3FP5A

Crystal structure of acbp from moniliophthora perniciosa
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
106
structure length
106
Chain Sequence
SHMSKAKFDKAVEIVQSLPKDGPIKPTQDEQLYFYKYFKQATVGDVNISRPGLMDFTGKAKWDAWKSVEGTSKEVAYQKYVEKLLEILKKADTEESKKYIAEIEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new topology of ACBP from Moniliophthora perniciosa.
pubmed doi rcsb
source organism Moniliophthora perniciosa
molecule tags Lipid binding protein
molecule keywords Acyl-CoA Binding Protein
total genus 40
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2009-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3fp5A00
2CB8A 3G9WA 1MIXA 4NY0A 3U7DA 2YVCA 3ZDTA 1J19A 1HB8A 3PZDA 1SGHA 1HBKA 3IVFA 4HDOA 2ZPYA 2HRJA 5IJMA 2RQ1A 1MK7B 4YL8A 1HB6A 3BINA 4ZRJA 2COPA 2FDQA 3X23A 1NI2A 3U8ZA 4HDQA 4EKUA 2CQUA 3EPYA 2AEHA 1NVLA 1ISNA 1Y19B 1GG3A 2I1JA 3AU5A 2EMSA 4CYEA 2AL6A 2ABDA 2D11A 2EMTA 4F7GA 1ST7A 3FLVA 1NTIA 2FJ9A 3PVLA 2D10A 2J0MA 2J0JA 1GC7A 3FP5A 1ACAA 1H4RA 2D2QA 3QIJA 3WA0A 1MK9B 2WH5A 1E5WA 3AU4A 2HE7A 4ZRKA 4ZRIA 4DXAB 2J0KA 4P7IA 1MIZB 2LBBA 1GC6A 1EF1A 2I1KA
chains in the Genus database with same CATH superfamily
4ILJA 3SBTA 1HB8A 1HBKA 3IVFA 2ZPYA 4JKDA 2RQ1A 4JK9A 1NI2A 4JKFA 4EKUA 4JK8A 2EMTA 4F7GA 1NTIA 2R82A 2J0MA 2J0JA 1GC7A 2D2QA 3WA0A 2WH5A 4DXAB 2J0KA 1GC6A 2I1KA 1MIXA 4NY0A 4JK7A 3U7DA 1SGHA 4HDOA 1VBHA 4ILHA 4JKEA 1MK7B 4YL8A 2COPA 3U8ZA 2CQUA 3EPYA 1NVLA 2EMSA 4TKNA 2FJ9A 4JKBA 4JKCA 1KC7A 1KBLA 3FP5A 3QIJA 1MK9B 4ZRKA 2X0SA 2I1JA 1EF1A 2CB8A 1GGOA 4JKAA 5JVLA 1J19A 3E66A 3E9OA 1JDEA 5IJMA 2DIKA 3BINA 2FDQA 2AEHA 1ISNA 1GG3A 2AL6A 2D10A 3E9PA 3AU4A 4ZRIA 4JKGA 4P7IA 1MIZB 1VBGA 3G9WA 2YVCA 3ZDTA 3PZDA 2HRJA 1HB6A 4ZRJA 4JKHA 3X23A 4HDQA 3ENBA 1Y19B 3AU5A 4CYEA 2ABDA 2D11A 1DIKA 1ST7A 3E9LA 3FLVA 3SBGA 3PVLA 4ILGB 1ACAA 1H4RA 1E5WA 2HE7A 4JKGB 2LBBA 4GXBA
chains in the Genus database with same CATH topology
4ILJA 3SBTA 1HB8A 1HBKA 3IVFA 2ZPYA 4JKDA 2RQ1A 4JK9A 1NI2A 4JKFA 4EKUA 4JK8A 2EMTA 4F7GA 1NTIA 2R82A 2J0MA 2J0JA 1GC7A 2D2QA 3WA0A 2WH5A 4DXAB 2J0KA 1GC6A 2I1KA 1MIXA 4NY0A 4JK7A 3U7DA 1SGHA 4HDOA 1VBHA 4ILHA 4JKEA 1MK7B 4YL8A 2COPA 3U8ZA 2CQUA 3EPYA 1NVLA 2EMSA 4TKNA 2FJ9A 4JKBA 4JKCA 1KC7A 1KBLA 3FP5A 3QIJA 1MK9B 4ZRKA 2X0SA 2I1JA 1EF1A 2CB8A 1GGOA 4JKAA 5JVLA 1J19A 3E66A 3E9OA 1JDEA 5IJMA 2DIKA 3BINA 2FDQA 2AEHA 1ISNA 1GG3A 2AL6A 2D10A 3E9PA 3AU4A 4ZRIA 4JKGA 4P7IA 1MIZB 1VBGA 3G9WA 2YVCA 3ZDTA 3PZDA 2HRJA 1HB6A 4ZRJA 4JKHA 3X23A 4HDQA 3ENBA 1Y19B 3AU5A 4CYEA 2ABDA 2D11A 1DIKA 1ST7A 3E9LA 3FLVA 3SBGA 3PVLA 4ILGB 1ACAA 1H4RA 1E5WA 2HE7A 4JKGB 2LBBA 4GXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CB8 A;  3G9W A;  1MIX A;  4NY0 A;  3U7D A;  2YVC A;  3ZDT A;  1J19 A;  1HB8 A;  3PZD A;  1SGH A;  1HBK A;  3IVF A;  4HDO A;  2ZPY A;  2HRJ A;  5IJM A;  2RQ1 A;  1MK7 B;  4YL8 A;  1HB6 A;  3BIN A;  4ZRJ A;  2COP A;  2FDQ A;  3X23 A;  1NI2 A;  3U8Z A;  4HDQ A;  4EKU A;  2CQU A;  3EPY A;  2AEH A;  1NVL A;  1ISN A;  1Y19 B;  1GG3 A;  2I1J A;  3AU5 A;  2EMS A;  4CYE A;  2AL6 A;  2ABD A;  2D11 A;  2EMT A;  4F7G A;  1ST7 A;  3FLV A;  1NTI A;  2FJ9 A;  3PVL A;  2D10 A;  2J0M A;  2J0J A;  1GC7 A;  3FP5 A;  1ACA A;  1H4R A;  2D2Q A;  3QIJ A;  3WA0 A;  1MK9 B;  2WH5 A;  1E5W A;  3AU4 A;  2HE7 A;  4ZRK A;  4ZRI A;  4DXA B;  2J0K A;  4P7I A;  1MIZ B;  2LBB A;  1GC6 A;  1EF1 A;  2I1K A; 
#chains in the Genus database with same CATH topology
 4ILJ A;  3SBT A;  1HB8 A;  1HBK A;  3IVF A;  2ZPY A;  4JKD A;  2RQ1 A;  4JK9 A;  1NI2 A;  4JKF A;  4EKU A;  4JK8 A;  2EMT A;  4F7G A;  1NTI A;  2R82 A;  2J0M A;  2J0J A;  1GC7 A;  2D2Q A;  3WA0 A;  2WH5 A;  4DXA B;  2J0K A;  1GC6 A;  2I1K A;  1MIX A;  4NY0 A;  4JK7 A;  3U7D A;  1SGH A;  4HDO A;  1VBH A;  4ILH A;  4JKE A;  1MK7 B;  4YL8 A;  2COP A;  3U8Z A;  2CQU A;  3EPY A;  1NVL A;  2EMS A;  4TKN A;  2FJ9 A;  4JKB A;  4JKC A;  1KC7 A;  1KBL A;  3FP5 A;  3QIJ A;  1MK9 B;  4ZRK A;  2X0S A;  2I1J A;  1EF1 A;  2CB8 A;  1GGO A;  4JKA A;  5JVL A;  1J19 A;  3E66 A;  3E9O A;  1JDE A;  5IJM A;  2DIK A;  3BIN A;  2FDQ A;  2AEH A;  1ISN A;  1GG3 A;  2AL6 A;  2D10 A;  3E9P A;  3AU4 A;  4ZRI A;  4JKG A;  4P7I A;  1MIZ B;  1VBG A;  3G9W A;  2YVC A;  3ZDT A;  3PZD A;  2HRJ A;  1HB6 A;  4ZRJ A;  4JKH A;  3X23 A;  4HDQ A;  3ENB A;  1Y19 B;  3AU5 A;  4CYE A;  2ABD A;  2D11 A;  1DIK A;  1ST7 A;  3E9L A;  3FLV A;  3SBG A;  3PVL A;  4ILG B;  1ACA A;  1H4R A;  1E5W A;  2HE7 A;  4JKG B;  2LBB A;  4GXB A; 
#chains in the Genus database with same CATH homology
 4ILJ A;  3SBT A;  1HB8 A;  1HBK A;  3IVF A;  2ZPY A;  4JKD A;  2RQ1 A;  4JK9 A;  1NI2 A;  4JKF A;  4EKU A;  4JK8 A;  2EMT A;  4F7G A;  1NTI A;  2R82 A;  2J0M A;  2J0J A;  1GC7 A;  2D2Q A;  3WA0 A;  2WH5 A;  4DXA B;  2J0K A;  1GC6 A;  2I1K A;  1MIX A;  4NY0 A;  4JK7 A;  3U7D A;  1SGH A;  4HDO A;  1VBH A;  4ILH A;  4JKE A;  1MK7 B;  4YL8 A;  2COP A;  3U8Z A;  2CQU A;  3EPY A;  1NVL A;  2EMS A;  4TKN A;  2FJ9 A;  4JKB A;  4JKC A;  1KC7 A;  1KBL A;  3FP5 A;  3QIJ A;  1MK9 B;  4ZRK A;  2X0S A;  2I1J A;  1EF1 A;  2CB8 A;  1GGO A;  4JKA A;  5JVL A;  1J19 A;  3E66 A;  3E9O A;  1JDE A;  5IJM A;  2DIK A;  3BIN A;  2FDQ A;  2AEH A;  1ISN A;  1GG3 A;  2AL6 A;  2D10 A;  3E9P A;  3AU4 A;  4ZRI A;  4JKG A;  4P7I A;  1MIZ B;  1VBG A;  3G9W A;  2YVC A;  3ZDT A;  3PZD A;  2HRJ A;  1HB6 A;  4ZRJ A;  4JKH A;  3X23 A;  4HDQ A;  3ENB A;  1Y19 B;  3AU5 A;  4CYE A;  2ABD A;  2D11 A;  1DIK A;  1ST7 A;  3E9L A;  3FLV A;  3SBG A;  3PVL A;  4ILG B;  1ACA A;  1H4R A;  1E5W A;  2HE7 A;  4JKG B;  2LBB A;  4GXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...