3FOZA

Structure of e. coli isopentenyl-trna transferase in complex with e. coli trna(phe)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
305
structure length
305
Chain Sequence
ASLPKAIFLMGPTASGKTALAIELRKILPVELISVDSALIYKGMDIGTAKPNAEELLAAPHRLLDIRDPSQAYSAADFRRDALAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTELTQTSGDALPYQVHQFAIAPASRELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPEQARDEVLQVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA-Protein Mutually Induced Fit: STRUCTURE OF ESCHERICHIA COLI ISOPENTENYL-tRNA TRANSFERASE IN COMPLEX WITH tRNA(Phe).
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transferase/rna
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
total genus 101
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2009-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fozA01
3WHKA 4U7DA 2WSSD 2FSFA 4J0QA 3SDZA 1XEWY 1CJKC 4HLCA 1U99A 2JASA 1XFAA 2PL3A 2WAYA 3EWAA 4W5WA 5FTMA 4TN1A 1NL3A 3W3AA 1DAKA 2PEZA 1N6KA 3RWOA 2YYZA 3Q5DA 4JVNA 3MGCA 1G20E 2QE7D 2WVJA 5DN6A 1KDPA 1MABA 3FVQA 4D0GA 2ZVPX 4Q9JA 2DCUA 2WJGA 3SQXA 2IYQA 3LLMA 3PUZA 5TVKA 4NBSA 2AFIE 4Q9HA 1E2JA 2OCBA 4CEJB 1TQ2A 1DAIA 1KAGA 1UKVY 1N5JA 2UZ3A 4AG6A 2O0KA 3U3KA 4NONA 5GVSA 1EFRD 1Z0KA 1WF3A 1Z0IA 2P5SA 4PC1A 5FPTA 5H68A 2ZYUX 4GL2A 3QPUA 2XX3A 1EGAA 4OJQA 2FFHA 1ESMA 4NYJQ 1FP7A 1E0JA 1KSHA 3CH5A 4BEJA 2IT1A 1ANKA 4BFSA 1OH5A 4M9XA 1R0WA 4TT3D 3TH5A 4C7OA 1JR3E 3K9NA 3MWKA 1E2PA 4D4MA 3KJGA 1AGRA 4Y0VA 2FE4A 4F93B 4BLTA 2GESA 2GJ8A 2A78A 4NE2A 4FMDF 3RS2A 5KNCA 4G5SA 3T5GA 1NJGA 1XNJA 2G6BA 4TMWA 1OH8A 5FPSA 2D06A 5L3SA 1NLZA 3VKGA 3OHMA 2ZRAA 4M8NE 2IS1A 1FX0B 3U4QA 3PFIA 1L4YA 4ZO4A 4BGDA 2REBA 3VTKA 4HLQB 3O47A 1E94E 4TYYA 4FMCB 2JCSA 2ZRCA 2GJAA 5BN3A 2HV8A 5ELXA 2QM8A 1RRCA 4BRUA 5CYOA 4LRWA 3R8FA 1V43A 2ZJYA 4UXIA 3OE7D 2CL7X 4ZCIA 4TMXA 4D80A 2EYQA 2ZM5A 2V1UA 1KDOA 4PC3A 4Y0AA 5DH9A 3HU2A 1X1RA 2BDTA 3RLFA 1ZJ6A 4EJSB 5JEEA 2GK6A 1DBSA 4NCHA 2ZITA 4B6FA 4PAQA 4QBFA 4PO8A 1G4UR 4Z8XA 3W6OA 3CWQA 5EP1A 2ZS7A 2ZS9A 1GNQA 1IONA 4PANA 3BD9A 4V0LA 1G8HA 1G41A 2GXUA 2YOGA 3ZIAD 2OESA 5C4MA 4NCKA 2GJ9A 3QKTA 3TBKA 4DLUA 2QPOA 2JLQA 4IEIA 4MUBA 3TR0A 2WWGA 1G3MA 4PR0A 5JBQA 5KSPA 1OXVA 1UKYA 1ZVQA 2GK7A 2F1IA 3WMEA 3GJ5A 5FI1B 5GJBA 3ZZ0A 2I4IA 3BK7A 5TXGA 2J1LA 2QP4A 4HSEA 4LX0A 4US0R 1KZGB 3LX8A 4C3ZA 3T61A 5HR5A 2QRZA 2D7DA 1CF4A 1FQKA 3AUXA 3MWYW 4H1UA 3T15A 2FFBA 3PEWA 4AKHA 5JWHA 1VPLA 4KV9A 4YMUA 2QMEA 2ZXUA 2JLUA 1LF0A 1KSGA 2ASEA 3EPKA 1BOFA 1ZUHA 4TWZA 5C4GB 1GFIA 3GLFB 1UADA 2LKDA 1CRQA 4RY2A 3TUIC 4QJ3A 2ZJOA 4P33A 4HDOB 1HT1E 3IDQA 2VP5A 4L4UA 5DYGA 1R6BX 2JATA 2HLDA 2RHMA 3CNOA 1FMJA 2I1QA 3QKRB 3LQRA 3NEYA 2J0SA 3VX4A 4OYHA 2IBMA 3NBXX 2WJYA 3ZVNA 2VRWA 4M22A 4OK3A 4S35A 5FL3A 3MJRA 2ANCA 3BC1A 1E1RA 1MR3F 3FYHA 4KFSA 3GLFA 4QGFA 2Z4RA 3LXXA 1T91A 4LWZA 5JEDA 2REXB 4B73A 3KDSE 3QKSB 4U02A 2FA9A 3SN6A 3THXB 1NG1A 3LDAA 4P3YA 1NVUQ 2ORVA 3IHWA 1SVOA 3BBPA 2ANBA 1Z63A 2ZRDA 3UATA 1E1RD 3GP8A 4FMBB 3QBTA 1XU4A 4KBFA 3SZRA 5JCZA 2QMHA 3GJXC 1E2LA 1QVAA 3B8HA 3IEUA 3ZS9A 4ZDIA 2WSMA 1MO4A 2R2AA 4RCYA 4X8HA 4DUGA 1ZU4A 2ZSEA 1W4CA 1WBBA 2H16A 4URYR 4OQMA 2GCOB 1VYTA 3K0FA 4KAXA 4O2RA 4UJ3A 2ZRJA 3W5IA 1N6IA 2IXFA 4TSFD 1G8FA 1NRJB 5CM8B 1JPNA 3A1WA 2CCKA 2EWVA 1JEDA 3CRW1 1HQCA 5E3HA 2KI5A 2XNDA 1NBME 2GAOA 2ZU0C 1GL6A 1U98A 2ZSAA 1CRPA 3QPVA 1ZD9A 3B5JA 3BH7A 2GJKA 4CGZA 1N25A 3NHBA 3RS5A 4BWYA 3ZIAA 1A5TA 1BS1A 2JLRA 4TL8A 3CW2A 3U2QA 3IIJA 2GKSA 2CLDX 1K6MA 4XWKA 4M1OA 1U81A 2ONKA 4WZBE 5FBWB 1YZKA 2DFNA 1SVLA 2FU5C 4IEEA 2VPPA 3LD9A 1JXMA 1VMAA 4KJZA 1XRJA 3AF4A 4O2LA 4A0HA 4PC6A 4PHGA 3VR6A 3B82A 4TQUS 4JKYA 1VIAA 3AF0A 1N6OA 4GT1A 3IO5A 5G3YA 2CHGA 4WA7A 5SZJA 2WPDD 4KHZA 1C9KA 3B60A 4N0EA 4A2PA 3GQBA 1GKUB 1KO5A 4RFVA 1NNEA 1F2UA 2BC9A 4KLNA 1M74A 2DWOA 4KU4A 4UXHA 5FL7D 2QTFA 3NDBB 2QBYB 2VIIA 4O3MA 1H65A 4PHHA 1GWNA 3LW8A 2UZIR 3DVLA 1VTKA 1ZNZA 3P4XA 2G83A 2TMKA 1TQ4A 3AVYA 1AJEA 3EAQA 4LK2A 5TMPA 1QHSA 5J40A 1XEFA 2P6UA 2CMKA 3M6AA 1SQ5A 4XSHA 4ZDJA 3Q7PA 1KSJA 1GAJA 2FGJA 3QIAA 2P2LA 2ZYWX 3EPJA 3A4MA 3E5HA 4JLDA 4H9GA 1XEXB 3LO5A 5J47A 2YVUA 1ZD8A 1IN5A 3U7HB 4QBIA 2Q9AA 2FOLA 4KVGA 2XB4A 1S3GA 2EFEB 2FFQA 4C0HA 4B75A 2OV2A 2FZLA 4B74A 4D0LB 2L0XA 3MCAA 3GFPA 4QBGB 2CBZA 1XB2A 1GP2A 2X19A 5C1BA 1E0SA 3TQFA 4FW9A 1KK2A 5AK0A 4M9QA 4EPVA 1I4TD 3THWA 1OFHA 2PH1A 3I32A 5J4VA 1YR9A 4BASA 2X77A 1T8TA 1G3UA 1M6NA 4JYCA 4JZKA 3A1UA 4R2HA 4LYJA 3X1DA 1YKSA 3FE2A 2Q9BA 4GOXA 4DXAA 4DKXA 4OHWA 2VHUA 1AGPA 1N6NA 5HZHA 3ZH9B 3NBZC 3TQCA 2V9PA 2WSSA 4TTRA 2QE7A 5DN6D 1N5LA 3WXMA 2R6DA 2XZOA 3PIRA 1KZ7B 2PT7A 4LJYA 1DPFA 1ZUNB 5EUQB 3WMGA 5HCIA 4P4TA 4A36A 1YQTA 3FKSD 4P4UA 3C5CA 1VG0B 3WP0A 2P6NA 3KKMA 2FFAA 2CNWA 4TMVA 4XTRA 3FHCB 3ADDA 1XMSA 1YZNA 1GG2A 3REGA 3I8SA 1GL9B 1DVRA 4I1OA 4XTCS 3SOPA 1E2EA 1VHLA 3GJ6A 1TADA 2J46A 2C99A 4D0NA 1UBFA 1UF9A 3C41J 3TVDA 3FMFA 3KJEA 3GPLA 5HPYB 1KAOA 1WCV1 5KSZA 1JR3A 3QENA 4DEYA 1GSIA 4TLEA 2GNOA 5EXTA 4V0NA 2ZEJA 1XTRA 2VA8A 4DSTA 4B32A 5FTKA 4NCJA 621PA 4I81A 3KXLA 2BEJA 1RIFA 5F9FA 3NDPA 2BJWA 3U7EB 2GTPA 4KBGA 4XVUA 1G6HA 1IY0A 2ZE7A 2GHIA 3SR0A 2BIFA 4LYHA 2J0QA 1XXHA 4AKGA 2VF7A 2HJGA 4LBYA 2PZFA 1SZPA 3IEVA 1G3QA 4BLQA 1EFUA 5DO9A 1XWIA 5CB6A 4Q66C 1EK0A 1E2KA 3IBGA 1FQJA 4NHOA 1KMQA 2ZI6A 5KO2A 2JIZA 2ZE6A 1J70A 3I1FA 2VP6A 3BFVA 2F3TA 5HE9A 6Q21A 1E9SA 2H1LA 1EXMA 3K9HA 4LCBA 1X8LA 2XJ9A 3B13B 4M2LA 5E95A 2AFHE 1PUIA 3C7KA 3LFUA 1CIPA 2Q3HA 4LC0A 3K09C 1QHHB 4OI1A 4P0TA 1JAHA 3BB4A 4LY6A 1W36D 1WBDA 5F3WB 1S4QA 1Q3TA 3BB3A 3LVQE 4NU0A 1COWD 4WIAA 2ZUDA 1IBRA 4KSBA 4YDSA 2R9VA 3TR5A 1TUEA 4B48A 4G3XA 1T6NA 5L3RA 2W6ID 4DDTA 2JLVA 2HEIA 3TAUA 1T4GA 1Z83A 3RC3A 3W6PA 5AJWA 4JLPA 2Q9CA 3QG5A 3DZ8A 4Z54A 3T1TA 1XJCA 2N46A 4IHQA 5F9HA 4PPNA 3RRYA 3BE4A 1U94A 1GNRA 1GZSA 1UM8A 1X8JA 3PUYA 2AN9A 1UKEA 4A8JA 5JJLA 3P4YA 2J7PA 1Q57A 1KO7A 3AVXA 3TE6A 4YMWA 5TB5A 4DSOA 4RD6A 5H70A 2O8FA 2QM7A 3IIKA 1OE0A 4KI0A 3H1TA 1AKEA 3EZFA 3GJ0A 4AKEA 4JMPA 4MGIR 3RS4A 3SU8A 1F60A 1RJ9A 3DPUA 5FTLA 4JLKA 3TVTA 1IY2A 5UKDA 5FL7A 4F4JA 4ZPXA 3DL0A 4LV6A 3AKEA 1FFHA 2C2HA 2CDNA 2GCNA 2OFXA 1KJWA 2IYUA 2IK8A 2WKPA 4DLZA 3K70B 1J99A 1KO4A 3IIMA 4FI3C 2HXYA 5FR2A 3TLXA 1II8B 2OBMA 1OH6A 2F55A 3UXMA 1KHTA 1S9DA 4ZIRB 2MSEB 3A8TA 4GZMA 3FMOB 4JL5A 4DB4A 2JLSA 1RJ9B 3ADCA 5CJ2A 1NSTA 4I1SA 3MSXA 4Q9KA 2PJRA 1P61B 1Z6TA 3FPAA 3F8TA 3TW4A 1AQUA 3B9PA 5J4LA 2CXXA 2OBLA 4BUJA 1TEXA 1JBKA 3C4JA 4AYTA 4LHYA 4O25A 1DAHA 4RZXA 1S3SA 4M9SA 1ZC4A 2MSDB 1CR1A 1RVDA 3CUEF 2Q6TA 4OI0A 1FP6A 4CIDA 1CLUA 1K5DA 1RKBA 4LJAA 2XNDD 4MUAA 2ZANA 1LTQA 2G9NA 4HUTA 1AA9A 2JEOA 5HTKA 4Q19A 3UPUA 2OILA 2WWHA 3HPQA 2ZS8A 1QHXA 4G0NA 3GLIA 2DPXA 2IYSA 4ASUD 1OYWA 4QG7A 2IX3A 1OFIA 4BFYA 4JBYA 4GBMA 1F2UB 4OHYA 5BQ5A 3OEHA 2FEMA 3WHLA 1NIPA 2YWGA 2PJZA 4QGHA 4RD3A 1KI9A 1JQJC 1R0YA 4D82A 3A1SA 5AJVB 1KIMA 2H57A 3VFDA 1CS4C 3CZPA 4Z1MA 4EPTA 1YZTA 4JIMA 2ZI7A 1T5LA 3RAPR 5FOXA 3U44B 1IXZA 2KE5A 3DMDA 3RRNA 2JLWA 2R6AA 3ND9A 3LXRA 4RKEA 1IN7A 1PZNA 1IM2A 2KBFA 4LC1A 2JGNA 3QVVA 4MGYR 3QSYA 2GVZC 4RFSB 3W34A 4F4IA 2K5UA 4MQBA 4C0BA 4HB3A 1J8MF 2ATVA 4QOSA 2WWXA 1BO6A 2CHVA 4PO9A 2O5VA 1RZ3A 3B1VA 2YWHA 4JLAA 5FUYA 2GEDA 1E2QA 2PZGA 3NH9A 3VNVA 1FPMA 1PLJA 1IN8A 3JZMA 2O8FB 2GAAA 2ZRFA 2YOHA 2ZAOA 1ZIPA 2HYDA 5EP4A 4QNRA 4KITB 1Z5ZA 1XPRA 1BIFA 4NYIR 1TMKA 2ZI5A 3KTAA 3MLEA 3QQ5A 2IUSA 5CDFA 3VR2A 3BS4A 4BE7B 4NCNA 1OPXA 4QJ5A 2GCOA 1IN6A 3MWLA 5G41A 2VSXA 3SJAA 3THYB 3AF1A 1Z0FA 4P31A 3U7GA 4DDVA 1IJEA 3CNLA 2EVWX 4KXFB 1XTKA 2B92A 2E87A 2EFCB 4OI2A 4B33A 4DCNA 3K70C 5AWFC 2XZPA 5DE3A 4R9UC 2NZJA 3TAHA 2HJVA 5FI0B 4JLOA 4FCVA 4GOKA 1XD8A 1EFHA 2IL1A 5IHPA 2XTZA 1GKYA 1WB9A 1UPTA 2H17A 2BEKA 5JHHB 2ZQ5A 5FUVA 1G8YA 4DCSA 1SXJB 5AUQA 5KTYA 2BV3A 2QQ0A 3PUVA 2HDNB 2XGJA 3EC1A 3ZD6A 4CEHB 1OSNA 2OXCA 2D2FA 4Q4JB 5FBLB 4CZ2A 3CZQA 1E9FA 1DAGA 2ZTSA 1BKDR 3KXKA 4KYIB 4UKDA 4A0GA 4FWTA 1RFLA 2WKRA 4URZR 3EW9A 1E9BA 4MRVA 4MYHA 3A4LA 4LHWA 5P21A 2IYRA 1QHHA 4BRWA 4C0QC 1F6BA 2G0NA 1W5SA 3VMFA 2OO7A 2WKQA 3QKSA 2VO1A 3I3SR 2NMVA 4LSGA 3HR7A 1OLOA 2P0EA 2BM1A 3CRQA 2W6JD 3TGPA 2F43A 3C15C 3R8CA 3U61B 1XF9A 1KI4A 3K70D 3VNUA 4EIWA 3KXIA 2H5EA 4KODA 4ZDWA 3QF4A 3UANA 3T1VA 2HUPA 2AD5A 3DOFA 1W0KD 4B3XA 4D26A 3GLGB 5TARA 5IDVA 2NTYC 3AQ4A 4KYUA 4FMCF 3SYKA 1NSFA 1XEWX 2R6CA 4PPGA 3UK6A 1NMYA 1N0VC 2IYLD 1Z8FA 4TYQA 5JJKA 1Z06A 2QP9X 2GJSA 3KFVA 3IPYA 2QAGB 3RSOA 1W4RA 3QE0A 3SJBA 1YJ5A 1XZPA 5DIFA 5HKKD 1ZAKA 2PEYA 4Q9LA 2ORIA 3H2YA 5B64A 4UNPA 4HZIA 4QM7A 1AN0A 5JSZB 2F9LA 4A82A 1T3SA 4LGMA 3CB4A 5SZKB 1A82A 2VBCA 4EAQA 1P60A 1W2GA 2IS2A 2RGAA 4NKRA 4B3CA 4HUQB 4PO1A 1DO0A 1W36C 1IY1A 4AC9A 1SVSA 3B78A 2ZRIA 3IGFA 3X1YA 2VEDA 3E2IA 4D25A 1GDDA 3WP1B 1XPOA 3EZ2A 1TF7A 4Q18A 3O8BA 5L3VA 2FSIA 1SVKA 1G8GA 2QGNA 5JRZA 2IUTA 2ZJBA 1UEJA 2OBNA 3ZQJA 1JPJA 1NLYA 1UKZA 1Z28A 4MA4A 4OQLA 4U5XA 3T1QA 1H8HD 4PSKA 3FHTA 3AEZA 4OBEA 3AB3A 4PC7A 1SGWA 1AIPA 1E2FA 5EE0A 2DHRA 4A6XA 3KZ1E 2HT6A 1X3SA 2Z0MA 3NBYC 3LA6A 3Q3JB 4MDFA 3R9XA 2PCLA 1P2UA 4PFSA 2ZSFA 4B71A 2JJ2D 4JLNA 3EA5A 2H92A 221PA 4W5JA 1R8SA 3PITA 4LZZA 4BZPA 4TTQA 1TU3A 4JSTA 5DHFA 1W4AA 3CH4B 4YMVA 4B3FX 2VQSA 4D4JA 3SBDA 4D4KA 2CL0X 1NMXA 2CK3D 2AD1A 4ZV4A 1T8UA 2QSZA 1COWA 3LX5A 1X1SA 4IRUB 2GEUA 4TLDA 2ERYA 2MMCA 3K8YA 4HB4A 2IWRA 5B58C 2FZ4A 4X8OA 1ODFA 4Q1AA 2DY1A 2QPAA 1ZD1A 3PENA 3EIQA 2AHOA 1D9ZA 1OF1A 2RKOA 1YZGA 4UNQA 3GJ7A 2V7QA 1GUAA 2ODBA 4ACAA 1ZM7A 1D8TA 5JWRA 4RCZA 2QEQA 4BLOA 1KI3A 1FNMA 4MYCA 2J87A 1P9WA 3WY9A 1Z0AA 3BH6A 4PQRA 1MKYA 1Q22A 1VCNA 2F6RA 2JIZD 5EE9A 3SQWA 3TSOA 2QSYA 1KO8A 3TK1A 3ND8A 3KQUA 2UKDA 1M7BA 5BWMA 1Z6GA 1P75A 2D74A 4MRSA 1U8ZA 2VP0A 3FFAA 2W2TA 1KY3A 5E7IA 5KNBA 2DBYA 1N6PA 3TSWA 1YVDA 2QUZA 2H7VA 1R5NA 2CLCX 2W00A 3LV8A 4Z8YA 4ERNA 1E2GA 3ICQB 4EPRA 2AL7A 3BFXA 4FWIB 2IEYA 3O8RA 2O8DA 1GVNB 1LS6A 2G88A 1R5OA 4EPYA 2FSGA 1Z22A 4B3BA 1NN0A 4ZKDA 4KSCA 2J0UB 1QHIA 1RW4A 4QFMA 4DCVA 1ZIOA 1US8B 2ZYVX 1OKKD 1JR3D 4PAOA 1HA3A 2FMXA 4RD4A 3W6NA 1NN1A 1XTQA 2R8RA 4AIIA 3I92A 1SKQA 2C9YA 3EA0A 3IHLA 3KKNA 2C04A 2WJJA 2X1VA 4MYUA 1JXOA 2P3SA 1SKYB 3SFVA 1NBMD 1G3IA 3SJZA 2ZRNA 1CJUC 2RGGA 2OG2A 3ADBA 5JLJA 3R7WB 3AH8A 3SHFA 4JL6A 2R6GA 3B1ZA 3B2EA 3IO3A 5KSOA 2A5JA 4YQFA 1I4LD 1RE0A 2J7KA 2ZIAA 4BECA 4ZIRA 5JI3E 2QT0A 3EWSA 4F91B 1G19A 2OT3B 3QEOA 2Z4SA 1RRFA 1UBGA 1FNNA 4DEXA 3P26A 2OAP1 5EUMA 1XCPA 4W9MC 2BVNA 1AQYA 721PA 2GBLC 2CE7A 2QAGC 4ZI3A 2VP2A 3RABA 1Z0DA 5D3MA 3TUJC 4HB0A 3I5XA 4ZDKA 1TPZA 4M1WA 4ABYA 4HLUA 1M7GA 4PSAA 4B3DA 3QXCA 1SXJA 2FG5A 2ZJ5A 2AK2A 3EZ6A 3Q7QA 2C95A 2ZROA 1KO1A 1W0JA 1HYQA 1P4SA 3AKDA 3QKRA 2XOKD 3FWYA 5IK2A 3GEEA 1E9CA 2V6JA 2C5LA 2ZYTX 4NCIA 1ETUA 1XXHE 1L2TA 3CM0A 1KTVA 1ZBDA 2A9KA 1W48A 2ZRMA 4XIGS 4YXWA 3SI7A 3R9IA 1YE8A 1ZINA 4V0OA 5DNYB 2V54A 4LYAA 2W0MA 2VTKA 4OHZA 5DYIA 4JYBA 2G1JA 3K0CC 2JDIA 4IOLA 5DI3B 4GMXA 2IEZA 4D4LA 1MRSA 4FXPA 2GF9A 4KFUA 4LHXA 4MGKR 4TZ6A 1W7AA 4K81B 1LVGA 1VG9B 3ASYA 1DELA 2QU8A 3O8DA 3S1AB 5DLQC 4NPHA 2CJWA 5TY0A 1W36B 3EPLA 3N70A 4JLBA 3PXGA 3TRFA 4LPKA 2J5XA 4Z51A 2KJQA 2R44A 2H8KA 3AGPA 3Q9LA 4BFXA 4NZYA 2J45A 3GJ4A 4YMSA 3T34A 2EFGA 4JLMA 4MRPA 4TYWA 2WPDA 5J5CA 4QC2A 2ZE5A 1KI2A 2IF2A 3W9YA 3S1AA 3OIWA 4N3NA 3OAAD 1GITA 4V0ME 2B7BA 1OXSC 3OAAA 4C4PA 4A92A 1QBKC 3DMNA 2HT1A 4ZKEA 4LHVA 2C78A 3NEJA 1TL7C 3G82C 3JVVA 1XX6A 4HAZA 2MMGA 1E0AA 1ZU5A 3T5DA 3L43A 3L8ZA 4GP6A 2IXGA 2RGBA 4YMTA 521PA 4AI6A 1PV4A 2OLKA 1IHUA 1J8YF 1E2HA 1Q1QA 4Q00A 1HTWA 1K8RA 2F9MA 4PPFA 2WOJA 3SC3A 1BMFA 4U00A 4OJKA 4K46A 1PVOA 1P2VA 1TNDA 3AVWA 3AP3A 1YU9A 1FL9A 1JB1A 3QXXA 1A2BA 4TSFA 4CRWB 4ASUA 1EFTA 2GBLA 3MUFA 1X86B 4ZCLA 2EYUA 1A1VA 4Q5IA 5LB2A 4CYMA 1TTTA 4EFLA 5CDFE 2ZJ8A 4DUGD 3GLHA 4IFEA 2DYKA 1NVVR 4UNRA 3CF2A 4P32A 4A2WA 5EQTA 1FTNA 4GDFA 2RGEA 1XZQA 3LVRE 1V5WA 3BOSA 4IDPA 4II7A 3VU9A 2JJ8A 4AY2A 1SXJC 2CVFA 2IYVA 4BFVA 1CJMA 2SHKA 3KKQA 4OHXA 4MGZR 1KI6B 3D8BA 2AK3A 4LJ4A 2E1RA 4NL4H 1SHKA 4QGGA 1U90A 2QNRA 4C0SA 1Q1BA 3U3RA 2QMOA 1GRQA 3L82B 1W0JD 3GEIA 4C7OB 1G8PA 3B1WA 4EKDA 2O8CB 1C4OA 2ZPTX 2W2XA 4LJ6A 3TIFA 2ZSDA 2WICA 4A8JC 4Q21A 5JS8A 1M1YE 4NTZA 4LV5B 5EZ5A 1P9RA 1NVWQ 3B1XA 5DI3A 4DVGA 3VX3A 2X2FA 1KJYA 2RB4A 3C8UA 2ZR9A 3T12A 2GXAA 4ILEA 1II0A 2VYFA 4Q4AA 1II8A 1UJ2A 4MRRA 2OFWA 4B2PA 2IYWA 3LY5A 1J2JA 5K8TA 1XPUA 3KL4A 4OQFA 5CIQA 4M21A 1FOEB 1GTVA 2WZQA 2P5TB 1CU1A 3TSZA 4Q9IA 2ECKA 2Z43A 1N5IA 4EFMA 4W7SA 4JVMA 1TF5A 1FW6A 2GEVA 421PA 2XSZD 1MO5A 2Z6VA 2QPTA 5H1YA 5J4HA 3U3JA 2WMNB 4IW3B 1QHGA 4B44A 3B85A 4TQAA 4TYNA 4E22A 2FPMA 4Q4HB 1VG8A 4IDNA 3U3OA 1IOZA 1AS2A 3NBFA 4JT4A 2ZRBA 2V8OA 3J81k 1N3BA 4IVQA 1P3JA 4IOJA 3KQNA 4DBLC 4B76A 4DCUA 4L8GA 1G5TA 1I2MA 1X6VA 1GNPA 3LWNA 5H8WA 1NMZA 3KKPA 4ITRC 5LB4A 2DFTA 2YNMA 1QRAA 4JT2A 2V6IA 1IXRC 1LV7A 3CRRA 2QENA 2PLFA 4HAVA 2GRJA 3M4YA 3NTUA 4JKIA 4MITA 4C2TA 2QORA 5AJXA 4JJZA 2O8EB 5SZIA 2GXQA 3DO6A 4AYWA 1P2SA 5L3QA 2DB3A 2QGZA 4UXJA 2NIPA 3AVOA 1KI7A 4KLZA 2VSOA 2A5FA 3KQKA 2JAQA 1NG9A 2FNAA 1LNZA 3AV0B 2HF8A 3A1TA 1RC8A 1MV5A 3T1OA 1OIVA 2XITA 1KMHB 2IC5A 3LBHA 4LYFA 4QKQA 1NKSA 4MH0R 1TUIA 4M1SA 1XD2A 4POAA 5C18A 3HYRA 1F2TA 4GI7A 3BJIC 4HYYA 4BQSA 3OZXA 2FSHA 2QI9C 3QF4B 4Q48A 3MFYA 2P67A 1OB2A 2EU8A 2CHQA 4LJ9A 2NO1A 2I3BA 4EJSA 3HU3A 3KFXA 1E96A 2DWPA 4P4SB 1OIXA 3VR1A 2PMDA 3KKOA 4DRZA 3AVPA 1L7VC 2AWOA 3DHWC 2PCJA 2WJIA 1KDTA 4TL6A 1AZTA 2WWFA 3AUYA 2BMDA 2RGNC 3GMTA 4XVQA 5GJWC 5FOTA 3RC8A 2JJ2A 4LJ8A 5K8LA 1ZC3A 1II9A 3QPWA 3SS8A 4HZUB 3NG1A 4AD8A 4EFNA 4LV8B 1Q21A 4I4LA 1WDTA 4AWXA 2A5DA 4XD7D 5C46F 3TUZC 3VKHA 2EQBA 2HXSA 3X2SA 4B34A 3BWDD 1S1CA 1T9HA 3GFOA 1LW7A 4PX9A 2JJ1A 4BLRA 4D2IA 5AJYA 1R10A 1MO3A 3DKPA 4DZZA 4ESVA 3PEVA 2RCNA 1M8PA 3UG7A 5KSYA 2FN4A 3V9PA 3I4LA 1YZLA 4TLAA 4UNNA 4BFUA 3K53A 2D3WA 1R0XA 3DZDA 4QJ4A 1OHHA 3BIFA 4B3GA 2WV9A 3VHLB 3TMKA 4QNMA 3U6BA 2V55B 1NY5A 4M4SA 5JI2E 3RANA 1RPZA 4JBWA 5HCNA 3GEHA 4E09A 4X8MA 3EASA 1FUUA 1TQDA 5KHOC 1IJFA 2AXPA 2W0SA 4HAYA 4HUQA 2JJ1D 1E9RA 1YHNA 2CE2X 2CJWB 2C8VA 2OZEA 2QROA 2ZRKA 5BW8A 3G0HA 3FMIA 3NC0C 4PQFA 4UQOA 4I1VA 3WNCA 3H4MA 1NF3A 1JNYA 2CLSA 5FH9A 4TTPA 4B43A 3SHWA 4HDCA 5KDOA 4PXAA 2VL7A 5FTNA 8OHMA 2D4HA 4I99A 4AG5A 2KSQA 1NY6A 3KQLA 3CX8A 4IVPA 1HE1C 3WNBA 2NOAA 4Q7LA 2IWHA 1A2KC 4PQYA 2XJ4A 2WJVA 3MRSA 3PVSA 1VYVA 1YR6A 2P65A 2V1XA 5FBRB 3THXA 2W6JA 5FFMA 3ZGXA 1ESNA 1NLFA 2WM9B 4URXR 3HP1A 3KJHA 2OCPA 5BN4A 3QF7A 1KOFA 2LWIA 1IAQA 2ERXA 1DADA 3THOA 1M34E 1TU4A 1XBTA 4Q4LA 3CPJB 3SE0A 1SKYE 1C1YA 3ZLJA 4AKIA 2FWRA 2ZSBA 1KKMA 4M1KA 1D2NA 4ON9A 5HZKA 2PMKA 4TYPA 1R5BA 1SXJE 4C0JA 3I5YA 3GLFE 4OK6A 5FR1A 3W90A 4M1MA 1CTQA 4CF7A 1SULA 3F3YA 5JRJA 2JLYA 1E98A 4MKFA 3IILA 3ZZUA 2GDJA 4MKGA 1P62B 5BYJA 4OKSA 4DLYA 3LQQA 4FCTA 3HWSA 3ZYCA 2FJUA 4EQ6B 2GZDA 1U9IC 3MWJA 1NJFA 2QAJA 1D6JA 1VIYA 2ZR0A 3C16C 4GP7A 4TLBA 1VG1A 1A4RA 3F5FA 2O52A 1R8QA 1KGDA 2NZ8A 2PBRA 1DE0A 1TF2A 2PX0A 1E79A 1SVIA 3CBQA 4FIDA 2WIAA 4DLWA 1GRRA 3A36A 2O8DB 121PA 1MO6A 1OH7A 4DCTA 2ZREA 1EESA 3GLHE 1CBUA 2FDCA 3CR7A 4LBZA 4B35A 3N2EA 1XD2B 2O8EA 2QL6A 1VKJA 1M2OB 2NO0A 3AP2A 3K0AB 3Q5EA 4JLVA 5G40A 4V02A 5EZ6B 4DLTA 2WOOA 2IYTA 2ZU6A 1EWQA 2RHDA 1W1WA 3AGQA 4BEBA 2YINC 2EFHB 2QA5A 3DKVA 5JCPA 1Z3IX 2OXRA 2P6RA 4GNKA 1AKYA 3EIEA 1VDZA 2WIBA 3RSLA 3REFA 3B6EA 4WZ6A 2OHFA 2FPKA 1JEEA 1S0UA 5KDDA 1S9HA 3F0TA 3BORA 4NMMA 2IUUA 1QDEA 2BCGY 2CVHA 2WMOB 3FB4A 1T0HB 5FOWA 1XTSA 1Q1ZA 4V03A 3QXJA 1ZMXA 4KFRA 5AUOB 2YWEA 4B47A 2XNSA 1BH2A 4V0MA 1A7JA 4RD1A 4JS0A 2FV8A 4M0LA 5FUWA 3FGNA 1O87A 1J90A 3GCGA 3K9GA 4DDWA 3A37A 2YC2C 3EZ9A 2F1RA 1W49A 4BLSA 1Z6XA 3ZQ6A 1E4YA 5KOYA 3R9WA 2A7QA 4PAMA 3RS7A 4JSYA 2AWNA 2JA1A 3QXHA 1QG2A 3WRXC 5EJEA 3P1JA 4A1FA 2F7SA 4PZYA 4V0KA 3RS3A 2F1JA 1KI8A 2E9SA 3EG5A 5LD2C 1LS1A 3I8XA 3GLHB 3NKVA 5HE8A 2C96A 1JJ7A 1ZM2A 5G3ZA 4F92B 2XTMA 3VR3A 4CT4B 4EPXA 2OAQ1 4GZLA 3LRPA 4G01B 2IYXA 3A58B 1WA5A 2BCJQ 4MDEA 1DAMA 1N2CE 2BBOA 2CL6X 1ZNWA 5IRCD 3U7FB 2FGKA 2BMJA 1TAGA 4DC9A 4TZ0A 5KYKA 3EIHA 4RD2A 4FINA 1GKIA 3AP1A 3CWZA 3FKQA 2AKAB 3VAAA 3O8CA 2F1HA 3BRWD 5EE3A 5KPJA 2BBTA 3G5UA 1B0UA 4ESHA 2NGRA 4XWAA 2HYIC 4JVLA 5G53C 4D6PA 4PZLA 1XJ0A 4L15A 3FOZA 1QHNA 1DOAA 3QVUA 1L4UA 2WHXA 1EFCA 1HURA 3KUCA 3K0SA 2VP9A 5JZVA 2F3RA 2WTUA 2KWIA 1CJTC 1WXQA 4G5GA 1OB5A 1TEVA 4HI0E 1PLKA 1D2EA 3DEFA 5IT5A 3EZ7A 2BOVA 1CR4A 3X1ZA 1SHZA 2ODEA 5KDLA 1OIWA 1G16A 1E2NA 3OE7A 4A8JB 2O0JA 5F98A 3UWKA 3UMRA 1VYUA 5L3SB 3AVVA 1Z47A 3SYNA 2YJTD 2ZRHA 4B6EA 1RYFA 2GVDC 4LBWA 3JZAA 3OF5A 4A0RA 1OFUX 1E32A 1R7RA 3OIYA 3QNUA 4BPBA 2VHQA 1R0ZA 2LCFA 4TLCA 3RVBA 2B8WA 4DWJA 1ZNYA 1Z2CA 3CIOA 1AS0A 3TW8B 4R98A 4RFSA 1YZQA 1DTSA 2QBYA 5TV2A 4Q02A 1VECA 4AK9A 3P20A 3I73A 5JFGA 4JL8A 1RRGA 2WAXA 4Q1DA 4YONB 2NO7A 4IOMA 5FPHA 1G6OA 1VCMA 1AZSC 4IXNA 4RZUA 2Z83A 2GZHA 4TT3A 1E79D 4DLVA 1E2DA 4Q1EA 2G0TA 3KQHA 3SJCA 2XOKA 4NYIQ 4PHTA 2YWFA 3D3QA 2NQ2C 3PUWA 4I1UA 1VHTA 4L5BA 1P5ZB 1AK2A 2RGNA 1YR7A 3NXSA 1HH4A 2IS4A 3BGWA 1E2IA 5CJPA 1I2DA 3IUYA 2AX4A 1U2RA 2R65A 2A5YB 3TJZA 3EPHA 3ZVMA 1D5CA 5B2ZA 4C30A 2IHBA 1E69A 3OFND 3KB2A 2CCJA 3FTQA 2IYZA 4WW0A 2RMKA 2QTHA 5L8VA 2OCYC 1E9DA 3LBIA 1OT3A 5DSZA 4HAWA 1U8YA 1N6RA 4GMDA 4BFWA 5A0FA 2GETA 2GILA 2I1VB 4EPWA 5L3QB 5AUNB 4OI4A 5EXXA 3ONWA 1G4AE 3IQXA 1T3LA 1FMLA 4BFZA 1QF9A 4WZAE 1QVRA 3W3ZB 5K8UA 3WYAA 4MKIA 3L0OA 3CONA 2QZ4A 3C14C 3ZDQA 1XCGB 2B21A 3U5ZB 1JQLB 1ZM4A 4CEHA 4Q4AB 2G1KA 1VCIA 3ZD7A 3K9LA 4RZ3A 3CNNA 1G7RA 1OJLA 3X1XA 1MT0A 3WYFA 1T0JB 4IXMA 1BYIA 1U0LA 3W5JA 4URVR 1HV8A 3N5CA 1OXXK 5CLLA 4M1YA 1MOZA 4E03A 1KNXA 1YR8A 3WYGA 5EE5B 4G5QA 3R20A 4IOKA 3K1JA 1HY3A 5K8IA 3H0KA 1CJVC 2VHCA 2KB0A 3OEED 5EXSA 5FPYA 3U60B 2W6IA 2AR7A 1XEXA 3RNLA 4E5UA 1TX4B 5KPDA 4US2R 1O3YA 2XXAA 1OV4A 1DAEA 4C0AC 1ZP6A 1KK1A 2CNWD 4L9SA 2MSCB 5A5GA 1XCMA 4DJTA 3AM1A 4EQ6A 1DO2A 1EX6A 4M9ZA 4IDOA 4KVAA 1WRBA 4QM6A 1ONBA 2IHYA 4LOAA 1ZM3A 2C9OA 3M0EA 4Q4HA 5D3QA 5EP2A 2J0VA 3D6TB 4C0KA 1NP6A 3GLIB 1OYYA 2H18A 1Q20A 4R71A 1D2MA 4Q4JA 1J7KA 2OEPA 4BZQA 3CKLA 2J3EA 2OFOA 2CCGA 4DT1B 4IDQA 3NH6A 1UDWA 3V4FA 1Q0UA 2V7QD 2PX3A 3MAAC 5DGXA 4D81A 2GXSA 3WBJA 1DG1G 1M7HA 4HATA 1KYIA 2WJHA 2IF0A 3NVAA 4W5HA 5KU1A 1GILA 4KFTA 5GJCA 1WP9A 1W5TA 3LNCA 4DIEA 1X8KA 3ZZTA 1F2TB 3K0EA 1G18A 3K0FB 4JLJA 1Z29A 5B30A 1GRNA 2CK3A 3CF0A 4Q03A 5CITA 1G7SA 3K0AA 4QGAA 4YDHB 1CR0A 3ZS8A 3RRMA 1KY2A 2LKCA 3E1SA 3PUXA 4LPSA 2RAPA 1BYUA 4GSYA 4MKHA 4XVRA 4GRAA 5FOUA 4PC2A 2R6FA 2PLRA 2O0HA 4RKFA 1PLLA 3GLGA 4HZUA 5J4YA 1FX0A 3U4QB 2BJVA 4F4CA 4BFTA 2NG1A 2QP3A 1ZCAA 4L16A 1E4VA 5ANRB 2J0UA 2GCPA 3UMSA 1H8ED 5IF9A 1HUQA 1G7TA 1P73A 4RZ2A 2VHJA 5LDDC 4DLXA 1Q44A 2BHRA 1KJZA 1E1QD 4IVRA 3PR1A 3QKUA 1LFDB 1G291 3NWJA 4N0DA 2EFDB 1EWRA 4NYMR 2C98A 4O0MA 1U0HC 3BXZA 3Q8XB 4KCGA 4DHEA 3FDIA 4M53A 4PZZA 1G9XA 1KNQA 1ZYUA 1H8HA 2ZVQX 1N5KA 1OHHD 3EC2A 3NIBA 3PCRB 1KK3A 2WWIA 4S2EA 3L0SA 1ZCBA 1DAFA 2ZI3A 3RS0A 2A5GA 1JI0A 4IDHA 4HAUA 2KBEA 1U0JA 5FOSA 2XEXA 1NIJA 2C77A 1W46A 1S96A 3AKCA 4ACBA 2BBSA 3Q85A 1OW3B 5JJIA 1ZUIA 1MABB 2B8TA 3QG1A 1MH1A 1QG4A 1XD9A 4XD7A 3VKWA 3AVTA 4CT5A 2NO6A 2N1BA 1IQPA 3OEEA 5GADl 1TQ6A 3QUSA 3SNHA 4QHYA 4A9AA 3LH5A 4QL3A 4R2IA 2PZEA 3KJIA 4IFBA 1OFTA 5JS7A 1DG3A 2BWJA 3RDPA 5HKKA 4IJMA 3CPHA 3THYA 3X1WA 3E70C 1KI1A 4Q7KA 3HYTA 2R62A 5LPNA 2BKUA 3H86A 2YKGA 1YRAA 2DWQA 5M04A 1QZXA 2DFLA 1GM5A 2ZJ2A 2NO9A 3HU1A 2WWWA 1N6HA 5CYPA 2XSZA 1Z08A 3T06B 1XTJA 4LUCA 1XP8A 2VHTA 4A0FA 1SVWA 1GL7A 1G5PA 2HCBA 2AKYA 3DOEA 1RRPA 1ZM9A 4ZI2A 1W0KA 2G3YA 4LI0A 1Q1EA 1T3HA 1US8A 3LBNA 3OESA 4DT1A 5EE1A 1Y3AA 5FOVA 5AUPB 1LY1A 5AJZA 4RVCA 3A6PC 1KK0A 2EW1A 2OLJA 1Z2AA 2VH5R 3ASZA 4A2QA 3ICEA 1P9NA 1U9IA 2QRNA 1S2MA 1VCOA 3SFZA 1Z0JA 1UBEA 4OL0A 2BBWA 3ADKA 2J41A 5BN5A 1RYHA 3FFBA 3QJYA 4HB2A 3OFNA 1HQYE 1YRBA 3PEUA 2ZR7A 2WBLC 2O8CA 3BERA 4ARZA 4NDZA 1DEKA 3U6KA 1WE2A 4Q7MB 2OSBA 3SYLA 4C9BA 2C03A 3Q72A 4K8OA 3ZVLA 2ZAMA 3N2IA 4TMKA 1JAIA 2YZ2A 2JLZA 1AS3A 4GFDA 5LD2B 3WNDA 3EARA 2N42A 4QHSA 3UMFA 1NN3A 2ZUBA 2IYYA 3QY0A 4HEJA 1LB1B 4QHTA 5F2EA 1N6LA 3UIEA 5A4JA 3ETLA 5TDHA 3DM9B 5J4KA 4DSNA 2IA5A 4Q01A 2YV5A 5C2JB 3RHFA 5DISB 1G17A 1WMSA 4TQ9A 1XXHB 1P6XA 2VF8A 3MJHA 3CRMA 4KO8A 4A6PA 3GLIE 2IS6A 1JR6A 3BB1A 2RGDA 2QMUA 1P2TA 3V00A 5GVRA 4PHFA 1D9XA 2BM0A 1XJQA 1R2QA 1AM4D 2Q3MA 3CX7A 1CXZA 3GD7A 3P32A 3LAWA 4HAXA 5FBQB 3RYTC 2ZI9A 1E6CA 4G5RA 4TL9A 4Q7JB 3WMFA 3U44A 3I62A 3QEJA 1IN4A 2ZRGA 4LJ5A 1WQ1R 2W58A 1EX7A 4C0LA 2ODWA 2FPLA 1ELOA 2PT5A 3A1VA 1DARA 4M1TA 4NYMQ 5LBIA 5JWOA 4UNSA 2V4ZA 3AKYA 3IBYA 3GFTA 2B7CA 2X2EA 1HT2E 4MYTA 2G77B 3KB1A 5E7MA 2IXEA 1E99A 5CM9C 3TNFA 1W44A 5B57C 4PTLA 1PUJA 4URUR 1KKLA 4CDGA 4A4DA 4Z1MD 3IQWA 3GJ3A 3VQTA 1S1MA 1F5NA 4B2IA 2RGXA 3K09A 3PV0A 4HLUC 4CEIA 4NP6A 3AF2A 3CLVA 4AYXA 2Q3FA 2ONJA 2XZLA 2YHSA 1OXUA 3L0IB 1KI6A 4URWR 4YLGA 4TMZA 2XAUA 1IXSB 1Q3HA 3A4NA 1GIAA 2AXNA 3T35A 2ZI4A 3D31A 3L8YA 2HLDD 4JBXA 1KMHA 1DS6A 2J59A 1ZW6A 2FH5B 2OUKA 4TL7A 4X8LA 4CEJA 4DSUA 1UEIA 2B6HA 3PQCA 3OEHD 2Q0HA 5EP3A 2Q21A 3RWMB 2Z5FA 4WAUA 5CLQA 3VR4A 4FCWA 1Z07A 1YZUA 3RRZA 4XWOA 4QXAA 4DLRA 2ZE8A 4BLPA 3ZVRA 1HE8B 3KUDA 3PG5A 4JVSB 5CB8A 1Z6YA 2YOFA 4WOPA 4WXRA 3PJRA 2QN6A 2Y8EA 4RSGA 1UDXA 3L0PA 4XOIA 2OCAA 3B1YA 4P4SA 3K0CA 1R4AA 5D3MB 1MRNA 3KTAB 3V4RA 3FHOA 2REOA 4YC7A 3QOFA 4LJ7A 1E3MA 1BMFD 1SVMA 4CEIB 3AF3A 5CK5A 3MMPA 4DIDA 4DDUA 4IKEA 2GWHA 4C2UA 1CEEA 3FMPB 2ZETA 3UKDA 3B7GA 2XB2A 2D7CA 2XTNA 2O8BB 1K5GA 3CF6R 4NYJR 4LHZA 2BKEA 2OM2A 4DLSA 2WWYA 1Q12A 5FTJA 4FD2A 5CK4A 4Q1CA 1XMVA 3ECCA 3EX7C 4UJ5A 3EXAA 3B9QA 4L9WA 3DDCA 4RJLA 1F48A 4OQNA 1W2HA 1E0KA 4QBHA 4BZXA 2CEAA 1UBCA 1XTIA 2OE2A 1N0UA 2NPIA 3WRYC 3I72A 1KSFX 5DHAA 1CKEA 5DI9A 3L2OB 2W83A 4LDJA 1W47A 3LLUA 4MRNA 2QQEA 3CRVA 5GJVC 3I61A 2YC4C 4US1R 4QRHA 2BMFA 4GPTA 4EJSC 3NC1C 3VHXA 2VLIA 1E1QA 2J7PD 3P27A 4G1UC 4XH9B 5FUXA 4A15A 4OK5A 5BXQC 1GOTA 2ZRLA 2QG6A 3LW7A 3W8RA 5JSZA 2O8BA 2A30A 2QTVB 4B2LA 2HCJB 1H8EA 4WBSA 1EG7A 3AVQA 3ZJYA 1UAAA 1NBMA 4PPQA 1NVXQ 2QT1A 4EUNA 5JHGB 5KUTA 1QHYA 821PA 4H1VA 2DR3A 2FX3A 3HR8A 1NVVQ 3TKLA 1W4BA 2ZJAA 2JDID 3MG9A 3NHAA 1CULC 1P7CA 5E4FA 2DFKB 4F7WA 2ORWA 3JVUA 5EXPA 3UG6A 3VR5A 1XDBA 3SBEA 4HDQB 4ARZB 3BH0A 1EFRA 2D2EA 1P72A 2A3RA 2NPFA 1N0WA 4N1AA 5CIWA 4F38A 4YXWD 2A2ZA 4CW7A 4R7ZA 2QAGA 2GA8A 3HJNA 1E9AA 1G7CA 3CX6A 5IK2D 2V3CC 1JECA 4WXPA 3DM5A 2X8AA 3BFKA 1ZNXA 3CR8A 1FTSA 2FF7A 2GF0A 1XMJA 4FN5A 1UFQA 5AR1A 2ZRPA 4EDHA 4JJKA 2ODNA 4XJXA 4AURA 3KX2A 1SXJD 1HEIA 5FPKA 4OQXA 4Q47A 2J9RA 4E07A 2D62A 2RGCA 3QI2A 1FUKA 1L8QA 2ZJZA 1CP2A 1CR2A 2F43B 1F3OA 4FMDB 1G21E 1OXTA 3MD0A 4PSVA 4Q1FA 3SEAA 3HDTA 1U8AA 3QBVA 2EWWA 1NN5A 3THWB 2BMEA 3WBKA 4LBVA 1G3RA 3OIVA 4NH0A 5FBVB 3CO5A 3R7WA 3OIUA 4TMTA 3VU9B 2ATXA 5KNDA 1G64A 5JMTA 2HF9A 1JJVA 1Z6AA 2RH5A 4Q1BA 5E7JA 3AVUA 3PEYA 1E2MA 1PJRA 1G5RA 4G5OA 2ZUCA 3U3MA 3GLGE 4WVFA 1S8FA 3UWOA 5SZHB 3QXSA 3D7MA 1NKTA 1FZQA 2GZAA 4HLDA 1T5IA 2XXAB 1Y63A 2IW3A 4ZCMA 4CVNA 3CPEA 3W8NA 3BAFA 2QY9A 5JECA 1JALA 1NI3A 3C5HA 4GOJA 2JLXA 1E9EA 4DB2A 1ZRHA 1OKKA 1B23P 5BYKA 3H84A 2FEOA 1KDRA 2C9CA 3HPRA 3M1IA 3FKSA 4OHVA 3IKJA 1G1MA 3IPXA 1XMIA 2VSFA 3GJ8A 2VP4A 4RD0A 1LF5A 4XSGA 1I4DD 2UVQA 2W2VA
chains in the Genus database with same CATH superfamily
3WHKA 1QQBA 3F97A 5IULC 4JXZA 4JB3A 3K1ZA 3VHXB 1UUFA 3OJXA 2Z8YM 2AN3A 2BGMA 2G36A 3FUCA 3K94A 2B0CA 5E4TA 5J2UB 3RROA 4AULA 3TL2A 2PL3A 3UBMA 2VT3A 4AO8A 3LXMA 3W3AA 1DBPA 4ZU1X 1ORDA 2PEZA 3CVWA 1OLUB 2A9JA 1Q7GA 3SK0A 3Q5DA 4R4JA 3G2QA 2EWMA 1W8IA 2QE7D 2WVJA 2YVKA 3EMVA 4XLTA 2ZYSA 3ROFA 2W22A 1YULA 5JY6A 3T0IA 2IYQA 1G2IA 3L9XA 5BPHA 5KVAA 3FUWA 2VOEA 1EJ6A 1KZ1A 3G17A 1I7NA 2Y77A 1TQ2A 2ZRQA 1Y81A 3VSBA 1KAGA 3DE4X 3EOAI 5JANA 1N5JA 2WJ3A 2I6FA 1QC5A 1ECGA 5TPZA 3STWA 5AM3A 1F1JA 1HFJA 5K5EA 1EKXA 4NONA 2JAXA 2ZIVB 1LK7A 3FJOA 3WB9A 3DE6X 1WF3A 2J6BA 5FPTA 5H68A 3LCUA 3NYQA 2ZYUX 4WEQA 2VJKA 3WGTA 4BV8A 1E5LA 1JHUA 4OJQA 3ENZA 3ESZA 2FFHA 4PONA 4YAJA 5DMXA 1MDBA 2OCXA 2D13A 4RIGA 1VI2A 4Z0HO 1ANKA 3A9SA 3UZUA 1TYCA 4Y1FA 2YV1A 1KBQA 3MWKA 1VB5A 3T5AA 1E2PA 1AGRA 3H3JA 1FE8A 3L0DA 4BLTA 5HP4A 1F8XA 2MCFA 1GZUA 2X4GA 1J21A 1LBQA 2A78A 4NE2A 4RV4A 4JYPA 5IVPA 5LMCA 1KEEA 2Q2WA 1NLZA 5D84A 1T8YA 2DHCA 3KPYA 3H2SA 3OHMA 2BFDA 1W75A 2I66A 3G85A 4ZVVA 4M8NE 3SX2A 5I7HA 4F9EA 3U4QA 5JS2A 3PFIA 4AMBA 1IM5A 2IZ1A 1QX4A 2REBA 5EMJA 3TFQA 1B8VA 4HLQB 3O47A 2R66A 3G2PA 1MNAA 1V2HE 2NNWB 4CG3A 4FMCB 2JCSA 9ATCA 4FQ5A 4UQPA 2ZRCA 4ZEXA 3WG9A 1SHJA 4N5LA 1DEAA 3VPGA 2I4TA 3WJ2A 1AQJA 3DXYA 2P9HA 2PQMA 1G20A 3V1YA 3ZZNA 2V1UA 2VOJA 3NTVA 1KDOA 3HU2A 3Q9UA 2BEVA 4LMAA 4OA8A 2XVMA 3ER9A 1GUZA 4J03A 4BN4A 4EJSB 4EO4A 2GK6A 3ABQB 7REQA 2E5LB 2X0KA 4MIKA 1NZJA 4PO8A 3DZBA 1BEUB 2JIBA 3IPLA 1Z4PX 2Y1GA 4MRMB 3JTMA 4ZO7A 2PQ6A 1YCFA 2ZS7A 2ZS9A 4H6WA 5HTOA 4V0LA 4JCCA 2J6CA 2IDZA 3H4TA 2OESA 2RHRA 3WTCA 4YRJA 3M5DA 3ZCTA 1C3LA 3GA0A 2OPHA 3TBKA 4DLUA 5KYGA 1HE3A 1JU9A 2H2FA 2VNJA 3IXLA 4IEIA 4US2R 2COKA 2WT4A 3EW7A 4ID9A 4PR0A 1GGKA 5F12A 5JISA 3NHUA 4KQ2A 1LLDA 4GL4A 4K9MA 1JTFA 4MGEA 3GJ5A 4YJ3F 5FI1B 1BCRA 1P8AA 1QH1A 2I4IA 3HGQA 2PZMA 1Z4JA 5EMLA 1ND6A 3HDQA 2D59A 3LQ1A 3B6MA 4HSEA 4U7FA 4UE2A 4LX0A 5ENDA 3LX8A 1V35A 4HO1X 1YB2A 2GA9A 3HCEA 4C3ZA 1CF4A 3B6JA 4C3OB 3MWYW 5DYNA 1X9IA 4AMVA 1VA5A 4OX9Y 4RHXA 3C5EA 3H05A 4N40A 4YMUA 2ZXUA 1PFQA 1Y89A 1VJCA 3G6WA 2ASEA 1BOFA 1P5FA 1THGA 5C4GB 1QF7A 1GQQA 1P0CA 3ONVA 4MQ6A 3ZU5A 1CRQA 4RY2A 1IPEA 2AN1A 4JX8A 4OXQA 4B5LA 1XLVA 3TMAA 4RA6B 2I4MA 4HDOB 1ISSA 2JFOA 3HHPA 4Q34A 4U2DA 5F73A 4MUKA 4ZVLA 1F38A 1KC1A 4ND7A 4MI1A 3QKRB 3UUFA 4CODB 3CEMA 1WPRA 4Q82A 1V8BA 4Q9AA 4UFOA 4C88A 1C3XA 2IBMA 2WU0A 3ZVNA 2Y66A 4Q1VA 4OK3A 4S35A 1WM1A 5AVYA 2QZSA 3BC1A 1C3VA 5A6SB 4BV9A 1IHXA 2NAFA 1N8SA 1OFUA 2CLOB 3B9BA 3N7TA 4NJOA 4B6RA 4EYKA 2I2DA 4W5OA 2PJDA 3D43A 3KZXA 1GNVA 1OFVA 4HWRA 4IXTA 3GLFA 1AUXA 2X22A 1V8DA 1X77A 3NHLA 3QVGB 2OCIA 1DSSG 5BRJA 3CSSA 4EB0A 4X90A 3DFFA 2REXB 1K3FA 5ALMA 3G49A 5DOVA 4FSDA 1O94D 3KDSE 2FA9A 2E5FA 4PYOA 2C2KA 5DYYA 5IDQA 1NG1A 1DQRA 1PW7A 3M2TA 5EZYF 3ZKWA 5ERGB 4HD8A 2QK4A 1N2OA 5BQ3A 1FFXB 2N75A 5K0NA 5REQB 2JFXA 1GYQA 2E3JA 3SZRA 3AHFA 2R4UA 4HVLA 1E4OA 4RW0A 1TKBA 5JCZA 4J1TA 1THTA 5IXSA 1HT3A 4X8HA 4KTVE 1W4CA 1QGED 1UDRA 2H16A 4URYR 4CCSA 1Z4MA 3YASA 2PIDA 2VHZA 5DXJA 4UJ3A 3U4IA 2RHGB 1SUWA 1ZSNA 2IXFA 4GVXA 4JJGA 4TSFD 2YJZA 1JEYB 1QIJA 3IALA 4K7JA 1JPNA 3A1WA 4L5IA 4U9UA 2XLCA 3QTBA 1FNSA 3JRXA 3WWYA 3K8QA 4JXKA 3IT1A 1ZWKA 2R11A 2DY0A 2QOEA 3KS9A 4NNOA 1U98A 4F5ZA 2IH2A 4LMRA 4WDRA 3JWIA 3B5JA 3JQGA 4HQLA 1VIMA 5CT8A 5H3CA 4PG8A 2TSYB 3SVTA 1J5EB 1O9BA 4BVJA 1LNQA 2B2CA 1U9CA 1YQDA 4GC9A 3ZIAA 4JENA 4F6CA 1SXGA 4OH1A 1QAOA 1JYEA 2UVPA 3QFFA 3AXTA 3CW2A 3M9WA 1K4YA 1XOIA 2GSWA 2WU3A 3PDHA 4GGPA 2YJNA 1K6MA 3L1KA 2RB5A 4G1MB 2JI9A 2OP0A 4WZBE 4EB6A 2DFNA 1L1RA 1XLUA 3AM4A 1XRMA 2DBZA 3BMOA 1JXMA 4ND5A 3DWFA 2NU6A 4IINA 4MCIA 3HMQA 1FNCA 2Z3VA 3EG9B 2AJLI 1NBOA 3CCCA 5DW0A 3T41A 1RLTA 2VYND 3VR6A 1CUUA 4CQMA 1DIOB 4TQUS 1GVHA 3ISJA 1QAQA 4ILKA 1N6OA 3H9CA 3WWOA 1U2GA 3W9UA 1R64A 3D3WB 3WLAA 1E2UA 1DUVG 3RT1A 2ZZMA 1M8FA 3GQBA 5M29A 1NNEA 4KU4A 1F1BA 1LDMA 2X6QA 2DWOA 2YNMC 3ETDA 1X7WA 2PTHA 2O4CA 3GV0A 3AINA 2AH5A 1ZL2A 2NZUG 2AOXA 3DAYA 3PDUA 1H65A 3QNMA 4N3BA 4OXKA 3LW8A 4HL6A 1WMFA 2B4KA 5BW6B 3WLNA 3DVLA 1VTKA 3P4XA 5K3BA 2TMKA 3ZHZA 5ECWA 4GVPA 3NBAA 4HQ0A 3PKIA 3KOZA 1PFGA 2E85A 3EAQA 4KN9S 5KNCD 5CFQA 3KWLA 3UA4A 3GAMA 5J40A 3TZCA 1XEFA 3HL4A 2CNLA 2R7KA 4E30A 5B5SA 4B7CA 1D7AA 1SQ5A 1J6UA 4WXMA 3Q9NA 3C7AA 4N7MA 3QIAA 4Z49A 4U4AA 2P2LA 2ZYWX 3EPJA 5KAPA 5DM0A 3EXFA 2QMYA 1JMKC 4FGSA 7MDHA 3V7UA 5J47A 1CUWA 1WCIB 2G9ZA 3EZLA 3O4GA 2ROQA 1X80A 3CXRA 4TKLA 2Q9AA 3GZJA 4WKNA 2EFEB 4ZD6A 1DTWA 1OD6A 1LQ2A 3QV1A 2OV2A 1EXNA 3HUEA 5HFAA 3K8ZA 1VCHA 3VAYA 3MCAA 3GFPA 4J0DA 4KXXA 4LA4A 4NENA 2CBZA 4X1KA 4YK7A 2X19A 4I4NA 2VUTA 5MGNA 3NVKI 1L5YA 1Z35A 1E0SA 4GUDA 1KK2A 5AK0A 2R6R1 4M9QA 1OASA 1W5AA 1BD4A 3N2LA 5K3EA 2I5PO 3THWA 4MR8A 1LVUA 1Q2XA 1M6EX 4QDKA 4DM4A 1QO7A 2OCLA 3E3AA 3K31A 3PNPA 2G40A 1G3UA 2I8CA 1W9HA 4JYCA 1O1YA 3SYTA 4DA6A 3FWNA 4LYJA 4OPMA 4B6SA 4LVNA 1GGEA 1JHOA 4RAOA 3V48A 2C3UA 1JKXA 1B1CA 3EVNA 4OHWA 4LVUA 3QELA 3HSYA 4JI4B 3GQBB 4PLGA 1QF6A 1N6NA 2BZ0A 3ZH9B 4JLUA 2V9PA 3WGUA 1RLUA 2WU8A 4TTRA 3LC2O 5AESA 1ZMRA 2R6DA 1FFDA 3ZH2A 3DHYA 4H7DA 1VHQA 3RBAA 2ZKLA 5C8YB 2D5LA 2EFYA 3G9QA 2OR3A 2VK1A 1PBNA 2VXYA 1CX9B 4WZBA 3WS7A 5BV8A 1EQUA 4P4TA 3FYUB 3E8SA 4WASA 4W1RA 4A36A 2O5CA 3AOEC 4P4UA 3ZE9A 3TXAA 2AZ4A 3PDWA 3M5CA 3GWZA 1VSUA 5MN4A 1NFRA 1TZCA 1I3KA 4WFJA 3QVKA 4I1RA 3ZHYA 1WY7A 2O8VA 2YFHA 3INGA 3TL3A 4HNVA 3V1TC 4RTKA 2LIPA 1MV8A 3I8SA 4BV3A 1DVRA 4UEQA 1OAOC 1TCUA 3SOPA 3ZW9A 4YRGA 1JQEA 2C99A 5I8PA 4GD3Q 3TJRA 2CY0A 3UCFA 2WQ7A 3DMFA 3FMFA 3QEMA 2D1QA 3DGFC 3KJEA 2DKOA 2PLWA 5AM4A 3QPDA 2QDXA 2FMTA 5A4MS 4YQEA 3L6BA 2OORA 5KSZA 4K9QA 2CLLB 2ZJ6A 2H1WA 3CZ4A 3DAPA 2DR0A 2RHJA 1YJXA 5B55A 5AW1A 1YUMA 4YCAA 1Z4KA 1XTRA 1GN9A 2N0SA 3HQ4O 2XBUA 4KGDA 4DSTA 5FTKA 4NCJA 2FR8A 1K88A 1MPXA 3RIXA 5CDSA 4Y9TA 1ZK4A 2OGSA 3NDPA 4FOLA 4HVAA 2XIQA 3HR4A 5AW5A 5DEIA 2WIGA 3HE3A 1EHYA 2JH8A 4KAJA 1EFVB 2GHQA 3K8OE 1PFUA 2MINB 1L9KA 1XXHA 3JAMA 4OSPA 2R1UA 3DEHA 1SZPA 5E6SA 1E3QA 5CB6A 1BE6A 2V03A 1G6KA 1QP8A 1Y34E 2IJGX 1TQHA 2P79A 3UH1A 3MA0A 5L6LB 1I2AA 1OGIA 1RHRA 5T5QA 2VDOB 4YRCA 5ALEA 4JT9A 5LP6B 4BNKA 1P3DA 3RFVA 5L53A 2OQRA 3OPMA 1VIVA 4O33A 1RYZA 1VBMA 3E2PA 4Y9SA 3FVVA 3QGMA 2WZBA 1Y5LA 4HDNB 1NUAA 3ZE0B 4YB8A 4B3SB 2X6TA 3ECAA 3PGJA 5PNTA 2VP3A 2QLMA 5HQTA 4PGMA 1SCDA 4M2LA 3D4LA 1YJBA 5A4IS 3TLMA 1JFVA 1TZ2A 3JD1A 3RYCB 4I5DA 3OETA 2Q3HA 4KRXA 2YMLA 3SMVA 4N54A 2WINI 1EDZA 1LDBA 4P0TA 1RYMA 2RCYA 4X7PA 2HSZA 4LFCB 1TU0A 3RI3A 3HFJA 3ZLTA 1W36D 1WBDA 5ADWA 3SGLA 1V1JA 1R9MA 1V4NA 1Z2NX 2YZ7A 3I42A 3HJRA 4KLCA 4NU0A 2V7PA 3RRXA 5BW4A 3UGJA 1IBRA 4KSBA 2BHTA 1KA9H 1U2GC 5LVAA 4FHGA 2RI6A 1D2HA 1T6NA 3GLQA 4R2WA 5KTKA 2W6ID 4A73A 4DDTA 2JLVA 2VNSA 3B52X 3LBFA 3OHPA 2WT8A 2IY9A 2HEIA 1V16A 4MARA 1KOLA 1Z83A 4Z54A 4UMDA 5D1HA 2Q9CA 2JFFA 3ILSA 2YCBA 1XJCA 2N46A 3UJ7A 5LMUB 4PPNA 1IK4A 1GZSA 3KQTA 2HPVA 3EGIA 4J16A 4ZYXA 2UU9B 1OC4A 1E7SA 2QRVB 3SLKA 3BJMA 2IOFK 4IDAA 4Y6OA 1KO7A 1TTQB 4MZDA 1G8AA 4GE0A 4O1IA 5TB5A 1N2SA 4DSOA 4EF5A 4LY0A 4MB0A 2ZIGA 3IIKA 4J2HA 2HRDA 1C5KA 1NV8A 2N9UA 5EJAA 4KI0A 3H1TA 1YF3A 1AKEA 1EE9A 4AKEA 3HCBA 3JASB 1C7ZA 3VSAA 4BLUA 2Q4EA 4C4ZA 4JMPA 4MGIR 5FTLA 3IXMA 4JLKA 3U9LA 1E7WA 1NVTA 3EDOA 2A0UA 3HCWA 3ZDBA 5UKDA 3U19A 4MW5A 3RC7A 2Y1OA 4ZU3A 4ENUA 4WBNB 2HHJA 2IYEA 1JQAA 2V98A 4ZPXA 5KMGB 1Q15A 2CV0A 2C2HA 1T9DA 2IU6A 4EZBA 5LOVA 3SG0A 2BFBB 5JOQA 5KWVA 3PVCA 3K70B 1EYZA 3GJSA 3WLFA 5DNEA 4MHTA 1A5SB 2QW8A 3M4NA 5FR2A 4RU1A 4ZYLA 2F55A 2UDPA 1P7ZA 3S4YA 1GPWB 2JLBA 2BHLA 4MVJH 4RV5A 1QIGA 2VJDA 2MSEB 4A7PA 4GZMA 3K9CA 1P17A 4PG7A 5ITVA 3ADCA 1Y7HA 4I1SA 1Q14A 3Q87B 2A14A 4L50A 4P80A 3WOVA 3FPAA 3TW4A 1Y8AA 5J4LA 4UDNA 2CMHA 2QRMA 2OBLA 5DKFA 2FZEA 3UB3A 1JBKA 2H2HA 2VJQA 4AYTA 3KYIB 3K5PA 3E18A 3EUWA 3ZUPA 5TNXA 4G65A 5YASA 1XDGA 2C2YA 4I2VA 4LXYA 1IUNA 5IJ0A 3OSZA 1RKBA 3JY6A 4PCUA 4LJAA 4TS3A 2O0MA 3EY4A 1E5QA 4HN2A 1YQXA 2A35A 4IPTA 4FP9A 3ZJUA 3FNRA 5I7UA 1C9YA 3DUFB 4HUTA 4Z6KA 1Y8QA 2XKBA 5HTKA 4Q19A 3WDKA 3C4VA 2OILA 4H3KB 1J0BA 4DR2B 4PGGA 2LV8A 4ASUD 1GZVA 4YALA 2OZLA 1I10A 3H1AA 1JT2A 1ZH2A 4UM9D 3I5UA 3V4VB 4AW9A 1KEVA 3I4FA 4QBTA 3DP7A 2JHPA 3RK4A 4MJ7A 2J33A 1X7WB 5CVJA 1Q16A 5E1OA 4GWGA 3DAOA 4BNWA 2C9ZA 4BBZA 4QGHA 2PXXA 1QC5B 1WR8A 4MLZA 3QFHA 2HTEA 3DDOA 4Z7OB 3L06A 5I48A 1C0LA 4D82A 2RG7A 1OR8A 4YLYA 4DV2B 1W6RA 2H57A 2PRKA 2QQGA 3OZFA 2XUGA 3BMQB 3D1JA 3LY8A 1T5LA 2Q07A 1AQLA 1H4TA 1RR6A 2XQVA 4IRMA 4QOGA 3U44B 1IXZA 2KE5A 3OMXA 3DOIA 3LXRA 1NBWB 1PHPA 1PZNA 4LC1A 3QVVA 4MV4A 2XD9A 4RFSB 2PR2A 3KLBA 4HB3A 3OP1A 4OAPA 2QVLA 4H6VA 4HDKB 1TKAA 1BO6A 1CEXA 2PKEA 3L40A 1DIGA 3N2KA 4FYWA 5JQWA 3P97A 3B1VA 2YWHA 2OCDA 3H9JA 1IG3A 4JUBA 2X42A 3HVKA 4AZ3A 5JD3A 3RRFA 2VK2A 5BT8A 3OQMA 5GONB 4R84A 4Q4DA 1A96A 1IN8A 2Y1KA 3JZMA 2O8FB 3V2GA 1IZ0A 4L8FA 2CDCA 1HZJA 2HYDA 1LK5A 1TZBA 4QNRA 2B20A 1U0GA 3WHIA 4YV1A 1V7ZA 1TKCA 1R27A 2FX2A 1SIWA 2R96A 4Q7EA 5IKXA 1JUDA 2JZNA 1JVBA 1P3Y1 1J2YA 1REQB 1UMBA 3OICA 5AHRA 1Y42X 2IUSA 2EJWA 5EOVA 3PQ2A 3VR2A 5B7QA 2XBMA 4AQYB 1VE7A 3GBSA 3HDHA 3M33A 4ARUA 4BE7B 1FJGB 2VDUE 3F6BX 3U4AA 1BDHA 3X44A 1NNLA 1GSOA 1VKZA 3U7GA 4DKJA 5JZBA 3HDGA 5IZCC 1GZ3A 4JSRA 2EFCB 2B92A 2E87A 4EA8A 5IDXA 5AWFC 3ZE6A 1IJKA 1J33A 1EI9A 1E1MA 3LQ2A 2ZTMA 3ENVA 1KOJA 4GPEA 2NZJA 3MEQA 4R9UC 2DUNA 1MOSA 4BKPA 4GOKA 5BURA 1XD8A 2W6ZA 1UIMA 3LTEA 4MRAA 5IHPA 2OPBA 1GKYA 4CLOB 2B4YA 3G2MA 1SBHA 4DM7A 3PYXA 5JHHB 5FUVA 4TKMA 3MYYA 1P44A 3STHA 5AOBA 2WC1A 5AUQA 3WGHA 1Z88A 5I6DA 1R9GA 2AZDA 2HDNB 1SOVA 3EC1A 3FXAA 4P82A 4B83A 1A9XA 2XGJA 3ZGZA 1OSNA 2GYVA 4HX5A 3STXA 2ATEA 4D9IA 1E9FA 1DAGA 1QV6A 2FZCA 2NWQA 4UASA 4X1IA 5HKBA 2ZTSA 5CLIA 5CBPA 2CLIB 2Q41A 3KXKA 4KYIB 5H81A 1E60A 4A0GA 1KWGA 3VO1A 3B38A 1SKMA 3NYIA 2Q1UA 3A4LA 4K0KB 3VU1A 5P21A 1F3LA 2IYRA 1QHHA 4EENA 3IBCA 5FYDA 5BV0A 2DQ4A 4C0QC 1F6BA 4ZODA 1W5SA 1YONA 4QZVA 3VMFA 4IV8A 4QULA 2Y99A 1T2VA 3EIUA 3I3SR 2YWRA 4XB2A 4ZTBA 1G9TA 3HR7A 5FNZA 4G0PA 3TGPA 1NFFA 1P31A 2W6JD 1ZHFA 2VJAA 2YXDA 3GJTA 3U61B 1FXUA 4R68A 3W4IA 1W1IA 3BWBA 4KNWA 5BXYA 1H3EA 1ATIA 3LC1O 4PHCA 3KXIA 4R1MA 5F4ZA 3Q0TA 5G0SA 1NQXA 1SXIA 1FDIA 2B78A 4KK3A 2NTEA 2H5EA 3P45A 4M9UA 3QF4A 4ZDWA 5TQJA 2RE8A 4MVJD 5EAIA 2Q5LA 3DOFA 3DZKA 2R7NA 1T4CB 3FYUC 2ECPA 3T1VA 1A9PA 1ACMA 1FRVA 5DBFA 4EHKA 4EGCB 4EHFA 2NTYC 4KYUA 4FMCF 3Q3CA 5IXJA 1XEWX 4PPGA 3MQ4A 3UK6A 4KQFA 5CT4A 1N0VC 4G0OA 3FNEA 1Z8FA 4DIOA 4CIBA 1ADFA 1PUXA 3H2HA 1RKQA 3UMCA 1HLGA 1ONNA 1TVEA 1V2GA 3C48A 3OY2A 4UVDA 4R0NA 1RI1A 3RVJA 5F2KA 2HBQA 2ZTUA 3NHWA 2Q5JA 3T9EA 2YIDA 1E5TA 1M2NA 1N2GA 2DGDA 2H1SA 1ZAKA 2PEYA 4ZQEA 3EQ6A 4K9RA 4UNPA 4TRRA 1E1KA 1WLSA 2VAXA 5JSZB 5JJ5A 3H75A 1LU9A 3OTHA 4BMYA 3AEKB 4X7BA 2QX9A 5F35A 4MQMA 2EEZA 1X0XA 2AX3A 1P60A 1W2GA 2LW7A 2WWRA 4MV0A 2DQYA 1L5KA 3BKWA 4YAIA 4ARIA 4PO1A 4PCLA 1W36C 1RAIA 2XUHA 5CCDA 4DRYA 3GZTB 1JEYA 2A1TS 2LCIA 2CSXA 2LE0A 1F8GA 1K7YA 1RWWA 4P3XA 4BXOA 3RBXA 2WF9A 3U17A 1XPOA 3GPCA 3KJZA 4DANA 4DXHA 5L3VA 1SVKA 1G8GA 3GDHA 4O29A 5L45A 1FUYB 1UEJA 1TD1A 1H4VB 3DT8A 1SZCA 3GFBA 3IP5A 4LAFA 2Q8QA 1QG0A 4LJSA 5HQ3A 3I9FA 1Z28A 2ADFA 1TK2A 3PXCX 2NSLA 4L75A 1ABFA 4OQLA 5ADHA 3T1QA 1X7HA 4ETWA 3FHTA 1CHDA 4PC7A 2I62A 1IHYA 1P91A 3X1JA 2DHRA 3V8VA 5A4FS 3JQEA 4MW2A 4GZ3A 1X3SA 2XHZA 2YWDA 3LA6A 4NLLA 5ALJA 3QNWA 2ZB8A 3DDSA 3HI6A 2XT0A 3MS2A 4YRAA 5LLDA 4OMCA 3CNQS 4M0MA 1HDOA 4PFSA 2FMKA 2CMGA 1TM3E 4JLNA 5DTRA 1PT9A 1QQTA 4Q6WA 4W5JA 5TQ2B 5KQPA 1MENA 4UATA 2DVMA 5K3CA 3NHRA 1Q0TA 4IIVA 2XVXA 1LJ8A 2UYHA 4MYDA 2FWMX 1TU3A 3KV3O 1QPGA 3A7DA 2D1RA 2YVAA 4YJGB 5DHFA 1S89A 2AMLA 3CH4B 1P4AA 4B3FX 3RASA 4CUKA 3MF4A 4YJKA 3SBDA 4EBBA 4R5MA 2J3DA 2AD1A 4C6SA 1HL3A 1UK7A 3PBKA 2GYUA 2OP1A 4J6FA 4J94A 3BQNB 3INRA 3O1HB 4M0EA 5BNIA 2GHRA 2C42A 1SCNE 2ERYA 3DL2A 1SU4A 3ESBA 4F3RA 3K8YA 3OF2A 4HB4A 4O3FA 2BGRA 3V55A 4HNTA 5AKZA 3UTDA 2YICA 4OH7A 4RDHA 3BULA 1KYWA 2DY1A 1UXHA 3BHIA 3PENA 3LUJA 3EIQA 4RLHA 2OFPA 4H7FA 4OQPA 1QE5A 4UNQA 3EPPA 3N39C 4FE3A 3ORSA 2VDJA 2X8JA 4LW8A 3B7WA 5A4KA 1ZM7A 1D8TA 3PFBA 4YH1A 5JWRA 2QEQA 4Y9RA 2XB6A 4PNHA 3HGTA 3WY9A 1UL1X 1RQNA 3BH6A 4LXGA 4UNIA 2PD6A 5CEJA 3TK1A 3WDSA 3K92A 4Q15A 1C4XA 3KQUA 5BOVA 1M7BA 4CMKA 4ROTA 1Z6GA 1P75A 3A6DA 1DX4A 4U39A 3PKZA 4TKVA 4DQLA 4O0LA 5E7IA 1VOTA 3KIPA 3TQHA 1N6PA 1WU7A 3PWTA 4NZNA 2R5NA 1JHAA 3MC1A 5EWLA 4D43A 1R5NA 2CLCX 3FNIA 2BW0A 2WFZA 4QSMA 4Z8YA 1H2YA 2ARKA 2E4VA 3OF3A 4M8KA 3O8RA 2ZWMA 4J7AA 2DFDA 3MUOA 1GVNB 1UPCA 3H8VA 2J5BA 3OLVA 1MEOA 1NN0A 4OXYA 2J0UB 2QW0X 1X7XB 3M70A 3N75A 4DCVA 1W52X 5AVOA 4CL2A 3QX8A 2M32A 4IM7A 2IOQA 3SCZA 4B80A 3QW2A 3T7CA 4K40A 3DFIA 2FPUA 3E8XA 3L1UA 1NN1A 3H87A 1XTQA 3L6UA 3Q40A 4N7BA 3IQHX 4O4IA 3AEKA 3DWIA 5FPPA 3R6WA 3ZV4A 2C9YA 1V1RA 3IHLA 3JWPA 3M4JA 2OYCA 1AKWA 2C04A 2GZ2A 3KKNA 3OURA 2WJ4A 3LHDA 1JXOA 3HCPA 4G8CA 1SKYB 2AI1A 3KSZO 4MMZB 1CJSA 1V9CA 2AT1A 5JYDA 3SJZA 1ADYA 4XX0B 2ZRNA 3V1NA 5KYXB 1CJUC 2BR3A 2OG2A 4NBNA 1G63A 1FC0A 1QH8B 5CM2Z 2XCUA 1HTBA 3L1JA 3BMXA 4QEDA 2DPGA 1A5BB 3B1ZA 1BJRE 1AY0A 5DM1A 3R7WB 4AP5A 4BQPA 2A5JA 1F12A 2ZJ7A 3EGCA 4NOKA 4BECA 4MWTA 4ZIRA 1IEQA 1H0HA 1ODTC 3N0RA 4YJFA 5KTRA 3OQNA 4QT0A 3D6UA 4OSOA 2EKQA 1C3OB 1G19A 2OT3B 4C4XA 3PU6A 2YHIB 1ITZA 3QEOA 2W2PA 3PC8C 2WNSA 2HF2A 2BVNA 4H17A 3OBIA 3A6FA 1U0NA 6ADHA 4FFBA 5B1EA 4YY3B 1LRJA 5GINE 5HKAA 4HPJB 2QLFA 3TUJC 4B79A 4B3HA 3JTEA 5JSUA 4HB0A 2PGXA 4FDVA 4YROA 4ABYA 2FHPA 3SM3A 1KU0A 3IOEA 4FVTA 4F8EA 1F5SA 2RSLA 1KS2A 5C7LO 1L8LA 1T9GR 5EPUA 4R6XA 2ZW9A 2I99A 1UJ6A 1U2PA 1VQ1A 4RVFA 1IG0A 3DPIA 1WUHS 5ALFA 4IIXA 3KC2A 2VRCA 3E0XA 4V2IA 2XKAA 1YB6A 3NKLA 1C7RA 3TSAA 5I7VA 5A9RA 1KTIA 1BDMA 2XOKD 3FWYA 4FBGA 1E9CA 2V6JA 2VNAA 1XXHE 2IZOA 4Z7NB 4LG1A 2Q2VA 3CM0A 1TJYA 1SRRA 1Z7EA 4L8YA 1ZBDA 3FDZB 2A9KA 1KVUA 3SI7A 1HC7A 4V1CA 1VE5A 2H4YA 13PKA 1DDOA 4LTNA 2JB9A 1HLDA 5FT9A 4GM0A 1I24A 1CIVA 4OGFA 4JYBA 4AB1A 5FEUA 3I6QA 4HG2A 4MJ3A 5IDYA 2JDIA 4IOLA 1AN9A 5CLJA 4RTOA 3JAWA 1TI7A 1MRSA 5JPIA 1BQ4A 4RJ2A 4UAVA 5ARCA 2GPTA 2XVZA 3NHKA 2W2LD 5BNWA 3ZWCA 2HOQA 3RK0A 5TS2A 4DV3B 3S1AB 3M82A 3P2OA 3GOQA 1F2VA 4WESA 1R6VA 3DBIA 3H5OA 4KR0A 1VIDA 1TA0A 1SD1A 1W59A 2CJWA 3EPLA 1C8BA 2FB9A 3PXGA 2WAAA 2XF8A 5ALOA 1Q6YA 2DKNA 2PBFA 4RK6A 4UUBA 3AGPA 1NMQA 4BFXA 3AL0C 2J45A 3GC6A 5J2TF 4BQIA 2ZPAA 3RUPA 3S2YA 4I4TA 2WYUA 1Q83A 3QTLA 4JLMA 5DNWA 4JASB 4F9GA 3IA7A 3AHGA 1FYEA 1N36B 5J5CA 2ZE5A 3LX6A 1G0NA 4NIMA 3DKKA 3S1AA 1DJMA 3H9EO 4N3NA 4GBGA 1OZGA 2I4OA 4H7KA 4IGFA 2J3KA 4KLAA 4EZIA 2YY5A 2VQEB 1ZN8A 3HCNA 1UMDB 5GAJA 1OXSC 3BGSA 4QQNA 1J2TA 3OAAA 4L02A 4C4PA 4P86A 4Q12A 4DQUA 3E9ZA 3MILA 4ZT3A 3FFTA 5FHRA 3BRWA 3WV5A 3Q7SA 3MELA 3R3ZA 1XX6A 1XZBA 1Q19A 2MMGA 4ZVPA 4GYYA 3L43A 4NDAA 2VA9A 4GP6A 2BAGA 1T1RA 4WEOA 3NALA 4V1CB 2IXGA 4UUPA 1B74A 1VE6A 1Z4LA 4XR9A 1E1LA 1HEUA 2J3JA 1K75A 2VQ6A 3C7TA 4I8IA 5KNLA 1JHZA 3BXOA 4N9WA 4YDQA 3MW8A 2F9MA 3VHQA 1HTTA 1BMFA 2Q3BA 2PRSA 4J4HA 4OJKA 2V7TA 3FRJA 3R5KA 5BWCA 1ZITA 3CG0A 4ENQA 1PG5A 5CXUA 3EPRA 2JW5A 3CE6A 4TSFA 3OCZA 1EB9A 5ALPA 2WAOA 3P0FA 4IDDA 4N7JA 4G24A 4ZCLA 3OU7A 2EYUA 3S81A 3I6YA 1O57A 1TTTA 1PSDA 4LFAB 2ZJ8A 4BCDA 3PEFA 1PBTA 3ANXA 4BLVA 2NZ2A 3R0QA 1D5WA 4P32A 5EQTA 4GDFA 5FULA 4WKPA 1NJ6A 3LVRE 2BGLA 3BOSA 2R8PA 3G7SA 3AEQB 3INYA 2JJ8A 4II7A 4R2MA 1SXJC 3VPAA 4AY2A 1CJMA 4ZCSA 3UAYA 3LGXA 3K3PA 2CNOA 4OHXA 3IS3A 5EIWA 1GQOA 5CFPA 1KI6B 2ZYHA 7AT1A 3D8BA 1E1DA 2A58A 2YQ5A 2E1RA 3D0OA 3LLSA 4LJ4A 4ZZIA 1YS2X 4NL4H 3C6YA 4RJIA 1GKKA 1EGQA 1YIOA 1U0FA 2WDPA 3O4IA 3B3AA 2QUKA 2W2KB 4G4SP 2HDWA 1G8PA 4AFNA 1BH6A 5EA2A 4EKDA 3C6BA 3CW9A 5JFTA 4LJ6A 1TAHA 2QV0A 3TIFA 5AM2A 4OBXA 2REQB 1EDBA 1CNMA 3HDJA 1XZFA 2P2CA 2ZSDA 5K7SA 2C2GA 4QVGA 2ZWVA 2HRBA 3F6CA 1SNYA 3PPVA 3BRSA 1PD1A 5EZ5A 4M8IA 3JSAA 1MC4A 2BM9A 4XJTA 3B1XA 3BGDA 3ROZA 3VX3A 4AZ0B 5C3MA 3A2MA 4R8SA 5DU2A 1T1JA 3C8UA 3QE4A 3A9RA 4P7GA 4TRJA 3HGMA 1ZG3A 3TI9A 2ZZKA 4IGKA 5B2FA 1II0A 4ZO9A 1P2DA 2VYFA 2HX1A 3TIVA 1BWSA 3R5HA 1JZTA 5GWXA 4UZSA 5ICEA 1CUDA 4REOA 1QQ7A 5K8TA 4WX2B 4PNZA 3ZWYA 3KL4A 5EKXA 1U3TA 3GELA 2WE7A 3TSZA 4Q9IA 5CFLA 1P0PA 1R8YA 2ECKA 4H7JA 2L82A 4TS1A 5EPOA 4E15A 2WHPA 2Z43A 4MV3A 3QVSA 421PA 1M1YB 3IH5A 4AP9A 4MP8A 2XSZD 1DKUA 3FD8A 4O4JB 3WLHA 5FIUA 1JLKA 2WMNB 2XUDA 4E22A 1CUJA 1YDWA 4MKRA 1VG8A 3U3OA 1I6MA 3U37A 4CMGA 1AS2A 1TM7E 4D9EA 1J8FA 4FOTA 2ZRBA 3V1KA 1N3BA 2E4WA 3KQNA 3AR9A 1P1FA 4DBLC 2INGX 3T3PB 2H8GA 3V7FA 1KORA 3UYKA 2PZLA 3JV7A 4E6EA 4KGZA 3ZY4A 3NFYA 3QYAA 4MROA 3OZTA 1UKAA 1IOVA 1GNPA 2QXUA 4OV6B 3HG7A 5BQFA 2CFSA 1FU4A 2AI3A 3UMBA 2QAIA 5LB4A 2VEOA 1QKIA 3E9YA 5TEVA 4YT2A 1IXRC 4OHPA 4QXQA 3IAM1 1JLLB 1BCRB 1B8PA 4O1HA 4D9BA 3VVMA 3QE9Y 2ICAA 4NECA 1C2TA 1U2SA 2FMFA 4JKIA 4AY3A 1Z5WA 3AZOA 3C74A 3GGPA 4OJMX 2QORA 3SP1A 1JDTA 2YV4A 4C2TA 5LU8A 3GZ4A 3NC4A 3SZLA 3GRFA 2QL5A 1RWNA 2XV1A 3NKFA 1LQUA 3QWFA 2BISA 4A5OA 1P2SA 4MR9A 4UXJA 1QFYA 1MW9X 2LP4Y 2VSOA 3DZFA 3IVMA 1Z26A 3LP8A 4BO1A 3AV0B 3C8MA 4FGLA 1EUZA 4NJMA 1V6AA 3PXAA 4BNFA 5IT9A 2XITA 1KMHB 2IVFA 4QKQA 3QLUA 3SQOA 3ZE8A 2AVDA 1ZD4A 2WFMA 1A27A 1XD2A 5C18A 2QJRA 1A98A 4GI7A 4BQEA 3NT4A 4HYYA 3UGKA 4JI2B 1M2KA 1QP0A 4E5UA 2QI9C 1DC4A 3IEIA 3ENKA 4RMHA 5I9TA 2B3TA 3AJRA 4CGYA 3MFYA 5FWYB 3SHTA 2P67A 3FCAA 4CBVA 4Y2QA 3M5PA 2Q4DA 3MVEA 4Z3OA 4RTRA 5A3JA 4AUNA 1FP4B 1EVJA 2POCA 3WLOA 4PWYA 1X1DA 2C3OA 2MT9A 3ZDZB 4EJSA 1E96A 1SA0B 4O2BB 4C6RA 3VR1A 2D2VA 3HNPA 4INZA 4LN1A 2OHVA 5CJJA 2PMDA 4YS6A 1L7VC 2C2MA 3DHWC 1G9SA 2WJIA 1YAHA 1R1DA 1U6IA 3WO0A 4NBKA 1ZISA 1RM3A 4D1YA 4YRIA 3AUYA 2REQA 5E9JA 3IXQA 5A5VA 3K6RA 5AK3A 1NM5A 2ISSD 3ICWA 5H9WA 2QD4A 4FONA 1NF8A 4UVGA 3S44A 4HZUB 3NG1A 1FSSA 1WMEA 1I1NA 2ZIZA 3OKCA 1HDXA 4XD7D 5C46F 2P6PA 2V8BA 4UTNA 3U49A 3C0KA 5JS6A 2ZBQA 4BXOB 1S1CA 3H19A 3U13A 4CKWA 2V7XA 4D7AA 2R84A 1QTQA 1TB4A 3GRUA 3F49S 4P38A 1FTWA