1E0AA 2XUJA 2J3DA 3GU3A 5DB4A 2P6OA 3QW4B 3VVLA 2DOKA 3PGXA 5AOBA 4G24A 1DBVO 5AI4A 1SXQA 3ELBA 3WNCA 1N2HA 3T34A 5HCIA 4MW9A 4ID9A 3IC5A 3ZU3A 4D4IA 1RQ2A 2PX3A 1B3BA 3HHPA 1N0IA 1UK7A 3VYUB 4MEBA 3GMIA 2JZNA 3U80A 2VHTA 1UF9A 1M1NA 1N1GA 3RRBA 2JJ2D 4FFLA 5JJBA 2X14A 2NQTA 1YJAA 2PDAA 3HDVA 3KG2A 2JCGA 1FVFA 4KV7A 4D3DA 9ATCA 3U7GA 4AQDA 3W5JA 2QVZX 2P2LA 2WNIA 3THSA 3ZWQA 4ACAA 4DR6B 4BCDA 3A9UA 4ZZ0A 3UOWA 1GN9A 2BE7A 1OAOA 3UWKA 1D5WA 3AUUA 3A6EA 3CPSA 5A9SA 4HYTA 1M2VB 3W5IA 3PUYA 1FRZA 1L7VC 2NVWA 2Y1EA 2ZT7A 1G55A 3B1WA 3EW7A 5A9RA 3F6PA 1U5CA 1VI5A 4R8VA 3UAOA 2NV2B 1BRMA 2EW2A 3HJTA 5KTMA 1Z6GA 2P9QA 1YZ3A 2PV0A 3Q0EA 1MJ5A 5SYMA 3K8OE 1L7DA 4IG9A 1MDFA 4BCBA 4EQ6B 4F2DA 3W4KA 3OZEA 4RK5A 4C7KA 2Q2OA 3T9FA 5HRAA 3BFKA 4PZPA 1LC3A 2ARKA 1R7RA 2ZCUA 5CURA 3PSHA 3WNBA 4R81A 4G63A 3EPRA 2QN9A 4INJA 5FD8A 3TW0A 1M0EA 4RKYA 5BR7A 1BH2A 1TO1E 1XHEA 4TV9F 4AMVA 4UNIA 2X0FA 1W8IA 1FYFA 1GZ3A 2OHGA 4QYSA 1Y7TA 2FH5B 2VJBA 4DUGD 4QTYA 3VNUA 3JYPA 4LDZA 1Q3KA 3U17A 3NIWA 3JQBC 4HL6A 3KLOA 1A4UA 3CKMA 1GOTA 2P11A 3HLTA 4MQEB 4DILA 4YCMA 2FPIA 3KZMA 3GCDA 1Z2DA 2VSFA 2R65A 1CUJA 3OCVA 4NARA 3ZJVA 3CSDA 3FCUB 3SC3A 4G89A 3S8EA 2IU0A 3CCBA 4GOLD 2ISCA 5IC4A 3HZRA 1HDOA 5G4KA 5LXTF 1SWVA 1SA0B 1FUUA 2FHSA 3LA6A 4JKYA 2FW9A 1K8YB 1OOEA 1VJ0A 1QVRA 5I8PA 2QX8A 3AL2A 4N47A 4KXQA 2R97A 4WY8A 4JLAA 4TQAA 4P5DA 1G3RA 1N3IA 2RGCA 3PC7A 1L2TA 2C5FA 5DCUA 2HUNA 5TQ2A 3UJ9A 5BVHB 4E1VA 2P2NA 3FDZB 3DBRB 3BGWA 3DTNA 4HAUA 4KYTA 3U3XA 3KL4A 3PU6A 1ZAKA 2DHCA 1PT7A 3OMLA 4OIMA 1UBNA 1S2MA 1SBTA 5MHTA 4K88A 2W8BB 2WHPA 5GONF 1PFYA 3T3EA 2YR0A 3CNLA 3ZEIA 1DQPA 3DNMA 2JIRA 2HO4A 3B52X 2AI1A 2RJNA 1NMZA 3FZYA 3KPYA 2ZB4A 4I1IA 2E82A 1YH3A 1UBMS 4AY6A 2PLAA 4NBVA 1J9GA 1P33A 2HDOA 3DWEX 4NCNA 1JDUA 4R69A 2VSNA 2X8AA 2PH1A 3BF7A 4TUYF 1N75A 5M3BA 1S3SA 1A0OA 1PK8A 2CXXA 4AUMA 4ZRDA 4OXYA 2BZGA 1WXWA 2VF7A 3VZSA 5LXTB 1NF2A 1OFHA 1W5SA 2L42A 5I4KA 2PSDA 1NUUA 5DHFA 4GO1A 1QQ7A 1XMSA 3H4IA 5LP6C 4J1SA 4LF6B 3FWHA 2CLHB 5DW0A 5ITVA 4Y67A 2XGSA 3DPSA 1UBUS 1XRLA 4EJSA 1JG1A 4Z3DA 2NZWA 2HB6A 3TF5A 2FTKE 1ZVMA 5FT9A 4XD7D 4XCXA 5JSFA 1HBJA 1IZ9A 3HB5X 2I8LA 2GRAA 3ETCA 4LECA 2BIFA 3R5TA 1NMEA 1X1EA 2FDXA 5T57A 1CS0B 1I13A 2FZWA 1K88A 1KOGA 2B8EA 1VTKA 2BBOA 2WKQA 4UBMA 1M5TA 1J1ZA 4YALA 1XN1A 5KI6A 4XDHA 3ZKWB 4NS1A 3JTMA 3NPMA 4DDKA 5TGZA 4ZT6A 3PA8A 5I7FA 1MTOA 2G04A 1KAOA 3SZ3A 1U7UA 4LI3X 5E3IA 3CLRC 3WYBA 4EITA 3U37A 2G70A 2RONA 3ZVLA 1BXZA 4GE0A 4JZKA 1NV8A 1JPUA 1US8B 3T9EA 3TI9A 5BR1A 2CMDA 3UKDA 4IH9A 3TQFA 3BWMA 3KFVA 4L28A 3MLAA 2PD3A 4ZYLA 1MAWA 4GE3A 2WEKA 2R7NA 1Z0UA 2XR1A 3LSTA 3AIOA 1U8FO 1J8YF 2DECA 2FPPB 1JR3D 2GK6A 4RZUA 1TCCA 5I01A 3FHOA 3L4BC 1KMHB 2KWIA 3LQ2A 4L8YA 4DMMA 4PVDA 2H11A 4ZAZA 2H1VA 2O0LA 2PKWA 4NDNE 4QVGA 3WA6A 4A16A 5HKOA 2Q0XA 1P7WA 2ATEA 5FOVA 2Q1YA 4WADA 3SVLA 2G1AA 4LE2A 4ZKDA 3K5IA 1HRDA 1A7AA 1MIOA 2ZBEA 4MTCA 3E2PA 3PDIA 4Q4DA 3CLTD 2QIPA 3VR5A 2XDQA 5DXJA 4D3SA 3RUEA 1IQPA 4RGBA 4YUXA 4YCLA 3HBFA 4QFCA 1R27A 2Q0SA 3NP7A 4GIBA 5JCXA 3T5GA 3U19A 1ND5A 1S2GA 4P0PB 1V1JA 2ERCA 1GTG1 1RJ9A 1YB4A 4LJ4A 3RARA 4N5HX 4BYGA 4JI3B 5LM3A 1TC2A 4Y7DA 4YV2A 3FYUA 3QWFA 1W36D 5FRDA 4WNAA 2FVYA 1PJLA 1TYEB 1JF8A 2FSGA 3HL0A 4QBKA 3TL6A 2FDRA 4G5YA 2G5TA 4G5OA 3RC2A 3VZBA 4HZIA 5LZ9A 2I6FA 3RIXA 2QRPA 5ALHA 3T7SA 3OESA 4BLOA 5DOZA 5IC6A 3A9SA 2C84A 3P9ZA 2W9XA 5DEOA 3QVKA 4PLGA 4PGHA 4Z4GA 3IEMA 4OL9A 1RXEA 3ASYA 2WHXA 4LOIA 4FGKA 4IHQA 1SXJC 1TEXA 1U3UA 1MC4A 4EK9A 3I6IA 2Q2VA 4EUKA 2XD4A 2UUCB 4U02A 1BE1A 2VDVE 2QT1A 3TIVA 1NVVR 4N0DA 2HEIA 4KQJA 1KK0A 4MIYA 4DW8A 3RYFB 2K4MA 4F8JA 4G5GA 4N7RA 3FCXA 1XDZA 2A9KA 4Q1FA 4UTRA 2WYWA 4R7TA 1JFTA 3N5CA 2C9OA 4KODA 5G0VA 4D6YA 1YZQA 4PTYA 1TKBA 1TKRA 3GN2A 1PZEA 3VU8A 4PC1A 2H1LA 4EX7A 3NKFA 3AR2A 2CK3D 4PZ0A 2PE5A 1KS2A 3GJ0A 3GZ4A 3RFXA 1G3MA 5D1NA 1HE4A 5COBA 4HAWA 4WE3A 3GAMA 3U4AA 1KMIY 3ZNQA 4DR3B 1A9PA 4I19A 2PY6A 4D81A 1XZNA 3WLAA 3I72A 2H63A 4EW6A 1VC2A 4PAOA 4QOHA 3RNOA 5BNTA 2BSAA 4L6IA 1S4MA 4P4SB 5HZHA 3UWSA 3BHJA 3H5TA 3PUHA 4IH1A 4MRPA 2HIMA 1FU4A 3FMGA 2D5CA 1TF5A 4JLWA 4R2XA 3T7AA 5KPDA 4DZTA 2R62A 1XRMA 4FQ5A 1ZKMA 3PTAA 1Y3FE 1PNQA 4ZQBA 1JXMA 1V3VA 3AUSA 2VI5A 5A4FS 8GPBA 4GGMX 4P86A 5EWJB 1RWPA 3EH1A 4OHMA 3ZGLA 4CCSA 4R0MA 2ZIGA 1DRVA 1J2YA 4MW4A 1F9AA 4NABA 1QIFA 1PVDA 3OZDA 2Q0HA 1H2XA 4KFCA 5CP8A 2PMEA 4C7VA 3DWIA 2IF2A 4FZVA 4HLUC 4DG9A 2J5QA 4GC9A 4M89A 4ERXA 1E1QD 3UG7A 3BIXA 5IZ4A 5IWCA 1YFKA 3F78A 3FWNA 2PKXA 1SU7A 1CJMA 5FPTA 2WVHA 1NR7A 2IYRA 3AHEA 4ZYYA 1WMAA 3F67A 2FWRA 3MD0A 5CH3A 4DYDA 1VXOA 2AB0A 2JGRA 3O03A 3QUQA 2NU7A 5HNKA 3D64A 1OIXA 2EDCA 3UTCA 2ONJA 3AM1A 3Q6NA 3PDIB 5I3ZA 4YCAA 1OXUA 3DV0A 4XQCA 2HWXA 3QWHA 4L5JA 2K2QB 3R5SA 4FMDB 3P9CA 4UUOA 2LCIA 2JLWA 4RTJA 2FSIA 4UD6A 2HRQA 3D9QX 4NZ9A 1NNUA 4G0XA 1GR0A 3L05A 3ZLBA 1DKNA 4DWOA 5KEIA 2I6UA 2NMVA 1M2OA 2AC2A 3MCTA 2H8GA 3AJAA 4MR9B 4GICA 4DHWA 5FADA 3GFOA 6PFKA 5AI5A 1BDHA 1VB3A 3CCCA 1KO1A 1HORA 2ZS7A 3K6RA 4F8YA 3RG8A 3K3PA 1R9GA 4FIZA 4AI6A 1SH7A 4OFXA 5IJAA 5KSZA 1E3EA 4MVJD 1KY4A 1U8YA 2GK4A 4XRGA 5LLDA 3W05A 1Z15A 1CUXA 2QAGC 2C61A 3FVTA 4HD8A 4UAVA 3I1YA 4ZT2A 1Y7IA 3M1YA 1W5FA 1JWBB 4BZZA 5INTA 3ISTA 1ZHFA 4RO0A 3PIDA 1E6KA 4XJTA 3K1ZA 5T8KA 5KNCH 4YRTA 1NPYA 4EFDA 4XLZA 1QKIA 3NASA 5BMVB 4P54A 4QYTA 4DJJA 1ZICA 2X9GA 3I37X 3OM8A 3SFVA 1EVZA 5TGTA 3RRFA 1NFQA 4BFLA 3PC4A 1NZJA 2VDMB 4OU5A 3T9BA 1UQUA 4YQYA 4Y7CA 3PNKA 3GRPA 7REQA 1R74A 2HSWA 5BOVA 1VPVA 2QSZA 3HGMA 5AWFC 1ECJA 1VKZA 2H2AA 1PJCA 3O2NA 3NHLA 3CUYA 2G1KA 4DOMA 4FR0A 1KU0A 3Q98A 4ZGGA 4IDDA 2Z58A 4UOZA 1ATZA 3WGKA 1E1MA 5BQOA 1X94A 1LRJA 3WIVA 2ACEA 3CEJA 3RWBA 4E5YA 4QA9A 1OI7A 1WO8A 1KI8A 3BHIA 4P3XA 5EEHA 2WM9B 1MABB 4O4IF 3HZHA 4PU0A 3ZCRA 2PWZA 1UJCA 4UULA 4PLZA 2AZ4A 2OV2A