3FOZA

Structure of e. coli isopentenyl-trna transferase in complex with e. coli trna(phe)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
305
structure length
305
Chain Sequence
ASLPKAIFLMGPTASGKTALAIELRKILPVELISVDSALIYKGMDIGTAKPNAEELLAAPHRLLDIRDPSQAYSAADFRRDALAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTELTQTSGDALPYQVHQFAIAPASRELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPEQARDEVLQVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
publication title RNA-Protein Mutually Induced Fit: STRUCTURE OF ESCHERICHIA COLI ISOPENTENYL-tRNA TRANSFERASE IN COMPLEX WITH tRNA(Phe).
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transferase/rna
total genus 101
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2009-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fozA01
4JLAA 4HLUC 2F9LA 2VL7A 1YU9A 3FWYA 2X19A 4M1WA 1M1YE 1U99A 3A4MA 2ORWA 1NKSA 2R65A 5AWFC 4AYTA 1XXHB 1XTJA 3NG1A 1FMLA 4MKGA 5EJEA 2ZR9A 2FGJA 4BECA 4GL2A 3AGPA 4N0DA 3B1VA 4F4CA 1RC8A 4R71A 4DCSA 1NNEA 1LVGA 2O5VA 2ZSBA 3KUDA 1KJZA 4ASUA 2V4ZA 1JXOA 1ELOA 5FUYA 3FKSA 4LBZA 3QKUA 2ZJOA 3U3MA 2IS1A 2C9YA 3AKEA 3CIOA 4RKFA 4CEIA 4Q9KA 1H8HD 1HY3A 1OKKA 3QIAA 1E9AA 1KNXA 2W83A 5AJYA 1QHGA 2VF8A 3H86A 4IXNA 4DLSA 4JYBA 3PITA 1R2QA 1CJKC 2RGAA 3EC2A 1Z29A 5E95A 4B74A 2GJ9A 1S1MA 4BRWA 4JJZA 1A5TA 2NIPA 2C96A 4URYR 2FMXA 3AQ4A 4Q9LA 5J47A 3EIHA 1Z6TA 4ABYA 1ZNXA 3THWA 3R9IA 1II9A 1G5TA 4ZKEA 1SGWA 2J46A 1TAGA 2BCGY 4TSFD 2A7QA 3K9HA 2W0MA 4IOLA 4B47A 1FPMA 3MMPA 1RRPA 3C7KA 4BFWA 1W4RA 1A7JA 1GUAA 3EZ2A 4B3BA 1AM4D 4L9WA 4NKRA 4TL8A 3CF2A 3EC1A 1Z0DA 1U98A 3QPUA 5TB5A 3N2EA 2GZHA 2PZFA 3A1TA 3OZXA 1NJFA 3OFNA 5FPKA 3ADKA 1S3GA 4YMVA 2CDNA 4V0NA 1R4AA 4ZCLA 2ZE7A 2DHRA 2BMJA 121PA 4CEIB 4BLPA 3CBQA 1TMKA 2FZLA 3WMFA 2KBEA 5FR1A 2C9OA 1W4CA 2F43A 4LV5B 3CRRA 1IHUA 4A0FA 1XEWY 4IFEA 1FQKA 2HEIA 2QAJA 3I62A 1G7CA 3PEUA 5F9FA 1NI3A 1XWIA 2JLZA 1CXZA 1OXXK 4G5QA 1AKYA 2YWFA 2ZYWX 3B2EA 3RRNA 3QXXA 1MRSA 3THWB 4EAQA 3CWZA 3K0SA 3G82C 4XSHA 2NO0A 3BERA 2N42A 1N3BA 4PQFA 1ZRHA 4DHEA 3AVWA 3GPLA 4LPSA 5KPDA 1RIFA 4Z1MA 1NLYA 2VHJA 1JXMA 1DG1G 1WDTA 2NZJA 3W9YA 3R9XA 1ZUHA 4OQXA 3SZRA 3I73A 4JJKA 3RRYA 4DC9A 3IIJA 4LYJA 2F1RA 1NY6A 2JIZA 4TYYA 4LHVA 3A4LA 3TH5A 1R5NA 2GVZC 4C7OA 4A0HA 1OFIA 4QC2A 4WAUA 4TZ6A 4A2PA 4TMVA 4XVRA 5LD2C 1PVOA 2GXQA 1G5PA 1P7CA 3DVLA 4QHTA 3VHLB 2F43B 3W3ZB 3GLGA 3A1VA 5BWMA 2QORA 4HB4A 1OFHA 2QMOA 1XP8A 4FD2A 4LBWA 5SZJA 3U61B 3K0FA 2ZUCA 3EPHA 1SKYB 1Q1QA 3L0IB 3A1SA 3T15A 1VYVA 5CB6A 5GADl 4US2R 2YNMA 2YVUA 3AUXA 4HI0E 4TL7A 4B44A 1S8FA 1VHLA 1HTWA 1XB2A 2ZITA 1E2KA 3UANA 3W6OA 2N1BA 2YWGA 2E87A 2WSSA 1WRBA 3BB4A 3QKTA 4HDCA 3EA5A 4PC3A 4PC7A 4WW0A 3TW4A 3BH7A 4AI6A 4US0R 1CR4A 2WMNB 2FF7A 5CDFA 1P75A 2D7CA 1R0YA 3EXAA 1S3SA 2ZJAA 1LTQA 4OHVA 1HURA 1UF9A 5K8UA 2ZRIA 5GJBA 5LD2B 1Q1BA 1LS6A 3BJIC 4O2RA 4IEEA 4FMCF 1OXVA 4L5BA 5EE0A 1CTQA 3CNNA 4O0MA 1KO5A 3U6BA 3IEUA 1MKYA 1EXMA 1Q12A 4C7OB 1U9IA 1MV5A 5DIFA 3SYLA 2A2ZA 2Q3HA 3JVUA 4LHXA 5A0FA 3LW8A 4AIIA 3GLGB 1PJRA 4LX0A 2PT5A 2CVFA 1XTSA 5J5CA 1VCOA 2WZQA 1KDPA 2IYSA 2R6GA 3K0FB 3ZS8A 3T5GA 5DH9A 2WICA 1QVAA 2D2EA 2HYDA 3LQQA 1HA3A 1T0HB 2OCPA 3UG7A 4Q9JA 5EE5B 4LBVA 3G0HA 2HJGA 2OT3B 3DZ8A 4P3YA 2GAOA 3GP8A 3ZJYA 4C4PA 1RRFA 4PSKA 1UBCA 1KO4A 2KBFA 1NN5A 4I1SA 4IRUB 1UBGA 3A37A 2E9SA 1AQUA 1KDTA 1FNMA 4EPYA 2ZJ5A 3F8TA 1E2LA 2YYZA 2BM0A 2ZVPX 3TE6A 1EFRD 1ZNYA 3QXHA 4C0JA 2K5UA 4NCHA 2YHSA 4PQRA 1NY5A 1CJMA 3GJ6A 3AUYA 1XFAA 1TQDA 2VF7A 5FPHA 3A8TA 3EA0A 2IL1A 2J7PD 2C99A 1G21E 2P5SA 2J3EA 1D9ZA 3TNFA 5IRCD 4PANA 2RKOA 2WPDD 4ZCMA 4OHYA 1DVRA 1F2UA 1D2NA 1S4QA 5JS7A 2Z43A 4HAZA 5FPTA 3AVTA 3DHWC 4JT4A 4MUAA 3EWAA 5B64A 4FMDF 1BIFA 2FOLA 2R62A 4NMMA 5AUQA 4ZI2A 1YR8A 1AZTA 2XSZD 4FW9A 4IOMA 1GZSA 3OIYA 1LNZA 3NHBA 4PXAA 1KI9A 3BRWD 1GNQA 3CRMA 5D3MA 5TDHA 2B7CA 1E1RA 3NEJA 4Z8YA 1KI7A 4B34A 3GJ7A 1U8AA 2RGCA 2FEMA 5B2ZA 2ONJA 2RGBA 1D5CA 1BH2A 2OBNA 2ZU6A 4D4MA 3SYNA 621PA 5CYPA 4YQFA 2BOVA 1NLZA 3EX7C 3KKQA 1Y3AA 4XTCS 4JT2A 1I4TD 1T8UA 1COWD 1W2GA 1WP9A 2H17A 4FINA 4Q4HA 3U5ZB 4HAVA 4I1OA 3P26A 5AJWA 5AJZA 3VR6A 4JLDA 2JDID 2P3SA 5FOWA 2EFCB 5G41A 3I61A 3GJ5A 3ZYCA 1F2UB 2CL6X 1M7BA 2C2HA 3M0EA 3TSOA 1UFQA 2GJAA 1S1CA 4RZUA 5H1YA 3NXSA 4PC6A 4MDFA 1E2JA 2W2TA 4Q5IA 4ESHA 3GFPA 3VX3A 4XWOA 4ZDKA 2A5YB 4GSYA 3SJZA 1TUEA 3BH0A 5ELXA 3AB3A 3EASA 4S2EA 1YJ5A 1KZ7B 4X8OA 5DO9A 2RAPA 4M1SA 1G6OA 2DPXA 5CIWA 3QBVA 2QQ0A 2CL0X 5D3MB 1QHIA 1X8JA 2QSZA 3E2IA 3KXLA 4RFSA 4KAXA 2ZYVX 5KDLA 1KI6A 2EFEB 3T5DA 4JVMA 1M34E 1MO5A 4IFBA 1NF3A 3KKPA 1VG1A 4PO9A 3ZS9A 1ZMXA 2OLKA 3C16C 2P65A 3IQXA 3BD9A 2JGNA 4M22A 5L3RA 2XNSA 1NL3A 4DLVA 4EFMA 3R9WA 1GKYA 2JLYA 3PEWA 4LV8B 5HCNA 2OLJA 1E2EA 4GOKA 2BIFA 1KDRA 4Q4HB 4KITB 2RHDA 1RRGA 1XJQA 1N5JA 3NH9A 3QVUA 2PZEA 4RVCA 4YC7A 4KFSA 2ZYUX 1SZPA 3AGQA 3BH6A 1OPXA 4B48A 4CVNA 2CK3D 3IBGA 4TQAA 4MDEA 3KQUA 3REGA 1P5ZB 2GXSA 2FNAA 4XD7D 3DEFA 5JJKA 3EW9A 4JKIA 3BFVA 4A36A 2ZSEA 2AK3A 721PA 4C0LA 2JATA 5F2EA 4TT3D 4JMPA 3E1SA 2VHCA 1K8RA 2JLWA 2GWHA 4URUR 4PAQA 3ZVRA 5C4GB 5JI3E 1J7KA 2QP9X 1ZUNB 4A15A 2OSBA 2IYQA 2V6JA 2GBLA 1HE8B 3LQRA 3RSOA 4M53A 5EXSA 2D7DA 1WXQA 3L82B 4J0QA 4RFSB 3VU9A 1FP6A 4TLCA 1H8ED 1KI6B 1OHHA 1VYTA 2R2AA 3A58B 4B3DA 1HQCA 1E69A 2RCNA 3EPKA 3QF4A 4Q02A 2RB4A 1FW6A 2GBLC 2ZJ2A 2GK6A 3TSZA 1N0UA 3QOFA 4CT4B 1F48A 1ZVQA 1RZ3A 5AR1A 3V4FA 1ESNA 1K5GA 4TL6A 2YINC 1XTQA 3R8CA 2WPDA 3SQWA 3LX8A 1LW7A 4URVR 3EIQA 2O0JA 4H9GA 4IEIA 4GI7A 4PO1A 4E5UA 2VPPA 2J1LA 3U60B 4KCGA 3EWSA 3O8RA 4FN5A 1FX0A 1IN7A 1F5NA 3BC1A 4CDGA 2QTFA 4QHSA 3NEYA 3TJZA 1ODFA 2HV8A 4TTQA 3KQNA 4ZDJA 1O87A 3UKDA 4YMSA 2VHUA 4HATA 1S9HA 1YZLA 1HE1C 3A1WA 2FJUA 5GVSA 4A0GA 4OK6A 1D6JA 1IXRC 3Q8XB 3PQCA 4RCZA 2AL7A 4C0KA 3B1WA 1EFCA 1SVKA 1AS0A 2Z5FA 1P9NA 3ECCA 4WZBE 2CJWA 4DLZA 1XTIA 3W5IA 1GITA 3MFYA 1W46A 1LB1B 3VU9B 1T4GA 3Q72A 1PUJA 4RZXA 4V0ME 2XGJA 1XMIA 1E2IA 4Q1CA 3QF4B 5E3HA 1SHKA 3WY9A 4Z54A 2V3CC 1OT3A 1E2DA 2ZUBA 2QT0A 1OF1A 2ZTSA 1WCV1 1KKMA 5GJCA 3U7EB 3W5JA 4LGMA 2O8FA 1G8YA 1D8TA 2IYZA 2ZSFA 4Q21A 4D26A 4PZZA 2CCGA 1E9DA 4M1OA 2YKGA 1A1VA 1FX0B 2Q6TA 4NZYA 3DZDA 1T3LA 1G3IA 3K0EA 4RD0A 4C30A 1OH8A 1ZINA 2HT6A 4B33A 3DPUA 4M9XA 1NRJB 2O8DA 1ZCBA 4G01B 1EWQA 3PUWA 5G3ZA 3O47A 3P32A 1WE2A 3V4RA 3M4YA 3RS7A 2ORVA 2P6NA 3UWKA 1Z06A 1CR2A 2OUKA 4D0LB 1Z6GA 2C77A 1NG1A 4FCTA 1TQ4A 2WWXA 3G5UA 4MGIR 1RYFA 3HDTA 4M21A 4AURA 4NHOA 3ZLJA 1FNNA 2CJWB 4S35A 521PA 3W90A 2G6BA 1JBKA 3FKSD 4MKFA 1P6XA 1OIWA 4I81A 1UADA 3VMFA 2OFWA 4M8NE 1VIYA 5F3WB 4DUGD 4HAUA 4BFUA 1KK1A 3TQFA 2JASA 1R5OA 2ANBA 1CRPA 2O8CA 4QBGB 1TEXA 1XJ0A 2OILA 3CO5A 3D3QA 3B5JA 3LBNA 4POAA 2FFQA 1QVRA 2EW1A 2O8FB 1LV7A 3RDPA 3I32A 3W34A 4UXJA 3LDAA 3AH8A 5FI1B 3ND9A 4ZI3A 1HH4A 2BJVA 5HZKA 3TSWA 5JWOA 3QKRA 4C0BA 4TT3A 1KYIA 2D62A 4OHZA 1AK2A 3RVBA 1DPFA 1T0JB 4RFVA 3AF1A 2O8DB 5CJ2A 4ARZA 2ZQ5A 1Z6XA 2BKUA 1GRNA 3CX6A 5J4YA 1E0KA 1MABA 2QROA 2GAAA 2VH5R 3LX5A 1NN0A 3QQ5A 3OFND 4F7WA 3D6TB 1DG3A 1X8LA 2MSDB 2AKYA 1M74A 3TGPA 3A4NA 2C5LA 4KLNA 5EP4A 5M04A 3HPRA 4TLAA 1GFIA 1MRNA 4HAYA 3K53A 5E7JA 2DFLA 3U7GA 2J59A 1MO6A 3QXSA 2QRNA 5EE3A 1Q22A 4BE7B 2BEJA 4EPWA 3SFZA 3IO5A 4DLXA 3SS8A 3B85A 3THOA 5A5GA 5JRJA 5FOUA 2O8CB 1JPJA 4GRAA 1L4UA 1OYYA 3K1JA 1OYWA 4GMDA 2WMOB 2W2VA 3BXZA 2NMVA 2VBCA 4AYWA 1Z3IX 1IY1A 3Q5EA 1JJ7A 2A3RA 2AXPA 3MWJA 4KHZA 4QJ5A 4HSEA 2XTZA 3L8YA 221PA 2ATVA 4JLBA 2QMEA 3X1WA 3PFIA 4DKXA 5TMPA 4JYCA 5B57C 3QKRB 2PEYA 5CM8B 2HJVA 4QG7A 2RGXA 3UMFA 1P2UA 2OAQ1 2WIBA 2ZI9A 1CKEA 2Q9AA 4IDQA 4LJ8A 4QBFA 4ARZB 3ZZUA 1ZIOA 2UZIR 5AUPB 5JECA 1CRQA 1MABB 4G3XA 1LS1A 1E2NA 2BCJQ 3QUSA 2OO7A 4W5JA 1QHHA 2JCSA 4GT1A 3DM9B 4E03A 2IYUA 4JKYA 4OBEA 2D3WA 2B8TA 4BEJA 2JIZD 2QRZA 4FXPA 5BW8A 5JZVA 2ZAOA 3B1YA 1E79D 4FCWA 2GJ8A 1OSNA 1DAFA 1V43A 4BPBA 4QHYA 4PPGA 2BC9A 2KI5A 4ILEA 4PZYA 1U8YA 3T34A 3TK1A 5C2JB 3CR7A 1IN4A 2BKEA 3W6NA 3C15C 1KZGB 4N0EA 2R44A 5EUQB 4KYIB 2O8EA 4WOPA 1VG9B 4M4SA 2ECKA 1UJ2A 2FU5C 2HCBA 2QSYA 2NO9A 4HEJA 2H1LA 2NG1A 2GZAA 2ZRKA 1ZC4A 3A36A 1CJTC 2DB3A 4Q66C 4ZIRA 3EZ6A 2OCAA 4AWXA 2WSSD 4JLKA 4NCKA 2JLVA 2WKPA 3LA6A 5AJXA 3KJIA 1GRQA 4LDJA 2DR3A 4HUTA 3I8XA 4LBYA 1XMVA 1IJEA 1W4BA 3AP2A 2IS2A 1TF5A 2LCFA 4ZPXA 3Q85A 2ZRMA 3C5CA 1QHHB 2WOOA 2ZETA 2ZRAA 2ZR7A 4MRSA 4DUGA 3WXMA 3CNOA 1VYUA 2Q3MA 3HU2A 2ZJBA 4HDQB 4DBLC 2VHQA 2RGEA 1OXUA 1CS4C 1ZIPA 2V9PA 4JSTA 4M1YA 4M9SA 5EZ5A 2CCJA 4MUBA 2PLFA 2WAYA 4Q47A 4WA7A 3SJBA 2WWHA 1YRAA 2Z0MA 5L3VA 2EWVA 4XVUA 821PA 1MH1A 3VQTA 2O8EB 1NBME 4CZ2A 2PH1A 1WB9A 2GEUA 1II0A 3WRXC 1KO1A 1LY1A 2B21A 4BEBA 3QPVA 4KV9A 2CLSA 1CR1A 4D4KA 2WWFA 3H4MA 1W4AA 1DTSA 4NTZA 2BVNA 4G5SA 2IEYA 5FBRB 4ZIRB 5AUNB 2VLIA 4HDOB 3SU8A 4DIEA 2ZI5A 2ZR0A 2OV2A 4V03A 5CJPA 1TADA 4JIMA 3T1OA 1G7SA 2JAQA 2YWEA 3ZZTA 3B9PA 1R10A 3TKLA 3SN6A 1T3HA 3UMRA 5FPYA 2GJKA 1Z0FA 3E70C 3F5FA 4JL5A 2BBOA 2JJ2D 5A4JA 3DM5A 1VG8A 4FMCB 1G3UA 4W5WA 2AXNA 2XEXA 4EIWA 5C1BA 4GDFA 1SULA 1EGAA 4MKIA 2WVJA 2EFDB 4LI0A 1HEIA 1OW3B 2AR7A 2ZPTX 2VP6A 2JLUA 3O8BA 3IUYA 2X8AA 1X86B 4U02A 1TTTA 4TLDA 3WP0A 3AEZA 4ESVA 3ZQJA 3RS2A 1R0ZA 1VCNA 4RD6A 4A6XA 2IF2A 4NYIR 4EKDA 4IKEA 5GJWC 1RJ9A 3Q9LA 3T35A 1F60A 3NC0C 2RHMA 4PSAA 3HPQA 5HPYB 4DRZA 2ZS7A 2QUZA 3BS4A 1BOFA 3VR5A 4B3XA 1J90A 3B78A 3NDBB 3AVXA 2HUPA 2AHOA 3I8SA 1N6HA 2ZVQX 4XVQA 1XEFA 4V02A 3TQCA 1E1RD 4F91B 1N6RA 3PG5A 1N0WA 5KOYA 3NKVA 1YHNA 1KTVA 1E79A 5L3QA 1KSHA 1FP7A 1UDWA 3CRQA 4Q7MB 4LC0A 1E9BA 1PV4A 3PV0A 2IC5A 2ZROA 3QY0A 3T61A 3WBKA 5BN4A 4LV6A 3LBIA 3N70A 3NBZC 1ZW6A 2CE7A 1Z6AA 3KKOA 3WNCA 3LW7A 2G83A 1IXSB 3KJHA 1IN5A 1TQ2A 1N5KA 2QPAA 3M6AA 2JJ1D 4HZUA 3K70D 4LCBA 2UZ3A 3ZVMA 4OJKA 2DY1A 3KDSE 3ZVNA 1Z0AA 1DARA 5FTLA 1W7AA 1ONBA 2GNOA 4UJ3A 3UATA 1RJ9B 3LXRA 3QNUA 4URXR 1KK0A 1T8TA 2X77A 4XTRA 2YC2C 1KK3A 1MT0A 3TR0A 1EESA 2W6ID 1Z0JA 2GF9A 4XWAA 3CNLA 4GZLA 2ZRDA 2NO6A 4Q7LA 1AZSC 4JLJA 4PR0A 2GETA 3BFXA 3WNBA 1XBTA 3ADBA 3NVAA 4V0MA 2OBMA 1AN0A 2C98A 1ZP6A 4XIGS 4XJXA 4YMUA 4W7SA 3ND8A 1IOZA 3ZD6A 1RYHA 2YZ2A 4OQFA 1DAIA 5FUVA 5FL7D 3A1UA 3TAHA 1XRJA 4R7ZA 4B2IA 1OB5A 4PO8A 1U81A 2XXAA 4N1AA 1KI2A 5KYKA 1Z08A 4WXRA 5L3QB 3ICQB 4C9BA 3IKJA 1W49A 2P6UA 4LUCA 1GL9B 4TL9A 3N5CA 5DGXA 3MGCA 4NYJR 1N6NA 3L0OA 3KQLA 1FUUA 3OHMA 3B13B 4BLTA 2V7QA 1ZBDA 2P67A 4BFVA 3X1DA 1GSIA 1U9IC 3P4YA 3SBEA 3DMDA 4XH9B 1KAOA 3KB2A 3LY5A 2YWHA 3TIFA 4HZUB 3KKMA 3TUJC 1KHTA 2VQSA 5B58C 4US1R 4DCUA 1KDOA 3ADCA 1HT2E 1RE0A 4R9UC 5CYOA 3K9NA 4MGZR 4U00A 5FTJA 1S9DA 3IBYA 3VNVA 3OESA 2FEOA 1X8KA 4HYYA 4EPTA 1NVWQ 3V00A 2HYIC 2FDCA 2RGGA 1W44A 5FUXA 3UMSA 4Q9IA 1P9WA 1IN8A 2ZRHA 5DLQC 3L8ZA 5UKDA 1OJLA 1HUQA 4MRNA 4DZZA 1G3MA 5F9HA 5FBQB 5JWRA 1JJVA 2G3YA 2QP4A 2WIAA 1DAGA 2Z4SA 1QDEA 2P5TB 1NVVR 2IUSA 2C95A 2JJ2A 4U5XA 1OHHD 1K5DA 1VMAA 5EE9A 3T06B 4DSNA 2XXAB 1N5LA 4BFSA 1XD9A 1EG7A 3EPLA 1IONA 2Z6VA 3PENA 1KSGA 2AK2A 1OIXA 3DMNA 2BMFA 3FGNA 3U3RA 2E1RA 2FSIA 1NIJA 3FDIA 4JVLA 1XZPA 3KXKA 1A2BA 4KFTA 2B8WA 5DE3A 3THXA 2G0TA 4KODA 1P60A 1E2QA 5J4LA 3KKNA 1M2OB 1C9KA 1SKQA 4KI0A 5CK4A 3W8NA 2HCJB 1G41A 1IQPA 5KUTA 2PMDA 2RMKA 2XNDA 1QG2A 3PVSA 5JRZA 3WP1B 1IJFA 4IDPA 2FWRA 3OIVA 1G8GA 2NTYC 5HCIA 4Q1FA 1XPRA 5LDDC 5EQTA 2BMDA 2IYVA 3FMPB 5LB4A 4LK2A 4DJTA 4M1KA 2XZLA 1N6OA 2FSFA 3AKYA 3VR1A 2PLRA 1FQJA 2OHFA 3IILA 3LXXA 5TXGA 1Z6YA 4YLGA 1SVLA 2BBWA 3HU1A 1W5TA 3ZIAD 1ZM9A 4X8HA 3BORA 4A9AA 2QN6A 2XJ9A 2GEDA 3QENA 4DDTA 3O8DA 2DBYA 2QZ4A 4UXHA 3AVUA 4V0LA 5JS8A 1ZU5A 4X8MA 1L7VC 1KGDA 1LFDB 1W36C 1JNYA 4DEYA 1GWNA 3AM1A 4C0HA 1W47A 4KFUA 4QM6A 3GFOA 1VG0B 1U0HC 1YE8A 2JJ1A 2UVQA 1KSJA 5G40A 1WBDA 4Q03A 2YOFA 3THXB 5EP1A 2X2FA 1OXSC 1OH6A 2IYLD 2D74A 3CUEF 2PCLA 1XJCA 3I92A 4R2HA 1XCGB 3TUIC 5IK2A 1NLFA 1OXTA 2G1JA 3RRZA 3GJ4A 3SEAA 2W6IA 1PZNA 3ZGXA 3K70C 1N6KA 1G20E 5HE9A 4Q1DA 4MRRA 3SI7A 2D06A 4QNMA 4B73A 1CEEA 4DSTA 4P31A 2ZSAA 4B3FX 1Y63A 2ZI6A 4KVAA 2AD1A 3P1JA 4KFRA 4DXAA 5LBIA 3DO6A 4QJ3A 1W36B 3FMIA 1US8A 5FL7A 3ZDQA 2WJHA 4AD8A 2OBLA 5EP2A 3U3JA 3LBHA 2WWWA 3CF6R 2AD5A 1QHNA 3WYFA 3B8HA 4GFDA 1JQLB 3KX2A 5HE8A 5KNDA 3MG9A 1RVDA 3H84A 5KSOA 4TYWA 5JJIA 4BZQA 2KE5A 2H7VA 2ZIAA 4MKHA 1E3MA 1C1YA 3CRW1 3W8RA 2GCNA 1CJVC 3I72A 1U0JA 4IDNA 3K70B 1QRAA 3GLHE 1ANKA 4OK5A 1Q21A 5KNCA 3FB4A 2AX4A 4DEXA 2GDJA 5FR2A 2ZSDA 1JB1A 5FOSA 4DSUA 1QHSA 1KY2A 1NN1A 3UK6A 1I4DD 3Q7QA 1A4RA 4OQMA 5JSZA 5KDDA 4B76A 4F92B 4Q4LA 6Q21A 4UQOA 2IXFA 1WF3A 1KNQA 3SFVA 2H57A 4RD4A 1AKEA 2IF0A 4FCVA 1E9EA 1GRRA 4Q4JA 2F9MA 3EG5A 3K8YA 4G1UC 1AGPA 4A6PA 1ZM4A 2IXGA 3H1TA 1E4YA 1US8B 4NBSA 3OE7A 3T1TA 3L0SA 1KI1A 3TBKA 1DAEA 2XZPA 1G16A 2IK8A 5FBLB 5TVKA 4OHXA 1XMSA 4NL4H 4P4SA 2J0SA 2NPIA 3BK7A 4A2WA 3RS0A 3LD9A 1NBMA 2F55A 5DYIA 3UXMA 3ZH9B 1GG2A 1VECA 5FOTA 4A4DA 3RS4A 3CWQA 1FL9A 1QBKC 4C0QC 3B60A 2IHBA 4PHHA 3QKSA 4JVNA 2JJ8A 4Q7JB 4DLTA 1TU3A 2CLCX 3CPEA 4R98A 4WIAA 5IHPA 2CCKA 4D6PA 1UKVY 1YR9A 1Z22A 4IHQA 5FOVA 4FIDA 4ZDIA 2DFTA 1G19A 1AQYA 2FA9A 2QY9A 4Q1EA 2A5JA 2DCUA 2XTNA 1VDZA 3NHAA 3GLFE 5JFGA 5JSZB 5JMTA 2GXAA 3ZIAA 3KFVA 4MRPA 3KQKA 1YVDA 5SZIA 2Q9BA 1ZC3A 5JLJA 5F98A 2QTHA 2QEQA 2V6IA 4PPQA 4AKIA 3KJGA 4JBWA 3PEYA 1GIAA 4Q4JB 3EZFA 4TMXA 5CIQA 2Q21A 2QGNA 1Q20A 5G3YA 4DDVA 3BWDD 2O52A 3F0TA 4P4TA 2ZXUA 1Z5ZA 3EZ7A 5J4HA 5J40A 1G4UR 1C4OA 4TWZA 4JL8A 2QT1A 2Z83A 5C46F 4LJ4A 2IWRA 2ZJ8A 2GXUA 4P4SB 3C5HA 4PFSA 4KU4A 1XDBA 1Z0KA 4OI4A 4B32A 1EX6A 3HJNA 4RJLA 5H68A 4GMXA 3DKPA 1UBFA 5KO2A 1G64A 2C03A 3HR7A 4KBFA 4LJAA 1QHYA 1SVSA 1PLLA 3QKSB 2EWWA 4MGYR 4NP6A 3AP1A 3LRPA 2QAGA 2CHQA 4KXFB 4PC2A 4YMTA 2CNWA 3VKWA 3PUXA 3RRMA 3BE4A 1QZXA 3CM0A 2GZDA 2A30A 4HZIA 2PJRA 1G3QA 3WHLA 2G88A 3CPHA 3VX4A 2NQ2C 1RRCA 1EFTA 2F1HA 3VNUA 1W0JA 3ASYA 1JR3E 1KK2A 2QAGC 2W00A 1DADA 5KSYA 1FOEB 4M1MA 3QPWA 3CPJB 3SOPA 3IIMA 3GCGA 2IYXA 2J5XA 4JBYA 3M1IA 4O3MA 4M1TA 1MOZA 3DKVA 1SHZA 2NO1A 1OIVA 2FFAA 4DSOA 1BS1A 1NMZA 4NYIQ 5K8TA 2REOA 4XOIA 1E0SA 5JEEA 5FBVB 2IX3A 2W6JA 1B0UA 4R2IA 1ZJ6A 4GP7A 4DLWA 3V9PA 4OI0A 1WMSA 3T1QA 4TTRA 1FMJA 1BMFA 1XTRA 4BLSA 3GJ3A 4M9ZA 4X8LA 4L16A 3MWKA 2LKCA 4QBIA 3CX8A 1DOAA 4XWKA 3B7GA 4LHZA 1E1QD 4AG5A 3PXGA 1IXZA 1NSFA 3R7WA 1CP2A 2QAGB 4DWJA 4PHTA 4IOKA 5DN6A 1CF4A 4B3GA 4NH0A 4ZKDA 1W48A 3X1XA 2VSXA 5P21A 2NPFA 4IVRA 5HKKD 2IUTA 2VSOA 2FX3A 3QXJA 2P0EA 4DCNA 3LV8A 1J8YF 3FTQA 2WJIA 4CRWB 2ZUDA 2ZRJA 2WKRA 4TMWA 5AK0A 1AJEA 4CW7A 2BMEA 4G5OA 4WZ6A 2AKAB 2QPTA 3AKCA 4QBHA 3K0CA 3MJHA 1UEIA 1X6VA 3C41J 1UKYA 5FI0B 1ZM2A 4CEHA 2WBLC 3KL4A 5LPNA 4Q1BA 1E6CA 4A8JA 5BYJA 3L2OB 3QXCA 5KHOC 1XPOA 5JHGB 2R6DA 4GPTA 4F4IA 4CT5A 2V1XA 1ETUA 2DFKB 1XMJA 2ZRFA 2A5GA 1GL6A 3GJXC 3K0CC 4QGAA 3BGWA 1FUKA 3HR8A 4YDHB 2GHIA 4M9QA 2VA8A 4KVGA 5EE1A 2V8OA 4PZLA 1E2MA 4A8JC 4BGDA 3IGFA 4OQNA 2A78A 3CH5A 3IHWA 4OQLA 4GP6A 3R7WB 2IEZA 4K46A 3U7FB 3DL0A 1ESMA 2GCPA 1LF5A 1G4AE 1R0WA 2QA5A 2CL7X 3GLIE 2JLSA 1ZYUA 4NYMR 4HB3A 4DT1A 1TNDA 4Q7KA 2VO1A 4NYJQ 3NIBA 1XPUA 5EXXA 2RH5A 3PJRA 3LLMA 2HLDA 4Q48A 5IF9A 4QGHA 4D81A 3W3AA 5IDVA 4LJ7A 1UDXA 2W0SA 1NG9A 1DAMA 2O0KA 2OXRA 2CMKA 2VTKA 3L43A 5FFMA 1TX4B 1E99A 5K8LA 1S2MA 4AK9A 1P9RA 3QBTA 5GVRA 4B75A 1E32A 5DI3A 4AY2A 4CEHB 2F3RA 2EQBA 4EQ6A 3ZVLA 5JCZA 4A8JB 1VCIA 2ZM5A 4UNNA 4DDUA 2XZOA 3WMGA 2EFHB 3MAAC 3MWYW 4PAOA 4JLMA 1KIMA 5SZHB 3ZD7A 2J87A 4ZDWA 4B3CA 4JSYA 4TQUS 2LWIA 2WJYA 2BDTA 2JA1A 3EIEA 3LAWA 3TVTA 4C3ZA 1NMXA 1S96A 4QKQA 2J7KA 1ZM7A 4C0SA 1RPZA 2SHKA 4QRHA 3NBYC 1AA9A 3ZZ0A 1NVUQ 4LPKA 3B82A 2VHTA 3CONA 2FN4A 3ASZA 1G7TA 4D2IA 2CXXA 4AKEA 4FMBB 3Q3JB 4D80A 4NCJA 4TZ0A 1YZQA 5J4VA 3K0AA 1E98A 1GAJA 1G7RA 3LVRE 4DT1B 4QNRA 2H92A 3SHFA 3ADDA 5TV2A 1SXJE 3B9QA 4TLEA 3OAAA 4HUQA 4UJ5A 4FWIB 5E7IA 5DHAA 1Z8FA 1K6MA 2ZREA 4QL3A 2ODNA 3MJRA 4IVQA 2AFHE 3X1YA 3KUCA 4V0OA 2QI9C 5DI3B 3J81k 3P27A 5FTNA 1ZD9A 2WWYA 1MR3F 2ZE5A 2H5EA 4EQ6B 1P2TA 2VSFA 1YZKA 1N5IA 2GILA 2ZJYA 2VIIA 3RS5A 2V7QD 2J45A 1VPLA 1QHXA 2WHXA 3H2YA 1E1QA 1R5BA 2QL6A 3AVYA 4O25A 1OLOA 2BV3A 2ODWA 4LOAA 3SBDA 1CIPA 3VKGA 1P62B 3GJ8A 2CHGA 4TQ9A 1GILA 1JR3D 4NDZA 5C4MA 3FHTA 1E9CA 5JBQA 1U8ZA 4Z8XA 4IDOA 2IHYA 2XTMA 1DE0A 2BEKA 1PLKA 2FSGA 2A5FA 5HKKA 1GNRA 3AF2A 2DWQA 4HAWA 1HV8A 2QE7D 1KI8A 1N6IA 3NWJA 2GTPA 5ANRB 3UWOA 3BFKA 4QOSA 3SE0A 5FPSA 3PR1A 2VEDA 4II7A 2GKSA 1GDDA 2QQEA 4V0KA 5CK5A 3IHLA 3A6PC 2XOKA 3K0AB 1UKZA 4P4UA 2I3BA 3I3SR 1R8QA 5DSZA 2GF0A 3SNHA 1P73A 3UG6A 2ZEJA 421PA 2QG6A 4IW3B 4RD3A 1Q44A 4HUQB 5CITA 1GL7A 2G1KA 2JLRA 5KDOA 3GLHA 3GEHA 3LFUA 4QJ4A 5FTKA 2ZS8A 2J41A 1EFUA 4QGFA 2FGKA 1SVMA 4BFZA 3R20A 1Q57A 1X1RA 3RC8A 3NC1C 2EU8A 2IA5A 1SVWA 4E09A 2B7BA 4RKEA 1CJUC 2F3TA 1TL7C 3EAQA 4JZKA 4PHGA 3BIFA 4IDHA 1TF2A 2RGNA 3TR5A 2EFGA 4B71A 2ZI7A 1UBEA 1CU1A 2XNDD 3Q5DA 1T3SA 4DLUA 1XD2A 2ZS9A 2ERXA 1Z0IA 4JVSB 1E9SA 4KJZA 2AWNA 2JLQA 3BAFA 5CLLA 2QTVB 4RD2A 1DO0A 8OHMA 2G9NA 2RGNC 1WBBA 2LKDA 2IS4A 1AIPA 4W9MC 1X3SA 2P6RA 4Q01A 2IWHA 1ZAKA 1W36D 1JALA 1Q1EA 4ZV4A 4JLPA 4BLOA 2ORIA 1Z63A 4TYNA 1GVNB 1N6LA 1UM8A 1YRBA 2AWOA 3TW8B 1T91A 1UKEA 3FFAA 3QVVA 4UNPA 4BFTA 3SYKA 3GQBA 3QG5A 3GLHB 2MSEB 3OIWA 3KZ1E 5DNYB 1CBUA 2GESA 1EK0A 2ANCA 4PC1A 4Q18A 3WMEA 1W0KA 2D2FA 3NTUA 4JLNA 4DCVA 2H8KA 4DB2A 1W2HA 3ZQ6A 4MYHA 2GVDC 3GLFA 1MO3A 4JLVA 2XAUA 2PT7A 1HQYE 1E96A 4NCNA 3VKHA 4JBXA 2ZU0C 4LJYA 4P32A 5JHHB 3QEJA 2H18A 5DISB 5E7MA 2FFHA 3GMTA 4LYHA 4JLOA 1TEVA 4CYMA 4KO8A 1ZD1A 1XD2B 4ZO4A 3VFDA 1G6HA 5IK2D 2OEPA 2O8BA 1Q3TA 3B1ZA 2DWOA 3QI2A 1W5SA 2IW3A 3GFTA 2NGRA 3VR3A 1WQ1R 4FMDB 1JAHA 4QXAA 5JCPA 1P3JA 4K8OA 4DLYA 1YQTA 1Z2CA 3D8BA 2O0HA 2FZ4A 2V54A 3CH4B 3S1AA 1P72A 2WV9A 2AFIE 1OFUX 1XF9A 3BOSA 4D25A 5JI2E 1YR6A 2KB0A 4Z51A 1G17A 3QJYA 4P0TA 1HT1E 4YDSA 1P2SA 1XNJA 3AVOA 1NP6A 2IBMA 4Q9HA 5KSZA 4TYPA 2B92A 1L2TA 3IDQA 5HTKA 1L8QA 2R6CA 3AF4A 4KSCA 1JEDA 1F6BA 1PLJA 3HU3A 4AC9A 3U6KA 4LJ5A 5CLQA 5FL3A 4BASA 3HYTA 1WA5A 3REFA 1IN6A 3KB1A 3I1FA 1H8HA 4RZ2A 1JR3A 3GLFB 1IY0A 1KMHA 2QU8A 5H70A 2F7SA 1YZUA 1U94A 1ZUIA 4KBGA 5TY0A 5E4FA 2WSMA 4H1UA 4UKDA 2WOJA 1YZTA 3FYHA 4KYUA 1F2TA 2QE7A 3T12A 2O8BB 1GKIA 3L0PA 3KJEA 3C8UA 5K8IA 3Q7PA 5CM9C 1SXJD 2L0XA 3O8CA 4PSVA 4TMTA 3AP3A 2IUUA 2QENA 3I5XA 1E2FA 4OYHA 1BYIA 4TSFA 3TRFA 3OF5A 3ONWA 1DELA 4UNQA 4A2QA 3UPUA 2FPKA 3HYRA 4QGGA 3S1AB 2MMCA 3FKQA 3PUVA 4L8GA 4LYAA 2CEAA 4FI3C 3OE7D 1KO8A 4Q00A 5KNBA 1IBRA 2FG5A 1T5IA 2FV8A 2J9RA 3OEHD 4LJ9A 2PCJA 5GJVC 3RLFA 1OH5A 1OH7A 2IYRA 1FTSA 4PPNA 4RZ3A 5JWHA 1P2VA 1RKBA 1KI4A 2CVHA 2YJTD 1NBMD 1RW4A 4BZPA 4QM7A 3PIRA 4C2UA 2GCOA 2F6RA 1XXHE 2GRJA 2QBYA 3K9LA 5KPJA 2ATXA 4OHWA 2J0VA 3THYA 2WJJA 1G1MA 4B2PA 1TUIA 2ZANA 1KJWA 3IEVA 1M6NA 4CGZA 3ICEA 3X2SA 1KMHB 2FH5B 1Q1ZA 5EXPA 5J4KA 2ONKA 2FPLA 2GEVA 4NE2A 2G77B 3T1VA 1F2TB 4LYFA 1D2MA 4EPVA 2W2XA 3C4JA 3SR0A 1VTKA 2ZRNA 2ZRGA 2BHRA 3B1XA 3EARA 3IPXA 4PQYA 4EDHA 2YV5A 1TQ6A 4WZAE 1GOTA 4BQSA 1FTNA 1CR0A 2PZGA 5AJVB 3I4LA 4OI1A 4GZMA 4BFXA 1JQJC 4MA4A 1YKSA 4EPRA 3HWSA 3KTAA 4A1FA 2BM1A 3FMOB 5L3SA 1AS3A 2OESA 1FZQA 2DYKA 2Q0HA 1KO7A 4NONA 1G9XA 4B6EA 4I1VA 2GJSA 5H8WA 1G3RA 1YR7A 1M8PA 4EFLA 5FH9A 1G8FA 5BXQC 3FOZA 1QF9A 4RCYA 3TMKA 1UAAA 2F1JA 1BO6A 1FFHA 1OFTA 2GCOB 3JVVA 2C04A 2ZI3A 4URWR 1XCMA 4LC1A 4ERNA 3GLIA 2QBYB 4HB0A 3THYB 1OV4A 3FE2A 5BQ5A 2PMKA 4AG6A 4U7DA 4PPFA 4F93B 1HYQA 3KXIA 1DO2A 2CNWD 5FBWB 1ZNZA 2C9CA 4GBMA 5KTYA 3VR2A 2VP5A 3IPYA 1E0AA 3AKDA 3CZPA 3TVDA 1BKDR 2KSQA 1W0JD 3EZ9A 4Q19A 2HXSA 4BLQA 1R8SA 3WNDA 2PL3A 2OFOA 2QMUA 2JEOA 4KLZA 2NO7A 3NH6A 4TN1A 5G53C 1A82A 2BWJA 2WAXA 3KTAB 1RFLA 1J2JA 1P61B 2VYFA 4B6FA 5L3SB 3LH5A 3U3KA 1SVIA 2QMHA 3AF0A 1SVOA 4IJMA 2WTUA 1UEJA 2ODBA 2WWIA 2VP9A 2W6JD 3DOFA 1YZGA 2D4HA 2OE2A 3FHCB 2IYTA 1X1SA 3JZAA 2H16A 1UPTA 1EFHA 2EYQA 1BMFD 4D82A 2R6AA 4MH0R 3GJ0A 4NYMQ 3EPJA 2I1QA 5BYKA 5JEDA 3P4XA 3GLIB 4IOJA 1U2RA 1GM5A 4D4LA 4G5GA 3D31A 4PAMA 5FOXA 2KJQA 2AN9A 2FE4A 4TLBA 2FPMA 4KSBA 5DN6D 3KFXA 1SXJA 4F38A 1Q0UA 4UNSA 4L15A 4ITRC 5D3QA 1OB2A 1AS2A 3C14C 3LLUA 5FTMA 5CB8A 4LSGA 1XEWX 3LO5A 3GD7A 4HB2A 3VAAA 4YXWD 1SXJC 2MSCB 5BN3A 4M2LA 1I4LD 4IXMA 3FFBA 1KI3A 2ZJZA 3OEHA 2CHVA 1VCMA 2VP4A 1F3OA 1SKYE 1P4SA 2CE2X 2QGZA 4RY2A 2Q3FA 1ZNWA 1H65A 1G8HA 5AUOB 1N2CE 2PJZA 1KY3A 3QEOA 3WHKA 3OIUA 4A82A 4DB4A 2ZRCA 1E2HA 4L4UA 1M7HA 3WYGA 1EFRA 4BLRA 2VRWA 2YOHA 3TLXA 1G291 4MGKR 3FMFA 2FFBA 3AF3A 2FSHA 1I2DA 3JZMA 3IO3A 5DI9A 5EXTA 4NU0A 2J7PA 3FVQA 4I99A 2J0QA 3RYTC 2QP3A 2ZRPA 4NPHA 1SXJB 5FUWA 1G18A 4OL0A 3RWOA 3AVVA 1NIPA 3F3YA 2OCBA 1KOFA 3RNLA 4LRWA 1JR6A 1E9FA 2F1IA 3BB1A 4URZR 1E0JA 3UIEA 2IYWA 2HLDD 3CF0A 4OJQA 4FWTA 4DIDA 3GLGE 1EX7A 3OEED 3E5HA 4Q4AA 2IXEA 5HZHA 3ETLA 3PUYA 2OFXA 4K81B 1VIAA 2XSZA 4N3NA 1Q3HA 3SJCA 2C78A 4HLCA 1U0LA 5DYGA 2R6FA 3P20A 1XX6A 4CEJA 4B43A 1XTKA 1DAKA 3KQHA 4ACAA 1PUIA 2OM2A 1E2GA 4D0NA 1W1WA 2IT1A 3HP1A 4WBSA 1JPNA 4XSGA 4TMKA 3U7HB 1JI0A 5CDFE 3DDCA 3RHFA 4BZXA 1JEEA 1TU4A 3NBXX 2NOAA 3LVQE 1COWA 4C0AC 2QM8A 2XJ4A 1OE0A 2VP2A 3D7MA 4ACBA 2Y8EA 4HAXA 2R8RA 4HLDA 1B23P 2V1UA 1BYUA 4TTPA 3VTKA 3QE0A 4BWYA 3RAPR 4CIDA 1R0XA 4JL6A 2JDIA 4DDWA 1XCPA 2QPOA 3QF7A 4MITA 3TUZC 3NDPA 4DVGA 2OCYC 1NKTA 1D2EA 2ASEA 2NZ8A 3AVQA 2A5DA 3K09A 2WKQA 3DOEA 2DFNA 4DCTA 1GTVA 2YC4C 3CB4A 1GP2A 3FHOA 5KSPA 1DEKA 3U44A 1J8MF 3QG1A 3GEIA 4ON9A 1GNPA 4WXPA 1IAQA 1KSFX 4Q4AB 2HF8A 4UXIA 3OAAD 5L8VA 4EPXA 2PX0A 1KKLA 3TAUA 1AGRA 3K09C 5EP3A 3SHWA 4EJSA 4E22A 1NN3A 1A2KC 2YOGA 4MYCA 4NCIA 4HLQB 4LY6A 4CEJB 2X2EA 1R6BX 1VHTA 3CZQA 4A0RA 3MRSA 3SC3A 1N25A 1D9XA 5SZKB 3QSYA 1NMYA 4G5RA 2WJGA 1NVXQ 1Z28A 2N46A 2XB4A 2BJWA 3W6PA 4EJSC 2JLXA 4ASUD 4GNKA 4LJ6A 5JJLA 3WRYC 1R7RA 3N2IA 3WYAA 4D4JA 4MQBA 1ZM3A 2VP0A 4YONB 1E9RA 4M0LA 4H1VA 1OKKD 2OZEA 3RS3A 1II8A 1IY2A 4PX9A 2X1VA 4MYUA 2A9KA 4BRUA 3I5YA 5LB2A 4D0GA 1NJGA 1Z83A 4W5HA 1ZD8A 3LWNA 1G5RA 5DHFA 3PCRB 2CK3A 2OXCA 2W58A 3U3OA 3RABA 4TYQA 4AKHA 1KAGA 2BBSA 3R8FA 3MCAA 4YMWA 1O3YA 1ZU4A 4YXWA 4RD1A 4XD7A 3SJAA 4F4JA 2PX3A 2MMGA 4ZCIA 1M7GA 2XOKD 4L9SA 4QFMA 3BB3A 2DWPA 2WWGA 3U44B 2TMKA 2WJVA 1XU4A 4LWZA 2KWIA 1T6NA 4C2TA 1DBSA 3FPAA 3RSLA 4EUNA 2BBTA 3VR4A 2IYYA 2Z4RA 4GOXA 4JS0A 1MO4A 3PUZA 4GOJA 1E94E 4CF7A 3CX7A 4EJSB 1NSTA 1XD8A 3WBJA 4Q1AA 5B30A 2IS6A 2ZRLA 2QM7A 4B2LA 1J99A 4EFNA 2HDNB 4TMZA 2EVWX 3U2QA 1GKUB 5BN5A 1H8EA 1LF0A 3RC3A 2PEZA 3MUFA 5HR5A 2REXB 1VKJA 3IQWA 1DS6A 3CKLA 2ZE8A 2OG2A 1XEXA 2C8VA 2J0UA 4WVFA 3PEVA 1CULC 3SQXA 1T5LA 3U4QA 1XZQA 4I4LA 3MSXA 3VHXA 4B35A 1SQ5A 2ERYA 2ZI4A 1II8B 4IVPA 4O2LA 2R9VA 4Y0VA 2ZE6A 1JAIA 4OKSA 2EYUA 4A92A 4LHWA 5KU1A 2ZYTX 3CW2A 4P33A 5C18A 1Z07A 2REBA 3SDZA 2I1VB 2XX3A 3OEEA 4Y0AA 1Z2AA 3RANA 4AKGA 3IIKA 4E07A 1S0UA 1EWRA 1N6PA 2P2LA 2PBRA 1DAHA 2UKDA 4LZZA 4MYTA 1XXHA 2ZAMA 2XITA 2I4IA 1U90A 3B6EA 4UNRA 2Q9CA 3MWLA 2CLDX 2ODEA 2ZRBA 3H0KA 4AYXA 3LNCA 1I2MA 3BBPA 2CBZA 2RGDA 4Z1MD 1KJYA 2GK7A 3CR8A 1E4VA 1G8PA 3K9GA 2WM9B 4MRVA 1KMQA 4OK3A 5EUMA 1W0KD 1ZCAA 4BFYA 1N0VC 3CRVA 4BUJA 2B6HA 1TPZA 1V5WA 4RSGA 3CLVA 4DLRA 1E2PA 2HF9A 4G0NA 1JECA 1XEXB 2J0UB 2QNRA 3MD0A 2G0NA 1IM2A 1CLUA 2GA8A 1NVVQ 1TF7A 3AV0B 3U4QB 1T9HA 3GEEA 1L4YA 1QG4A 3MLEA 4OI2A 4PHFA 4PTLA 4LHYA 3X1ZA 3AVPA 4I1UA 4HLUA 5IT5A 5EZ6B 2V55B 1YZNA 1Z47A 5TARA 3NBFA 2HT1A 3RWMB 1J70A 2XB2A 2HXYA 2OAP1
chains in the Genus database with same CATH superfamily
3F3KA 4L07A 4Y1RA 3TOCA 3WFIA 5KC8A 5J2TA 2ISCA 3OT1B 4JGIA 3W2HA 1OLUB 4FU0A 5JJ5A 5JH7A 1YU9A 4AFNA 1EP1B 2Z1MA 3GQVA 1M1YE 4XUDA 3I2GA 3F7OA 5AWFC 5ALUA 1XTJA 1ENZA 3NG1A 4IMIB 4FQ8A 5AOVA 1FMLA 4C3OB 3L1HA 1RYZA 4IYRA 1E7SA 1OAOC 4J76A 1VLZA 4DIBA 2A0KA 1GYPA 4H6WA 4HR7A 4RVSA 2AJLI 3ZYZA 3RTGA 4CFYA 1E64A 1KJZA 4ASUA 2XUZA 2GCIA 1K7CA 1ZNQO 2V7PA 4FYYA 2ZJOA 4EB6A 1KP9A 2C9YA 1L0BA 4RKFA 5CNKA 2X9NA 2ZGVA 4Q9KA 1HY3A 1OKKA 2Q5EA 1D04A 4LOKA 4CR8A 3CLUD 1Z5GA 4INAA 2K2QB 2HF2A 5AJYA 2IY9A 4Y2RA 2VPQA 2VF8A 3ML1A 3Q3HA 2OV1A 2IH5A 4GPBA 3CNEA 3UC9A 3PITA 1B3BA 1TA0A 3EC2A 1EPUA 4B74A 4RVFA 3LT4A 4I50B 3AR5A 2OD2A 1S1MA 4ZQGA 5JU6A 4OX9B 3IP9A 1DCMA 2BI4A 3FLBA 3H42B 4JJZA 3DL4A 2FMXA 4URYR 1ZS9A 5HK8A 5HOQA 4ABYA 3REQA 3JR7A 3R9IA 1L8OA 3FNEA 5AVVA 2DVMA 3QK7A 4PONA 3M81A 5K20A 1UFRA 2DFVA 2Q0QA 2AYXA 2NU7B 4B47A 4TLLB 3ORYA 1FPMA 4PGHA 3UAXA 4AS3A 4XQEA 4BFWA 1W4RA 1GUAA 2QRMA 3EZ2A 3KKZA 3RT9A 2SBTA 2QG4A 2WAOA 3AOEA 3CF2A 3R40A 5LMCA 5I7WA 3I9NA 4K6HA 4DWVA 4KR7A 1HE4A 1S7GA 4ZMBA 1MORA 5TB5A 1PJCA 3FUCA 2GZHA 5D01A 1RNLA 4IX9A 1EZ1A 3A1TA 1KRHA 3RJTA 2LPMA 1C4XA 1RWKA 2ZDQA 3OZXA 1QAMA 3H2SA 4FFNA 4IIEA 3PPVA 1S3GA 4F2WA 2O50A 2E7ZA 4WFJA 2CDNA 4JLSA 2I6TA 3Q41A 3S0JA 4ZCLA 5E38A 4ITVA 4Q3NA 1D8AA 4BO3A 3AOEC 5BSMA 2O7RA 3MN1A 2AG1A 2CVPA 4FOLA 3QELA 2YRXA 4BAZA 5M2QA 4CEIB 4DJDC 2NNLD 1ZEJA 4R2LA 5FR1A 3UMCA 1DFHA 3G2MA 4Q7EA 4A0FA 1Z7WA 2K2WA 1IHUA 4LV5B 4P38A 2WA2A 1JQDA 1HZJA 1SY7A 3PEUA 3N59A 1XWIA 3EIUA 3OFSA 3RYHB 1CXZA 2W93A 3L6UA 1OXXK 7AT1A 1RPTA 2JHFA 4JNKA 1J24A 5EVJA 1SUDA 4MUIA 5DEIA 2VZ0A 5K3FA 5LQNA 4UC0A 3HO8A 3RSGA 2IPOA 3IVXA 4AN1A 3NOXA 4EAQA 5BUQA 4FBMA 1N2CA 3SYRA 2WU0A 4Y1FA 4MVJF 1EAYA 4FYMA 3U09A 2PD6A 3QTBA 1YI8A 2NXJA 3VPDA 3DXZA 2WLSA 3V3KA 3K35A 1FFWA 2XVYA 1NC1A 1VHQA 4LPSA 3T9CA 2QM3A 3V8EA 2HCFA 4IDFA 1RIFA 3B52X 3AZOA 5GY7A 4BVEA 3JQGA 2IYAA 2ECOA 2GPAA 1U8TA 1DG1G 1WDTA 2JF0A 1JX6A 3O4RA 5FUMA 4PTZA 1ABEA 1FFGA 4EKIA 1EE2A 3HVKA 3SZRA 1NNUA 2VAPA 1D1TA 4BMNA 4DC9A 4AP9A 4O4JB 3T3HA 3QUQA 4N7JA 1TIBA 4BQPA 2I87A 1OWNA 4LHVA 5JYEA 1R5NA 3HDYA 2JD1A 5JFTA 4A0HA 4HNGA 1ZJZA 1KS2A 4WAUA 4TZ6A 2I1WA 2C9MA 5EMMA 4A2PA 4BLVA 3WLEA 1C7JA 4XVRA 2SKCA 4G85A 1UBKS 2PKQP 1Z4NA 1PVOA 4F46A 1G5PA 1E62A 1P7CA 2EZUA 2HPZA 4WT7A 2F43B 5EEHA 3IPLA 3OTQA 2NXCA 4HB4A 1E6MA 2JGKA 3D6VA 3UICA 3VR2D 1XP8A 5H3LA 4F2GA 5EUBA 3X2EA 3U61B 1A2QA 3EXHA 3GZNA 4HCJA 2OPHA 3SZMA 2H7YA 3JD2A 3GZTB 1ABFA 2Y0DA 4U2DA 1Q1QA 1J23A 3A1SA 1Z7GA 1CS0A 1NW4A 2YNMA 4TL7A 4HI0E 3C70A 1S8FA 1VB3A 3O83A 4PFQA 4B6SA 1VHLA 1HTWA 1KZ4A 2CSUA 1RFGE 1RJGA 2PS1A 2XDQB 3EVGA 4K40A 4KLCA 4Y9RA 3UANA 1CY0A 3SX2A 3EXHC 2N1BA 2E87A 2WSSA 3B6MA 3QKTA 1XDDA 3ZWWA 3EA5A 3ZDXB 2WMNB 1I5OA 1RYBA 3DVQX 3D7NA 5CDFA 2D7CA 3FUVA 4PWYA 2Q5JA 5IVIA 2YNMC 4OHVA 4YP9A 1HURA 2WIJA 4RVNA 5JAQA 1W5AA 5K8UA 2ZRIA 1LPSA 2HO4A 4LF8B 5LD2B 1E3TA 1UPXA 2I7VA 4FUTA 1LS6A 1NBHA 2FMUA 1JQBA 2J6CA 1OXVA 5JO9A 3RVQA 4BQEA 1CTQA 3R5XA 3GFGA 1T9AA 3INTA 1CQZA 4O0MA 1KO5A 4NSNA 4YMGA 4R3NA 4ND4A 3ZGZA 3IEUA 4O4HA 3NVDA 4D8YA 4EHJA 1EXVA 2JRLA 4EJ6A 4TKVB 2GYVA 3EMVA 3L5KA 4CCYA 2EG5A 3H5TA 1JFFA 1DIBA 1K4KA 4YYZA 1R9JA 4E08A 2HSJA 1D1QA 1IQRA 4AIIA 4NY1A 2QRLA 2OC4A 5KKCA 4HK4A 1Z36A 4IBOA 5DVZA 5EINA 1V16B 1VCOA 2WZQA 5J5CA 3VVBA 1KDPA 1YDWA 2DP4E 2IYSA 3LT5A 2VPWA 1E1CA 3T5GA 5DH9A 2WICA 2ZXEA 2NM0A 2DETA 3T0IA 2ID8A 2VNSA 4BPRA 4G9BA 2ERCA 2X22A 1PG5A 3OIDA 1SOUA 3KXPA 4XUEA 1B3RA 1GQSA 1JKJB 1DKOA 1ZXLA 3BK2A 3KYIB 4WZBB 5H59A 5H3CA 1X0VA 3N05A 4OQEA 4ZMSA 4KPGA 3KJXA 2PNJA 2QLBA 3HRHA 4C4PA 2O57A 3RSQA 1KO4A 1USGA 3B7WA 3GVXA 9LDTA 1RLTA 1BEZA 3QVSA 2P2NA 3NPAA 4KPFC 4EMSA 2C4WA 2QMZA 1AQUA 1KDTA 3K7EA 4LJLA 4MIEA 3VU8A 2WNHA 2DBVO 3PQ8A 4QVIA 1RCFA 1E2LA 1C2YA 2AVNA 3TE6A 1EFRD 1ZLXA 2K5UA 2ZQZA 3IRVA 4NCHA 2HFJA 2VUUA 4GX2A 4PQRA 2P1ZA 1NY5A 4WLFA 3S28A 3STXA 4ZHQF 3B3FA 1XFAA 3ER9A 2FUNB 4UDYX 1QQ7A 2VF7A 3DW3X 1BOOA 2HPHA 3K5HA 4HDKB 3A8TA 4OHUA 1T2EA 3LK6A 2NVOA 1OJ7A 2IL1A 2J7PD 3D5QA 1KH3A 3GARA 1QDLB 1IUPA 3L5OA 5A4MS 3KM0A 3FPJA 4MUKA 1ODIA 4M86A 4OHKA 3JQ7B 5CH8A 1C29B 2NYAA 3AEQA 3DZFA 4CFSA 4ZCMA 1U1DA 4BX3A 2DUUA 5C81A 5GONA 1GPJA 5B1SA 3ZHBA 2C94A 1H2YA 1WVIA 3FPFA 3LGSA 2HJWA 5EFZA 1GFZA 4WNAA 2HU7A 5BV2P 4K1LA 4ZEXA 1UT8A 4ESVA 3N74A 2OPBA 4PRLA 4B7AA 3FDZB 5AUQA 4LDRA 4CMGA 1R5JA 2O2ZA 4UPDA 5I9NA 3QX7A 1YR8A 1AZTA 4QTUB 4FW9A 3M1LA 4IOMA 4WESB 1L3BA 3OIYA 1BVYF 1HORA 3UYLA 1F2DA 3GG9A 4PXAA 3ZZ1A 4EA6A 1K0FA 1NBWB 1GNQA 2CUTA 5D3MA 5TDHA 3PKZA 1C7FA 1H1DA 4TZTA 1NTRA 4Z8YA 4B34A 3GJ7A 1IL0A 2ONJA 2FSVA 2FEMA 2RGCA 1LPNA 4JHXA 5AW2A 2ZU6A 4O33A 1MH9A 3SKXA 4D4MA 1Q6YA 3R1IA 3LKVA 1I5EA 3JPWA 2DHDA 1ZUD1 2BOVA 1NLZA 1DUIA 2XNCA 2YYYA 2B99A 4FD3A 3F96A 3RVNA 1RYEA 3OWOA 4ZOAA 2Y76A 1X8XA 4IFTA 3U49A 2FSVC 3EIWA 1A8SA 1MPTA 3I01A 2ONZA 2PRKA 3AI2A 1FY2A 1PWYE 1RRKA 5TPWA 4YRQA 3U7IA 1SU4A 3AC0A 1V3VA 3FD8A 5AJZA 1UIMA 2XAAA 3PX3A 1M1ZA 5KYVA 3RPEA 3RJ9A 3EFOA 3OURA 1VJGA 2EFCB 5G41A 2WHYA 4IX1A 4O8CA 2UVDA 4U4AA 2Q2NA 1NF8A 3FIUA 3KE8A 3QZUA 1M7BA 1WUKS 1EZ4A 2FEPA 4E1AA 1JH9A 3AJ9A 3QEAZ 3NBQA 3TSOA 3WLJA 2GJAA 2EP5A 3NXSA 4PC6A 3VSBA 1KEUA 3S81A 1E3JA 2W2TA 4LAFA 2RC6A 4OA8A 3GFPA 5IM4F 4DY6A 4XWOA 3A7EA 2A5YB 5ITVA 2QRGA 1KU0A 3CSSA 5BNFA 3N0TA 1YFKA 1Y5MA 3AB3A 1YJ5A 1XT6A 4X8OA 2SKDA 3W5IA 1ZUNA 3ZHOA 1M0WA 1V47A 5CIWA 2VPZA 1E5DA 5D87A 2XCIA 1PHPA 4N3GA 2X2OA 1QHIA 3EVEA 3GNQA 4FC6A 5EJIA 3Q9SA 2QSZA 3E2IA 4TOIA 1VL1A 2PTGA 5BWCA 3AUJB 2EFEB 4MB2A 1M34E 4IFBA 4PO9A 3KKPA 4R9VA 2PKRA 4AP6A 2ZULA 2I6UA 3DFZA 3WMRA 1HMPA 2JGEA 3C16C 3UJNA 3IQXA 1XMPA 2JGNA 4M22A 3EEIA 3S7TA 2A1IA 1U1GA 2AMFA 2GN4A 2XNSA 4HDAA 3R9WA 1TMYA 1VLVA 1XE3A 1GKYA 2ASVA 2JLYA 1N1EA 1FYDA 4TUYB 3VGJA 1DBRA 3NIGB 3LYLA 1HDXA 4LV8B 4WTOA 5HCNA 4C4YA 4DA9A 1E2EA 2BIFA 3D7RA 4WK2B 1SVUA 2RHDA 2WHPB 4GL4A 1RRGA 1N5JA 3CW8X 1Q11A 1M1YA 2PZEA 3AY0A 5ERXA 3TQOA 5B5SA 3NHWA 4CVNA 3IBGA 4DAOA 1T2AA 5JPDA 1QH1A 2IHJA 1W2WB 4M8LA 3UMYA 2F90A 4XD7D 4KOEC 2OECA 3GLRA 4JKIA 1BJRE 1S4MA 3T9AA 4AJJA 4EYSA 5L40A 3BHIA 3QYFA 4P83A 1UAGA 4I6JA 1NU6A 2MYPA 5HJ7A 4MWCA 4C0LA 2OK7A 3AESA 5KJ1A 4MLDA 3BXGA 3IUEA 2Z8XA 4JMPA 3VJKA 2VHCA 3FPGA 2B0CA 2GD1O 4KX3A 4TT8A 3G5TA 2GO7A 2BFFA 2QP9X 3UGKA 4EAAA 2VUSA 4ZCTA 2ETVA 1P1JA 4PN3A 3V9AA 3LQRA 3RSOA 4M53A 4DQDA 5DRYA 4QDZA 1WXQA 5DBIA 1MIHA 3L82B 4HUJA 4F5YA 2C42A 1JBQA 1DIOB 3R5FA 1C4KA 1FP6A 4RFSB 4TLCA 4OPMA 1SN7A 4ND8A 3N86A 2I76A 3OKPA 3ZLUA 5KTTA 2RCNA 2VSQA 3E9ZA 1QOQB 4QASA 3OUUA 1ATZA 2H9IA 3DVRX 4RS4A 1XTUA 4YMIA 2CN1A 3EJ6A 3UJPA 1UR5A 3PHLA 4RY8A 3ZV6A 4OFZA 3FI0A 1RD4A 4ITUA 4D7AA 1QLHA 2F48A 2XD4A 3QOFA 3KPWA 3V4FA 2HLHA 4B82A 1ESNA 1K92A 1SWWA 2WP0A 3TQHA 4EHLA 3UPTA 4TL6A 4X44A 3GY0A 3GVPA 3PB3A 4K05A 1H2EA 1LW7A 3QVTA 1X70A 1VBKA 2O0JA 3PEEA 3PFKA 4MJ7A 5E7QA 4WK0B 5E3JA 4D44A 3U60B 3O8RA 1BEUB 1K5PA 2AMVA 4IHJF 1ADFA 1IN7A 1OY1A 1HGXA 2C3YA 2P40A 3BC1A 5AVKA 2AEFA 2VF2A 1YF3A 4QHSA 2CXRA 4ZEWA 1S2NA 4TTQA 1GN9A 4ZDJA 4YMSA 1JHUA 2HZ7A 2GK3A 2FWIA 4BY9E 4MPJA 1U28A 1ZN7A 3A1WA 3T6KA 3WYBA 1CQXA 1CW2B 1ENYA 5BV8A 1I8TA 1D6JA 4W1QA 3QLUA 5IKOA 2JIDA 3PQCA 4RCZA 3QEKA 2QLMA 1RXCA 2QNIA 2W48A 3HKEB 5MN4A 4NS1A 5JSFA 4ZYYA 3ND5A 3IP5A 2X0JA 4DTCA 2Z5FA 1P9NA 4WZBE 1U28C 4XX1A 4RLSA 3V1UA 2BEUB 2P11A 3VHRA 5K0SA 4IJWA 3QQPA 1LPAB 2BHSA 3BGSA 3PZRA 3DVSX 3QLUC 4HBZA 3T7DA 1EU1A 2GO1A 5LYJA 2Z2KA 4ALJA 4KWTA 4LXUA 2WNIA 1PUJA 4V0ME 1XMIA 4BMCA 2EJBA 5IAKA 2O7QA 1SHKA 3ASUA 2IZOA 2E4ZA 2G40A 1OT3A 2OZKA 2ZUBA 1C8BA 1RRVA 2LBPA 2H65A 1C0PA 5C7YA 5IKMA 2XNHA 1X92A 1T2FA 1KKMA 3F6BX 1JJBA 1EM6A 4FS8A 1B8PA 1R18A 3DKRA 4NCXA 4RYDA 5GJCA 5SY4A 1UBJS 1DJLA 2XMCA 1B00A 3W5JA 4DRXB 4D26A 3BUSA 3OTHA 2YBDA 2WVHA 4PZZA 3M3DA 2CCGA 1E9DA 4BMPB 4M1OA 2YKGA 4EHHA 1FX0B 3MSCA 4HNQA 4QREA 5ILQA 3UV7A 4ZN6A 5D1HA 1T3LA 1Q6ZA 2FFRA 3DV2A 4GKVA 2Y1WA 3K0EA 2NTNA 3WO0A 1EGVB 2ZTUA 1LSUA 1H94A 1AG9A 3MWGA 1NRJB 2OORA 4M9XA 4V24A 2R751 2UDPA 1XRSB 4G01B 1EWQA 1MAAA 4MCIA 3P32A 4D6YA 5LM3A 3V4RA 3EAFA 5IABA 4FM9A 2E3JA 4LJKA 1RWWA 1FNSA 2P6NA 2PD4A 1PQUA 3VDNB 1IXYA 4GKJB 1Z6GA 4AS1A 4MX8A 1I32A 2ZR8A 4MGIR 1RYFA 3OETA 2TMGA 1DEHA 2ZIFA 1R9NA 4AURA 4NHOA 5FI5A 2EHDA 1KZ1A 3RUFA 5CB4A 2CJWB 2AI2A 1OD6A 3BWBA 4ZP1A 521PA 5LA6A 4EX7A 1XZJA 3FKSD 2WPNA 4I81A 5ADUS 2GHQA 4Z3KA 1UADA 4FE4A 5CBPA 1G1AA 1SVNA 2EZ8A 5DLEA 2VSYA 5DLPA 3T0FA 4C4SA 2FKAA 4MVJG 4BFUA 4CMHA 1ORHA 2IEIA 1R5OA 8ATCA 4UUNA 2R8ZA 3BIWA 4BZWA 4NRDA 1ECCA 5A3RA 1XJ0A 2OILA 1O1YA 3D3QA 5JXWA 4OD0A 4AM8A 5ALOA 3EXIB 1TKCA 4O1MA 3RDPA 3I32A 1FP4B 2JFWA 4UXJA 3W34A 2B4RO 1TI7A 3DD5A 3R0ZA 3NVMB 3OM0A 4Y6OA 3QHQA 4MUMA 1ADCA 5K5EA 1QMGA 1YK0A 3TLGB 3PNOA 3VNQA 5ENDA 3B6IA 3ZH2A 2GPTA 1SIBE 1T8WA 2JVJA 2VDPB 2D62A 3JYOA 5IXSA 4NOKA 3ORQA 4QDOA 5BNIA 2O8DB 4EY7A 4MS3A 1HQKA 2G06A 3GLKA 1Z6XA 1L1FA 2EV9A 3CX6A 5J4YA 2BGUA 2VH5R 3CJTA 3LX5A 4U9IS 3QQ5A 3SCZA 2FWAA 1RM3A 4QPDA 3I39X 4ZCSA 1DG3A 2AKYA 3ZLTA 1Z15A 4FHFA 1HZZA 3AF6A 5KTSA 4GIBA 4XLTA 1XAIA 4QVGA 5HA5A 4EVIA 1GFIA 3HY4A 5BMVA 4YHBA 2XBMA 3K53A 3L1JA 2ZIGA 1HNZB 4UPEA 1LSSA 2W6OA 3ES9A 1M76A 3HEBA 4A0SA 2QRNA 3FGZA 5EE3A 1VC2A 2DPYA 5AXCA 5H80A 3H7IA 1BXZA 1E3LA 1IEXA 1ZXBA 1LRLA 3SS8A 1HZZC 3COYA 5A5GA 2X5OA 4BJ1A 1OLSB 2CB0A 2XQGA 1JPJA 1L4UA 2ZSJA 1OYYA 3K1JA 1UP4A 1Z2PX 4LDPA 5KWVA 2Q5IA 4GMDA 4JXZA 3BGIA 2NMVA 3BXZA 1Z3IX 3NFYA 3SSOA 3RFXA 3NP7A 4L8LA 4QJ5A 4HSEA 5LC1A 1M2NA 4L76A 5IUNC 4YCNA 1S2GA 4G1BA 3DHEA 3QIVA 3L6CA 5TMPA 1B0PA 1X80B 3MCWA 4DIFA 5EIBD 5B57C 1SC4A 4GWLA 4Y6RA 1JMKC 5CM8B 3T99A 3VYUB 4ZYUA 2RGXA 2OAQ1 2ATEA 2ZI9A 4LJ8A 1FK8A 4ARZB 4Z9YA 2WT4A 3OZTA 3TJMA 1TJ5A 1EVJA 1L4HA 4YJGB 3ZU2A 1USKA 2BCJQ 1NVGA 2F4NA 3BHNA 2OO7A 3M5PA 4GT1A 4NZOA 3AILA 3B2QA 2IBTA 4RPLA 2C4KA 2DY0A 2IYUA 1ZGJA 3EFEA 2D3WA 3U16A 2JIZD 3ABZA 3CGWA 4I4TF 4FDMA 4F7DA 5BW5A 4YT5A 3ROZA 4D9IA 1N2HA 1E79D 4HQNA 2XNJA 4FCWA 1XZFA 2GJ8A 4ZTUB 4RIEA 1EFDN 3NHFA 2O20A 2BR3A 2VWPA 2WT8A 3A6ZA 4QHYA 1V45E 5ALMA 3WV4A 4JAVC 5LNK1 1WG8A 4PLFA 2XZTA 1YMVA 1NV8A 1BHQ1 3IQDB 3EPPA 2OVFA 2NYRA 1YXMA 4HYEA 5C2JB 1ZGBA 2H4ZA 1IM5A 4ZC8A 2IPXA 2G9VA 2IZ0A 1KZGB 2WIFA 2Y6VA 3C15C 2NVBA 3E9RA 4KYIB 5IJXA 2HJSA 3E35A 3S55A 5KOJA 3BPSA 2O8EA 2O2YA 4MTLA 2FW9A 4YJ3F 2BY4A 2ECKA 3IAM1 2FU5C 2HCBA 2C7VA 4QXQA 4CN9A 3V7NA 1DMSA 2D4AA 4HEJA 3RQIA 4KMOA 2X0FA 2IE0A 3CTPA 4ZYWA 4AN4A 3AXTA 4ZIRA 1C7IA 5BWOA 1SUIA 1C9NA 2ZBEA 1CUJA 3ZD9A 1RZRA 2YWBA 3A3PA 1P77A 5MF6A 2D5CA 5IVDA 4AW9A 3KJIA 4LDJA 2DR3A 1KFJB 1EK2A 2O1WA 1PO7A 1XMVA 3I8XA 3GAMA 4MUFA 5GP1A 1W4BA 3AP2A 3V2IA 2EKZA 4MVXA 3VDQA 2BFDA 4ZU3A 5JBNA 1E7MA 3FUXA 3I04A 3ZIDA 4B4OA 2WOOA 5AVZA 1R8XA 3ESQA 4HPWA 4FW8A 1G21B 2DCMA 3N9IA 1XDZA 2J48A 1MUUA 1K7XB 1E8DA 3IP7A 4LXQA 5FA5A 3RRXA 1Y1QA 2ZJBA 1W29A 5GZ3A 1Z0SA 2RGEA 1SQSA 4P84A 2PWYA 1CS4C 3WRXA 4M1YA 3RSSA 5K6TA 5LLDA 1V0JA 4G0VA 2WAMA 3GU3A 2QUJA 2WAYA 5EIEA 1T9ZA 3E5MA 1M6WA 2NSYA 1YRAA 2Z0MA 4XVUA 4AU1A 1GU0A 2B3DA 1FQWA 4Q0MA 5CYFA 1GPLA 3U31A 3KQWA 3E82A 2GEUA 3WRXC 1QX3A 4OHBA 4FZVA 4CMJA 4WBNA 2IPNA 2OXIA 1BCRA 2B21A 3QPVA 5HF6A 5B36A 2CLSA 2ROQA 1YS2X 2A4MA 3AWIA 3F5QA 2CBGA 3HRIA 5TNXA 1W4AA 1M34A 5FBRB 1ZZEA 4JLWA 4FGZA 4UHJA 5D00A 5FYDA 4KN5A 4NWIA 2E82A 1F17A 2QX6A 4BNLA 1H9AA 1M2EA 1STOA 2ZI5A 4RA6B 4Z7JA 5BORA 1BS2A 2FR0A 2GM9A 1E18A 1TADA 2OV2A 3B3JA 3QFHA 4D92A 5IJ0B 3CZ9A 4X6YA 3T1OA 1B6TA 1G7SA 3QWBA 2HR1A 1Q0SA 2O0MA 3P9CA 3SSMA 4GM1A 3SKVA 4BAUA 1PW5A 2C61A 3SWWA 3JCZA 2Y4NA 3UMRA 4E70A 1WDKA 4EY3A 1V3TA 1JQEA 1Z0FA 3F5FA 4XEUA 1J20A 5DM2A 3QVGA 1E3WB 4JL5A 3SR4A 1WOMA 2BBOA 4CLOB 5KOHA 5B1YA 3DM5A 1EZZA 3AQIA 4OOEA 2AXNA 4BMSA 5IEBA 1EGAA 2W98A 1C1XB 4L08A 1OW3B 1Y42X 1PNVA 2HDHA 2IY8A 5K3DA 1I5RA 4TXLA 1X86B 3G1TA 2OHIA 1TTTA 4TLDA 3WP0A 3IP8A 4IV5A 1QNFA 1G98A 3CKYA 4DLAA 1H4QA 1QRUA 5COAA 1JQAA 3TKAA 4AAYA 5HSGA 4RD6A 1SMKA 2IF2A 3FSGD 3OIGA 4GYKA 4QDKA 4U7PB 3ZX5A 2PMFA 4MWOA 2W37A 4IIXA 2R68A 3NQ41 4CIWA 4XRRA 4DQUA 1RJFA 5DTIA 3FNIA 1M83A 2ZS7A 3BS4A 3TEFA 3RM3A 4B3XA 3HBAA 1YASA 3AFGA 1MV8A 3I12A 5LCXA 3B78A 2HMWA 3O38A 5COQA 4YRDA 2FPXA 3AVXA 1P9OA 4WXYB 1FNCA 1IQUA 2AHOA 2CHUA 3I8SA 4GEGA 4XAQA 2AJDA 4BMXA 4G1EB 3D0OA 3AM3A 3ILVA 1N0WA 3T41A 5TE9A 3ZDZB 2P0YA 3NKVA 1Y5RA 1N9KA 1MHPA 1WHSA 1E79A 3HRKA 5L3QA 4DR2B 4CIYA 4A2CA 9GPBA 1NR5A 3CNBA 3RG2A 1XDUA 4UD6A 1GQOA 3BMXA 2BELA 2FAXA 3PTAA 3RFTA 3LKZA 3T61A 3WLAA 4OQYA 3EF3A 4DV3B 4KMMA 4FLFA 1Y4ZA 4YYEA 4DG8A 5TPZD 2ZBPA 1ZW6A 3KALA 3OQPA 4IV0A 3KKOA 3WNCA 4ZHQB 2C2GA 3GOHA 3QV1A 1NOKA 4MDYA 4MUEA 3UKJA 1TQ2A 3VR6D 2QPAA 4BNMA 2JJ1D 4HZUA 5B58T 4BVFA 3K70D 1XELA 3MINA 4HRVA 4OJKA 3S99A 5JAIA 4H2DA 5DM70 3DUFB 3GELA 2Q1YA 1W7AA 4DM4A 5I9BA 1PRYA 2GNOA 1RJ9B 1HRKA 3LXRA 4AJIA 4FB4A 3K9QO 1UK7A 3W5CA 2A9RA 1R6DA 2OQRA 2YJ6A 1KK3A 4XTRA 1NXXA 3TR0A 5DM0A 2H4YA 3AUSA 1EESA 5KTKA 1Z0JA 1HDZA 1LBQA 1SPXA 4Y2YA 4IGFA 3ENZA 5LZ7A 4ZAVA 2C2YA 1UPBA 1Z4PX 4KO4S 4F6RB 3BFXA 2X5NA 3CN9A 1XBTA 2GN6A 2W6QA 3NVAA 4V0MA 4WERA 3A2NA 5CFQA 2LV8A 2JBHA 2XYHA 4U7JA 2XF8A 3NXKA 1ZP6A 5H81A 1MXFA 3H75A 3WGZA 3JASA 2ID4A 3ILHA 4GI1A 1RYHA 4JMLA 3ZD6A 1VLJA 1L4KA 1GT6A 2JZNA 3DHVA 3K1ZA 1XRJA 3TAHA 5LXTF 2CNDA 4UEKA 4UVDA 1N8TA 3IUQA 4MI1A 4AJOA 4KN9S 2IIPA 4C9BA 4N41A 2LW7A 5CAEA 2WYOA 2PSSA 2P6UA 4LUCA 3KSZO 4LQCA 3L4SO 3JAWB 3N5CA 5DGXA 3MGCA 4FFOA 4FX5A 1ABBA 1FUUA 3OHMA 3B13B 3PHBE 5GZ1A 5BN4B 3ZE9A 3KQLA 5BMOA 1ZBDA 3X1DA 1I4WA 3S2FA 3F6SA 1U9IC 4S1OA 3AEYA 2IU3A 2AS0A 1QB7A 3OE4A 4K9SA 4BQRA 2M6KA 3KB2A 4K9PA 3VKFA 1Y5LA 5BSTA 3FHLA 3KEMA 5HM6A 4A27A 3QU9A 4R9UC 5FTJA 4DV5B 4MGZR 4U00A 2YIDA 1S9DA 4JOCA 4EZBA 3OESA 1DDIA 5HG0A 5I9LA 1J2EA 1HL3A 2OM6A 2CXPA 5CLIA 5DK4A 3G3EA 4FDLA 4HDRA 3DC2A 5THQA 1Q15A 3W5VA 2HYIC 1W44A 3RVRA 2GZ1A 5B7GA 2ZTVA 5IARA 1F20A 1PEYA 1RHUA 2O5EA 3L8ZA 1IEWA 5J5AA 1HUQA 1T1SA 3I5UA 4LRQA 1XSEA 3RVMA 3PC7A 2P4UA 4F04A 4ENSA 1U7PA 2D2VA 2G3YA 2WIAA 3AIMA 1VBNA 4XCQA 1JSLA 4GGPA 4MVJE 5BRJA 2G8LA 1E1MA 2IQ5A 4QELA 4L50A 4U5XA 3C43A 3JD4A 2GJ4A 2XXAB 1V2GA 4BFSA 2J30A 4UCFA 1IONA 3EUFA 1SQ0A 2B8JA 4M3NA 3SF0A 3IURA 1BROA 1CQIB 1JSRA 2ZYRA 3BG5A 3O9VA 1I7NA 4Y98A 2HWWA 4JVLA 3E6AA 1WUHS 4IJQA 3THXA 3GOQA 1QK5A 4KODA 3TINA 4GRDA 3FSGA 3PRHA 4RVGA 1M2OB 1OWLA 4KI0A 4MINA 2FMTA 2HCJB 4WHMA 4X0EA 5HRCA 3ESZA 3PVSA 1RRMA 4HL6A 1RKXA 2I3AA 4RF4A 1IJFA 2F67A 1KYWA 3B20A 5GV7A 3NOOA 3IJRA 5KYTA 1ZX1A 2YX1A 5JADA 1Y6QA 3FMPB 2OQVA 5AM4A 4J2HA 3IAS1 4ZVTA 4DYVA 2XZLA 1LDYA 1BKYA 5CFLA 4DDMA 1YQ9A 2PLRA 1FQJA 1TVMA 3LXXA 5L7WA 1BSVA 1Z6YA 2QX7A 1UXGA 2R7MA 3GAZA 4YI3A 4RE5A 5JD3A 3ZIAD 5BT8A 3ZG6A 1ZM9A 1TM5E 2JFXA 1A88A 4ALLA 3U4DA 2QN6A 4CF4A 3UMMA 1VCHA 1U0NA 3KEOA 2GEDA 3QENA 1DIGA 1SXQA 4FTWA 1QYCA 1MX9A 4QEKA 4LF7B 2R87A 1PBTA 1SC3A 3OIFA 2PUWA 4JFAA 3I9KA 4D42A 4V0LA 3AVUA 1WMAA 2QL9A 1ZRMA 4X8MA 4AJ2A 2RGWA 1EDEA 3ZCTA 1LFDB 2YH2A 3ILXA 4LG1A 1ZWLA 2PZLA 2QJTA 5JTUA 1JNYA 4DEYA 3QVKA 3V7WA 4W5QA 1WL8A 3C6MA 3PU6A 3AM1A 4FMPA 5M34A 4DTIA 1W47A 1X7YB 4AUEA 3JTMA 3JW8A 4DABA 1PIWA 3NDRA 2C88A 4Y6QA 4M60A 4QM6A 4YRTA 1U0HC 1YE8A 2JJ1A 3PHGA 1KSJA 4L73A 1KOGA 4M7WA 4Q03A 4RPIA 2OGWA 5L4NA 1USWA 4K9MA 1NGSA 3K4QA 2XUJA 3KPVA 1QZTA 4FXOA 5HWSA 1YB4A 3ZHVA 1DBVO 2PCLA 3FOAA 4QFBA 4PIPA 5BSUA 1IBMB 4QYTA 1MQ9A 5IK2A 1NLFA 2G1JA 4P34A 1GQ2A 1AUPA 1JDZA 1RI5A 1ZFNA 1EGHA 3PF8A 3S8MA 3K70C 4UAJA 4G4SP 3CW9A 1OGIA 2VPXA 1F9EA 1K0UA 3FIJA 3P5BA 1A96A 3TLBA 3EW7A 2D06A 4XQ9A 4N3BA 4X97A 4DSTA 2G5GX 2O2DA 4YK7A 1BWQA 2H1SA 4B3FX 1Y63A 3ROMA 3P2YA 2MHCA 1V96A 1DBQA 1Z6PA 5LBIA 1L9KA 4CHTA 4DXAA 4U2GA 3DE7X 1OX4A 3OP1A 2I03A 1KYZA 1CZUA 4Y1GA 2QD4A 4ZVVA 4GAEA 5EJ6A 3U3JA 2HH9A 3VDXA 3JAKB 1QRDA 2ENWA 3NAZA 3TQSA 2XA2A 5DGHA 3WHPA 3B1FA 1GAXA 2QW1A 3KX2A 1E1YA 1VP9A 1KEKA 5KNDA 5D7BA 2PUBA 1B7GO 1UOQA 2KE5A 2VEOA 5AW8A 3IDAA 3JV7A 4QJBA 1YAJA 1QRSA 5CDYA 4MKHA 3DR5A 3ENVA 1EFAA 1C1YA 1EWKA 3EFHA 3W8RA 1HDIA 1RWMA 1KAMA 4DILA 3MTDA 1ANKA 2QYHA 4G84A 2WFLB 3PXCX 2AGVA 3OWXA 4EARA 2AX4A 5ICSA 2V7EA 2QN1A 2NU9A 5FR2A 4BFLA 1E66A 2ZSDA 4MRMA 4ZI7A 2PUDA 3CCCA 1GD1O 3UK6A 3Q7QA 4C03A 5ARBA 1SB9A 2B1RA 2WU3A 1Z6QA 4WKGA 4DZRA 1T9CA 4E5MA 5JSZA 1WZIA 2CMDA 3ADPA 4F92B 4BL5A 4RHCA 3WWYA 1IC6A 2IXFA 1YFJA 1C9DB 3GIWA 3HZOA 5IUKC 4E7PA 1M8JA 1PZMA 3AG6A 1QGUB 1TT5A 1U3GA 1FS5A 4IO1A 4Q4JA 3W0LB 4TWIA 3EG5A 2Y0CA 3EBLA 1ZM4A 5I7SA 4C22A 1GPUA 1XZCA 1E4YA 5NULA 3U37A 1US8B 3AFMA 4NBSA 3OE7A 2VK2A 3KB6A 4W82A 5DW0A 3RS9A 3ED1A 4P4LA 4D8TA 1EQ2A 5BP7A 1ZQ9A 1XAHA 5TVKA 3K8QA 2OMKA 2PXXA 1E60A 3F3SA 4TTSA 4EEZA 3BK7A 1NP7A 3VYSB 1RAAA 3LQ2A 4RQTA 3RS0A 2I80A 3DXXA 3X0DA 4QG3A 3DC7A 2SKEA 5FOTA 1Z25A 2YS6A 2ZFUA 4A4DA 3HJUA 3EQ8A 1QBKC 5EEGA 4HT3B 4EW3A 5JTTA 3GRAA 2Q6OA 4KQKA 3O6VA 3O91A 3ROTA 4DLTA 4UZFA 2CLCX 4ROTA 1E3IA 1KE1A 3TM4A 2F64A 1UKVY 3PDIB 3BIXA 4IHQA 5AVJA 3DBVO 4ZAZA 1VB5A 2I7CA 2E5LB 1O4WA 2CJPA 1MTZA 1SCBA 1NQOA 2A5JA 3K5PA 3N7UA 4R8KA 1VDZA 3ZW7A 1AK1A 5KWEA 3RS8A 5LVAA 3EVZA 3WVNA 1JRLA 3ZIAA 4GKKB 2X41A 2J3IA 4MRPA 1Z7EA 3HSSA 5CD1A 3GGJA 4DA7A 5BPHA 4MVJD 3RFUA 3HA2A 4N9QA 4N0PA 5JMPA 4R54A 3IMKA 3UA3A 3I09A 2X42A 5EOVA 3SK0A 2D1YA 3ZGVA 5SY6A 4E4RA 3F6CA 3IQZA 3KBOA 3NETA 3U3DA 2D8AA 3S2YA 4ARCA 4P4TA 3EGOA 1JEAA 1Z5ZA 2F2TA 3EZ7A 5FORA 1QFSA 1C4OA 4JL8A 7YASA 1J42A 2Z83A 1H4SA 2WINI 9MHTA 4X64B 4ND5A 4P4SB 3I9JA 2J67A 3KQYA 1XDBA 4GH5A 1U3TA 3ZPXA 3ORRA 1P4RA 4BJHB 1UBUS 4US2R 5F52A 1EX6A 3HJNA 4RIGA 3CKMA 4QTYA 5K6AA 4B83A 1NASA 3QUCA 3BIJA 1H22A 1X7ZB 4KBFA 3VZPA 1O9GA 4AZ3A 1QTRA 1J49A 5ES4B 2H1HA 4JYZA 3A2KA 2PSFA 3QKSB 1EFVA 4HADA 4MGYR 5B4UA 1N9GB 3ONFA 1VIDA 1QPBA 4YMTA 3N28A 2AG0A 3OOEA 3GAAA 3BE4A 1QZXA 3PQFA 4INJA 5CHEA 2IZ1A 3LT1A 5K6AC 3VX4A 1ISSA 4GLJA 4G24A 4UARA 3DMGA 2NN3C 4MR9B 2XKAA 3WKBA 4BNKA 1KK2A 1YR2A 2N0SA 3ND7A 5ENVA 3P97A 4S1TA 3ZV7A 2WF9A 3PICA