3FP5A

Crystal structure of acbp from moniliophthora perniciosa
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
106
structure length
106
Chain Sequence
b'SHMSKAKFDKAVEIVQSLPKDGPIKPTQDEQLYFYKYFKQATVGDVNISRPGLMDFTGKAKWDAWKSVEGTSKEVAYQKYVEKLLEILKKADTEESKKYIAEIEAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-CoA Binding Protein
molecule tags Lipid binding protein
source organism Moniliophthora perniciosa
publication title A new topology of ACBP from Moniliophthora perniciosa.
pubmed doi rcsb
total genus 40
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2009-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3fp5A00
2RQ1A 1SGHA 4NY0A 1E5WA 1H4RA 1MK9B 2I1JA 1GC7A 4HDQA 1EF1A 2AL6A 2AEHA 3G9WA 3IVFA 2HRJA 2CB8A 3PVLA 3AU5A 2J0MA 1MIZB 1HB6A 2D11A 4EKUA 1MK7B 2EMSA 2I1KA 3PZDA 4HDOA 1HB8A 1NI2A 1NVLA 2LBBA 1GG3A 1Y19B 4F7GA 4P7IA 2FDQA 1MIXA 3WA0A 1HBKA 2J0JA 5IJMA 2COPA 3AU4A 1GC6A 1ST7A 2D2QA 4ZRKA 4CYEA 4ZRJA 2EMTA 2HE7A 4ZRIA 3U8ZA 4YL8A 1ACAA 2CQUA 2D10A 2WH5A 2ZPYA 3EPYA 3FLVA 3X23A 1ISNA 2YVCA 3FP5A 4DXAB 3U7DA 1NTIA 2ABDA 3BINA 1J19A 2FJ9A 2J0KA 3ZDTA 3QIJA
chains in the Genus database with same CATH superfamily
2R82A 2AEHA 3SBGA 2CB8A 4JK7A 1HB6A 1MK7B 4P7IA 3WA0A 4JKCA 3U8ZA 4YL8A 2CQUA 3EPYA 4ILJA 3BINA 2FJ9A 4NY0A 1E5WA 2I1JA 4HDQA 4JKBA 1GC7A 3G9WA 3IVFA 3PVLA 3AU5A 2J0MA 1MIZB 4JK9A 4EKUA 3E66A 2I1KA 4HDOA 4JKDA 2LBBA 4F7GA 2FDQA 2X0SA 1MIXA 2J0JA 3ENBA 4JKGB 1GC6A 2D2QA 4CYEA 4JKGA 2D10A 1VBHA 1KBLA 1ISNA 3FP5A 4JKHA 4ILHA 4DXAB 1NTIA 2DIKA 1J19A 2J0KA 3ZDTA 2RQ1A 4JKEA 1H4RA 2EMSA 1Y19B 3E9OA 3E9PA 4GXBA 5IJMA 2COPA 4JKFA 4ZRKA 4ZRJA 2EMTA 1JDEA 1ACAA 2WH5A 2ZPYA 3X23A 2YVCA 3U7DA 2ABDA 3PZDA 3QIJA 1SGHA 1MK9B 4JKAA 1EF1A 2AL6A 5JVLA 1GGOA 2HRJA 4ILGB 2D11A 4JK8A 1DIKA 4TKNA 1HB8A 1NI2A 1NVLA 1GG3A 1VBGA 1HBKA 3AU4A 1ST7A 4ZRIA 2HE7A 3FLVA 3SBTA 1KC7A 3E9LA
chains in the Genus database with same CATH topology
2R82A 2AEHA 3SBGA 2CB8A 4JK7A 1HB6A 1MK7B 4P7IA 3WA0A 4JKCA 3U8ZA 4YL8A 2CQUA 3EPYA 4ILJA 3BINA 2FJ9A 4NY0A 1E5WA 2I1JA 4HDQA 4JKBA 1GC7A 3G9WA 3IVFA 3PVLA 3AU5A 2J0MA 1MIZB 4JK9A 4EKUA 3E66A 2I1KA 4HDOA 4JKDA 2LBBA 4F7GA 2FDQA 2X0SA 1MIXA 2J0JA 3ENBA 4JKGB 1GC6A 2D2QA 4CYEA 4JKGA 2D10A 1VBHA 1KBLA 1ISNA 3FP5A 4JKHA 4ILHA 4DXAB 1NTIA 2DIKA 1J19A 2J0KA 3ZDTA 2RQ1A 4JKEA 1H4RA 2EMSA 1Y19B 3E9OA 3E9PA 4GXBA 5IJMA 2COPA 4JKFA 4ZRKA 4ZRJA 2EMTA 1JDEA 1ACAA 2WH5A 2ZPYA 3X23A 2YVCA 3U7DA 2ABDA 3PZDA 3QIJA 1SGHA 1MK9B 4JKAA 1EF1A 2AL6A 5JVLA 1GGOA 2HRJA 4ILGB 2D11A 4JK8A 1DIKA 4TKNA 1HB8A 1NI2A 1NVLA 1GG3A 1VBGA 1HBKA 3AU4A 1ST7A 4ZRIA 2HE7A 3FLVA 3SBTA 1KC7A 3E9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQ1 A;  1SGH A;  4NY0 A;  1E5W A;  1H4R A;  1MK9 B;  2I1J A;  1GC7 A;  4HDQ A;  1EF1 A;  2AL6 A;  2AEH A;  3G9W A;  3IVF A;  2HRJ A;  2CB8 A;  3PVL A;  3AU5 A;  2J0M A;  1MIZ B;  1HB6 A;  2D11 A;  4EKU A;  1MK7 B;  2EMS A;  2I1K A;  3PZD A;  4HDO A;  1HB8 A;  1NI2 A;  1NVL A;  2LBB A;  1GG3 A;  1Y19 B;  4F7G A;  4P7I A;  2FDQ A;  1MIX A;  3WA0 A;  1HBK A;  2J0J A;  5IJM A;  2COP A;  3AU4 A;  1GC6 A;  1ST7 A;  2D2Q A;  4ZRK A;  4CYE A;  4ZRJ A;  2EMT A;  2HE7 A;  4ZRI A;  3U8Z A;  4YL8 A;  1ACA A;  2CQU A;  2D10 A;  2WH5 A;  2ZPY A;  3EPY A;  3FLV A;  3X23 A;  1ISN A;  2YVC A;  3FP5 A;  4DXA B;  3U7D A;  1NTI A;  2ABD A;  3BIN A;  1J19 A;  2FJ9 A;  2J0K A;  3ZDT A;  3QIJ A; 
#chains in the Genus database with same CATH topology
 2R82 A;  2AEH A;  3SBG A;  2CB8 A;  4JK7 A;  1HB6 A;  1MK7 B;  4P7I A;  3WA0 A;  4JKC A;  3U8Z A;  4YL8 A;  2CQU A;  3EPY A;  4ILJ A;  3BIN A;  2FJ9 A;  4NY0 A;  1E5W A;  2I1J A;  4HDQ A;  4JKB A;  1GC7 A;  3G9W A;  3IVF A;  3PVL A;  3AU5 A;  2J0M A;  1MIZ B;  4JK9 A;  4EKU A;  3E66 A;  2I1K A;  4HDO A;  4JKD A;  2LBB A;  4F7G A;  2FDQ A;  2X0S A;  1MIX A;  2J0J A;  3ENB A;  4JKG B;  1GC6 A;  2D2Q A;  4CYE A;  4JKG A;  2D10 A;  1VBH A;  1KBL A;  1ISN A;  3FP5 A;  4JKH A;  4ILH A;  4DXA B;  1NTI A;  2DIK A;  1J19 A;  2J0K A;  3ZDT A;  2RQ1 A;  4JKE A;  1H4R A;  2EMS A;  1Y19 B;  3E9O A;  3E9P A;  4GXB A;  5IJM A;  2COP A;  4JKF A;  4ZRK A;  4ZRJ A;  2EMT A;  1JDE A;  1ACA A;  2WH5 A;  2ZPY A;  3X23 A;  2YVC A;  3U7D A;  2ABD A;  3PZD A;  3QIJ A;  1SGH A;  1MK9 B;  4JKA A;  1EF1 A;  2AL6 A;  5JVL A;  1GGO A;  2HRJ A;  4ILG B;  2D11 A;  4JK8 A;  1DIK A;  4TKN A;  1HB8 A;  1NI2 A;  1NVL A;  1GG3 A;  1VBG A;  1HBK A;  3AU4 A;  1ST7 A;  4ZRI A;  2HE7 A;  3FLV A;  3SBT A;  1KC7 A;  3E9L A; 
#chains in the Genus database with same CATH homology
 2R82 A;  2AEH A;  3SBG A;  2CB8 A;  4JK7 A;  1HB6 A;  1MK7 B;  4P7I A;  3WA0 A;  4JKC A;  3U8Z A;  4YL8 A;  2CQU A;  3EPY A;  4ILJ A;  3BIN A;  2FJ9 A;  4NY0 A;  1E5W A;  2I1J A;  4HDQ A;  4JKB A;  1GC7 A;  3G9W A;  3IVF A;  3PVL A;  3AU5 A;  2J0M A;  1MIZ B;  4JK9 A;  4EKU A;  3E66 A;  2I1K A;  4HDO A;  4JKD A;  2LBB A;  4F7G A;  2FDQ A;  2X0S A;  1MIX A;  2J0J A;  3ENB A;  4JKG B;  1GC6 A;  2D2Q A;  4CYE A;  4JKG A;  2D10 A;  1VBH A;  1KBL A;  1ISN A;  3FP5 A;  4JKH A;  4ILH A;  4DXA B;  1NTI A;  2DIK A;  1J19 A;  2J0K A;  3ZDT A;  2RQ1 A;  4JKE A;  1H4R A;  2EMS A;  1Y19 B;  3E9O A;  3E9P A;  4GXB A;  5IJM A;  2COP A;  4JKF A;  4ZRK A;  4ZRJ A;  2EMT A;  1JDE A;  1ACA A;  2WH5 A;  2ZPY A;  3X23 A;  2YVC A;  3U7D A;  2ABD A;  3PZD A;  3QIJ A;  1SGH A;  1MK9 B;  4JKA A;  1EF1 A;  2AL6 A;  5JVL A;  1GGO A;  2HRJ A;  4ILG B;  2D11 A;  4JK8 A;  1DIK A;  4TKN A;  1HB8 A;  1NI2 A;  1NVL A;  1GG3 A;  1VBG A;  1HBK A;  3AU4 A;  1ST7 A;  4ZRI A;  2HE7 A;  3FLV A;  3SBT A;  1KC7 A;  3E9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...