3FP5A

Crystal structure of acbp from moniliophthora perniciosa
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
106
structure length
106
Chain Sequence
SHMSKAKFDKAVEIVQSLPKDGPIKPTQDEQLYFYKYFKQATVGDVNISRPGLMDFTGKAKWDAWKSVEGTSKEVAYQKYVEKLLEILKKADTEESKKYIAEIEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-CoA Binding Protein
publication title A new topology of ACBP from Moniliophthora perniciosa.
pubmed doi rcsb
source organism Moniliophthora perniciosa
molecule tags Lipid binding protein
total genus 40
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2009-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3fp5A00
1ST7A 3U8ZA 2D11A 2HE7A 1H4RA 2EMSA 2HRJA 2ZPYA 4EKUA 1Y19B 2D10A 2EMTA 3IVFA 4NY0A 3X23A 1J19A 1EF1A 3PVLA 3AU5A 1NVLA 2CQUA 2J0KA 2YVCA 3BINA 1GC6A 3EPYA 2AL6A 4P7IA 1MIXA 1MIZB 2FDQA 4ZRIA 4DXAB 2ABDA 2J0JA 1MK9B 1HBKA 1NI2A 4HDQA 4HDOA 2I1KA 3G9WA 3WA0A 1NTIA 1ACAA 2LBBA 3U7DA 5IJMA 4F7GA 1HB6A 1MK7B 4ZRJA 3AU4A 2AEHA 1SGHA 2FJ9A 4YL8A 1GC7A 1ISNA 2CB8A 2J0MA 3FLVA 3FP5A 1E5WA 1GG3A 2I1JA 3QIJA 4ZRKA 3ZDTA 2RQ1A 3PZDA 2WH5A 1HB8A 4CYEA 2D2QA 2COPA
chains in the Genus database with same CATH superfamily
2R82A 2D10A 3IVFA 2EMTA 3EPYA 3U7DA 1GC6A 4DXAB 1MIXA 2FDQA 2ABDA 2J0JA 4JKFA 1HBKA 1NI2A 4HDQA 2DIKA 2I1KA 4JK9A 4JKDA 3E66A 1VBGA 3E9OA 1MK7B 3AU4A 3ENBA 2J0MA 1GG3A 3QIJA 3ZDTA 1VBHA 4JK8A 4JKEA 2COPA 2HE7A 1H4RA 1Y19B 4TKNA 3BINA 2AL6A 4ZRIA 1MK9B 4JKGB 1ACAA 4JKCA 4F7GA 1HB6A 4JKBA 1ISNA 1GC7A 3FP5A 1E5WA 3U8ZA 2D11A 2HRJA 2EMSA 4EKUA 3SBTA 4NY0A 3X23A 1J19A 4JKHA 2CQUA 1MIZB 5JVLA 4GXBA 1KBLA 1KC7A 4HDOA 4JKGA 5IJMA 3E9PA 2X0SA 4ZRJA 1JDEA 2CB8A 3FLVA 2I1JA 4ZRKA 3SBGA 1HB8A 4CYEA 2D2QA 1ST7A 4ILHA 2ZPYA 4ILJA 4JK7A 1EF1A 3PVLA 3AU5A 1GGOA 1NVLA 2J0KA 2YVCA 3E9LA 4P7IA 4JKAA 3G9WA 4ILGB 3WA0A 1NTIA 2LBBA 2AEHA 1DIKA 1SGHA 2FJ9A 4YL8A 2RQ1A 3PZDA 2WH5A
chains in the Genus database with same CATH topology
2R82A 2D10A 3IVFA 2EMTA 3EPYA 3U7DA 1GC6A 4DXAB 1MIXA 2FDQA 2ABDA 2J0JA 4JKFA 1HBKA 1NI2A 4HDQA 2DIKA 2I1KA 4JK9A 4JKDA 3E66A 1VBGA 3E9OA 1MK7B 3AU4A 3ENBA 2J0MA 1GG3A 3QIJA 3ZDTA 1VBHA 4JK8A 4JKEA 2COPA 2HE7A 1H4RA 1Y19B 4TKNA 3BINA 2AL6A 4ZRIA 1MK9B 4JKGB 1ACAA 4JKCA 4F7GA 1HB6A 4JKBA 1ISNA 1GC7A 3FP5A 1E5WA 3U8ZA 2D11A 2HRJA 2EMSA 4EKUA 3SBTA 4NY0A 3X23A 1J19A 4JKHA 2CQUA 1MIZB 5JVLA 4GXBA 1KBLA 1KC7A 4HDOA 4JKGA 5IJMA 3E9PA 2X0SA 4ZRJA 1JDEA 2CB8A 3FLVA 2I1JA 4ZRKA 3SBGA 1HB8A 4CYEA 2D2QA 1ST7A 4ILHA 2ZPYA 4ILJA 4JK7A 1EF1A 3PVLA 3AU5A 1GGOA 1NVLA 2J0KA 2YVCA 3E9LA 4P7IA 4JKAA 3G9WA 4ILGB 3WA0A 1NTIA 2LBBA 2AEHA 1DIKA 1SGHA 2FJ9A 4YL8A 2RQ1A 3PZDA 2WH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ST7 A;  3U8Z A;  2D11 A;  2HE7 A;  1H4R A;  2EMS A;  2HRJ A;  2ZPY A;  4EKU A;  1Y19 B;  2D10 A;  2EMT A;  3IVF A;  4NY0 A;  3X23 A;  1J19 A;  1EF1 A;  3PVL A;  3AU5 A;  1NVL A;  2CQU A;  2J0K A;  2YVC A;  3BIN A;  1GC6 A;  3EPY A;  2AL6 A;  4P7I A;  1MIX A;  1MIZ B;  2FDQ A;  4ZRI A;  4DXA B;  2ABD A;  2J0J A;  1MK9 B;  1HBK A;  1NI2 A;  4HDQ A;  4HDO A;  2I1K A;  3G9W A;  3WA0 A;  1NTI A;  1ACA A;  2LBB A;  3U7D A;  5IJM A;  4F7G A;  1HB6 A;  1MK7 B;  4ZRJ A;  3AU4 A;  2AEH A;  1SGH A;  2FJ9 A;  4YL8 A;  1GC7 A;  1ISN A;  2CB8 A;  2J0M A;  3FLV A;  3FP5 A;  1E5W A;  1GG3 A;  2I1J A;  3QIJ A;  4ZRK A;  3ZDT A;  2RQ1 A;  3PZD A;  2WH5 A;  1HB8 A;  4CYE A;  2D2Q A;  2COP A; 
#chains in the Genus database with same CATH topology
 2R82 A;  2D10 A;  3IVF A;  2EMT A;  3EPY A;  3U7D A;  1GC6 A;  4DXA B;  1MIX A;  2FDQ A;  2ABD A;  2J0J A;  4JKF A;  1HBK A;  1NI2 A;  4HDQ A;  2DIK A;  2I1K A;  4JK9 A;  4JKD A;  3E66 A;  1VBG A;  3E9O A;  1MK7 B;  3AU4 A;  3ENB A;  2J0M A;  1GG3 A;  3QIJ A;  3ZDT A;  1VBH A;  4JK8 A;  4JKE A;  2COP A;  2HE7 A;  1H4R A;  1Y19 B;  4TKN A;  3BIN A;  2AL6 A;  4ZRI A;  1MK9 B;  4JKG B;  1ACA A;  4JKC A;  4F7G A;  1HB6 A;  4JKB A;  1ISN A;  1GC7 A;  3FP5 A;  1E5W A;  3U8Z A;  2D11 A;  2HRJ A;  2EMS A;  4EKU A;  3SBT A;  4NY0 A;  3X23 A;  1J19 A;  4JKH A;  2CQU A;  1MIZ B;  5JVL A;  4GXB A;  1KBL A;  1KC7 A;  4HDO A;  4JKG A;  5IJM A;  3E9P A;  2X0S A;  4ZRJ A;  1JDE A;  2CB8 A;  3FLV A;  2I1J A;  4ZRK A;  3SBG A;  1HB8 A;  4CYE A;  2D2Q A;  1ST7 A;  4ILH A;  2ZPY A;  4ILJ A;  4JK7 A;  1EF1 A;  3PVL A;  3AU5 A;  1GGO A;  1NVL A;  2J0K A;  2YVC A;  3E9L A;  4P7I A;  4JKA A;  3G9W A;  4ILG B;  3WA0 A;  1NTI A;  2LBB A;  2AEH A;  1DIK A;  1SGH A;  2FJ9 A;  4YL8 A;  2RQ1 A;  3PZD A;  2WH5 A; 
#chains in the Genus database with same CATH homology
 2R82 A;  2D10 A;  3IVF A;  2EMT A;  3EPY A;  3U7D A;  1GC6 A;  4DXA B;  1MIX A;  2FDQ A;  2ABD A;  2J0J A;  4JKF A;  1HBK A;  1NI2 A;  4HDQ A;  2DIK A;  2I1K A;  4JK9 A;  4JKD A;  3E66 A;  1VBG A;  3E9O A;  1MK7 B;  3AU4 A;  3ENB A;  2J0M A;  1GG3 A;  3QIJ A;  3ZDT A;  1VBH A;  4JK8 A;  4JKE A;  2COP A;  2HE7 A;  1H4R A;  1Y19 B;  4TKN A;  3BIN A;  2AL6 A;  4ZRI A;  1MK9 B;  4JKG B;  1ACA A;  4JKC A;  4F7G A;  1HB6 A;  4JKB A;  1ISN A;  1GC7 A;  3FP5 A;  1E5W A;  3U8Z A;  2D11 A;  2HRJ A;  2EMS A;  4EKU A;  3SBT A;  4NY0 A;  3X23 A;  1J19 A;  4JKH A;  2CQU A;  1MIZ B;  5JVL A;  4GXB A;  1KBL A;  1KC7 A;  4HDO A;  4JKG A;  5IJM A;  3E9P A;  2X0S A;  4ZRJ A;  1JDE A;  2CB8 A;  3FLV A;  2I1J A;  4ZRK A;  3SBG A;  1HB8 A;  4CYE A;  2D2Q A;  1ST7 A;  4ILH A;  2ZPY A;  4ILJ A;  4JK7 A;  1EF1 A;  3PVL A;  3AU5 A;  1GGO A;  1NVL A;  2J0K A;  2YVC A;  3E9L A;  4P7I A;  4JKA A;  3G9W A;  4ILG B;  3WA0 A;  1NTI A;  2LBB A;  2AEH A;  1DIK A;  1SGH A;  2FJ9 A;  4YL8 A;  2RQ1 A;  3PZD A;  2WH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...