3FOZA

Structure of e. coli isopentenyl-trna transferase in complex with e. coli trna(phe)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
305
structure length
305
Chain Sequence
b'ASLPKAIFLMGPTASGKTALAIELRKILPVELISVDSALIYKGMDIGTAKPNAEELLAAPHRLLDIRDPSQAYSAADFRRDALAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTELTQTSGDALPYQVHQFAIAPASRELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPEQARDEVLQVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
publication title RNA-Protein Mutually Induced Fit: STRUCTURE OF ESCHERICHIA COLI ISOPENTENYL-tRNA TRANSFERASE IN COMPLEX WITH tRNA(Phe).
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transferase/rna
total genus 101
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2009-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fozA01
3K70C 1DPFA 3CLVA 1H8HA 3A1TA 2ZS8A 3FMPB 2GZAA 2IXEA 1P73A 4ASUD 1M7BA 1HEIA 1K5GA 2G0NA 3I72A 2G1KA 2DFNA 3EWSA 4KJZA 1G8HA 3U44A 4D0GA 3A4NA 2R8RA 1YZQA 3DDCA 4FMDB 4CEJA 2RGNC 3D31A 4YMSA 5FOUA 1XMVA 3J81k 1GAJA 3KJHA 2ZS9A 5CDFA 4BFYA 3AKYA 2WJHA 4IFBA 2IHYA 2R62A 1T8UA 1HY3A 3HU1A 2AKYA 2BMJA 4GFDA 4MYUA 3QF4B 4UNQA 4A36A 1N5JA 4BEJA 3C41J 3CNLA 1TQ4A 2QM8A 3A4LA 5FTJA 1OHHA 1VYTA 5EE5B 3HPQA 1XMSA 4X8LA 4QGHA 2JLRA 2C99A 4Q47A 2KWIA 3CRW1 4TLBA 1P4SA 3GJ5A 2ZUDA 5AUQA 5GVSA 2C5LA 3KZ1E 2J41A 2OCAA 1CJMA 2WV9A 1GVNB 3G82C 2QBYB 1IM2A 2XAUA 3AKDA 2YYZA 3BB1A 3BOSA 4YMTA 1SVMA 3U4QA 1OFIA 2W58A 1CR4A 1WP9A 4MGZR 4FMDF 1C1YA 3V9PA 1HT1E 4PAQA 2CJWA 3P20A 5FL7A 4B48A 5TMPA 3R9IA 3KXIA 1G41A 1CF4A 3QXJA 1MT0A 1XF9A 4BUJA 1RVDA 3ZIAA 3P27A 1OPXA 2D3WA 1V43A 5J4VA 1EXMA 2IYXA 3HR8A 5CLLA 4P33A 2KBEA 4G1UC 4HLQB 4A15A 3ZD6A 3ZVMA 1OE0A 4KFRA 3U7GA 2ZTSA 1J90A 4IRUB 1XCMA 1OKKD 1KDOA 2WJGA 2O0KA 4DLRA 4LC0A 3CKLA 4ESVA 5JJIA 1U90A 2VHJA 2ZSDA 3IKJA 3N70A 3U3KA 2XOKA 5HR5A 4BPBA 2ORIA 2ZI5A 4MKFA 4Q4AA 1ZUIA 2ZS7A 1E9CA 5FH9A 4DLTA 4XWAA 3A37A 4QGFA 2OSBA 1S1CA 3CX7A 1CP2A 2VO1A 3SYKA 3T5GA 3ZJYA 5KUTA 2ZJZA 2C04A 4FCTA 3I92A 4PHGA 3AF2A 1JQLB 1R0XA 4JLDA 3EG5A 3U44B 2MMCA 1J8YF 2C03A 1GKIA 1IY2A 4NYMQ 1X1SA 3IILA 2ZRLA 4CEJB 4ZDIA 1W0KD 821PA 4DLWA 5DYGA 1M74A 2RHMA 1NN1A 1X8JA 3ZVNA 1YZLA 4DDWA 1A7JA 2OCBA 2QPAA 3OE7D 4RJLA 5E4FA 2ZAOA 3GCGA 5EZ6B 2OEPA 5HZHA 4U00A 4WIAA 3GJ4A 3WP0A 1EWQA 4A4DA 1RYHA 3SJAA 4US2R 1QDEA 1N2CE 1PLKA 2B8TA 2WSSA 4A0RA 4BLRA 1DOAA 3KUDA 2ZXUA 2VPPA 2F1HA 2C96A 1R5BA 4TTPA 1U2RA 2IYZA 3A4MA 1PV4A 1JPNA 3C8UA 1NKTA 3IPXA 3JVUA 4JIMA 4KITB 1R5OA 2QRZA 4EPRA 4DZZA 2VBCA 2V55B 1NG9A 5IT5A 4KLZA 3GLHA 4HLDA 4L5BA 4AKEA 4YDHB 1D2EA 1ZCBA 4ZDKA 3CB4A 2QE7A 3PEVA 3THWA 4QJ5A 1KO8A 2CJWB 3DHWC 4PPFA 3TGPA 4BECA 3K70B 1AZSC 4E09A 3NH6A 2W6ID 3CNNA 3TSZA 2ZUBA 3TLXA 4NYIR 1VG8A 4NHOA 2CNWA 4NYJR 5EXSA 2W2VA 2VRWA 3BWDD 4LBWA 3GP8A 4DLXA 2UKDA 3FVQA 1WXQA 4I1SA 1UKVY 2WWIA 3I4LA 4Z54A 3AGPA 2HYDA 3HPRA 4RFSA 5JHHB 1SQ5A 3GEEA 3W3AA 1GIAA 2CL7X 1R5NA 4KSCA 1W46A 4BLTA 1US8A 3VU9B 1NMXA 3QKSA 1KO5A 3QNUA 2A5JA 4G5GA 4Q19A 5EJEA 4IW3B 1LVGA 2PT7A 2CHGA 5EP2A 2B6HA 3EZ7A 4XD7A 1TU4A 4QNMA 3QKUA 1EGAA 1G5TA 2H5EA 3EIEA 5F9HA 4HLUC 1F48A 5EE3A 2B8WA 1JBKA 1ZVQA 2QP3A 2DWPA 1E9FA 1GRQA 1PJRA 3B7GA 4AYTA 1DVRA 5KTYA 2R44A 3EA0A 4JVSB 1Z6GA 1E2MA 2HJGA 2XJ9A 4DSNA 3O8RA 1G18A 3SE0A 5JLJA 2IS6A 3A8TA 1EFCA 3JZMA 1NVUQ 1MH1A 1R10A 1UKEA 1A5TA 1KO7A 5AJVB 2FPMA 3H2YA 1COWA 1S1MA 2FSGA 2GKSA 1Z28A 1U0JA 2ZRIA 3MJRA 2FG5A 4KBGA 3BK7A 3PV0A 4QRHA 4D0LB 3FMIA 5C2JB 5JZVA 4WZAE 2J0SA 1WRBA 1X86B 2NQ2C 4LJ7A 4BRUA 4Q7LA 4Q9LA 1QBKC 4Y0VA 1UKZA 3FFAA 5B64A 4OQMA 1DAFA 2HCJB 1P75A 1QG2A 4BFSA 5FBVB 3AVQA 2E1RA 1F6BA 1YR9A 2REXB 2IF2A 4WZ6A 3C14C 1PVOA 1MABA 4Q1DA 3T1VA 5DSZA 4PANA 2BCJQ 2I1QA 3MUFA 5DI3A 1B0UA 2J3EA 4Q1AA 3GLHB 3KTAB 4HB2A 5K8TA 2QENA 5HE9A 5CITA 5AUOB 2IS2A 3FDIA 2YV5A 4EPVA 2RB4A 1G4UR 3SC3A 1AZTA 2A9KA 5CDFE 4HAXA 1QHSA 2PEYA 2W83A 2ZRKA 3AF4A 3BRWD 1JJVA 5LBIA 4IDNA 4HLUA 4F93B 3BS4A 1QHIA 4ZDJA 3AUYA 3NEYA 2FH5B 5P21A 4LHVA 3U5ZB 1P9RA 1QHHA 2LWIA 2H8KA 1NF3A 4PSAA 2F3TA 5FTKA 5BWMA 4OQXA 3CZPA 4M9ZA 1VHTA 1VYVA 1S9HA 3HDTA 1LTQA 4RFSB 2HT6A 3MLEA 3OIWA 5CJ2A 3SNHA 5F98A 3TUIC 5KDOA 4Z51A 1YE8A 1SULA 1US8B 2BM0A 4UXIA 4EJSC 1VCIA 1QVRA 1KAOA 3TQFA 4QXAA 2WKRA 4B3GA 4JBXA 1Y3AA 1E94E 1FP7A 1QZXA 4P3YA 4NKRA 3Q7QA 3O8DA 3WHKA 5KOYA 5K8UA 3U6KA 1N6OA 2G6BA 2BKUA 2R6CA 4PHFA 1G7TA 1W4CA 2GF9A 5LB4A 5JJLA 3MD0A 4YXWA 1BMFD 1NVVR 1JQJC 4LHYA 4MYHA 4Q7MB 2ONJA 4BASA 2EU8A 2GVZC 2QI9C 4FCVA 2GA8A 1SVOA 2BIFA 3IBGA 3N2IA 4LJYA 3A1UA 2AX4A 3VFDA 1YHNA 2G83A 2IX3A 1N6RA 4O3MA 1XPUA 2IYYA 5JCPA 5JFGA 3MFYA 1PZNA 1TF7A 2HJVA 3AKCA 3QKTA 2GWHA 2QAJA 1YZTA 4JLNA 3WP1B 2XNDD 5ANRB 3Q5EA 4M1KA 3UMSA 4MUBA 1Z0KA 2Z4SA 3RSLA 4A6XA 1G8PA 2QAGC 3NHAA 1WE2A 4YLGA 3AUXA 1NMZA 4QL3A 3RLFA 3VX4A 4CRWB 1MABB 1E98A 4M1WA 3CWZA 1GILA 1XZQA 3D6TB 1P62B 1XZPA 4JSYA 5GJVC 4EJSA 2QNRA 4MITA 1E0KA 2REBA 4OJQA 4YC7A 3E1SA 3KXKA 3OZXA 3DO6A 4EKDA 2QGNA 2FPLA 1N25A 2ZRMA 1AA9A 2DCUA 2QMHA 3K0EA 5EXXA 4DC9A 2CL0X 4DLVA 3TUZC 2ZITA 3LVQE 4OYHA 4FW9A 4MGKR 3ZVRA 3UK6A 4TYPA 1QHHB 4RCZA 2JLWA 2FF7A 2BJWA 2PLRA 2PJRA 1KKLA 5HTKA 3IIMA 4P4UA 1W36D 2IYLD 2OXCA 1H8EA 2D7CA 4ZI3A 1VYUA 3SYLA 3KJEA 4YMWA 1TU3A 4UNRA 2GRJA 4M1YA 1ZU4A 3GLHE 1YR7A 4LC1A 4A6PA 4QHTA 4QBGB 3RAPR 3RVBA 4CEIA 1SVLA 4QOSA 1CJUC 1QF9A 1UDXA 2JLVA 4JLMA 1MO6A 2J46A 2YWFA 2JLZA 4MDFA 5J4KA 1NIPA 3TAHA 5B57C 1E79A 3EZ2A 3A58B 5FUYA 2F6RA 5HE8A 4FMCB 1G3UA 2VSFA 5KDDA 3V4RA 2XXAA 1UJ2A 2X8AA 1CJKC 4FN5A 2WJIA 4RY2A 2BWJA 3VR4A 3RC8A 2DFTA 1II8A 1NJGA 3FKQA 3C15C 4N1AA 1EFHA 2KJQA 5FBLB 1G20E 1GNQA 5KSPA 8OHMA 2ZYVX 4QFMA 4LHZA 1DE0A 1DG1G 1G8FA 3AF3A 2NZJA 4NPHA 2XSZD 5GVRA 1R4AA 3CX6A 2ZE7A 4DB4A 3EPLA 4PR0A 1XTRA 3BB4A 3B8HA 2GAOA 4MUAA 2A5DA 5KSYA 1IHUA 3LXXA 3MJHA 1JR3D 2CLCX 4HDCA 2VF7A 3B1YA 1OYWA 3FKSD 3SJCA 3B1WA 5AJYA 1UBEA 1GRRA 3NBXX 4UQOA 4Q4JA 4XTCS 3K1JA 4NTZA 4PHTA 5FR1A 1TMKA 3EZ6A 1FL9A 3NXSA 4JKIA 4LJ9A 4EJSB 2FFAA 3L2OB 4DDUA 4IDPA 3R8CA 1R0ZA 1L2TA 1Z6YA 2ZM5A 1M1YE 2GEDA 1KI2A 2IL1A 2O8BB 2FGJA 4GL2A 1L8QA 1BO6A 3TR5A 4Q18A 1T91A 5JI3E 4IHQA 4MYCA 3W6PA 1OXVA 2KI5A 4AKHA 2Z43A 1IQPA 1ODFA 2YWEA 5FUXA 3TK1A 4URYR 4QM6A 4Q7JB 2CE2X 2YOGA 3WY9A 1OT3A 1ELOA 1M7HA 2DBYA 2JCSA 5AUPB 3SYNA 3Q85A 2QY9A 4OHWA 1N0UA 4JLKA 2ZJ8A 3OAAD 1J7KA 4RD4A 2ZIAA 4CEIB 3MSXA 3SFVA 3GLIB 1YRBA 3BH0A 2ZI6A 1UPTA 4QBHA 4ZKDA 4HSEA 4Q4LA 1ZNYA 1XXHB 2P2LA 1AS0A 3U2QA 3GLGA 1W4BA 3VQTA 2K5UA 3DM5A 2XXAB 1RIFA 4PO9A 2VP2A 5FPKA 3I73A 4DLSA 1II8B 5DO9A 5SZHB 3FWYA 4DJTA 2O8CB 3P26A 4JLVA 4KVAA 4LYHA 3B78A 2H57A 4I81A 3KJIA 4MKGA 1Z6TA 4DUGA 3T1TA 3GJXC 1J8MF 3ZH9B 1YQTA 2QP9X 1CIPA 4F4IA 4IOKA 3TQCA 2EWVA 3EPKA 1NNEA 1QG4A 5K8IA 4MDEA 1XRJA 2OG2A 1N6KA 2FEOA 1F3OA 4RFVA 4ARZA 4IEEA 3A1WA 1YR6A 1KTVA 2ZRFA 1D9XA 3QXCA 5IK2A 2F3RA 2Z83A 1SHZA 5LD2C 3OIYA 1SZPA 4Q4JB 2VP6A 4TLEA 3X1WA 1T9HA 1ZC3A 3HYRA 4DCVA 2NO6A 5JRJA 2EFEB 2Q6TA 2LKDA 4ACBA 4WZBE 1ZP6A 4Q9IA 4PQFA 3IHLA 4A2WA 1XD9A 5HCIA 1Q1BA 1G19A 4B33A 2QPTA 2A5GA 2ECKA 5DGXA 2JJ8A 2JJ1D 4LDJA 3TMKA 1EG7A 4CYMA 4WXPA 3VHXA 1Y63A 1DAKA 1E2QA 2RGAA 1T4GA 1BOFA 3TUJC 1XTJA 2CEAA 1ZCAA 2ANCA 1R0YA 3GJ8A 3U7EB 5BN4A 1ETUA 3DL0A 1KI6A 3CBQA 1CR1A 3N2EA 1KK0A 3QF7A 1ZM7A 5JEDA 2D74A 3B6EA 2OLJA 2F1JA 3KKNA 5FPYA 1LY1A 3B85A 1KY2A 4QHYA 3GFOA 2O8EA 5CYPA 1UDWA 1UKYA 4NE2A 3VMFA 1II9A 1U98A 3ICEA 4M9XA 3EPJA 4KFSA 1TAGA 4Z1MD 3QY0A 1GITA 1EFRD 2DB3A 5BYJA 4NZYA 3RDPA 3W3ZB 1R7RA 4HB4A 4R71A 2Z0MA 3THYA 1KYIA 1D6JA 2A2ZA 3LWNA 1M34E 2IYVA 4JKYA 5LPNA 3K9LA 3AVYA 3VX3A 1CR2A 3R9WA 3ZS9A 2FMXA 1Z5ZA 4QM7A 1AM4D 1W48A 2ZRAA 3VNUA 2AWNA 2V7QA 2JATA 4F4CA 1W4AA 3AB3A 4DT1A 2QSYA 2HEIA 5JBQA 5EXPA 2MSCB 2A30A 4KODA 4M1MA 5CK4A 1SVKA 3ZD7A 4ZIRA 2VL7A 1DAHA 3BERA 1TQDA 4V0OA 1CU1A 2RAPA 5B58C 3GLIE 1AGRA 1NN3A 4ARZB 4M1OA 2EYQA 4NCIA 4OKSA 5HCNA 1AKYA 1TPZA 1JPJA 1XXHE 3QBTA 2ZJYA 4IXNA 4B71A 2YINC 4BLOA 2WIBA 4TL7A 5CB6A 2F9LA 2G0TA 2ERYA 3CUEF 5IF9A 1WF3A 4GP7A 4NP6A 2IF0A 5JWHA 4DCUA 2GHIA 3NBFA 3QEJA 2GJ9A 2O8FB 2XNSA 1KKMA 3BIFA 3UATA 5JSZB 3QXHA 2V3CC 1E9RA 4PO1A 4U5XA 5CYOA 1RJ9A 4C0AC 4QKQA 4I99A 4R7ZA 1XTQA 2ZE8A 3AH8A 3CR7A 4JLOA 3EPHA 1IONA 1E1QA 2NO1A 4S2EA 4UJ3A 4HZUB 3SEAA 2ZAMA 3WYAA 4AIIA 4B6FA 1ZM4A 2EQBA 1NL3A 3EXAA 2ZANA 3O8BA 2GDJA 1GRNA 2Z4RA 1P61B 1E2PA 4CF7A 1OLOA 1ESNA 1KI6B 2ONKA 2SHKA 2QN6A 3QQ5A 1VCOA 1II0A 2EFCB 4KAXA 4JVNA 2VEDA 3PUWA 1F2UB 2BM1A 4POAA 5EUMA 3BE4A 3VR3A 2A7QA 3NDPA 2J7PA 1EX7A 3E5HA 1NLYA 1EFUA 2CCKA 4GZLA 4NONA 3ZZUA 4B2PA 4UNPA 3NDBB 1W5SA 1Z6XA 2ZRBA 4EPTA 3P1JA 4PPGA 3D8BA 2V1XA 4OK5A 1AS3A 1SHKA 4URWR 3I62A 3EAQA 1M8PA 2WJVA 1XTIA 5LD2B 1KNQA 4B76A 3CPHA 4TLCA 1FFHA 1JEDA 3THYB 1OFHA 4LZZA 2FE4A 2KBFA 2X2FA 3MWLA 5DN6A 1J70A 2YC2C 4AK9A 4MYTA 4TZ0A 5A4JA 1Z83A 5B30A 1E4VA 3AVOA 2JIZA 3PUZA 4DT1B 3T15A 1RRPA 4NCHA 1Z29A 1HYQA 4KLNA 3IQWA 3OEED 4B34A 1RZ3A 3T35A 2J0VA 4ZIRB 5DI9A 3WRXC 2OBNA 1LFDB 3U3OA 1N5KA 2V6IA 4HB0A 1IY0A 1HQYE 2BCGY 1Q21A 1FX0A 3IUYA 1IXRC 2ASEA 1W4RA 4LJ6A 2OE2A 4JT2A 4ZKEA 1ZW6A 3E2IA 2KSQA 4C2TA 3KQUA 2JDIA 3Q8XB 5GJWC 4NMMA 1UBFA 1ZD9A 3PEWA 2OBLA 5DLQC 2A3RA 2CVFA 2OCPA 4XJXA 1XX6A 5LDDC 2G88A 3RWMB 3EASA 1OH8A 3IIKA 2CHVA 1KSJA 3QVVA 3QBVA 2FZLA 1N0VC 4MRVA 3GLFA 2WPDA 1XCGB 1E2JA 1JALA 1U9IC 1N0WA 2OFXA 4TN1A 1FZQA 5FI1B 4G5SA 5BW8A 4NDZA 2NPFA 2JASA 3VKHA 4K81B 1E0JA 2GEUA 4PC1A 4EFMA 1JECA 1MO4A 5EP1A 5HKKA 1Z0AA 4L9WA 4RZXA 1GOTA 1IJFA 5E95A 4B47A 1TADA 3M1IA 1D8TA 5JRZA 3VR5A 2ZSEA 2XJ4A 1GKUB 1LW7A 4Q02A 2Q0HA 5EQTA 1W0JD 3U7HB 2BV3A 3OESA 2NMVA 3BBPA 3CPJB 4V0NA 3QXSA 2GETA 1T0JB 1N5IA 3GFTA 4MRSA 1W1WA 4NYIQ 1GNPA 1E0SA 2WZQA 3Q9LA 1AIPA 1OH7A 2W6JA 4IDOA 4MRRA 3SJZA 1W2GA 1S96A 5JWRA 1J2JA 4MQBA 4GI7A 2W2TA 1XBTA 4F91B 3VR2A 3TRFA 4NL4H 1DBSA 1HH4A 1TF2A 4LV8B 4QNRA 3ZZ0A 2DR3A 4J0QA 5FPHA 3ZS8A 3K0CA 3CIOA 4C0LA 4KI0A 2YJTD 1KJZA 1OW3B 1LS6A 4Z8XA 1FOEB 2B21A 2ZJOA 1VG0B 4Q1BA 2QROA 2BVNA 1KMHA 1QHGA 1U9IA 3NC1C 4LPKA 4X8MA 1HE1C 3E70C 1FX0B 1S0UA 2ZJ2A 4W5JA 3EZFA 4JMPA 3PITA 4TYWA 2J45A 4F7WA 4LY6A 4BE7B 4M1SA 1DARA 2R6DA 3L43A 3HWSA 3Q3JB 5IHPA 2JJ2D 4II7A 4C0JA 2X77A 4AYXA 1OXTA 1MV5A 1QHNA 4GOXA 5G3ZA 2VTKA 2GBLC 1XEFA 2NGRA 4Q9HA 3LQQA 4PXAA 1I2DA 1L4UA 3IIJA 4ZV4A 1QHYA 1Q12A 5FPTA 3X1ZA 2FSFA 3NWJA 4D0NA 3U4QB 4ABYA 1D9ZA 1H8HD 4EDHA 2WOOA 1DAEA 4P4SA 3WYGA 3PVSA 3OEHA 3GLFB 1N6PA 2CCGA 1PUJA 5J4YA 5TY0A 1G7SA 4DVGA 4TL8A 3AVXA 2ZSBA 1G6OA 4IOJA 2QTHA 4JS0A 4RZ2A 2QMUA 3DOFA 2BMFA 1FQJA 2VSOA 2P6NA 3B5JA 2D2EA 4MKIA 3DVLA 4QHSA 3JZAA 3WMFA 4JYBA 3B9PA 1L4YA 4D4MA 4US1R 5JS7A 4NCNA 3MCAA 1TEVA 3DZDA 2WMOB 1U0LA 3MAAC 3CF6R 1JAIA 1HTWA 2OZEA 1T0HB 5EE0A 1OHHD 4EPWA 2FDCA 1W7AA 3GQBA 4HZIA 2ORVA 3IO5A 4CEHA 2HLDA 3AF0A 4JSTA 4Q4AB 5BYKA 1NSTA 4HAUA 5JHGB 2PX0A 3RS3A 2ZI3A 2RGCA 3WMGA 4KSBA 2GESA 1KDTA 2P67A 2GBLA 4L16A 4TMVA 5H1YA 1KK2A 4MGIR 2JEOA 4DB2A 1KK3A 3U60B 5FBWB 3OF5A 2WICA 4AY2A 3W5JA 421PA 4BZXA 3AVTA 4M9QA 3R20A 2FGKA 3BC1A 4B73A 2BBTA 3K70D 5FL7D 1G7RA 2G77B 4E07A 4F4JA 4NYMR 5TXGA 1G3RA 1I4LD 1Z08A 3ZIAD 2GZDA 5L3QA 1KMHB 1NY5A 2OBMA 1GDDA 3BAFA 3X1DA 1Q22A 1A1VA 1FMJA 2IYSA 2MSDB 2C98A 4Q5IA 1CXZA 3T06B 5A5GA 3I61A 3PUYA 1ZBDA 3K0AA 4TTQA 3RABA 2ODBA 4CVNA 3ASYA 4BLPA 1SXJA 1OH5A 2C9YA 3RRNA 3BD9A 2JLYA 3CRVA 5AJZA 4FI3C 5H70A 3RS0A 1G1MA 2XOKD 1EWRA 1DTSA 2GXUA 4PC6A 5JEEA 1I4TD 1DADA 3CR8A 521PA 1VG1A 4Q00A 1GFIA 3ZQ6A 4G3XA 4P4SB 2PEZA 4PX9A 2DFLA 5M04A 3THWB 1WDTA 2ZRNA 2QQEA 2D4HA 3ASZA 5E7JA 1DS6A 1WB9A 4JLBA 3U3JA 1IY1A 4CT4B 4DSUA 1IXZA 3CW2A 1AKEA 4Q1CA 4DIDA 5SZJA 2NIPA 3OHMA 1LS1A 3K9HA 4LPSA 3O47A 2ZR7A 4M4SA 4G5OA 4MA4A 1R8SA 4OK6A 5FUVA 5B2ZA 5FL3A 3WNBA 2GAAA 4XOIA 4Z8YA 2WSSD 1ZRHA 3PR1A 4KVGA 4R2HA 3QEOA 3QKSB 4Q9KA 1G8GA 4V0LA 1G6HA 4P32A 2CK3A 3WMEA 5FTNA 2ZVQX 1FW6A 4C0QC 2PX3A 3TSOA 4OHXA 4HDOB 4V0MA 3IBYA 4KBFA 5TB5A 4HUQA 4H1UA 1G8YA 2XZOA 3ZGXA 2IEYA 4QBIA 5TDHA 4TQAA 2QE7D 2PLFA 1KMQA 1NBMA 5FR2A 4OHYA 2AK3A 2XGJA 3GMTA 3DOEA 3ICQB 4C2UA 2OFWA 2XTMA 4RSGA 3BFVA 5CIWA 2AN9A 5DH9A 2CNWD 3H4MA 2KB0A 3B1ZA 5JS8A 3KQKA 1NP6A 1R0WA 3BFXA 2IXGA 4HUTA 3LLMA 3K0AB 2ZSFA 3NBZC 2BBSA 4TT3A 5L8VA 4TMWA 3BXZA 1KJYA 3WHLA 2EWWA 1ZUNB 2H16A 2VLIA 3AP2A 1XNJA 1L7VC 4EIWA 5DI3B 2GXSA 2PBRA 1GKYA 4XD7D 5KSOA 4PHHA 1E1RA 1OIWA 2WWFA 4CZ2A 3W8RA 4D82A 2VHQA 2EYUA 3B2EA 3LH5A 2J0UA 5FTMA 4EPXA 4HDQB 4URVR 4IVQA 1XD8A 4C0BA 1FUKA 4URUR 4TYYA 3FTQA 3VTKA 1ZD1A 4LBVA 4F38A 3NBYC 4EFLA 1RRGA 1TEXA 2Q3HA 4JJKA 1JI0A 3Q7PA 3VR6A 5E3HA 4FWIB 3H84A 4IJMA 1GWNA 3NH9A 1COWD 4UKDA 4I4LA 4I1OA 1NVXQ 2O52A 1AK2A 1K8RA 2ZRHA 4AURA 3ADDA 4BLQA 4W7SA 2OUKA 1XB2A 2W00A 2P6UA 3P32A 1VIAA 5AJXA 1NMYA 2NZ8A 4LJ5A 2ZPTX 5G53C 1XEWX 5CK5A 3ZVLA 1E2EA 1AJEA 1G3IA 1LF5A 2IUTA 2DPXA 3SJBA 4DDVA 3WBJA 5ELXA 5KNBA 3LQRA 1G17A 1JAHA 3KXLA 1E96A 1CRPA 1NJFA 2YVUA 4HUQB 2DHRA 2FSIA 4TSFD 5F3WB 2QGZA 4D81A 3QENA 3N5CA 2FN4A 2GK7A 3CM0A 3HJNA 1NY6A 2YNMA 2WM9B 3OFNA 1DEKA 2WSMA 1ZYUA 4LV6A 4R98A 2WBLC 2H1LA 2QPOA 3AP3A 4MRPA 3BORA 4LBZA 2KE5A 4BGDA 2ZE6A 1WMSA 5UKDA 4A0HA 2J5XA 1KIMA 4XVQA 5E7IA 3RYTC 5JI2E 1ZU5A 1BS1A 3T61A 3PEYA 5J5CA 2Z5FA 1XEXA 2IS4A 5J47A 1MO3A 3C4JA 4IDQA 4B3CA 4FMCF 1QHXA 1ZUHA 3KJGA 2FU5C 2ZYTX 5J4LA 4OL0A 2R2AA 3MG9A 1AGPA 2WMNB 5C1BA 4PAMA 4YXWD 1UBCA 5FPSA 1P9NA 2J0UB 2OCYC 1IAQA 2IWHA 2BMEA 2AK2A 2E87A 4D6PA 1Q1QA 4DSTA 4OQNA 5KPDA 2O5VA 5CM8B 1MKYA 2YWGA 4P4TA 2YWHA 4TZ6A 1EFRA 2EW1A 4UNNA 4LYAA 5G40A 3DPUA 3UMFA 5KPJA 1HQCA 4DKXA 2IXFA 1CJTC 1ZNWA 1S3GA 1F2TA 3UPUA 3X1XA 3CO5A 2CLDX 4N3NA 1T8TA 2R6FA 4RZ3A 1YVDA 4QG7A 3LW8A 3B1XA 4K46A 2Q3FA 2BEJA 1XMJA 3Q72A 1KNXA 1FUUA 4ITRC 5DISB 3F8TA 2VYFA 4L15A 1IJEA 2IWRA 5C18A 2P6RA 3CRQA 1T6NA 2V54A 3HU2A 1OIXA 2I4IA 5FOVA 3CF0A 2ZRCA 2ZE5A 3IPYA 2FZ4A 3PEUA 4GBMA 5C4MA 1K6MA 3MWJA 2JLSA 5L3SA 3NIBA 1JB1A 4BWYA 4IEIA 3W9YA 2QT1A 3CRRA 4KFUA 4LSGA 4B2LA 1E2DA 4D4LA 3SN6A 4EUNA 1G7CA 3LBIA 4QJ3A 3K53A 3L0OA 4QJ4A 2HXYA 2JLUA 2BBOA 4GP6A 5KU1A 2R65A 5JCZA 2GNOA 3H0KA 5EUQB 5SZKB 3FGNA 4A82A 1H8ED 2IS1A 4TYQA 3FOZA 4M21A 4JVMA 3KKQA 5TVKA 4ZCLA 3C7KA 1PLJA 3IO3A 4ESHA 2WWYA 1HURA 4TL9A 1G291 4NH0A 5EE9A 3SBDA 5FTLA 1UFQA 4PZYA 4XSGA 4Q1FA 4CT5A 4XWOA 4HAYA 1Q3TA 4M1TA 1SKQA 1IN6A 1KZGB 4UJ5A 2XTNA 2GVDC 3L0SA 1E79D 4HB3A 2B7BA 3KFXA 5IRCD 4WVFA 1N5LA 2GCOA 2RHDA 4ON9A 3LBNA 4A9AA 2R6GA 4PSKA 2BBWA 4OI2A 1PLLA 3RS7A 4C0KA 3ADKA 3KKOA 4PFSA 1OV4A 3G5UA 2ZU0C 3ZYCA 2WWHA 1F2TB 4TLAA 5A0FA 1Z8FA 4O2LA 4KV9A 2RGDA 1ZAKA 2D7DA 4RD6A 4LYFA 2W0MA 1Z06A 1ZD8A 1NG1A 4YMVA 4ASUA 2AFIE 2ZRDA 2IYQA 4ZO4A 5DIFA 3R7WA 3BGWA 3CRMA 1MOZA 2QSZA 2ZYWX 3SOPA 3GLGB 1OH6A 2WTUA 2IUUA 4G5RA 2VHTA 4OBEA 2HF9A 3CH4B 1GM5A 1AQUA 4CGZA 1UEJA 4S35A 5L3SB 3LLUA 1OXXK 2FA9A 4ACAA 3K0FA 4XVUA 1UM8A 3B9QA 3U6BA 1F5NA 1A2BA 2L0XA 3GPLA 2X2EA 3OIUA 2B7CA 4EPYA 1CKEA 4A1FA 2GXQA 1ZJ6A 3LVRE 1E9BA 1QVAA 4CDGA 2ZJ5A 3L8YA 4JVLA 1ZINA 2E9SA 3U61B 3K0SA 1VPLA 2LCFA 1P6XA 2WWWA 2QMOA 3F0TA 1XU4A 1ZNXA 2YHSA 3IEUA 1YZUA 4H9GA 2FJUA 4AG5A 2H92A 2IUSA 4Q9JA 3THXA 4B74A 2HXSA 1X1RA 5EZ5A 1IN8A 2HT1A 1TX4B 1XD2A 2CL6X 2GEVA 3K09C 2ZYUX 4R2IA 3VKWA 2O0JA 4MRNA 2ATVA 1DO2A 1OXSC 3UWKA 2GCOB 2MSEB 3AVVA 5CB8A 2TMKA 2OHFA 3W34A 2W0SA 3W6NA 1KO4A 1VHLA 5GJCA 3X2SA 1EFTA 2AKAB 2XITA 1Z2CA 1XJQA 5CIQA 5KHOC 1OKKA 1VDZA 3EC1A 4DUGD 4C0HA 1Z47A 3ECCA 5J4HA 3KB2A 2QM7A 1FPMA 1UBGA 5AWFC 1KSFX 4RD0A 3REFA 1NIJA 5GJBA 2O8EB 4UNSA 3UMRA 2OESA 2Z6VA 4GNKA 4XH9B 2QBYA 1JNYA 3CWQA 5IK2D 5KSZA 5L3VA 4GRAA 4KYIB 4C7OA 2EFDB 3R7WB 1VKJA 3LX5A 4DBLC 2ODNA 4NU0A 3AKEA 3IDQA 3AGQA 3HP1A 4JL5A 1VECA 1W47A 2GJAA 2D2FA 3TVDA 1W0KA 4BFUA 1RRFA 5EP4A 3QPWA 1YR8A 3PENA 4Q4HA 3KKMA 4PTLA 4BFVA 2EVWX 4JT4A 5JMTA 3KL4A 3OE7A 2RKOA 2CLSA 3AVWA 4W5WA 1RPZA 3K09A 5KYKA 1TTTA 4GMDA 3VAAA 4M0LA 3K0FB 4MGYR 4DHEA 4G0NA 1IXSB 2WKQA 3H86A 4PZZA 1HA3A 2F7SA 1KI1A 1CBUA 2CXXA 4TMKA 1C4OA 1G3QA 1U94A 4TL6A 2HDNB 1ZM9A 2RGBA 4V03A 1UF9A 3I3SR 3MWKA 1D2MA 4JLPA 2AXNA 3EIQA 3DEFA 4AYWA 3NG1A 1OB5A 4UXJA 2GCPA 4LK2A 1RKBA 2V6JA 4RKFA 1E4YA 1C9KA 3GLGE 2IW3A 2BDTA 3UWOA 1Z0JA 4WA7A 2I1VB 1NSFA 3THXB 3BB3A 4M2LA 1B23P 1XD2B 4GOKA 3HYTA 1Q44A 1N6HA 2W6IA 1BIFA 2ZI9A 3A36A 4WOPA 2IA5A 1RJ9B 3THOA 4LV5B 1E9SA 2MMGA 1P9WA 1WBDA 2ATXA 4ZDWA 2XX3A 3K0CC 1OYYA 2FPKA 4Q7KA 2YKGA 2V7QD 2XB2A 4DSOA 5CJPA 5TV2A 4YQFA 5BXQC 2GJKA 3LX8A 1G16A 4KCGA 4B75A 4LGMA 2ZROA 4A0GA 5BN5A 2AHOA 4GOJA 4OQFA 4DEXA 2JLQA 5G3YA 1XPOA 1M6NA 2VHCA 5LB2A 3PUVA 1S4QA 1UAAA 3CH5A 4C7OB 3WNCA 3L82B 4BZPA 3EC2A 4F92B 2WAXA 1ZC4A 4WXRA 4LRWA 5H8WA 1G4AE 5FBQB 3SZRA 2PCLA 3VHLB 1E9EA 4NYJQ 1Z63A 1VCMA 1O87A 4Q4HB 4AD8A 3ND8A 2ZRPA 2W2XA 3Q5DA 4G5QA 1XWIA 2ANBA 1NLZA 1A4RA 2PZEA 1N6NA 1W5TA 3CPEA 3P4YA 1E1QD 2UZ3A 4PQRA 4V02A 1Q1EA 4D4JA 1KK1A 2VH5R 2G9NA 3ADCA 2RGNA 1RE0A 2C78A 4RVCA 1T3LA 3VR1A 2REOA 3KFVA 5KDLA 1Z22A 1R8QA 3B13B 4TTRA 2FFBA 2OM2A 4XWKA 1E2FA 3C5HA 3DMNA 1VMAA 5J40A 3VU9A 5FOTA 2PMDA 4DDTA 4M22A 4C30A 4OQLA 3C5CA 4HYYA 3RSOA 1OSNA 4FCWA 2J7PD 4OK3A 3WBKA 3GD7A 2HF8A 3QG5A 1KSGA 1N3BA 3X1YA 3QXXA 2QORA 1P60A 1NN0A 4WW0A 4BFTA 2V8OA 3B60A 3IQXA 3WYFA 1GUAA 1EX6A 2F43A 3I32A 1Q57A 1U0HC 2QMEA 3U3MA 4GMXA 3K9NA 1TF5A 3PG5A 2PH1A 2OV2A 2NG1A 5DN6D 3HR7A 4LCBA 1W44A 2P5TB 1BYIA 1RC8A 5KNDA 3RS4A 3QKRA 1XDBA 5FUWA 2OXRA 4I1UA 4AC9A 1DAIA 1GL7A 1KO1A 3EWAA 4PC7A 1E2NA 2JIZD 3EW9A 1S9DA 2FX3A 2AXPA 1S2MA 1XJ0A 2RH5A 4TWZA 3QSYA 4R9UC 2R6AA 2N42A 4OHVA 2P3SA 1U8ZA 3I8XA 1SXJC 4DCSA 1J99A 2HV8A 1Z07A 5FI0B 2AL7A 2EFGA 1BMFA 3RRYA 3KTAA 4U7DA 1E2LA 4ZI2A 4D26A 1DG3A 1GTVA 1YJ5A 4IDHA 4L9SA 1W36C 1KY3A 2JDID 4IVRA 2WJYA 3TVTA 2NOAA 1F60A 121PA 2Q21A 3LW7A 3TNFA 1SVSA 2RCNA 4YONB 4QBFA 3WNDA 4C9BA 1XCPA 2QRNA 1Q20A 2XNDA 3CX8A 5DHAA 3I1FA 1KI4A 3TW4A 2BEKA 3M6AA 4CIDA 3AF1A 5F2EA 1NKSA 1OF1A 2WPDD 4Q66C 1IBRA 4ZCIA 4KFTA 1P5ZB 1AN0A 3ETLA 1XTKA 1GP2A 3SBEA 2XZLA 1G5RA 3SHFA 4W5HA 2G3YA 3GJ3A 5HKKD 1E3MA 1Z2AA 2UZIR 3KKPA 3D7MA 4GT1A 4IOMA 1NVVQ 4D4KA 1WBBA 3B1VA 2AD5A 1RW4A 2WVJA 1Z0IA 1VCNA 3LV8A 5IDVA 3F3YA 3SQXA 2F43B 4O0MA 1Q3HA 3SHWA 1T5IA 4Q21A 3SQWA 1LNZA 3DKVA 2N46A 2ZRJA 2JA1A 3SS8A 1KAGA 3SU8A 1R2QA 3ADBA 3QKRB 2NTYC 2AR7A 4LJ4A 4TQUS 2W6JD 2XEXA 3AVUA 2C95A 3GFPA 3TBKA 2ZRGA 1X3SA 3PIRA 4HAWA 2CMKA 3PFIA 3IEVA 1E2HA 3H1TA 3KUCA 4D80A 3I5YA 5EE1A 3NEJA 4BEBA 4DLUA 4FD2A 2CHQA 3RNLA 3RRZA 3WXMA 3TW8B 2D06A 3VKGA 2CBZA 1O3YA 1T3SA 4XVRA 1P2VA 3REGA 3MGCA 2FFQA 5KO2A 2C9OA 1KI9A 2WHXA 4B3BA 2ORWA 1HT2E 4LWZA 3GEIA 1CTQA 2R9VA 5H68A 2N1BA 4BZQA 1KDRA 4Q01A 1ZNZA 1P3JA 2BMDA 3TKLA 4FIDA 4JYCA 1Z0FA 4TSFA 4ZCMA 1CRQA 721PA 3TH5A 2GTPA 3TR0A 3FMOB 3QUSA 2C9CA 3HU3A 3FPAA 4V0KA 2FWRA 4PSVA 1A2KC 1Q1ZA 4CEHB 1T5LA 4YDSA 4L8GA 3QIAA 3GLFE 4PPQA 4BQSA 2QU8A 2IHBA 1E69A 2XSZA 3QJYA 4X8OA 2VP0A 4DCNA 1E9DA 2VP9A 1LF0A 5BQ5A 3T1OA 1K5DA 4W9MC 2IYTA 5FFMA 3SI7A 1DELA 2GJ8A 4NCJA 1JR3A 3OEHD 1HUQA 3RC3A 3AP1A 2Q9BA 3FMFA 2WWXA 3FKSA 4FWTA 4FXPA 4BFZA 2QG6A 5L3QB 1E9AA 3RS2A 3PXGA 3UG6A 2OT3B 3LDAA 2H17A 5K8LA 3O8CA 4HAVA 1NLFA 2DYKA 3V00A 4B3DA 4IFEA 4M9SA 2FFHA 3I8SA 2GCNA 1U8YA 4MKHA 4US0R 2D62A 1YZKA 1SXJB 2JGNA 2VP4A 5E7MA 3MMPA 4ZPXA 1BYUA 4QC2A 2NO7A 4HI0E 2XB4A 2FNAA 1P72A 1R6BX 4H1VA 3G0HA 4DLYA 4O2RA 2HLDD 3AVPA 3BH7A 1P2TA 3GJ7A 3W5IA 2BKEA 2XTZA 4D25A 1W36B 3R8FA 1YKSA 2BHRA 4QGGA 3KDSE 1KDPA 3A6PC 1IOZA 1WCV1 2AD1A 1OFTA 1ZM3A 1GNRA 3DKPA 4FINA 2J9RA 4LHWA 4C3ZA 4HATA 1JXOA 2JAQA 3JVVA 2ZETA 2ZI7A 3OAAA 4GZMA 4HAZA 4LHXA 2NPIA 2Q3MA 3CONA 3LO5A 1VIYA 3I5XA 1U8AA 1V5WA 1T3HA 4GSYA 4Q48A 4URZR 4RCYA 4OI0A 1DO0A 3SDZA 3MRSA 2OLKA 4C4PA 4FMBB 3GJ6A 4JLAA 2EFHB 2PZFA 3UIEA 1HV8A 4XIGS 2RMKA 3W90A 221PA 1SXJD 2FOLA 2IC5A 2J59A 4B35A 2O8BA 2ZEJA 621PA 2OAQ1 3LA6A 4NBSA 3PUXA 1CR0A 3AM1A 3FHCB 1SKYB 2PT5A 2P5SA 2HYIC 1BKDR 4AKIA 1G5PA 2VHUA 4TMTA 5SZIA 1OFUX 1IN5A 1NN5A 2QEQA 3KQHA 5DE3A 1CJVC 4B3FX 4LOAA 4DEYA 5D3MA 2VIIA 3GLIA 3LNCA 5EXTA 3SR0A 2IYUA 1G9XA 3GEHA 1U99A 2QL6A 2QAGA 4BRWA 1XXHA 4A92A 1TQ2A 6Q21A 2J0QA 5CM9C 1EESA 3UXMA 1KI7A 1KI3A 2JJ1A 1S3SA 1ZIPA 1IN4A 1LB1B 1X8KA 2WAYA 3UKDA 4ERNA 2O8CA 2VQSA 2ZI4A 1UADA 5C4GB 3U3RA 2NO9A 2P0EA 1M7GA 1LV7A 2VSXA 2CK3D 4JBYA 1ANKA 4LI0A 4PPNA 4RKEA 2CE7A 1OIVA 2GJSA 4PO8A 1TQ6A 1JJ7A 3ZQJA 2WIAA 4OHZA 5FOWA 3T34A 2Q9AA 2J87A 1U81A 4URXR 1BH2A 1WQ1R 2J1LA 4Y0AA 2A5YB 4GPTA 1NBMD 5FOXA 4KHZA 2CCJA 1ZIOA 4A8JC 4Z1MA 5AK0A 1KSHA 1FQKA 4E22A 1SXJE 3IHWA 3DM9B 2A5FA 2WOJA 1PUIA 2ZJBA 4LX0A 2RGEA 3KX2A 3LRPA 4KO8A 4E03A 2ZUCA 4KXFB 4U02A 2V9PA 1AS2A 4Q1EA 1JR6A 3T12A 3WRYC 1DAMA 1EK0A 4B6EA 2GK6A 3TIFA 3UG7A 5GADl 3KB1A 4TT3D 2BJVA 3MWYW 2OFOA 3NVAA 4TLDA 4B43A 2CDNA 3B82A 2QTVB 2WKPA 2XZPA 4CW7A 2X1VA 4IKEA 2IEZA 5DHFA 3BFKA 2YOFA 3NHBA 2FSHA 1CEEA 4PAOA 4TQ9A 2QA5A 5AUNB 3TE6A 1CLUA 4IOLA 1IN7A 4P31A 4JLJA 2OO7A 5L3RA 1VG9B 1G3MA 3ZDQA 1YU9A 2DWOA 2DY1A 2ZVPX 1E1RD 1JEEA 4LBYA 3ZZTA 1ONBA 3BH6A 2P65A 4HEJA 5AR1A 4DIEA 5HPYB 3R9XA 3DMDA 3QG1A 1WA5A 5D3MB 4HLCA 2JLXA 1FMLA 1TUIA 4IXMA 4G01B 2F1IA 4DWJA 5JJKA 3K9GA 4Q03A 2QAGB 4GDFA 1Z6AA 1FP6A 1RRCA 4KYUA 2NO0A 4A8JA 2UVQA 3LD9A 4RD2A 1GG2A 3NTUA 3A1VA 1DAGA 3U7FB 3LAWA 3RHFA 2H7VA 1SKYE 5BN3A 1KGDA 2QQ0A 4V0ME 1FTNA 4B32A 1XEXB 5FOSA 2ODEA 3A1SA 4LJ8A 5HZKA 4BFXA 3EARA 1NVWQ 1XPRA 1JR3E 4B44A 1NBME 1MR3F 2IK8A 4UXHA 4LYJA 5AJWA 5TARA 3EIHA 3FFBA 4YMUA 4I1VA 1NRJB 1H65A 1KOFA 2ZU6A 1E2IA 1W49A 4DLZA 1SGWA 3NC0C 1MRNA 1XMIA 4RD3A 1OB2A 2BC9A 2CVHA 4D2IA 2RGGA 1Q0UA 2YZ2A 2AFHE 4IVPA 2V1UA 2LKCA 2ZREA 4N0DA 2QT0A 3OIVA 3S1AA 3V4FA 3CZQA 4A2PA 1FNNA 3OFND 1G21E 2QZ4A 4JL6A 3FE2A 1TNDA 2O8FA 4EQ6A 2PL3A 4AI6A 1XEWY 3FHTA 5JSZA 4C0SA 2GXAA 5C46F 1W2HA 1TUEA 1UEIA 2QUZA 3TJZA 4EFNA 3M4YA 3QPVA 3RRMA 4L4UA 1YRAA 4HZUA 2GF0A 1Z3IX 1FNMA 2VF8A 2IT1A 3OEEA 1ESMA 1VTKA 1KI8A 3LFUA 2F9MA 1E2KA 5DNYB 5KNCA 4JJZA 1A82A 1KJWA 1OXUA 2ZJAA 3UANA 1ZMXA 2H18A 3PQCA 1E6CA 2B92A 2O8DA 1RFLA 1F2UA 1CS4C 2I3BA 4XTRA 1MO5A 1CULC 4RZUA 3W8NA 1S8FA 3KQNA 1KHTA 4QGAA 3T1QA 5JECA 2ZSAA 3EX7C 5CLQA 4A2QA 2ODWA 4EAQA 1FTSA 4TMXA 2QP4A 2PZGA 3PJRA 2PCJA 4AWXA 1JXMA 3QOFA 1NI3A 5JWOA 4A8JB 2IBMA 2PJZA 4O25A 1HE8B 4PQYA 3P4XA 1GL6A 3FB4A 4XSHA 4TYNA 4A0FA 4OI4A 1E2GA 1XTSA 3D3QA 1G64A 1XJCA 2F55A 1XFAA 3QI2A 1N6LA 4BLSA 1XP8A 2DFKB 4PC2A 4AG6A 4WBSA 3LBHA 2Y8EA 5D3QA 1GZSA 3F5FA 1MRSA 2HUPA 2PMKA 2G1JA 2ZQ5A 1ZM2A 4JBWA 3AV0B 1QRAA 4E5UA 2OAP1 1KZ7B 3PCRB 3QVUA 2DWQA 5DYIA 3NKVA 5FBRB 1X6VA 4ILEA 2YOHA 3GJ0A 3CNOA 1I2MA 1YZGA 1E32A 3LY5A 2VA8A 3RWOA 5EP3A 4MH0R 1SVWA 3RANA 1W0JA 4X8HA 2ZR0A 3EA5A 4KU4A 1E99A 3M0EA 4B3XA 2F1RA 3QF4A 3S1AB 4M8NE 2C8VA 1M2OB 3L0IB 3TSWA 2C77A 2WJJA 4N0EA 3AEZA 2GZHA 2WWGA 1GL9B 4AKGA 3L0PA 4OJKA 1Z0DA 4EQ6B 2YC4C 3FYHA 1SVIA 2Q9CA 2J7KA 3AQ4A 2OILA 4DRZA 1E0AA 3SFZA 4PZLA 1D5CA 4JZKA 4WAUA 2FEMA 3FHOA 3KQLA 2C2HA 3ND9A 2FV8A 1AQYA 1N6IA 3CF2A 1I4DD 2GILA 3W6OA 1X8LA 2A78A 3DZ8A 4OI1A 2AWOA 4LJAA 3VNVA 3EZ9A 5G41A 3LXRA 1P7CA 1RYFA 3TAUA 4B2IA 3RS5A 2O8DB 2RGXA 3C16C 3ZLJA 2ERXA 2IYRA 4LUCA 1GSIA 1YZNA 2V4ZA 1P2SA 3BJIC 3ONWA 4K8OA 4M53A 4BFWA 2BOVA 4DXAA 4JL8A 3QPUA 3T5DA 4RD1A 4NCKA 2HCBA 2VP5A 2ZR9A 1D2NA 2JJ2A 2QTFA 1OJLA 2X19A 5F9FA 4P0TA 4TMZA 3K8YA 4PC3A 1TL7C 2O0HA 3QE0A 4DCTA 2IYWA 3L8ZA 1P2UA 3IGFA
chains in the Genus database with same CATH superfamily
4M87A 1DPFA 4QICA 3A9UA 1A2OA 3CLVA 4AO7A 2ZS8A 3CGGA 2IXEA 2YCBA 4YBRA 1P73A 5AT1A 3UGKA 2ZTLA 4ASUD 4BNKA 5BVGB 5IFLA 2BM9A 1HEIA 3P45A 5A3VA 2OXIA 2HF7A 1ISSA 2G1KA 2DFNA 3HDVA 3R3JA 4KJZA 3NHRA 4KPUA 4MOWA 2XV1A 1C7IA 3VOTA 3H11B 4B4KA 2H4ZA 3C87A 1J2RA 3DDCA 4FGZA 4FYHA 3P2YA 3CBGA 1SZDA 2FWMX 2X9QA 3HGMA 3LUCA 4H7HA 4LSMA 1GAJA 3WQBA 1UDCA 2BGLA 5CDFA 1OR8A 4RMNA 3N8GA 3ED1A 4IFBA 4KGXA 1VI6A 2IHYA 2R62A 5F5LA 4MYUA 3PNKA 3QF4B 4DR3B 1N5JA 2QX8A 4JFAA 2G5CA 1XTBA 1BOOA 2XA9A 1TQ4A 2QM8A 3C41J 1SG9A 4PTYA 5FBZA 4BB5A 4F8YA 2IP2A 3HPQA 4J9UE 3ILHA 4QGHA 2IUFA 3FVTA 2C99A 1EE2A 4QBTA 3CKKA 3LL4A 1WXIA 1YBVA 3R24A 3BGDA 3GJ5A 5AUQA 3PNSA 2H0QA 2BYTA 2J41A 3P7MA 3R7DA 3PPYA 3K31A 1X7ZB 2X3UA 1WX1A 3AKDA 5J3JA 2C9MA 1XDSA 1SVMA 2FG6C 2VJCA 1K6IA 3LS2A 3OM0A 3EBPA 3K16A 4QOIA 4MGZR 4F84A 5BVHB 3KD3A 1AN9A 3F5MA 3OWHA 1T6XA 4WFKA 1HLFA 3UAXA 5TMPA 3CLRD 4P93A 3HDYA 1G41A 1A8IA 5F73A 4BUJA 1DKOA 4MJLA 3QVOA 2AOUA 1C0KA 4QUHA 3C0KA 1OPXA 3IP6A 1ZI6A 1V43A 3IAEA 2NO4A 4B8YA 3B9BA 4U2FA 2FK8A 1QMPA 4G8CA 4RK4A 4FIZA 1WCYA 3GVIA 2ZT7A 4WOJA 1A4XA 1GZ5A 2ADFA 3ZD6A 2ZCVA 2HIAA 4H7PA 5K0TA 4IRUB 4BHTA 2H5JA 3OF2A 3S8MA 5JH7B 2ENUA 1XCMA 1JTEA 3WGYA 2WJGA 4L73A 5CDHA 3JQ7A 3N70A 1VE7A 4ZP1A 3VV2A 2EIHA 1GEGA 1ILWA 1P39A 1T0UA 5JQWA 4W8OA 2ZI5A 4PGHA 3IPLA 5IYZF 4OVKA 4L0DA 2C5AA 3OSUA 5FKJA 2ZS7A 4XWGA 4PS0A 3KFLA 5DNWA 5YASA 1ND6A 5JJCA 4KH0A 3A37A 2MSKA 5A7HA 3NBAA 1YDMA 5DTMA 2EJTA 3S6JA 3SYKA 3ZJYA 2I80A 3H5WA 4NMWA 3OKCA 3UFXA 4KPUB 3AF2A 2ZB2A 2NU7A 5F33A 4FLEA 1GUYA 4I7EA 4EG3A 2B2XA 1XCBA 2C03A 1HYBA 2B5VA 2H1WA 4YUWA 1AU9A 3KKZA 3U09A 3EXFA 3LQ2A 1Y1TA 3UHJA 1TOAA 4MXDA 4XLLA 2B94A 1C7RA 3C7DB 3ILXA 4UOQA 3NKFA 1PKEA 2B1QA 4JQSA 5ALEA 5LQNA 1FUIA 2QPAA 3ZZNA 4C7KA 2OVBA 5E4FA 5K3AA 3GCGA 6GPBA 2OEPA 2Z58A 3D3KA 4GR9A 3W2EA 2R97A 3GJ4A 1EWQA 4NY1A 4X5OA 3RV3A 1VB5A 1PNVA 3T95A 3SJAA 4IIBA 4ZGGA 2O59A 1H3FA 1N2CE 1PLKA 1E1DA 1NUHA 2WSSA 2ZXUA 2VPPA 1OWPA 1M8JA 4BO4A 4G0OA 1RCUA 3GUYA 3A4MA 1PJZA 1JPNA 4TKLA 2R1VB 3ZWQA 4NPAA 1EDBA 5LLDA 1T2VA 1NPTO 4O4HF 3HM2A 4A73A 4DZZA 3FCEA 2CUTA 4WLUA 1NG9A 3ULKA 3ZOZA 3P0EA 3PQFA 4TLLB 3OO0A 1ZIYA 4HLDA 1WKBA 4B6QA 1XK7A 4AKEA 4E12A 1ZCBA 3AYXB 1BDIA 1CJCA 3AUSA 1D6SA 1MT3A 1B6RA 2FN8A 3PEVA 5F4BA 3T9AA 3LDGA 3GLTA 4F9GA 3V34A 5JISA 4KTTE 4BECA 1AZSC 3ZIUA 3R3ZA 4K3UA 1NPDA 2I5PO 2AOUB 2W6PA 4Y18A 5G4KA 3A2LA 1ZR4A 2G5PA 2VSYA 1VG8A 2B8EA 3OPNA 4G09A 2VWQA 3S8EA 3A6GA 2W2VA 2RCYA 3ITKA 4J7AA 4HC4A 4MUGA 4OMFG 1PI3A 3TQTA 3L7KA 1NW5A 3SC4A 2J3QA 3PTZA 5BPFA 5GONF 3NB0A 2ILTA 3GIWA 4LOLA 3R0XA 4Z54A 5M7EA 3IKVA 4O8CA 1F8GA 1GIAA 4PG7A 4RPHA 3W9UA 3JQ7B 1IEXA 3UMVA 2EQAA 3TSAA 3ZBUA 4DIFA 1SUPA 1NMXA 2QR3A 3GFSA 1PP4A 3QNUA 3RC2A 1KVUA 4DA9A 5EP2A 1K2VN 2E1PA 3TMYA 4XD7A 2AXEA 3F7NA 4G5YA 3SEFA 4QNMA 1CERA 1G5TA 3EIEA 4YMGA 4Z7OB 2QX6A 4WESA 3RJZA 3UFXB 2NU7B 1TM5E 2VPZA 5I9BA 1PJRA 4L5CA 2QVGA 3ANNA 1N2XA 3ZQUA 4EG6A 5CA1A 1QF6A 2P69A 1DVRA 1PCXA 2VH2A 3E82A 3EXFB 4M7RA 4MQ6A 2HJGA 5CCDA 1JILA 3RVRA 4BNMA 1G18A 5TS3A 3SE0A 3O8RA 1K6JA 2IS6A 1J7JA 1EFCA 3HC7A 3O1IC 1R10A 4DC1A 4FP9A 3FPJA 3H2YA 1PVDA 3K9WA 5C2JB 2EJVA 3FCXA 3MIIA 3NYWA 5SY6A 3S2SA 4L2IB 4D0LB 2J0SA 1WRBA 4XIYA 3GT3A 3T94A 4Q9LA 1QBKC 1WEHA 5B64A 2PGNA 1P75A 3KLOA 1M2KA 1QP4A 5FA6A 1JKIA 3W6ZA 3ZK9A 2XOXA 2PAFA 1F6BA 4RTLA 2YMQA 3G79A 3L18A 5ESRA 4PX5A 4Z7JA 5K45A 4KR6A 2HY7A 2D0PB 2CNKA 1K06A 4IQGA 1X14A 2BCEA 4MB2A 4ENSA 1TZMA 3DEKA 4L95C 2BCJQ 3MUFA 4Y9UA 2EKQA 2J3EA 5DI3A 2WTNA 4HB2A 2X4DA 4I4TB 2QENA 4RU1A 3IJPA 4PZUA 5HE9A 4OG2A 3WAKA 4TS9A 4ZODA 3N75A 3T0FA 5CITA 3KD2A 5L3ZA 1SOMA 3C48A 1G4UR 3SLKA 4HGNA 3SC3A 3Q3VA 5CDFE 1T6YA 2PEYA 3LRXA 3BRWD 1P29A 3UK7A 3E9YA 4IDNA 3V3TA 1NU8A 5G4KB 2FMHA 3AFIA 4TS4A 4ZDJA 4W8GA 2M6SA 3WNQA 3X2FA 4RNDB 1RKQA 1DMSA 1NF3A 4FYVA 3WGKA 1DQZA 2F3TA 1N0IA 2GPYA 2XNKA 4ZEOA 3UF0A 5HRUA 3CZPA 1ZESA 4M9ZA 3ITNA 2GAJA 2XQFA 3HDTA 5CT5A 2NTVA 4WKBA 2QJRA 5E6SA 5F98A 1FJGB 4QASA 4N6NA 3MF4A 1T8PA 2C3UA 5KDOA 4UPDA 2NZWA 3E22A 1KP9A 2UVDA 4QJIA 4UXIA 1BQ4A 1NAIA 3NLLA 2J3LA 4OQYA 1VCIA 1QVRA 4JU9A 4WFJA 5DHPA 3KK0A 1KAOA 4A5OA 1QG6A 1QX4A 1OYOA 1Q0LA 2I34A 3IQHX 3KYIB 4FGUA 4B3GA 1TW3A 1Y3AA 3I9MA 4TV8A 4E1BA 4F1WA 1NE7A 5KOYA 1T9AA 1DV1A 2N3ZA 2NXWA 2W70A 4EUHA 4ZHSA 2G6BA 2BKUA 3WGUA 1MAVA 1G7TA 4O2BF 5LB4A 3MD0A 3NHLA 3CF4A 4XLTA 1QTNA 3G5AA 3NALA 4KX3A 4Q7MB 1T8SA 2NAPA 3QU2A 1J97A 1O8BA 5CA1B 1Y82A 2GA8A 3K1AA 5CJJA 4FFRA 1D1QA 1ISJA 2ZYRA 3N2IA 4LJYA 4HNHA 2O57A 2IHVA 2IX3A 1X80A 2WD8A 3GC6A 3GGJA 1N6RA 1MMFB 3W2FA 2EKZA 3IMFA 1KYWA 5JCPA 4D7AA 1U8EA 3IUEA 2HJVA 1XMOB 3WGJA 2MSLA 2XGSA 3FR8A 4JLNA 1QIKA 5EPOA 3SBOA 5B1EA 2PUAA 2Z57A 1IMOA 3MQFA 2D7JA 2GPAA 4HADA 4XQGA 5ANRB 3WK4A 3FWZA 4M1KA 4MUBA 5B4UA 1UDBA 2Z4SA 5LZ2A 1Y4ZA 3GW8A 2X40A 1WABA 4HWOA 1G8PA 3NHAA 4CMCA 4YAJA 1B8NA 4YLGA 3AUXA 3RLFA 4GXQA 3JZFA 1RMTA 3OUUA 3L8EA 1C1HA 4WVLA 3M9WA 4L5YA 3CWZA 4JGBA 2OWEA 1UP4A 1BQ3A 2JFFA 2QNRA 2V6BA 2YY7A 1HKUA 3H2ZA 4LY3A 4MITA 4OJQA 4RQAA 1CF2O 1GLNA 1IE3A 2IIPA 1Z13A 3OZXA 1QGYA 1KOLA 1R27A 2DUMA 3VU3A 2QGNA 2VNHA 3TQIA 2QMHA 2DCUA 3JSXA 2J9XB 3KQSA 4O4LA 4DC9A 3RJTA 4J0FA 3E1GA 1N2EA 2EDAA 2JKVA 2OWDA 3ZVRA 3UK6A 2J3IA 1Q7CA 4DIUA 3BWXA 2ETVA 3ZKAA 3UN1A 4QOFA 4ZO9A 2ST1A 2V96A 4LG1A 4MWOA 1KXJA 4XASA 2TECE 2Y93A 4P4UA 1VZ2A 5B12A 2IYLD 3LJKA 3ZY2A 2OXCA 1UXJA 5E6SB 2JL1A 4MP3A 3KKLA 4PAGA 3QMVA 3SYLA 3QVTA 4AMVA 5IM4F 1OASA 5BV8A 1NXPA 1TU3A 3CLTC 3E22B 4AS3A 5L40A 1KDZA 2QLMA 2NSLA 3B12A 3BM5A 1HC7A 2VFAA 2RH8A 1W5AA 2JAPA 3ORQA 4ZJYA 1U8UA 1KDYA 4ZOLF 5IUNC 2YCLA 1U7XA 4Y3UA 2OK7A 4TV8B 3VPXA 2JLVA 1RDFA 2PXCA 3QW4B 4FDLA 1MJHA 4L3WA 4MO2A 4QDUA 2J46A 2YWFA 4QQKA 2P9JA 5J4KA 3O7MA 4ARAA 1XDZA 3A58B 3EXG2 1GTL1 3MCVA 5HMLA 1G9SA 1G3UA 3G0DA 5KDDA 1U8FO 2YDXA 1P1JA 3HN6A 4FN5A 1ENOA 1S8AA 4ZOAA 3VR4A 4DRYA 1YA6A 2XXAA 1ZRNA 2DFTA 1TVMA 1I4OA 3K1AB 2C0CA 3G2JA 3HR4A 1TYDE 4NS4A 1J8QA 1DT3A 1EFHA 3S44A 3A6FA 4XX1A 2HPAA 5KSPA 1QYRA 4YH1A 1QQ6A 4MCAA 2HI0A 4LHZA 4QFMA 2RK4A 4NU6A 5E0KB 1N1GA 3BK2A 2XSZD 3PL1A 1MIHA 5GVRA 3UYLA 4C6TB 1R4AA 4F3NA 3HM9A 3EPLA 4PR0A 4DLNA 4ZZIA 5D3KA 1MB3A 3R0VA 3ZNPA 4FQ7A 3RG8A 5DULA 1RHRA 3LXXA 1JR3D 2HSEA 5IVDA 4Y2JA 1R15A 3B1YA 2OSVA 2X15A 3PXBA 3AY6A 1PR6A 2C4WA 5AJYA 3M6FA 2IELA 4BRZA 4XTCS 1NR5A 4MW1A 2GCIA 2Q49A 4PHTA 1O6CA 4WXEA 5FR1A 3UMCA 3I9OA 4B8WA 1FL9A 3VZQA 3S1LA 1KPGA 3EDCA 2B5WA 4WUTA 1QS0A 3IR6A 3F5QA 1Z82A 1Q15A 3AEKA 3BE6A 3BWEA 4IDPA 3R8CA 3SMVA 2H85A 3BDVA 1F0PA 5A1TA 4MWDA 2UZ1A 2IOHA 2ASVA 2XWQA 1ARZA 1LJLA 3FKJA 2FZCA 3IDOA 4O4LB 2Y0CA 2GEDA 2ZWVA 3HBAA 4ZVOA 2FGJA 3P9XA 4CIAA 2G09A 1ST3A 3ZEAA 1TA4A 1H2ZA 1GPAA 3NHPA 2P9EA 3HB5X 5FUXA 4GEKA 1M1NB 4AJ4A 4AJLA 4YPFA 3NUZA 1ND5A 1KFCB 5CA0F 4G8BA 1KARA 5BPHA 2PUVA 1CUGA 1Y80A 3WY9A 5JCOA 3EFEA 2JCSA 3H1FA 3QE3A 3TRIA 1EDOA 4ZQCB 1FNCA 1JKFA 1O95C 4XGNA 3QKIA 3ZQKA 3SFVA 1V3UA 5DHTA 1PJ4A 1IVNA 3VPDA 3EF0A 3T1NA 3U3ZA 5FWNA 1ZNYA 3D8RA 2W9XA 4FYMA 1BGXT 1EXVA 2A1TS 2DUUA 1LXCA 3OPXA 4QTTB 4BWVA 1W4BA 3G7NA 1QYDA 3I23A 2XXAB 5FPKA 4JSRA 4XUDA 3DAYA 2IY7A 2P5UA 1YTLA 4NC9A 3JARA 2O8CB 2ZTHA 1RAEA 5FCDA 3GRCA 5AVZA 1OGIA 3TZHA 5AI5A 1T1JA 1HYHA 1ODCA 4BO3A 3H9EO 1YRYE 3R41A 4E33A 2P8JA 3OWXA 3TG2A 4D57A 1DJPA 4KIUA 3TQCA 2EWVA 3EPKA 1VSQA 4CL8A 3JAWB 1NNEA 1PEAA 2C4HA 4R8LA 4UBJA 1Q0TA 1XRJA 2W6OA 1F3OA 1KIFA 2Q50A 2QE6A 4IEEA 4PN7A 1CEYA 3F7OA 1F3LA 2XQIA 3MWDA 3U0VA 4KOAA 2F3RA 1DXOA 1U4OA 3U26A 3VNSA 3DOHA 1KJIA 3X1WA 5CDUA 1WHSA 3BTUA 2QQGA 2EFEB 2Q6TA 4YQZA 5LDGA 4ACBA 2WUEA 1ZP6A 4OMUA 3RUAA 1JKJB 1DBWA 1O95A 4QAJA 3IPRA 1Y37A 4Q9IA 5IARA 3B6JA 3IHLA 3AEKB 2YL2A 3PGJA 5K09A 2H1SA 1G19A 4IIGA 4GZ6A 2ECKA 5DGXA 3WWPA 3CUVA 5MN5A 5KIAA 3R74A 2JJ8A 1AB6A 3O84A 1LPNA 5I3ZA 3TTWA 3JAMA 2B4KA 1Y3IA 1EG7A 1HORA 2O8NA 1CUSA 4REQA 4WXPA 1QRUA 3NIWA 1XG5A 2E5FA 3VH2A 4CKZA 3A1FA 4YJ3A 1C1XA 2RGAA 3UKJA 4GZ5A 5AW3A 4F3YA 2CEAA 1ZCAA 5EJ5A 2G9UA 1ETUA 3DL0A 5K2OA 5LZ7A 3BD8A 3CBQA 4QYTA 1HEYA 2D74A 3VJKA 3ZK8A 4EGFA 2F1JA 3L9WA 4IIJB 4WN9A 1ENZA 2A9PA 1KY2A 2FMUA 3GFOA 3GT0A 4G81A 2O8EA 4MUEA 2WIFA 4UW9A 4NE2A 3T9DA 1C0IA 1GA6A 1L7QA 1U98A 2BDEA 4QX6A 3HCAA 4F04A 3ICEA 5MGBA 3C6XA 3V6MA 3VUFA 3S0JA 4U39A 3QY0A 3IS3A 4OQZA 1EFRD 5IUKC 4G0VA 4GGOA 2DB3A 3VHQA 4KP7A 1QYIA 1UC9A 1U0RA 3UW1A 4DZTA 2Z0MA 2R6JA 2XWBF 4G8JA 4WJZA 4B6PA 3NEAA 5IEJA 2NZUG 4QLBA 4H7IA 1CZLA 2C7GA 4OHMA 3THYA 4MMXB 4MI6A 3R4VA 1I2AA 3IAHA 4ZYUA 1B3BA 2E82A 4WJLA 1Y6ZA 4N49A 3A9RA 4FNGA 4WK6A 3R9WA 4LOJA 1H2HA 1NPYA 1Z5ZA 1Y8ZA 5K3SA 3CISA 2AWNA 4CQMA 2A84A 1LLUA 4F4CA 3HXTA 5DU2A 1NDQA 3AU8A 4G1EB 3EY4A 1JH8A 4DT1A 2QSYA 4O4IA 5JBQA 5BSFA 5B55A 4PFJA 3OLCX 1TFUA 1VKHA 4PY2A 4CM7A 1OC4A 4ZU1X 1FDSA 1DAHA 2GD1O 4V0OA 4ZIRA 3GB9A 3RYCA 4KK4A 3OM9A 2BEWA 1NUSA 3T7EA 2CVZA 3T9FA 2JK0A 3AKZA 4BUZA 2EOAA 1NQWA 2EYQA 4I9UA 3ZBQA 3B36A 1FSFA 1NNUA 1LX7A 1VJ5A 1JPJA 1NC1A 2Q1XA 2QQFA 2ZJYA 3MWDB 5GPBA 3SVZA 2ATIA 4A6DA 3WL3A 4B71A 1AF7A 3BRCA 4X94A 4XYBA 5IF9A 2B34A 3IURA 5LQSA 1YBFA 1TM3E 3K2BA 1WF3A 4GP7A 4BKQA 4QXPA 3U4IA 2BLLA 3HJGA 3QVSA 3QEJA 4UHFA 1TM7E 1L3BA 1X94A 2J3MA 1KKMA 2DPHA 4AU1A 5HP4A 4LZPA 3A26A 3KOMA 3UGTA 3QXHA 1TTQB 1OU4A 1LDMA 1G5HA 1E9RA 1P8JA 4GM1A 4PO1A 4U4AA 4U5XA 2WQ6A 2V3CC 1F4VA 2J5BA 1QJCA 4KI7A 4QKQA 3RIMA 5C1DA 3DMYA 2NYVA 3GYBA 2ZT8A 3AH8A 3EHEA 4OJNA 1DNPA 1GTG1 5GP1A 2NO1A 1JLLA 4MMZB 4REQB 4HZUB 1OI3A 2ODTX 4LXIA 4AJ2A 1FS6A 4B83A 1N3IA 1DJMA 4YJ3B 1C1XB 2HK7A 7MDHA 1Z8HA 2ZANA 1I10A 4KE6A 3W2TA 1UKAA 5FLXA 1GRNA 2Z4RA 1QU2A 1E2PA 2OCGA 1VGVA 2ONKA 4HVAA 2SHKA 4YPVA 3H75A 1R0LA 3RU2A 1VCOA 4BKOA 2XUDA 2NU6A 5J9FA 3I2KA 5CFQA 4WN9B 3S1SA 1F2UB 1EHCA 1T5TA 3HDQA 1TZBA 1VE3A 1B15A 4P98A 5K0LA 4J0CA 1EX7A 4NONA 4GZLA 3GVPA 2NUAA 3B8EA 1SBIA 2I4RA 3AR9A 2ZRBA 5C5EA 4KXUA 3M7IA 3ZCUA 2V1XA 2C94A 3DDOA 3GX1A 1AS3A 4URWR 1VPWA 1HDZA 1V9SA 2JVJA 1OD6A 2DPYA 2BEVA 4FLMA 1KNQA 3HKEA 4Y9SA 5ICEA 4CE6A 4D74A 1JEDA 2Y9PB 3THYB 3UJDA 2KBFA 2FMTA 2X2FA 2DR0A 5KU7A 3H2SA 1JSCA 1XIVA 4QGBA 3S5UA 3E0XA 1VL0A 2PO5A 3VZRA 4AK9A 3PCXA 5C8ZA 4HKTA 2JHFA 2R3SA 3N0XA 2DU8A 1BX1A 1Z83A 2HX1A 1V2GA 2EEPA 4QDXA 2X9LA 2PQ6A 1W5EA 3MAGA 3PUZA 5DX0A 2R00A 4CQMB 2NV6A 4CHTA 4ILKA 4DT1B 1ODKA 3TTXA 3BSYA 4O4IB 1FRVA 4YRBA 3IEMA 1Z29A 3O90A 1MHPA 3G1TA 3IJRA 4YB8A 5E1MA 3OEED 4GMFA 4EYGA 3T35A 4ZIRB 2MYNA 3EC7A 2F8MA 1RLJA 4JOQA 5DI9A 3WRXC 3RYCB 3BMQA 2Z6UA 2F8LA 2PRJA 3TI9A 2BEWB 1EVYA 4Q24A 1GT6A 4OGFA 3O2NA 4MQFA 5BQPA 4NBTA 3VSEA 1PJLA 2G5TA 4IKPA 3K5IA 4CKEA 5I8WA 3LHSA 1DTEA 1XGKA 2ZUWA 4CMIA 4KPFC 3LHIA 1IXRC 2ASEA 3OFKA 4C4RA 1BHQ1 3D2LA 4FN4A 2D1RA 5BSVA 4GWKA 5WRFA 4HO1X 3LT4A 1QYWA 4NU8X 4OFBA 1A9SA 2KSQA 6PFKA 3KQUA 3MJDA 3BTOA 4QQNA 2IEGA 4NMMA 3UY4A 1UBFA 3FWHA 5ALKA 5DBHX 2HMWA 2I78A 2OBLA 2C57A 3H83A 2MINA 3TLKA 3MRTA 1ADYA 1KYZA 5DLQC 4MIEA 2FSVC 4BO1A 3VKUA 2BDUA 3IBCA 1JLLB 1XX6A 5LDDC 2FQ1A 3GFRA 1DKLA 3RWMB 3FNGA 1OH8A 4X9XA 2JH9A 1H2YA 3INYA 4ZQGA 3L4BC 4DAOA 4P3KA 2Z30A 1IWOA 2JGJA 3L01A 2OFXA 3WMXA 3PS9A 1FZQA 4A6EA 2HMAA 2NU6B 1FDVA 3DNMA 2AKEA 2JASA 2Y2VA 5IKEA 1E0JA 4EFMA 3PPWA 1Z0AA 2LIVA 3Q8KA 2JFQA 1T2AA 3HXLA 4RZXA 1GOTA 4FFBA 1M83A 1TADA 1TO6A 1YS1X 4KQ9A 2NUAB 1KEZA 3FNRA 1IQRA 3NWPA 1FFAA 3WRXA 5EQTA 3NP7A 1QRTA 1RI4A 5H4GA 5BNTA 2YZKA 3HRIA 2CW5A 1UFVA 3MPOA 2YBEA 4MDYA 3C8DA 3N2GA 3CPJB 4V0NA 2NSDA 4QLOA 1BFDA 3HKEB 1E5DA 4O6VA 3GGDA 4N40A 4NYIQ 4ZAFA 3RO7A 3WOVA 4DPKA 4EY8A 2XZDA 1H6AA 1NJ5A 2QV7A 2WZQA 5TSDA 3WKAA 1SQ0A 3Q9LA 4NULA 2W6JA 1EFAA 5EIBD 4M1QA 5BSKA 1CUDA 2H1VA 2OBFA 3E9QA 4KAFA 4JEIA 5F3RA 1MIOA 3NASA 1YF3A 1BCRA 4Q39A 2PR2A 4QUAA 3VR2A 1FDOA 1QE5A 2FSVA 4HGZA 1AD2A 1DBSA 1Q7TA 1KVSA 3JVEA 4LV8B 1OLXA 2EJWA 4BNHA 3ZZ0A 1Z5OA 3BMQB 5FPHA 3ZS8A 4UFPA 4ML3A 4WQMA 1IZ0A 1LS6A 3C3DA 4PIVA 3L4BA 2ZJOA 2CHFA 3GVXA 4ZMSA 3GZTB 3TO5A 1YZ3A 1I3KA 1KMHA 4KGZA 4CKEB 5D3ZA 1HE1C 2JKYA 4ZAYA 3T7JA 2C88A 3SSMA 2VZLA 3KM0A 2IU0A 1NXXA 1X42A 3OE5A 3PITA 3ZLTA 1G55A 4CIYA 1KEUA 1QH8A 3V46A 4LY6A 1I5EA 1LLQA 3I64A 1K3UB 3OX1A 4YP9A 2FUEA 4WSOA 1QHEA 3QPBA 3TL6A 4Z2YA 2X77A 3VZCA 3EQZA 1X2EA 2PLAA 4NRDA 1QHNA 1RQ7A 1IZZA 1TMOA 2P2ZA 3OPYA 4P5PA 5IKPA 1XEFA 2MINB 3NYQA 4HR7A 1D4AA 5CNIA 4DA6A 2PZ8A 4AS1A 4QUJA 1I2DA 3IIJA 2PL1A 4R69A 4OM8A 1QHYA 1Q12A 5FPTA 3CSSA 2TSYB 3MELA 3U4QB 1VMIA 2WOOA 2C84A 1D4OA 3WYGA 5FNZA 3C1AA 3T9BA 3WGTA 3H05A 3K4QA 4FC6A 1YOVA 3AI3A 5BQFA 4FXOA 3JR7A 4TL8A 2OGUA 4HNGA 4OXQA 4OP2A 2K87A 1TK3A 1H4TA 2P6NA 3OM1A 2A67A 5ECYA 5ILGA 1PBTA 4E6PA 3R9KA 2PYZA 3UB2A 4YV0A 1ZAYA 4PXSA 1E5QA 2HH9A 1NASA 1J9ZA 1NZDA 3MCAA 4DR7B 5BMVB 2WMOB 4L50A 3RHSA 3YASA 4E08A 5K4GA 2F9FA 1HTWA 1NVEA 1P1KA 2G8LA 3I5MA 1B7GO 3RG2A 3EW7A 3SXJA 3EGCA 5FXMA 1W7AA 1NW9B 4GMKA 1YQGA 4BX8A 1WPXA 2RFLA 4HZIA 5NULA 1BW9A 2NSHA 2HLDA 4N41A 5F1PA 3WLSA 2WUFA 2OCKA 1EBFA 2OQRA 1G0NA 4NMHA 4MRMA 5L51A 2OOSA 5CXQA 2RGCA 1MIOB 1KDTA 1OX5A 3PQDA 1CY1A 1BCRB 3QYJA 5H1YA 4FOOA 4A8TA 4A10A 3AL2A 3OF5A 2WICA 4S1TA 1OLXB 4UZFA 4E4RA 5KKCA 3AVTA 3H5OA 1M2WA 4YRPA 3OZIA 3ZZMA 3EEIA 3JQDA 5EXEA 2BFEB 1EZ4A 4TTJA 2CJPA 2G77B 1E60A 4E07A 4NYMR 2TS1A 4R68A 4F4JA 1Q95A 5ICMA 1Z08A 2WG2A 2GZDA 2RBGA 1KMHB 3I2IA 1TT5B 3PFHA 3G3EA 1JP7A 4ZO8A 1OROA 3W78A 5LJIA 5A6SB 2FSPA 4F6CA 1G2PA 1FMJA 2MSDB 4Q5IA 5JNUA 3P9QA 4UFNA 1QH8B 1AURA 1DUIA 2JZOA 3CVXA 3K0AA 4TTQA 4YJFB 4FYXA 1V8FA 2ZIFA 5FI5A 5B7QA 5I4KA 1SXJA 2QRMA 1OH5A 1YI0A 4UCWA 2H7CA 3BF7A 3E0QA 2BFFA 4KWHA 2ARKA 1CETA 4CIXA 3CRVA 3EGVA 3KR9A 5H70A 3RS0A 4BMVA 3R7NA 4F4FA 4HOYA 1M0EA 2GXUA 1X7XA 1I14A 2NWQA 3HU5A 4IHJA 3CR8A 1EGQA 3TLJA 2XVAA 4YRJA 4LI3X 3B6IA 3PBKA 4Q00A 4CCAA 2WVGA 2X8WA 3ZQ6A 4E14A 4WOCA 4A3SA 5I8PA 3V97A 2WILA 3AILA 4ITUA 1YOVB 2ZRNA 1JVSA 2YMLA 1O9BA 5GM2A 1SRQA 3RF7A 1JKXA 1SWVA 4EB6A 2JS7A 2AN4A 1XAHA 2PX5A 3H3FA 4PTZA 2XVMA 4Y2TA 4L07A 2QMYA 1CZNA 1J49A 2GZ2A 5EKUA 1GGJA 4PYRA 3WYBA 4WN3A 1J2EA 1BX0A 1IXZA 2IEBA 3CW2A 2F17A 4LXHA 4Q1CA 3ZHCA 2AN3A 3MTDA 4RORA 1V11A 5JW6A 1EK5A 4XWYA 1EVLA 3ZXXA 4EAAA 1A77A 1YA8A 3GFBA 3KPVA 4G5OA 1CY8A 4MA4A 3EZNA 3N0RA 1IUOA 2GAAA 5CP8A 1IG3A 2OPBA 2RJOA 2WSSD 3EH2A 3PR1A 1RP7A 1XQYA 4MVYA 3U0BA 1G8GA 4J1SA 4NIMA 1BW9B 2YVLA 3J7TA 4V0LA 2WU0A 1G6HA 4P32A 3WMEA 1JFRA 1FDTA 2AEJA 4EHAA 3RB8A 1RPAA 2OZPA 4EW3A 4C0QC 4RW0A 4Y2YA 1ISGA 2GVNA 2ZBVA 5EJ6A 2UYOA 2OP0A 3I5UA 4HDAA 4KBFA 3M8KA 4FOPA 3V1MA 1ORVA 4H1UA 3PK0A 2IEYA 4CFSA 4RVNA 2EBWA 1WOYA 3CEHA 5F5NA 3LWBA 5HF5A 4B4WA 1T26A 2AK3A 3OQJA 3FCSB 5CT8A 1ESEA 3GMTA 3HUUA 4E2YA 4AMGA 3ICQB 4C2UA 4C08A 2OFWA 4ZTBA 4ZEMA 2XTMA 2ZJ6A 5B2EA 3BFVA 2AN9A 2Q29A 4KACA 2GEKA 2D0DA 4P6VF 3K96A 5A9SA 1JHMA 4NVRA 5JS8A 3KQKA 3K1TA 2JHGA 1XTPA 1EVQA 1YR3A 2RHRA 1YJ8A 3KZVA 3ZDFA 4OEHA 4G2NA 4ENQA 3K0AB 1N5MA 2DVMA 3L1KA 2Y1LA 3BZBA 3GGGA 4BV3A 2B99A 5E6UA 2Y67A 1NFQA 1EVIA 4EKIA 4P0QB 2BFFB 3HH8A 4BMXA 5LQMA 1YMUA 4B1FA 4OH1A 2P9QA 1L7VC 4IHJB 2PG3A 4V0RA 3WA7A 1EVJA 2IQ5A 1TZCA 4JI1B 2PBRA 4RX1A 1SC4A 2VYNA 4XD7D 3RIGA 5KSOA 4XEHA 2BMAA 4ARCA 1E1RA 1OIWA 2WWFA 1M5TA 4U7HA 2VHQA 4EITA 1IULA 1SOWA 3ROFA 1UQUA 1IEQA 1L9XA 3LH5A 3ONNA 3OWOA 5EJ7A 2WHQA 4F9FA 4URVR 5ADHA 1A8PA 3GGPA 4ZZ3A 4URUR 3EUFA 5CA0A 2PSFA 4ND6A 3SM3A 1C9JA 4EGQA 4EHNA 1V26A 5LXTB 4LRXA 4ZANA 3VR6A 2YWDA 1OBCA 3GO4A 5FWYA 3ZGLA 3S99A 3SJ7A 4UKDA 4I4LA 4I1OA 1V16B 1V11B 2Z1NA 1NVXQ 1AK2A 3GJTA 2JJMA 2OUKA 3GLSA 2P6UA 4MLZA 3P32A 3CJRA 1Y5NA 2NACA 1ESZA 4C43A 1CUCA 1XA4A 5KWJA 3LX4A 3QGMA 2I3GA 1ODSA 2HFKA 4LJ5A 4AM8A 1N32B 2ZPTX 5DGDA 3WFZA 4RTJA 4B82A 4CODB 4DJJA 3IVRA 3NO4A 2XECA 1SCQA 1AJEA 3SJBA 3ZE7A 1CHNA 1UP6A 2K7ZA 4DLLA 5A06A 5ELXA 1E8MA 2EFYA 3UWMA 3HN7A 1E96A 1TO1E 4MVJE 3BL8A 3D7KA 2EP8A 1ECFA 4BEWA 1JQEA 4XXHA 3E8MA 2XMPA 4E31A 1KJNA 1RSZA 3FUWA 4GP9A 1IHXA 1FU7A 4R81A 2AOXA 2QGZA 3CB2A 3QENA 3EVEA 3MS2A 3T9CA 1NVFA 3TZCA 5A4MS 3L8FA 5HZMA 3NTVA 2GK7A 1J2TA 1YA4A 4U63A 1TYZA 3DT8A 2ON6A 2YUIA 1Y9DA 4IV5A 1DEKA 5ELMA 5A9SB 1U65A 5AK6A 4GZ3A 2QN9A 2DY0A 4K9DA 4AP9A 3TCXB 5EESA 3BORA 1VLJA 1NVAA 3Q7TA 4LBZA 5HUHA 3EOZA 4ZFNA 5UKDA 2J5XA 4YT8A 1UBJS 1Y3FE 3KWFA 1O1YA 3B70A 3PEYA 1WDMA 3ISVA 3KJZA 4JJ7A 1RWOA 3GR6A 4Z49A 5HW0A 4DN6A 4U7GA 5J47A 3C4JA 4I5DA 1YAHA 5C35A 4ZRDA 2BGNA 1A9XA 4B3CA 4FMCF 3DH0A 2FI1A 4G84A 4IJ5A 5EMKA 3L6DA 2QTZA 4HN4B 4D4GA 5BSWA 2R8EA 4C3UA 3U7QA 1SKAA 1LDNA 4DR1B 4LDAA 2AFIB 1AGPA 1VB3A 2PKRA 4UNIA 5C1BA 1GQFA 3ESAA 5FPSA 1P9NA 2XT6A 4GHWA 1GAWA 1UZAA 5FWAA 4E5SA 1MORA 2IWHA 3ND5A 5ICSA 1IZYA 4AX4A 2I6FA 4F8JA 5KPDA 3PUKA 2FPRA 3NTRA 2YWGA 4K86A 4XYGA 4CNQA 5EZYB 2QUJA 4TZ6A 2X4LA 3DL7A 3RU9A 3SNKA 5FWYB 3K8ZA 4OYLA 1XA3A 4BMSA 4WLEA 1G2OA 3R7BA 4PXYA 5H7XA 4CLRA 3K6SA 3UPUA 3JRXA 3HA3A 3CO5A 4KUHA 2PWAA 1DX9A 1AF4A 2OL4A 3DLTA 3FNBA 2R6FA 3OLWA 4I50B 4N3NA 4S0ZA 3FPKA 3QEKA 4EO9A 4JEMA 4RZ3A 2DRIA 3I2YX 3WB9A 3COJA 3JS5A 4BQFA 2JD1A 1DIRA 2B37A 3LW8A 1NXWA 4EJ6A 1R4NA 1AQLA 2Q3FA 3QLJA 4I4NA 2XMSA 2EV9A 4ISBA 1P77A 2DKFA 2H1OA 3ZGVA 1SOVA 2GYVA 1H66A 2C8KA 5HA5A 3LUPA 1RLOA 3KZMA 1T6NA 2V54A 4CG1A 1JX6A 1PS8A 1SHUX 2I4IA 3PPXA 3IPYA 3FYTA 4RAQA 4WKCA 4GBMA 3TCKA 4HNSA 1INLA 4MV7A 5L3SA 2HB6A 2RIPA 1AKNA 1NBEA 3CRRA 3W9YA 4B2LA 3MGKA 4PX3A 5C7YA 5KQMA 1FSSA 1F14A 3EDRA 4EUNA 5HMMA 3K53A 3L0OA 3TRDA 4BMOB 1D2RA 2O1EA 2X7XA 3K5HA 4GP6A 4JITA 1VE6A 3UOWA 3USZA 4BNIA 5JCZA 3M6LA 1HOXA 1Y6QA 1CG6A 2EWMA 3CRNA 2IU6A 4B7AA 2QD3A 5JDCC 2D2XA 1BCSA 4I4CA 5IBPA 3M4ZA 5BRAA 5AW7A 1DDIA 3HSKA 3RT9A 1T9BA 4LIPD 4QRDA 2G07A 2QUBA 3JPYA 3HHEA 4ZCLA 2GPTA 2GN8A 5I9IA 3IAFA 4ESHA 3VUEA 3VNBA 1A9RA 2QB5A 4QYSA 1WCIA 4NH0A 1Q6ZA 5EE9A 4TXLA 1A9XB 4E46A 5FTLA 1HX7A 4XWOA 1E1MA 1N2OA 2PA3A 1ZK3A 1XTZA 2PD4A 5EFZA 1SD2A 4IBOA 3OCYA 1UJMA 2JANA 3U7QB 5LOVF 1KZGB 4UJ5A 3BSWA 2E55A 3OQHA 3D3NA 3AOEA 3B53X 1U2ZA 3LDHA 3UGQA 3VR4D 3CT6A 2D4AA 5E2AA 2YWXA 4BFCA 1U63A 1CUVA 1HT3A