3FP9A

Crystal structure of intern domain of proteasome-associated atpase, mycobacterium tuberculosis
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
150
structure length
150
Chain Sequence
PSGYGVLLATHDDDTVDVFTSGRKMRLTCSPNIDAASLKKGQTVRLNEALTVVEAGTFEAVGEISTLREILADGHRALVVGHADEERVVWLADPLIAEDLPDGLPEALNDDTRPRKLRPGDSLLVDTKAGYAFERIPKAEVEDLVLEELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasome-associated ATPase
publication title Structural Insights on the Mycobacterium tuberculosis Proteasomal ATPase Mpa.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 28
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2009-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16450 Prot_ATP_ID_OB Proteasomal ATPase OB C-terminal domain
A PF17758 Prot_ATP_OB_N Proteasomal ATPase OB N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3fp9A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3fp9A01
4KHZA 4KHPL 3OYYA 1VQFA 3UE0A 4C3JH 3G4SA 2XTIA 4DV7Q 1YHQA 2LSSA 1VQEA 1NMGA 4L5SA 5BR8Q 4POGA 3I4NG 1EOVA 2QA4A 1CKNA 4LF8Q 2B63G 4IFDJ 2IY5B 5C3EH 2FXQA 1VQPA 1HZCA 4ALPA 4BXXH 4AQYQ 5GAGC 3AEVA 4B3SQ 1X55A 4A3LH 4YY3L 4LFCL 4DNIA 4JI1Q 1K0RA 3RLOA 4LF6Q 1HZBA 2YTVA 1TWHH 2WB1E 2D0PA 1PH8A 1B7YB 1KD1C 3VDYA 2HHHQ 1N8RC 4A3JG 3S14H 3OTOQ 1UE7A 1S72A 3TRZA 2I0QA 1QVCA 4EX5A 4FDBA 4A3KH 5ELOA 3OW2A 1E3PA 5LMNQ 1IBLL 3F2CA 4B3MQ 5M5YH 1YJ9A 1IBKL 4DR3Q 2PI2A 4LF9L 1SLJA 2MQHA 3RR5A 3J80i 1PH9A 3W1GA 1JMCA 4DV7L 3EIVA 1XMQL 1VQKA 3S17H 4A3CG 5BR8L 5IYDH 1LYLA 1PV4A 1I5FA 3A0JA 4X66Q 2VS1A 2GVBA 4BBSG 5FLMH 3A74A 3K8AA 3CPWA 1B70B 4AQYL 4GKKQ 2YYZA 2EQSA 4B3SL 2F3IA 5IP9G 1L1OB 1SR3A 5GROA 2HQLA 3BZCA 4JI1L 2CKZB 4UP8A 2N8NA 4YWMA 4DR1Q 1I94Q 1K83H 4JG2A 2R92H 4A3BH 1VQ7A 1S3OA 5FJ8G 4DV2L 1QZGA 2PQAA 4TVAB 4UPAA 2UU9Q 2R7ZH 2YTYA 2E5LL 4KI0A 3STBC 2K5VA 1HR0Q 3I55A 1HH2P 1HNZQ 2NVXH 2OQKA 1Y1VH 4DV1Q 2L15A 4DR3L 4BY7G 1V1QA 4MTNA 4IPGA 1L1OC 4JI4Q 5C0XJ 4BA1I 1N32Q 1G6PA 1PYBA 5C3EG 4RG1A 4X66L 3GTOH 2OTLA 1MKHA 3HOYH 4JI2Q 1X56A 4DR6L 1YEZA 1Y1WH 1KXLA 2UUAQ 4X64Q 4DR1L 1XNRQ 2D62A 5M5XH 4KLKA 1N34L 1EUJA 3GO5A 1I94L 1VQ5A 4JBJA 2CWPA 4L5TA 4BBRG 3I56A 4DV5Q 3I4MG 3S1MH 2OQ0A 2UU9L 2JA6H 2PI2E 3ULPA 5JJIA 2KHJA 4HIMA 5C4JH 1SE8A 1HR0L 2K5NA 4A3MH 4O0AA 4DV1L 1VQDA 1QUQA 4GKJQ 5HY6A 1JJCB 4HJ8A 3MXNB 3HOZG 3ULJA 5IYDG 3Q8DA 4JI4L 1N9WA 1XNQQ 1WCMG 2JK8A 4C3IH 1N32L 2KHIA 2ZTDA 4DKAC 1IXRA 1XPUA 2Z6KC 3BZKA 1J5EL 2UUBQ 4IPHA 1VQIA 3U4ZA 3GTKH 4JI2L 2A8VA 1VCIA 4AYBG 1GD7A 3LGJA 1P16A 4JBWA 4X64L 3PUVA 1XNRL 4JOIA 1N33Q 2ATWA 3M3YH 4AYBE 1OXVA 3J7A5 1YHBA 4P72A 3G71A 3CF5A 2R7ZG 2VY3A 3CCVA 1PYSB 4IFDG 1Q12A 2QEXA 4PMWA 4OO1G 4A76A 2VUMH 4GLXA 1Q1EA 1Y1VG 2JA5H 3DLLA 2Z0SA 1FGUA 4JBKA 2MO1A 4GKJL 1E22A 1FJGQ 1K8GA 4POFA 3KF6A 3M4PA 4LNQA 2IX1A 5LMUQ 1EIYB 1PVOA 4DK6C 4GLVB 4GN3B 1XNQL 4DR5L 2D0OA 2RHQB 4YCWA 3H3VI 4OWWB 2CWAA 1DGSA 1E24A 1PH5A 2JA7H 3GTQH 3S2HH 1PH2A 4DV4Q 4A3FH 3T1HL 4JBMA 3HOYG 3TEHB 3WWVA 3CAMA 5IYCH 3HOXH 1WFQA 3E9IA 3J81c 4GOPA 3CC2A 1D7QA 4R1JA 1WYDA 3PSIA 2ZJRA 3RN2A 3KDFB 1BBWA 1L2FA 4PZ8A 4XTCS 1N33L 3B6YA 4GNXA 5J3BA 2JA6G 1A8VA 3UDIA 1JT8A 1CKNB 1PA6A 1CUKA 3H0GG 1IBLQ 1A0IA 4A3MG 3CCMA 3ERSX 1IBKQ 2UUCL 2BH8A 5K36G 5IWAQ 1FJGL 1HZ9A 1WOCA 2Q2HA 1R9TH 4DAYB 1XMQQ 3I7FA 3UDXA 5LMUL 4JI0Q 4LF4L 5ELNA 1GO3E 2VW9A 4YHHQ 1HJPA 2AMCB 3KYHC 4LUZA 4DV4L 2WB1G 4Y52H 1TWAH 2Y0SE 1VQBA 1IYJB 3HOWH 2K14A 1SMXA 5GAHC 3JAMi 4DR7L 3ICEA 2HIXA 3I4OA 3GTGH 1S40A 2F4VQ 3H15A 1VQJA 2GN5A 3K0XA 2N78A 1XJVA 1Q81C 3RLFA 4DV2Q 5C0XG 1OXUA 1Q8KA 3NBHB 2CQOA 2E5LQ 4R4QA 4B3TQ 4JI5Q 4NXMQ 2OTJA 2VUMG 4P74A 4LUOA 4OWXB 3PGZA 3GTJH 1A62A 1XPRA 2IT1A 4MNOA 1VQNA 5IE8A 4A3GH 5IWAL 3PCOB 4NPSA 1FL0A 4A3EH 3AQQA 3UDGA 4JI0L 4IO9A 2JA7G 2VZAA 2PQAB 4GN4B 4YHHL 3G6EA 4A3FG 5IYCG 1X3GA 3CCRA 3CD6A 5EAYA 2NVTH 1AE3A 1J6QA 4DR6Q 4DR7Q 1ASYA 2MO0A 3JC66 2AWNA 1HNXQ 1N34Q 1VQHA 2F4VL 1W2BA 3HOVH 3PUXA 1JB7A 1KRTA 3F2BA 4GS3A 4LUVA 3G48A 5IYBG 3PF5A 4JI5L 4B3TL 1A63A 1YBYA 2VQFL 2PMZE 4JI6L 4NXML 4PZ7A 4HJAA 1V43A 4AH6A 2UXCQ 3GTMH 2IHFA 1VQGA 3HOUH 4DV0L 3CPFA 1I3QH 3M4OH 1BVSA 2V1CC 3KLWA 1WJJA 2JEAI 1Z9FA 3ER0A 3E9HA 4L5QA 2BA1A 2VNUD 4BXXG 1U5KA 2NZOA 3A5UA 1J5EQ 4HIKA 4A3LG 3KF8B 2H5XA 4LFAQ 2JA8H 3HOWG 3BJUA 3F8TA 4DUZQ 1TXYA 1KC8C 4HIOA 4HJ7A 3A5ZB 3T1YL 1QUQB 4R4TA 5DLQE 5C4XH 2AHOB 1HNXL 3FKIH 1I50H 2A1AA 2Q2TA 1L1OA 1QZHA 3CCEA 4IFDI 4A3KG 2XGTA 1PH7A 4R4IA 4OO1I 2E8GA 4EQ5A 2VQEQ 2C35B 1C0AA 3M4QA 3CC4A 4A3GG 2UXCL 1KL9A 1QVGA 1X54A 1Z47A 1CKOA 1PHJA 5M3FH 4X62Q 2B3GA 4A3EG 1X6OA 1OTCA 2Q2UA 2UXDQ 4DR5Q 4LF7Q 5FLMG 1Q46A 4XIGS 3UE1A 1M90C 1XTDA 4X65Q 3T1HQ 2YTXA 3K80C 3U58A 4LFAL 2E2JH 1YHAA 2GVAA 2MNAA 5IP7H 4DUZL 2K5HA 4A3BG 4OONA 2R92G 4RMFA 1MIUA 3RZDH 1UE1A 1PH1A 1X3FA 5JEAG 3KF6B 1PH6A 2R7DA 2WAQG 3J81j 1SFOH 1QVFA 3CP0A 3GTLH 3CC7A 4LW1A 1K3RA 1VQ4A 2NVQH 2VQEL 3STBD 2WAQE 2UUCQ 3HOUG 1G291 3I4NH 5M3MH 1VQLA 3PV0A 4A3IH 4YWLA 1Q86C 1U0LA 4GOPB 1RL2A 4MZ9A 3CQZH 3K7AH 3PUZA 2B29A 4X62L 4OXPA 1EFWA 4LF4Q 4LF5Q 4JV5Q 1YIJA 5M5WH 3S2DH 1YVCA 2UXDL 2I5LX 1LTLA 3CCJA 5GADC 2IX0A 1LM0A 4LF7L 1JE5A 1YITA 1X65A 4X65L 1IL2A 2K4KA 4DPGA 4BY1H 2ALYB 4QJFA 1XMOQ 2YV5A 1YNXA 3AYHB 1Y1WG 1G51A 1VQAA 2I5MX 3SGIA 2RF4A 2ZM6Q 3ZJYC 1EWIA 5FLXc 4HJ9A 4A3JH 3TREA 3FKIG 1NTGA 3PIPA 1MJEA 1SROA 1HNWL 1Q82C 5C0XI 2LXKA 3GDEA 4J15A 2NN6G 3CCUA 3TS0A 4GOPC 2LXJA 4YCVA 4UP9A 2OCEA 2A19A 4H02A 2WFWA 4B3RQ 4A3CH 3L0OA 2JEBI 2K75A 4IJLA 5M3FG 4BBSH 4JI7Q 5JEAJ 2BA0A 2JJQA 2Y0SG 4JV5L 4NXNL 4YCUA 3GTPH 4X6AH 3J80c 5AJ3L 3RN5A 2HT1A 3J7ZC 3W5OA 1VQ6A 4IOAA 3I2ZA 3U50C 1UE6A 3F2DA 1XMOL 2ZM6L 2AKWB 5FJ8H 5GQOA 4K0KQ 3HKZE 3K81C 4GN5A 4DK3C 1VQOA 3KFUA 2VQFQ 4JI6Q 2K50A 3KDFA 4BY7H 2JA5G 1GM5A 5M3MG 1NBWA 2KBNA 1NY4A 4DV0Q 4A3IG 4B3RL 3KOJA 2WP8J 3FHWA 1VQMA 4OWTB 1K8AC 3J81i 4JI7L 2R7FA 1YZ6A 3HKSA 1ASZA 3KJOA 4A93H 3CCSA 4DR4Q 4BY1G 1IBMQ 3PF4A 3HOXG 1VQ8A 4O2DA 1TWFH 4DV6L 2KCTA 2Q2IA 3T1YQ 3L7ZC 4BBRH 4C2MH 1YJWA 1BKBA 3I4MH 1PH4A 3CMAA 3MEFA 4K0KL 1D8LA 4DV3Q 1KRSA 2RHSB 5C44H 2ES2A 1SN8A 2EXDA 3PO3H 4JI8L 2EIFA 1JJ2A 3M7NA 2NVYH 1CSQA 2IHEA 4QL5A 4LF5L 3FP9A 3NENA 2KCMA 1AH9A 2DGYA 3HOZH 1WCMH 4LF8L 2AWOA 1GVPA 3E0EA 3HFZB 2UXBQ 3ULLA 4JYAQ 1BBUA 2E2HH 3RLNA 3TS2A 3NELA 3S16H 1I6HH 5JJLA 4QQBX 4DR4L 1RIPA 1IBML 2ZTEA 4LF6L 4LFBL 2HHHL 2ZTCA 4YWKA 3OTOL 4APVA 1EQQA 1C7YA 1UE5A 4UP7A 1PFSA 1VQ9A 3BU2A 5IY0A 2N3SA 4WJ3M 4P73A 4IJHA 4DV3L 5LMNL 3M9BA 4C3HH 4B3ML 2F52A 5LMNW 1T9HA 2CCZA 3TQYA 2ZJPA 5GAEC 1JJGA 3CCQA 3L2PA 3PUYA 1IZ6A 3AFPA 2ASBA 1GKHA 1KQSA 2UXBL 4JYAL 1Q1BA 2JE6I 2MFIA 4GKKL 4A93G 4WJ4A 4Y7NH 2YU9H 3EBEA 2JA9A 4A3DH 1E7ZA 3K7UC 3PUWA 4OX9Q 2ID0A 4JCVE 1K9MC 4IOCA 3GD7A 1UWVA 3UDFA 4LFBQ 3IRBA 3HOVG 3PO2H 5C44G 1HNWQ 3EN2A 2NN6I 3H0GH 4GLAC 3F1ZA 3PO3G 1H95A 1HNZL 2R93H 2N49A 2I5HA 1N36Q 4JOIC 1K73C 1NE3A 2CFMA 1HR0W 1YJNA 2Z6KA 1KHIA 4QGUA 4NB3A 4JI3Q 4UY8C 3W1BA 1WI5A 1VS0A 1MJCA 3H3VH 4QY7A 5HGQA 4DUYQ 2B63H 4QIWE 1AE2A 1TWCH 4LWCA 1L0WA 4P71A 5H1SE 4PZ6A 4NXNQ 1M1KC 5AJ3Q 4GNXB 2E2IH 1B8AA 2RCNA 2JA8G 3DM3A 2K52A 2UUAL 4P75A 3CXCA 1E1TA 1NMFA 3S15H 4R4CA 2R6GA 1V9PA 3CW2C 3S1NH 4OX9L 1VQCA 1KIXA 5C4XG 5IT9c 2HIVA 1OXTA 3D0FA 4PG3A 4DV5L 4DR2Q 4AIMA 1XPOA 2JQOA 4R4OA 3U4VA 3M85A 3CMEA 3JAMc 4HJ5A 1W3SA 1O7IA 3KJPA 1FVIA 4IPDA 2BH2A 3PIOA 4IPCA 1N36L 2QGQA 4KHPQ 1KAWA 1OXXK 4GNXC 1LUZA 1C9OA 3RZOH 1Y14B 4ME3A 4JI3L 4HIDA 1CSPA 3S1QH 1EQRA 1UEBA 4TQUS 4A4IA 1Q7YC 3CCLA 1CKMA 4DUYL 2DUDA 1YI2A 2UUBL 1SRUA 1EIFA 1NJIC 1E1OA 4YY3Q 2PNHA 1PH3A 2OWOA 4LFCQ 5JJKA 1TWGH 5IP9H 1P8LA 4A3DG 4JC0A 3AFQA 4BA2I 3HKZG 5IP7G 4DV6Q 4L5RC 5E7NA 3S24A 3S1RH 1X9NA 1X3EA 3PO2G 2NZHA 1OXSC 5IYBH 4A75A 4DR2L 3NEMA 1EYGA 2KENA 2R93G 4DAMA 4JI8Q 1HZAA 2ZJQA 4LF9Q 2VL6A 3RNUA 3D31A
chains in the Genus database with same CATH superfamily
3UE0A 1VQFA 1HA6A 1PMRA 2JSOA 4DV7Q 2LSSA 1GUGA 2MUYA 1TT2A 4X3SA 4ULLA 4ZKCB 2QA4A 2F0LA 4LF8Q 4C1NK 4B08A 3TP6A 4ALPA 4BXXH 4AQYQ 2KQ3A 1SYBA 4B3SQ 3LWUA 2ICEC 4LFCL 3X3MA 1K0RA 2A73B 4DAYA 1EEFD 2WB1E 1PH8A 1N8RC 4A3JG 1MGSA 4LJZC 3OTOQ 4R8NA 3HOVB 2I0QA 3VYTA 5IGFA 5ELOA 2IW3A 1E3PA 5LMNQ 1IBLL 2Z9HA 4LF9L 1B2TA 4DR3Q 2PI2A 1B44D 1SLJA 3GTMB 1DOLA 4C56C 5BR8L 1LYLA 4UHVA 5KGUA 3J7AV 2JA8B 5IP9G 2HQLA 4UP8A 2L5TA 2N8NA 1VQ7A 5FJ8G 4NKLA 2R7ZH 2YTYA 2E5LL 2K5VA 1HNZQ 2NVXH 2L15A 1EWHA 1R4QB 1HCZA 5C0XJ 1ESRA 3GTOH 1B3AA 2YU9B 5CC4A 4KHVA 2B2UC 1YEZA 4X64Q 4DR1L 1AZPA 3RMHA 3T53B 1I94L 1STYA 2PW7A 2KCCA 2RQXA 4F8MA 3PO2B 2UU9L 2JA6H 2EYMA 3ULPA 4JK1C 3GTLB 1V1PB 3NBIA 1KTKA 3HOZG 4JI4L 1N32L 1N9WA 2B2YA 1YNJD 3A7AB 1IXRA 1F2ZA 4ZKBB 3BZKA 4K2KA 1XTCD 4KD4A 1VQIA 3SHLA 3U4ZA 2A8VA 3GTKH 3AB9A 2QEJC 3PUVA 2E75C 1FNWA 4A3JB 1N33Q 3P7JA 3EFXD 4IALA 1OXVA 5C4HA 3J7A5 3CF5A 2SEBD 4NP5A 1Q12A 4PMWA 3A7LA 5JPNC 1SNQA 3K59A 1PRTC 1FGUA 2Z0SA 4JBKA 4LNQA 3MVVA 3GQBA 4DR5L 2RHQB 2IWHA 1ZYRD 1KDAA 1PH2A 1TWGB 5CV6A 3TEHB 3WWVA 1EQVA 3J81c 4R1JA 1WYDA 3RN2A 4PZ8A 4XTCS 1BUVT 4EQNA 5J3BA 2F0EA 2PPBC 1KDCA 3UDIA 1JT8A 1IBLQ 4A3MG 3P1HA 2UUCL 2BOSA 3I72A 2F0HA 2KA7A 1GHJA 1GUTA 1RD9D 2B2VA 2Q2HA 3DM1A 4HCEA 1ILQA 1B53A 3A8KE 4LF4L 2F4IA 4LUZA 2HDMA 4DV4L 4N8X1 1WTRA 1TWAH 4EQOA 1IYJB 1TWHB 3EQLC 2K14A 1SMXA 4OEMB 4CBVA 2HIXA 1VQJA 2C9OA 2N78A 1WTWA 1XJVA 3RLFA 5C0XG 3NBHB 1QJOA 1VMCA 2E5LQ 2DNEA 3GP7A 4NXMQ 2NVYB 4LUOA 3PGZA 1XPRA 4MNOA 4DF7A 5IE8A 4A3GH 5IWAL 3HOZB 3N6RA 1FL0A 1NCVA 3AQQA 3H6MA 3UDGA 4YHHL 1GUWA 2NVTH 2R61A 2ENBA 5KNBA 3JC66 5EPKA 1VQHA 2F4VL 1GJXA 3BVGA 3PUXA 4WJWA 3F2BA 1QNUA 2F0PA 4GS3A 3G48A 5IGGA 1Z7TA 4JI5L 2PMZE 4PZ7A 1V43A 4KN7C 1SMYD 4E6IA 2V1CC 4RCNA 1HQMC 1XX8A 1L0XB 1YNND 4A3LG 2H5XA 4LFAQ 4Y7NB 2EDGA 1TU2B 1KNEA 3MXPA 3L9AX 3KLRA 1QUQB 4R4TA 1HNXL 2A74C 2Q2TA 5A2QE 1QZHA 1QE6A 4A3MB 3HEJA 1SE4A 2E8GA 1F9RA 2VQEQ 1TQOA 3SE0A 1LT3D 1KL9A 1QVGA 3HZXA 2B2TC 1X54A 4FXGC 1Z47A 2NBFA 1HRJA 4PMCA 1OTCA 2UXDQ 5J1ZA 4DR5Q 5FLMG 2K01A 3UE1A 1M90C 1XTDA 1NR4A 1Q90A 3U58A 2E2JH 4ID6A 3S15B 5E1FA 4A3BG 3S1NB 5CV8A 2R92G 2RDHA 1MIUA 1SNCA 1UE1A 5JEAG 1KNAA 3R2IA 5FK9C 1PH6A 3OSOA 3PQIA 4K8IA 3CP0A 3H3VC 4LW1A 1K3RA 2UUCQ 1LO5D 3MEHA 1G291 5DNFA 3I4NH 2Z4HA 5M3MH 1VQLA 2J0TD 2KHSA 4YWLA 4I7AA 1U0LA 2PQEA 2CQAA 3NP8A 2B29A 4LF4Q 4JV5Q 3C3LA 1LTLA 2IX0A 1IL2A 4X65L 3A55A 4BY1H 3M7NA 4U68A 1RODA 1VQAA 1Y1WG 3S1RB 5FLXc 2PMZB 3FKIG 3PIPA 1MJEA 4QB4A 5C0XI 4J15A 1BCPC 3SK8A 2MGSA 2EY6A 1CZWA 4DK0A 2OCEA 5LL6S 2WFWA 1PZKD 4IUNA 1FR3A 2K75A 4IJLA 1WTHA 1BXTA 2A5HA 1BOSA 4X6AH 4NXNL 3GTPH 3J80c 3W5OA 1EFID 4IOAA 2ZM6L 4K0KQ 2DNCA 3K81C 4GN5A 2K05A 2EYPA 5M5YB 2K50A 3KDFA 3FRPB 1GM5A 4EGVA 1NBWA 1TVXA 3FHWA 3DUZA 2F0WA 2XN9C 3J81i 5CV5A 3M4YA 1JOOA 4DR4Q 1IBMQ 4O2DA 2PW5A 1K83B 5ELCA 4A3BB 2R92B 3JAME 2Q2IA 2PCFB 2K5QA 1YJWA 1BKBA 3CMAA 1SDFA 1D8LA 1PXUA 2IPKD 2K04A 2ES2A 4OELB 1I4QA 3A8JE 4DK1A 3SK6A 1WCMH 5JJZA 1GVPA 4JYAQ 4F7XA 2DN8A 3RLNA 4EVOA 4JW0A 4XYQA 3S16H 4IZ8A 5J22A 1RIPA 1Y1WB 1EY8A 4LF6L 1LLRD 5M5XB 3FKIB 1UE5A 2A6HC 1VQ9A 4I65A 4P73A 4IJHA 4OIJA 4C3HH 1WD0A 2EZVA 5IGBA 5LMNW 2EE1A 4H0LC 1HUMA 1VF7A 3CCQA 3U9SA 5ELDA 2ASBA 3NTIA 2MFIA 4A93G 2LY7A 3K7UC 1K9MC 3M3YB 5E4WC 5C44G 3H0GH 4GLAC 3F1ZA 2WKCA 5CBEE 3RNUA 4X3UA 1N36Q 2I5HA 2HQEA 1K73C 2Z6KA 4KY6A 3VR6A 1U4LA 2F03A 3H3VH 4OHJA 4QY7A 2B63H 4QIWE 3S2HB 1L0WA 4NXNQ 3W2DA 4WORA 4RHRA 3URYA 1ILPA 4P75A 3OMGA 3H94A 5CV7A 4OX9L 1KIXA 2EJGC 4DR2Q 5FO8B 2F0NA 1O7YA 2JQOA 4R4OA 3U4VA 1ZEQX 3M85A 2AUJD 4HJ5A 1EZ8A 4O1NA 4IPCA 1OXXK 3TN2A 3D4DA 3OMCA 4JI3L 3ND8A 2WACA 2BDNA 4CDDC 4HIDA 1EQRA 4A4IA 1Q7YC 4R8IA 1HFNA 2OWOA 1ET9A 1E1OA 1PH3A 1EYCA 3NK9A 1KABA 3DWAA 2Q8IB 3D6WA 4A3DG 3AFQA 3HKZG 3VYUA 5IP7G 1VMPA 4B9WA 4HTHA 3Q24A 2HCCA 4XT1B 1S5ED 5IYBH 2K6AA 3OOCA 2KENA 4DAMA 2ZJQA 1HZAA 3R93A 4IUPA 1LTRD 1S5FD 4Q5VA 4KHZA 4L5SA 4POGA 1VQEA 2ZXRA 1CKNA 4IFDJ 1X32A 1VQPA 4A93B 1HZCA 3IFDA 4YY3L 1AW7A 4DNIA 4JI1Q 1TWFB 1S4ZA 4LF6Q 2YTVA 4H13C 2RCFA 3S14H 4ODGA 5C44B 3BVMA 1AN8A 4P2CB 4A3KH 1IW7C 3D8GA 1YJ9A 1CTMA 1IBKL 1BCPD 5ELBA 2MQHA 3J80i 3M4OB 1I3QB 4DV7L 1LT5D 3EIVA 3C1FA 5IYDH 4BBSG 2E2HB 3K8AA 1I6HB 4AQYL 2YYZA 4B3SL 1SR3A 1G91A 3MWYW 4IURA 4JG2A 1WTVA 1S3OA 1G6ZA 1TY0A 2PQAA 4UPAA 2NTSA 5CMDA 1BQQT 3I55A 3EA6A 4DV1Q 4DR3L 2RKSA 2PNRC 3MA2B 1V1QA 3TP7A 4IPGA 1A3UA 2L12A 1G6PA 3QOJA 3I3CA 5BN4A 2F0DA 2XWJB 5EKKA 2F0VA 4RGNA 1X56A 4A3DB 3HKZB 1D6EC 2D62A 4KLKA 1N34L 3GO5A 3RZDB 1PTOB 2CWPA 1JQYD 4BBRG 3S1MH 3I4MG 2NN6H 3SEBA 3MC0B 1F2LA 2PI2E 5JJIA 2B8FA 4HIMA 1SAPA 4XYOA 1U9RA 4GKJQ 3BDOA 2SNMA 2JK8A 2F0QA 1AZQA 4RWSC 5IT9L 2RA4A 4PMBA 1ONLA 1VCIA 1GD7A 1S5DD 4X64L 4OGQC 1M4VA 1YHBA 3OWEB 2R7ZG 4IFDG 1PYSB 4IQZA 2A6HD 1B50A 4A76A 4X3KA 4CGYB 4GLXA 2BE5C 2JA5H 1LV9A 2MO1A 1E22A 1ENCA 1K8GA 3KF6A 3J80L 1XXGA 1H9SA 5LMUQ 3SXHA 1EQTA 4BBSB 1EOTA 4DK6C 4GN3B 4YCWA 4OWWB 1PFMA 1EEID 2CWAA 1PH5A 2JA7H 3GTQH 4A3FH 1B9NA 3HOXH 5IYCH 4GOPA 2CH4W 1D7QA 3PSIA 2ZJRA 1N33L 1BBWA 2P5ZX 5I6YA 2XSCA 2JA6G 1WTXA 3L3OC 1A0IA 3I91A 2F0MA 3ERSX 1IBKQ 2BH8A 4DAPA 1HZ9A 3TZUA 1SNOA 4DAYB 1R9TH 1K3BC 3VR5A 2A69C 4JI0Q 1STHA 2A68D 2F0KA 3KYHC 3QWNA 2WB1G 4Y52H 4X3TA 2Y0SE 1VQBA 3HOWH 1LT6D 3H91A 4DR7L 5GAHC 3I4OA 1CFMA 2GN5A 4BBRB 3I4MB 3KLSA 1OXUA 2CQOA 1DOKA 1LT4D 1V1OA 4B3TQ 1CQFA 2OTJA 1IKMA 4P74A 3GTJH 3I4LA 1A62A 5A35A 5KYLA 4K5XA 4ZQ3A 1O78A 5J39A 3PCOB 1H9KA 4NPSA 3DHQA 4UDUC 4RKBA 5FOBB 1W6KA 1SSOA 3QB3A 3G6EA 2K5DA 3K6OA 3IL8A 3WOEA 2WIIB 2EPBA 2AWNA 1G8ZD 1N34Q 1UNSA 4G4KA 3R8BA 4KY7A 2R7ZB 3HOVH 1EYDA 4FF2A 1JB7A 1KRTA 1TS3A 3PF5A 2NVXB 1J8IA 4IUTA 1YBYA 1FNUA 4DGZA 4NXML 2MP1A 1MI2A 5E3FA 4AH6A 3GTMH 2IHFA 4QCLA 1C4QA 4HR7B 3HOUH 1CT1D 3KK7A 3CPFA 1RTOA 2C5CA 4GZYC 2BA1A 2WKDA 1U5KA 2NZOA 4HIKA 3CRLC 5I9PA 2JA8H 3BJUA 3IFTA 4HIOA 3A5ZB 4Q0FA 4RAUC 3T1YL 1JWSD 5DLQE 1JC7A 4NMZA 1I50H 2F0UA 3DEOA 1Z6HA 2JA6B 2A1AA 2JP1A 4IFDI 3C2PA 1Y8PB 4EQ5A 5CV4A 2QF7A 4A3GG 2F0GA 4TSSA 3KBXA 1D5ZC 4X62Q 5M3FH 2TSSA 3CHBD 1E2ZA 2WB1B 2YTXA 1CM9A 4LFAL 2JN4A 3BG3A 1YHAA 2GVAA 1J9OA 1U4PA 4OONA 4RMFA 1ICWA 5ELEA 3J81j 3GTLH 1D1IA 4RKLA 1I4HA 4PV1C 1VQ4A 2VQEL 4IUQA 1K8MA 1JWMD 1W6JA 3PV0A 4A3IH 1RL2A 4K14A 2SDFA 3K7AH 3K5OA 3PUZA 5C5LA 1QNKA 2UXDL 3DWQA 1YVCA 1JORA 2I5LX 4UAIA 2LFNA 1X65A 4KN4C 1F9SA 2B39A 5IGEA 1CA6A 2YV5A 4DR7Q 5C5MA 2RF4A 4A3JH 4HJ9A 1EWIA 1LTBD 3TREA 4DNRB 1LTAD 1STAA 2LXKA 2EVBA 3CCUA 3TS0A 4NDXA 4OIKA 1GUSA 5ISRA 1XWEA 2O5JC 4JI7Q 5JEAJ 4C3IG 4G7HC 2JJQA 4JV5L 4YCUA 5G3LF 3RN5A 5AJ3L 4HCSA 5I2YA 3N52A 3SR1A 1VQ6A 2NTTA 1UE6A 3F2DA 2K33A 2CH4A 5FJ8H 3KUPA 2L4NA 2IX3A 1KLGD 4DK3C 2EY2A 5EQ0A 4U673 3KFUA 5KNDA 4PNYA 4A3GB 3TSSA 1LABA 5M3MG 2KBNA 5FKAC 2BE5D 1NY4A 3S17B 1BR9A 1PFBA 2K1BA 5FO9B 2XWBB 3HKSA 2AQ2B 2SOBA 4BY1G 3QJYA 2NZ1D 3T1YQ 1RF2D 4C2MH 4RH6A 2AUKA 1PH4A 4K0KL 5KEEA 4DV3Q 2RHSB 1SN8A 3VA7A 3NTHA 3PO3H 4JI8L 2EIFA 2NVYH 1CSQA 2IHEA 4J6HA 4LF5L 2KCMA 1AH9A 3NBHA 5L37A 3HOZH 1NUCA 4ZUIA 1NNXA 4DNTB 5CV9A 5JJLA 4K6LA 2FJ2A 4QQBX 4DR4L 1IBML 1HQRD 4LFBL 2HHHL 2CVRA 1PTOF 3O13A 2LS01 1EQQA 1C7YA 1PFSA 5D3IB 3VYSA 1S5CD 4DA2A 4WJ3M 3M9BA 5C4JB 4I7ZC 3MFYA 3TQYA 3E6ZX 4QMGA 2ZJPA 1JJGA 2KECA 2B2UA 4C3IB 1GKHA 4JYAL 4M8AA 4CHTB 4Y7NH 1EY6A 3EBEA 4ABNA 1LTID 5EJWA 1E7ZA 3PUWA 2ID0A 2M9VA 3K57A 4IOCA 3GD7A 4QF4A 3IRBA 2R93H 3K58A 4RHSA 4JOIC 1NE3A 1TS4A 4FXKC 5M3MB 4QGUA 4NB3A 2HUGA 3QG1A 3W1BA 1VS0A 5HGQA 4DUYQ 3NXWA 4P71A 1QB5D 1M1KC 5AJ3Q 4GNXB 4BY1B 1B8AA 1GOZA 1U4RA 2UUAL 3MXNA 1A3TA 3S15H 4R4CA 1V9PA 3S1NH 5C0XH 5C4XG 5IT9c 4DV5L 3I90A 2VB3X 1SYCA 2B8GA 3MXGA 4CDEC 1W3SA 1FVIA 4IPDA 3W3AA 2BH2A 3PIOA 1N36L 2QGQA 1SNMA 4KHPQ 1KAWA 5DM63 3RZOH 1Y14B 2EYOA 2K03A 4ME3A 1CKMA 1CHPD 2DUDA 1SRUA 3C46A 5EKIA 3A56A 4RA8A 1PZJD 3VR2A 1P8LA 4JC0A 3GTGB 1BO0A 1S5BD 3S1RH 4MIUA 3FEWX 2NZHA 1OXSC 5DAUA 4A75A 4DR2L 1EYGA 1CK1A 1SE2A 4JI8Q 1SNDA 2VL6A 5IIFA 3D31A 5FO7B 3OYYA 1VDZA 4C3JH 4LF5Q 3G4SA 2XTIA 2EOTA 3OW7A 1PRTD 1B9MA 2B63G 2IY5B 5C3EH 2FXQA 4A3LH 1X55A 1Y69U 4IUUA 4LK1C 1HZBA 2L11A 4LFBQ 1KD1C 2D0PA 2HHHQ 1B7YB 3VDYA 2RDGA 1ZXTA 1QVCA 1STEA 3ERQA 4YIJA 4EX5A 4FDBA 4LMQD 3F2CA 5M5YH 1JMCA 3W1GA 1VQKA 1XMQL 4A3CG 1PV4A 2Z8LA 3A0JA 5EKLA 4X66Q 2GVBA 3J81E 5FLMH 3S16B 1B70B 2F3IA 1L1OB 5GROA 3BZCA 4JI1L 4YWMA 1SXTA 1NSNS 3A8IE 1K83H 4A3BH 2R92H 5C4XB 3X3NA 5IODA 4DV2L 4ZRZA 4TVAB 4KI0A 1HR0Q 4OO1H 2O4XA 3VYRA 2OQKA 1Y1VH 3MXUA 1F2MA 1I4XA 4BY7G 4BA1I 1PYBA 5T1IA 2H1EA 2OTLA 1MKHA 2V4DA 3HOYH 2O5IC 5ELFA 4JI2Q 2WV6D 2N88A 4G7OC 1Y1WH 2UUAQ 3U9OA 1SYGA 1XNRQ 5M5XH 1M8AA 1VQ5A 1KLUD 3T56B 4L5TA 4DV5Q 1ICFB 3PIO3 1CQVA 2B2TA 3GV3A 4XXEA 1SFOB 2KHJA 4O0AA 2NVQB 4DV1L 1X3QA 2KOLA 5HY6A 5K36H 3G7LA 1JJCB 3IAYA 3T13A 1TIID 4L8JA 2B63B 3ULJA 5IYDG 3CQZB 1XNQQ 5M5WB 3S2DB 1HTPA 1XPUA 1PTOC 1J5EL 4O42A 4CDFC 4AYBG 1STGA 3JAML 2HCIA 2J7ZA 3FVQA 3LGJA 3OWFA 4JBWA 4JOIA 1Q8IA 3M3YH 4AYBE 1F77A 4P72A 4EQPA 3G71A 4DFAA 3CCVA 2QEXA 1EIGA 2CHBD 2VUMH 1Q1EA 3DLLA 4ZK9B 2F0JA 3VA5A 1CA5A 1FJGQ 4GKJL 2M00A 2GA4B 4V190 4JPBW 1GUNA 1EIYB 1PVOA 4GLVB 3H3VI 2D0OA 2PZWA 3I73A 3S2HH 1DGSA 1E24A 3T1HL 3Q23A 1WFQA 3SDZA 3E9IA 1K28A 1Q3LA 4IUVA 1HPCA 2EY5A 1K0SA 3B6YA 1EY5A 1CKNB 1PA6A 1CUKA 1JOQA 1A2UA 1CZGA 1FNVA 4BY7B 4FXDA 4M1UB 1WOCA 5CORA 4XQQA 1XMQQ 3UDXA 5KYIA 5LMUL 5ELNA 1GO3E 2F0OA 1DYQA 4KJOA 2RDFA 1HJPA 4TKOB 1WD1A 3EVQA 4QUCA 1JOKA 3H15A 4DV2Q 2LMCB 4J8QA 3S9WA 4LAAA 3BS1A 4OWXB 3BVZA 1I4GA 2IT1A 1DCZA 3MZ5A 4QIWB 4ZUJA 2M2LA 4A3EH 4JI0L 5COYA 2FINB 4J1MA 2JA7G 4KMUC 2VZAA 3OIPA 2PQAB 4GN4B 4A3FG 5FLXE 2Q8RE 2IL8A 3LWEA 1QG7A 4AYBB 4N9TA 5IYCG 3CCRA 3CD6A 5EAYA 1J6QA 1QILA 1I4RA 2MO0A 3G6JB 2ICIA 5IGCA 4LUVA 4B3TL 2VQFL 2OF1A 5IOCA 4JI6L 4HJAA 2UXCQ 1VQGA 3TDQA 4DV0L 3ONAB 2X6GA 3M4OH 1I3QH 1BVSA 3J80E 2PO4A 1WJJA 2JEAI 1TY2A 1Z9FA 1DXMA 5M9OA 5K5PA 2VNUD 1QOHA 4BXXG 3A5UA 1J5EQ 4K8JA 3KF8B 3HOWG 4DUZQ 1KC8C 2EYLA 5NUCA 3CRKC 3S1MB 2AHOB 1U4MA 3K5NA 3FPPA 2EYFA 2I46A 3CCEA 3WDNA 5CBAE 2XGTA 3QO2A 1PH7A 4R4IA 1C0AA 1ML0D 1XYIA 1H9MA 2KJXA 1PRTF 1CKOA 2XRSD 1X6OA 1TWCB 3TBIB 4LF7Q 2QILA 1MSHA 4XIGS 4CJ2C 3T1HQ 2E2IB 3K80C 1JCKB 2B2YC 5IP7H 1AFPA 5KIXA 5D14A 3RZDH 1PTOH 1X3FA 1DOMA 3KF6B 1H9SB 3TP8A 1QVFA 2DY8A 3CC7A 1HTLD 4R9WA 3HOUG 1MD2D 1Q86C 4RGOS 1K8OA 4GOPB 3S1QB 4K5VA 4X62L 2EY1A 1EFWA 3GTQB 2JA7B 3OIQA 1YIJA 4A3FB 5GADC 1JE5A 5C3XA 2IJ0A 5I6WA 2ALYB 1XMOQ 1YNXA 3AYHB 3SGIA 3ZJYC 3CKIB 1L0YB 3ZYYX 1A15A 1O7LA 1DD2A 1HNWL 1Q82C 3GDEA 3UI2A 2FMCA 4YCVA 4UP9A 2A19A 4JVZA 4B3RQ 4ZCKA 3R3OA 1WTQA 5M3FG 4BBSH 4MTKA 2BA0A 2Y0SG 2HT1A 3HOWB 1MBYA 2B2VC 3J7ZC 2OEOA 3I2ZA 3U50C 4QUFA 1SE3A 1I4PA 2ZXOA 1G2TA 1VQOA 4RFBA 2VQFQ 3A54A 4CJ1B 4JI6Q 3P75A 5EBDA 4DV0Q 4A3IG 3RUZA 3KOJA 1Y8NB 1ENAA 1VQMA 5E4XA 1YNNC 2WINB 1K8AC 4JI7L 1KAAA 2X69A 1EY7A 2R7FA 1YZ6A 3OPOA 5C3WA 3PF4A 2JXMB 1AEXA 1VQ8A 4DV6L 2G9DA 2KCTA 1H9JA 4BBRH 4FNFA 3I4MH 3TMEA 5D3DA 1KRSA 2K32A 2DJGC 3NSWA 2EYHA 1IYVA 3HOUB 4KD3A 2F0SA 3FP9A 1FGBD 3E0JA 2J4XA 2QW7A 3E0EA 1PFNA 3HFZB 4MHEA 2UXBQ 3GTOB 1BBUA 3D4RA 3DEPA 3TS2A 3NELA 3LNNA 2DY7A 5EPLA 1KDBA 2ZTEA 3J7YW 4YWKA 3Q22A 1I50B 4APVA 2QDBA 4IFDH 5TSSA 4DV3L 2FHTA 4B3ML 2F52A 3AMUA 1T9HA 2RVLA 1ET6A 2CCZA 1IW7D 4RGTA 5M3FB 4G7ZC 1IZ6A 1KQSA 2Y0SB 3GV6A 1Q1BA 2F0TA 4FF3A 4GKKL 2Z6BA 3GTKB 2YU9H 2JA9A 4ZYSA 1F2YA 4KKUA 4JCVE 2EXZA 1UWVA 3UDFA 1HNWQ 3AU7A 3HGBA 3PO2H 3DMUA 4DXFA 3PO3G 4ZAIA 1H95A 3NWTA 2N49A 1HR0W 1YJNA 2TMPA 3EJIA 1BCPF 1KHIA 4A3IB 2K7VA 3K7AB 3T4AC 2VXWA 3K5MA 5HURA 1V1PA 4LWCA 1GUOA 3TP5A 4PZ6A 3V96A 1JWUD 2SNSA 1Y8OB 2RCNA 3NTKA 2K52A 4WFN3 3CXCA 1NMFA 1RKNA 1EWCA 5EGTA 2R6GA 3CW2C 3MHBA 4PG3A 2MJ8A 1BDOA 4AIMA 2CW0C 3JAMc 1PYWD 1HHVA 1O7IA 2L0CA 4H7BA 2KEEA 3E5SA 1SYDA 5T1GA 4CKEA 4GNXC 1LUZA 3LX0A 5I9OA 1H9RA 1CSPA 4G57A 1UEBA 2A6EC 4DUYL 4NW2A 2UUBL 1NJIC 1T5XD 4LFCQ 2PNHA 1WTOA 1TWGH 1TWAB 5IP9H 3I70A 1STNA 3HP3A 4DV6Q 4L5RC 2E2DC 2HD3A 4FF1A 1C48A 5CGKA 1X9NA 1X3EA 4ILWA 3NEMA 2R93G 4HSPA 4LF9Q 1RTNA 3ITPA 1O80A 4KHPL 1YHQA 3I4NG 3MTSA 1NMGA 3NUCA 5BR8Q 1EOVA 3IKJA 1E0BA 5LL6X 1D5XC 1RHPA 5GAGC 3AEVA 4KV6A 3FMCA 3RLOA 2NVTB 1TWHH 1DZ1A 4C2MB 4DXGA 1VF5C 1UE7A 4MN3A 1S72A 2EYJA 5I2XA 3TRZA 2F1MA 3PO3B 1SYEA 1SBBB 3OW2A 4B3MQ 3RR5A 1PH9A 4CKBA 3S17H 2ZXPA 1I5FA 2VS1A 5LHY1 1CHQD 1LTSD 3A74A 3CPWA 4GKKQ 2A69D 2EQSA 4PQXA 4FO2A 3K5LA 2CKZB 4DR1Q 1I94Q 1QZGA 2UU9Q 4XDXA 3FPUB 5C4ZA 2MPMA 1QCBD 3STBC 1HH2P 1SJHD 2R3ZA 4C3JG 3EROA 4BWGB 2N55A 4MTNA 1EYAA 1ESFA 1L1OC 4JI4Q 1N32Q 2PYKA 2OXPA 2K28A 5C3EG 1HFGA 4RG1A 4X66L 4XQJA 2XNAC 3D4WA 4DR6L 2E2JB 1KXLA 2KCNA 1E2VA 1EUJA 1IL8A 1FD7D 2FFKB 5DEHA 4JBJA 3I56A 2OQ0A 2I07B 2R93B 2NUCA 5C4JH 1SE8A 1HR0L 2K5NA 4A3MH 2G9HD 5EPJA 1VQDA 3RD4A 1BF4A 1QUQA 1JB3A 4N9PA 3I4NB 1WTPA 4HJ8A 3MXNB 1EZ6A 3Q8DA 1WCMG 4C3IH 2KHIA 1PRTB 2ZTDA 4DKAC 2Z6KC 2UUBQ 4IPHA 4K5WA 4JI2L 2ATWA 1P16A 1XNRL 3F2UA 1I6VC 4DAVA 3CU7A 5JPMC 3MFGA 2F3VA 5KNCA 2VY3A 3NE5B 4OO1G 4C3HG 1Y1VG 4KKTA 1GXDC 2RSNA 5F2DA 3RZOB 4POFA 3M4PA 2IX1A 2RBMA 3NWSA 1EY0A 4KJNA 1XNQL 3MAQA 1SYFA 3GTPB 3HOYG 4DV4Q 4JBMA 3ND9A 3DXJC 5CYUA 2OT2A 3CAMA 3CC2A 2B2WC 2BDOA 4CDCC 3KDFB 1L2FA 4GNXA 5A2QL 1A8VA 3HS0C 3K0YA 3H0GG 5HGTA 5C6AA 3CCMA 4C3JB 5K36G 5IWAQ 1FJGL 3I7FA 3Q0AA 5C3EB 5DM73 1PDQA 2XIWA 2VW9A 4YHHQ 1PLFA 2AMCB 3V2TA 1V8QA 4HMIA 3BZDB 3JAMi 2VB2X 3ICEA 3GTGH 1S40A 2F4VQ 3K0XA 1Q81C 1IKLA 1EY4A 4RGMA 1Q8KA 4JI5Q 4R4QA 2NB0A 2QKIC 2VUMG 4ME5A 2CW0D 1VQNA 2QCPX 1SEBD 4FVMA 1A2TA 1WCMB 4Z9CB 2KVMA 1AP0A 2AQ1B 4IO9A 3FDTA 2A6ED 1B1ZA 1X3GA 4DR6Q 1AE3A 4HN7A 1ASYA 1HNXQ 1IHZA 1W2BA 1F9QA 5JEAH 1UEAB 1JE4A 5IYBG 2RSOA 4C3HB 1A63A 1Y1VB 3J7AF 3QOLA 1NAPA 4CKCA 3BYTB 5JAVA 1LTGD 1OO9B 1RCVD 3QR8A 1B3QA 3KLWA 1ENFA 1E2WA 3ER0A 3E9HA 3HOYB 4L5QA 1R4PB 2DJFC 2X6LA 3F8TA 4B9XA 1TXYA 4HJ7A 2F0FA 5C4XH 2L1BA 3PMFA 3FKIH 4K6DA 1L1OA 4F87A 5JVH3 3H0GB 4A3KG 4K2LA 2PZUA 4OO1I 4HMJA 2C35B 4BS9A 3M4QA 3CC4A 2UXCL 2HDLA 2KUMA 2XRQD 1C8CA 4OL7A 1PHJA 4A3EG 2B3GA 1EU4A 2Q2UA 2G5DA 1Q46A 1QWYA 4X65Q 3PIP3 2MNAA 4DUZL 1IYUA 2H4OA 2K5HA 3HG9A 1SJED 1RDPD 1PH1A 3WOFA 2R7DA 3T51B 2WAQG 1SFOH 2VUMB 3NPPA 2NVQH 3STBD 2WAQE 4S3SA 2BCOA 1II3A 2A68C 2K5WA 3TZDA 4MZ9A 3CQZH 1BCPB 3J81L 4OXPA 1RJTA 4XQNA 5M5WH 3S2DH 3CCJA 4LF7L 1LM0A 1YITA 1HXYD 3HRZC 2AQ3B 2K4KA 2E74C 3I8ZA 4DPGA 2NWGA 4QJFA 1G51A 2I5MX 2D9UA 4XT3B 2JYOA 5EBCA 2ZM6Q 1NTGA 1UUPA 3SK5A 1SROA 2MHVA 1WVLA 2NN6G 2D5DA 4GOPC 1NR2A 3VR3A 2LXJA 3V05A 1CI3M 4H02A 4A3CH 3L0OA 5I4DA 2JEBI 2B2WA 1MSGA 1D5MC 1HA5A 3KLSX 4KY5A 2F3WA 1O7ZA 1XMOL 2AKWB 5CR3A 3S14B 5GQOA 3HKZE 5JOBA 5KRUA 4A3KB 1DM0B 4DN4M 2XVSA 4BY7H 2JA5G 1B4OA 4ZLTF 4B3RL 1EIHA 1TKWB 2WP8J 4A3EB 4OWTB 1FYCA 5JVG3 1ASZA 1TS5A 3KJOA 4A93H 3CCSA 5IT9E 4V0BA 3HOXG 1TWFH 1BNZA 3L7ZC 1T5EA 3NHHA 3OHXC 3BDCA 3MEFA 2QDLA 2WAQB 3BDLA 5C44H 2LKVA 1A6XA 2EXDA 3H09A 2Z4IA 5BN5A 1TR5A 1JJ2A 1BBXC 4L63B 4QL5A 3NENA 1YNJC 2DGYA 2L55A 4LF8L 2AWOA 3ULLA 1D2BA 2E2HH 2ZT9C 2L9HA 3T16A 1I6HH 1PZID 2FMMA 4HEDA 2ZTCA 4KTAA 3OTOL 4UP7A 5BN3A 1EU3A 3BU2A 4L6TB 5IY0A 2N3SA 4CJ0B 5LMNL 3D3RA 3R2TA 1ZKOA 3D6CA 3NQIA 3SVMA 1LACA 3P20A 1HUNA 4H44C 5GAEC 1GHKA 1ZYRC 3SK4A 3PUYA 3L2PA 2EJMA 3AFPA 1A3VA 2UXBL 5D65A 5G3LD 3E3XA 2JE6I 2EJFC 1MHWC 1DJRD 4WJ4A 4HSVA 4A3DH 3QIAA 3NQTA 5AFWA 4KK7A 4OX9Q 2D2CC 4C1NI 1JICA 3M7GA 3KF8A 4HAEA 3HOVG 1SNPA 3KBGA 3EN2A 4IN3A 2NN6I 4RCOA 1HNZL 3BYYB 2JA5B 2CFMA 1STBA 2F0IA 4JI3Q 4UY8C 1TS2A 1WI5A 4N8FA 1MJCA 4F88A 4FYDA 1LTTD 1DONA 1AE2A 1TWCH 3DWPA 5FLXL 5H1SE 2PZTA 4WRDA 5IGDA 2E2IH 3HOXB 2JA8G 3DM3A 2NYZD 1E1TA 4KKSA 1EL0A 1VQCA 2HIVA 1OXTA 3D0FA 1XPOA 3CMEA 2KEDA 3Q6SA 3KJPA 1F9PA 4FP5D 1EY9A 1C9OA 1R9TB 4TRDA 2O2LD 3S1QH 3CCLA 4TQUS 3VR4A 1D1KA 1X3PA 1YI2A 1EIFA 4YY3Q 2Z1CA 5JJKA 4FF4A 4BA2I 1PTOD 2E76C 5E7NA 3S24A 1G2SA 3PO2G 4DU9A 3C1EA 2Q8TA 1UAPA 3GTJB 1SMYC 1JR0D
chains in the Genus database with same CATH topology
4KHZA 4KHPL 3OYYA 1VQFA 3UE0A 4C3JH 3G4SA 2XTIA 4DV7Q 1YHQA 2LSSA 1VQEA 1NMGA 4L5SA 5BR8Q 4POGA 3I4NG 1EOVA 2QA4A 1CKNA 4LF8Q 2B63G 4IFDJ 2IY5B 5C3EH 2FXQA 1VQPA 1HZCA 4ALPA 4BXXH 4AQYQ 5GAGC 3AEVA 4B3SQ 1X55A 4A3LH 4YY3L 4LFCL 4DNIA 4JI1Q 1K0RA 3RLOA 4LF6Q 1HZBA 2YTVA 1TWHH 2WB1E 2D0PA 1PH8A 1B7YB 1KD1C 3VDYA 2HHHQ 1N8RC 4A3JG 3S14H 3OTOQ 1UE7A 1S72A 3TRZA 2I0QA 1QVCA 4EX5A 4FDBA 4A3KH 5ELOA 3OW2A 1E3PA 5LMNQ 1IBLL 3F2CA 4B3MQ 5M5YH 1YJ9A 1IBKL 4DR3Q 2PI2A 4LF9L 1SLJA 2MQHA 3RR5A 3J80i 1PH9A 3W1GA 1JMCA 4DV7L 3EIVA 1XMQL 1VQKA 3S17H 4A3CG 5BR8L 5IYDH 1LYLA 1PV4A 1I5FA 3A0JA 4X66Q 2VS1A 2GVBA 4BBSG 5FLMH 3A74A 3K8AA 3CPWA 1B70B 4AQYL 4GKKQ 2YYZA 2EQSA 4B3SL 2F3IA 5IP9G 1L1OB 1SR3A 5GROA 2HQLA 3BZCA 4JI1L 2CKZB 4UP8A 2N8NA 4YWMA 4DR1Q 1I94Q 1K83H 4JG2A 2R92H 4A3BH 1VQ7A 1S3OA 5FJ8G 4DV2L 1QZGA 2PQAA 4TVAB 4UPAA 2UU9Q 2R7ZH 2YTYA 2E5LL 4KI0A 3STBC 2K5VA 1HR0Q 3I55A 1HH2P 1HNZQ 2NVXH 2OQKA 1Y1VH 4DV1Q 2L15A 4DR3L 4BY7G 1V1QA 4MTNA 4IPGA 1L1OC 4JI4Q 5C0XJ 4BA1I 1N32Q 1G6PA 1PYBA 5C3EG 4RG1A 4X66L 3GTOH 2OTLA 1MKHA 3HOYH 4JI2Q 1X56A 4DR6L 1YEZA 1Y1WH 1KXLA 2UUAQ 4X64Q 4DR1L 1XNRQ 2D62A 5M5XH 4KLKA 1N34L 1EUJA 3GO5A 1I94L 1VQ5A 4JBJA 2CWPA 4L5TA 4BBRG 3I56A 4DV5Q 3I4MG 3S1MH 2OQ0A 2UU9L 2JA6H 2PI2E 3ULPA 5JJIA 2KHJA 4HIMA 5C4JH 1SE8A 1HR0L 2K5NA 4A3MH 4O0AA 4DV1L 1VQDA 1QUQA 4GKJQ 5HY6A 1JJCB 4HJ8A 3MXNB 3HOZG 3ULJA 5IYDG 3Q8DA 4JI4L 1N9WA 1XNQQ 1WCMG 2JK8A 4C3IH 1N32L 2KHIA 2ZTDA 4DKAC 1IXRA 1XPUA 2Z6KC 3BZKA 1J5EL 2UUBQ 4IPHA 1VQIA 3U4ZA 3GTKH 4JI2L 2A8VA 1VCIA 4AYBG 1GD7A 3LGJA 1P16A 4JBWA 4X64L 3PUVA 1XNRL 4JOIA 1N33Q 2ATWA 3M3YH 4AYBE 1OXVA 3J7A5 1YHBA 4P72A 3G71A 3CF5A 2R7ZG 2VY3A 3CCVA 1PYSB 4IFDG 1Q12A 2QEXA 4PMWA 4OO1G 4A76A 2VUMH 4GLXA 1Q1EA 1Y1VG 2JA5H 3DLLA 2Z0SA 1FGUA 4JBKA 2MO1A 4GKJL 1E22A 1FJGQ 1K8GA 4POFA 3KF6A 3M4PA 4LNQA 2IX1A 5LMUQ 1EIYB 1PVOA 4DK6C 4GLVB 4GN3B 1XNQL 4DR5L 2D0OA 2RHQB 4YCWA 3H3VI 4OWWB 2CWAA 1DGSA 1E24A 1PH5A 2JA7H 3GTQH 3S2HH 1PH2A 4DV4Q 4A3FH 3T1HL 4JBMA 3HOYG 3TEHB 3WWVA 3CAMA 5IYCH 3HOXH 1WFQA 3E9IA 3J81c 4GOPA 3CC2A 1D7QA 4R1JA 1WYDA 3PSIA 2ZJRA 3RN2A 3KDFB 1BBWA 1L2FA 4PZ8A 4XTCS 1N33L 3B6YA 4GNXA 5J3BA 2JA6G 1A8VA 3UDIA 1JT8A 1CKNB 1PA6A 1CUKA 3H0GG 1IBLQ 1A0IA 4A3MG 3CCMA 3ERSX 1IBKQ 2UUCL 2BH8A 5K36G 5IWAQ 1FJGL 1HZ9A 1WOCA 2Q2HA 1R9TH 4DAYB 1XMQQ 3I7FA 3UDXA 5LMUL 4JI0Q 4LF4L 5ELNA 1GO3E 2VW9A 4YHHQ 1HJPA 2AMCB 3KYHC 4LUZA 4DV4L 2WB1G 4Y52H 1TWAH 2Y0SE 1VQBA 1IYJB 3HOWH 2K14A 1SMXA 5GAHC 3JAMi 4DR7L 3ICEA 2HIXA 3I4OA 3GTGH 1S40A 2F4VQ 3H15A 1VQJA 2GN5A 3K0XA 2N78A 1XJVA 1Q81C 3RLFA 4DV2Q 5C0XG 1OXUA 1Q8KA 3NBHB 2CQOA 2E5LQ 4R4QA 4B3TQ 4JI5Q 4NXMQ 2OTJA 2VUMG 4P74A 4LUOA 4OWXB 3PGZA 3GTJH 1A62A 1XPRA 2IT1A 4MNOA 1VQNA 5IE8A 4A3GH 5IWAL 3PCOB 4NPSA 1FL0A 4A3EH 3AQQA 3UDGA 4JI0L 4IO9A 2JA7G 2VZAA 2PQAB 4GN4B 4YHHL 3G6EA 4A3FG 5IYCG 1X3GA 3CCRA 3CD6A 5EAYA 2NVTH 1AE3A 1J6QA 4DR6Q 4DR7Q 1ASYA 2MO0A 3JC66 2AWNA 1HNXQ 1N34Q 1VQHA 2F4VL 1W2BA 3HOVH 3PUXA 1JB7A 1KRTA 3F2BA 4GS3A 4LUVA 3G48A 5IYBG 3PF5A 4JI5L 4B3TL 1A63A 1YBYA 2VQFL 2PMZE 4JI6L 4NXML 4PZ7A 4HJAA 1V43A 4AH6A 2UXCQ 3GTMH 2IHFA 1VQGA 3HOUH 4DV0L 3CPFA 1I3QH 3M4OH 1BVSA 2V1CC 3KLWA 1WJJA 2JEAI 1Z9FA 3ER0A 3E9HA 4L5QA 2BA1A 2VNUD 4BXXG 1U5KA 2NZOA 3A5UA 1J5EQ 4HIKA 4A3LG 3KF8B 2H5XA 4LFAQ 2JA8H 3HOWG 3BJUA 3F8TA 4DUZQ 1TXYA 1KC8C 4HIOA 4HJ7A 3A5ZB 3T1YL 1QUQB 4R4TA 5DLQE 5C4XH 2AHOB 1HNXL 3FKIH 1I50H 2A1AA 2Q2TA 1L1OA 1QZHA 3CCEA 4IFDI 4A3KG 2XGTA 1PH7A 4R4IA 4OO1I 2E8GA 4EQ5A 2VQEQ 2C35B 1C0AA 3M4QA 3CC4A 4A3GG 2UXCL 1KL9A 1QVGA 1X54A 1Z47A 1CKOA 1PHJA 5M3FH 4X62Q 2B3GA 4A3EG 1X6OA 1OTCA 2Q2UA 2UXDQ 4DR5Q 4LF7Q 5FLMG 1Q46A 4XIGS 3UE1A 1M90C 1XTDA 4X65Q 3T1HQ 2YTXA 3K80C 3U58A 4LFAL 2E2JH 1YHAA 2GVAA 2MNAA 5IP7H 4DUZL 2K5HA 4A3BG 4OONA 2R92G 4RMFA 1MIUA 3RZDH 1UE1A 1PH1A 1X3FA 5JEAG 3KF6B 1PH6A 2R7DA 2WAQG 3J81j 1SFOH 1QVFA 3CP0A 3GTLH 3CC7A 4LW1A 1K3RA 1VQ4A 2NVQH 2VQEL 3STBD 2WAQE 2UUCQ 3HOUG 1G291 3I4NH 5M3MH 1VQLA 3PV0A 4A3IH 4YWLA 1Q86C 1U0LA 4GOPB 1RL2A 4MZ9A 3CQZH 3K7AH 3PUZA 2B29A 4X62L 4OXPA 1EFWA 4LF4Q 4LF5Q 4JV5Q 1YIJA 5M5WH 3S2DH 1YVCA 2UXDL 2I5LX 1LTLA 3CCJA 5GADC 2IX0A 1LM0A 4LF7L 1JE5A 1YITA 1X65A 4X65L 1IL2A 2K4KA 4DPGA 4BY1H 2ALYB 4QJFA 1XMOQ 2YV5A 1YNXA 3AYHB 1Y1WG 1G51A 1VQAA 2I5MX 3SGIA 2RF4A 2ZM6Q 3ZJYC 1EWIA 5FLXc 4HJ9A 4A3JH 3TREA 3FKIG 1NTGA 3PIPA 1MJEA 1SROA 1HNWL 1Q82C 5C0XI 2LXKA 3GDEA 4J15A 2NN6G 3CCUA 3TS0A 4GOPC 2LXJA 4YCVA 4UP9A 2OCEA 2A19A 4H02A 2WFWA 4B3RQ 4A3CH 3L0OA 2JEBI 2K75A 4IJLA 5M3FG 4BBSH 4JI7Q 5JEAJ 2BA0A 2JJQA 2Y0SG 4JV5L 4NXNL 4YCUA 3GTPH 4X6AH 3J80c 5AJ3L 3RN5A 2HT1A 3J7ZC 3W5OA 1VQ6A 4IOAA 3I2ZA 3U50C 1UE6A 3F2DA 1XMOL 2ZM6L 2AKWB 5FJ8H 5GQOA 4K0KQ 3HKZE 3K81C 4GN5A 4DK3C 1VQOA 3KFUA 2VQFQ 4JI6Q 2K50A 3KDFA 4BY7H 2JA5G 1GM5A 5M3MG 1NBWA 2KBNA 1NY4A 4DV0Q 4A3IG 4B3RL 3KOJA 2WP8J 3FHWA 1VQMA 4OWTB 1K8AC 3J81i 4JI7L 2R7FA 1YZ6A 3HKSA 1ASZA 3KJOA 4A93H 3CCSA 4DR4Q 4BY1G 1IBMQ 3PF4A 3HOXG 1VQ8A 4O2DA 1TWFH 4DV6L 2KCTA 2Q2IA 3T1YQ 3L7ZC 4BBRH 4C2MH 1YJWA 1BKBA 3I4MH 1PH4A 3CMAA 3MEFA 4K0KL 1D8LA 4DV3Q 1KRSA 2RHSB 5C44H 2ES2A 1SN8A 2EXDA 3PO3H 4JI8L 2EIFA 1JJ2A 3M7NA 2NVYH 1CSQA 2IHEA 4QL5A 4LF5L 3FP9A 3NENA 2KCMA 1AH9A 2DGYA 3HOZH 1WCMH 4LF8L 2AWOA 1GVPA 3E0EA 3HFZB 2UXBQ 3ULLA 4JYAQ 1BBUA 2E2HH 3RLNA 3TS2A 3NELA 3S16H 1I6HH 5JJLA 4QQBX 4DR4L 1RIPA 1IBML 2ZTEA 4LF6L 4LFBL 2HHHL 2ZTCA 4YWKA 3OTOL 4APVA 1EQQA 1C7YA 1UE5A 4UP7A 1PFSA 1VQ9A 3BU2A 5IY0A 2N3SA 4WJ3M 4P73A 4IJHA 4DV3L 5LMNL 3M9BA 4C3HH 4B3ML 2F52A 5LMNW 1T9HA 2CCZA 3TQYA 2ZJPA 5GAEC 1JJGA 3CCQA 3L2PA 3PUYA 1IZ6A 3AFPA 2ASBA 1GKHA 1KQSA 2UXBL 4JYAL 1Q1BA 2JE6I 2MFIA 4GKKL 4A93G 4WJ4A 4Y7NH 2YU9H 3EBEA 2JA9A 4A3DH 1E7ZA 3K7UC 3PUWA 4OX9Q 2ID0A 4JCVE 1K9MC 4IOCA 3GD7A 1UWVA 3UDFA 4LFBQ 3IRBA 3HOVG 3PO2H 5C44G 1HNWQ 3EN2A 2NN6I 3H0GH 4GLAC 3F1ZA 3PO3G 1H95A 1HNZL 2R93H 2N49A 2I5HA 1N36Q 4JOIC 1K73C 1NE3A 2CFMA 1HR0W 1YJNA 2Z6KA 1KHIA 4QGUA 4NB3A 4JI3Q 4UY8C 3W1BA 1WI5A 1VS0A 1MJCA 3H3VH 4QY7A 5HGQA 4DUYQ 2B63H 4QIWE 1AE2A 1TWCH 4LWCA 1L0WA 4P71A 5H1SE 4PZ6A 4NXNQ 1M1KC 5AJ3Q 4GNXB 2E2IH 1B8AA 2RCNA 2JA8G 3DM3A 2K52A 2UUAL 4P75A 3CXCA 1E1TA 1NMFA 3S15H 4R4CA 2R6GA 1V9PA 3CW2C 3S1NH 4OX9L 1VQCA 1KIXA 5C4XG 5IT9c 2HIVA 1OXTA 3D0FA 4PG3A 4DV5L 4DR2Q 4AIMA 1XPOA 2JQOA 4R4OA 3U4VA 3M85A 3CMEA 3JAMc 4HJ5A 1W3SA 1O7IA 3KJPA 1FVIA 4IPDA 2BH2A 3PIOA 4IPCA 1N36L 2QGQA 4KHPQ 1KAWA 1OXXK 4GNXC 1LUZA 1C9OA 3RZOH 1Y14B 4ME3A 4JI3L 4HIDA 1CSPA 3S1QH 1EQRA 1UEBA 4TQUS 4A4IA 1Q7YC 3CCLA 1CKMA 4DUYL 2DUDA 1YI2A 2UUBL 1SRUA 1EIFA 1NJIC 1E1OA 4YY3Q 2PNHA 1PH3A 2OWOA 4LFCQ 5JJKA 1TWGH 5IP9H 1P8LA 4A3DG 4JC0A 3AFQA 4BA2I 3HKZG 5IP7G 4DV6Q 4L5RC 5E7NA 3S24A 3S1RH 1X9NA 1X3EA 3PO2G 2NZHA 1OXSC 5IYBH 4A75A 4DR2L 3NEMA 1EYGA 2KENA 2R93G 4DAMA 4JI8Q 1HZAA 2ZJQA 4LF9Q 2VL6A 3RNUA 3D31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHZ A;  4KHP L;  3OYY A;  1VQF A;  3UE0 A;  4C3J H;  3G4S A;  2XTI A;  4DV7 Q;  1YHQ A;  2LSS A;  1VQE A;  1NMG A;  4L5S A;  5BR8 Q;  4POG A;  3I4N G;  1EOV A;  2QA4 A;  1CKN A;  4LF8 Q;  2B63 G;  4IFD J;  2IY5 B;  5C3E H;  2FXQ A;  1VQP A;  1HZC A;  4ALP A;  4BXX H;  4AQY Q;  5GAG C;  3AEV A;  4B3S Q;  1X55 A;  4A3L H;  4YY3 L;  4LFC L;  4DNI A;  4JI1 Q;  1K0R A;  3RLO A;  4LF6 Q;  1HZB A;  2YTV A;  1TWH H;  2WB1 E;  2D0P A;  1PH8 A;  1B7Y B;  1KD1 C;  3VDY A;  2HHH Q;  1N8R C;  4A3J G;  3S14 H;  3OTO Q;  1UE7 A;  1S72 A;  3TRZ A;  2I0Q A;  1QVC A;  4EX5 A;  4FDB A;  4A3K H;  5ELO A;  3OW2 A;  1E3P A;  5LMN Q;  1IBL L;  3F2C A;  4B3M Q;  5M5Y H;  1YJ9 A;  1IBK L;  4DR3 Q;  2PI2 A;  4LF9 L;  1SLJ A;  2MQH A;  3RR5 A;  3J80 i;  1PH9 A;  3W1G A;  1JMC A;  4DV7 L;  3EIV A;  1XMQ L;  1VQK A;  3S17 H;  4A3C G;  5BR8 L;  5IYD H;  1LYL A;  1PV4 A;  1I5F A;  3A0J A;  4X66 Q;  2VS1 A;  2GVB A;  4BBS G;  5FLM H;  3A74 A;  3K8A A;  3CPW A;  1B70 B;  4AQY L;  4GKK Q;  2YYZ A;  2EQS A;  4B3S L;  2F3I A;  5IP9 G;  1L1O B;  1SR3 A;  5GRO A;  2HQL A;  3BZC A;  4JI1 L;  2CKZ B;  4UP8 A;  2N8N A;  4YWM A;  4DR1 Q;  1I94 Q;  1K83 H;  4JG2 A;  2R92 H;  4A3B H;  1VQ7 A;  1S3O A;  5FJ8 G;  4DV2 L;  1QZG A;  2PQA A;  4TVA B;  4UPA A;  2UU9 Q;  2R7Z H;  2YTY A;  2E5L L;  4KI0 A;  3STB C;  2K5V A;  1HR0 Q;  3I55 A;  1HH2 P;  1HNZ Q;  2NVX H;  2OQK A;  1Y1V H;  4DV1 Q;  2L15 A;  4DR3 L;  4BY7 G;  1V1Q A;  4MTN A;  4IPG A;  1L1O C;  4JI4 Q;  5C0X J;  4BA1 I;  1N32 Q;  1G6P A;  1PYB A;  5C3E G;  4RG1 A;  4X66 L;  3GTO H;  2OTL A;  1MKH A;  3HOY H;  4JI2 Q;  1X56 A;  4DR6 L;  1YEZ A;  1Y1W H;  1KXL A;  2UUA Q;  4X64 Q;  4DR1 L;  1XNR Q;  2D62 A;  5M5X H;  4KLK A;  1N34 L;  1EUJ A;  3GO5 A;  1I94 L;  1VQ5 A;  4JBJ A;  2CWP A;  4L5T A;  4BBR G;  3I56 A;  4DV5 Q;  3I4M G;  3S1M H;  2OQ0 A;  2UU9 L;  2JA6 H;  2PI2 E;  3ULP A;  5JJI A;  2KHJ A;  4HIM A;  5C4J H;  1SE8 A;  1HR0 L;  2K5N A;  4A3M H;  4O0A A;  4DV1 L;  1VQD A;  1QUQ A;  4GKJ Q;  5HY6 A;  1JJC B;  4HJ8 A;  3MXN B;  3HOZ G;  3ULJ A;  5IYD G;  3Q8D A;  4JI4 L;  1N9W A;  1XNQ Q;  1WCM G;  2JK8 A;  4C3I H;  1N32 L;  2KHI A;  2ZTD A;  4DKA C;  1IXR A;  1XPU A;  2Z6K C;  3BZK A;  1J5E L;  2UUB Q;  4IPH A;  1VQI A;  3U4Z A;  3GTK H;  4JI2 L;  2A8V A;  1VCI A;  4AYB G;  1GD7 A;  3LGJ A;  1P16 A;  4JBW A;  4X64 L;  3PUV A;  1XNR L;  4JOI A;  1N33 Q;  2ATW A;  3M3Y H;  4AYB E;  1OXV A;  3J7A 5;  1YHB A;  4P72 A;  3G71 A;  3CF5 A;  2R7Z G;  2VY3 A;  3CCV A;  1PYS B;  4IFD G;  1Q12 A;  2QEX A;  4PMW A;  4OO1 G;  4A76 A;  2VUM H;  4GLX A;  1Q1E A;  1Y1V G;  2JA5 H;  3DLL A;  2Z0S A;  1FGU A;  4JBK A;  2MO1 A;  4GKJ L;  1E22 A;  1FJG Q;  1K8G A;  4POF A;  3KF6 A;  3M4P A;  4LNQ A;  2IX1 A;  5LMU Q;  1EIY B;  1PVO A;  4DK6 C;  4GLV B;  4GN3 B;  1XNQ L;  4DR5 L;  2D0O A;  2RHQ B;  4YCW A;  3H3V I;  4OWW B;  2CWA A;  1DGS A;  1E24 A;  1PH5 A;  2JA7 H;  3GTQ H;  3S2H H;  1PH2 A;  4DV4 Q;  4A3F H;  3T1H L;  4JBM A;  3HOY G;  3TEH B;  3WWV A;  3CAM A;  5IYC H;  3HOX H;  1WFQ A;  3E9I A;  3J81 c;  4GOP A;  3CC2 A;  1D7Q A;  4R1J A;  1WYD A;  3PSI A;  2ZJR A;  3RN2 A;  3KDF B;  1BBW A;  1L2F A;  4PZ8 A;  4XTC S;  1N33 L;  3B6Y A;  4GNX A;  5J3B A;  2JA6 G;  1A8V A;  3UDI A;  1JT8 A;  1CKN B;  1PA6 A;  1CUK A;  3H0G G;  1IBL Q;  1A0I A;  4A3M G;  3CCM A;  3ERS X;  1IBK Q;  2UUC L;  2BH8 A;  5K36 G;  5IWA Q;  1FJG L;  1HZ9 A;  1WOC A;  2Q2H A;  1R9T H;  4DAY B;  1XMQ Q;  3I7F A;  3UDX A;  5LMU L;  4JI0 Q;  4LF4 L;  5ELN A;  1GO3 E;  2VW9 A;  4YHH Q;  1HJP A;  2AMC B;  3KYH C;  4LUZ A;  4DV4 L;  2WB1 G;  4Y52 H;  1TWA H;  2Y0S E;  1VQB A;  1IYJ B;  3HOW H;  2K14 A;  1SMX A;  5GAH C;  3JAM i;  4DR7 L;  3ICE A;  2HIX A;  3I4O A;  3GTG H;  1S40 A;  2F4V Q;  3H15 A;  1VQJ A;  2GN5 A;  3K0X A;  2N78 A;  1XJV A;  1Q81 C;  3RLF A;  4DV2 Q;  5C0X G;  1OXU A;  1Q8K A;  3NBH B;  2CQO A;  2E5L Q;  4R4Q A;  4B3T Q;  4JI5 Q;  4NXM Q;  2OTJ A;  2VUM G;  4P74 A;  4LUO A;  4OWX B;  3PGZ A;  3GTJ H;  1A62 A;  1XPR A;  2IT1 A;  4MNO A;  1VQN A;  5IE8 A;  4A3G H;  5IWA L;  3PCO B;  4NPS A;  1FL0 A;  4A3E H;  3AQQ A;  3UDG A;  4JI0 L;  4IO9 A;  2JA7 G;  2VZA A;  2PQA B;  4GN4 B;  4YHH L;  3G6E A;  4A3F G;  5IYC G;  1X3G A;  3CCR A;  3CD6 A;  5EAY A;  2NVT H;  1AE3 A;  1J6Q A;  4DR6 Q;  4DR7 Q;  1ASY A;  2MO0 A;  3JC6 6;  2AWN A;  1HNX Q;  1N34 Q;  1VQH A;  2F4V L;  1W2B A;  3HOV H;  3PUX A;  1JB7 A;  1KRT A;  3F2B A;  4GS3 A;  4LUV A;  3G48 A;  5IYB G;  3PF5 A;  4JI5 L;  4B3T L;  1A63 A;  1YBY A;  2VQF L;  2PMZ E;  4JI6 L;  4NXM L;  4PZ7 A;  4HJA A;  1V43 A;  4AH6 A;  2UXC Q;  3GTM H;  2IHF A;  1VQG A;  3HOU H;  4DV0 L;  3CPF A;  1I3Q H;  3M4O H;  1BVS A;  2V1C C;  3KLW A;  1WJJ A;  2JEA I;  1Z9F A;  3ER0 A;  3E9H A;  4L5Q A;  2BA1 A;  2VNU D;  4BXX G;  1U5K A;  2NZO A;  3A5U A;  1J5E Q;  4HIK A;  4A3L G;  3KF8 B;  2H5X A;  4LFA Q;  2JA8 H;  3HOW G;  3BJU A;  3F8T A;  4DUZ Q;  1TXY A;  1KC8 C;  4HIO A;  4HJ7 A;  3A5Z B;  3T1Y L;  1QUQ B;  4R4T A;  5DLQ E;  5C4X H;  2AHO B;  1HNX L;  3FKI H;  1I50 H;  2A1A A;  2Q2T A;  1L1O A;  1QZH A;  3CCE A;  4IFD I;  4A3K G;  2XGT A;  1PH7 A;  4R4I A;  4OO1 I;  2E8G A;  4EQ5 A;  2VQE Q;  2C35 B;  1C0A A;  3M4Q A;  3CC4 A;  4A3G G;  2UXC L;  1KL9 A;  1QVG A;  1X54 A;  1Z47 A;  1CKO A;  1PHJ A;  5M3F H;  4X62 Q;  2B3G A;  4A3E G;  1X6O A;  1OTC A;  2Q2U A;  2UXD Q;  4DR5 Q;  4LF7 Q;  5FLM G;  1Q46 A;  4XIG S;  3UE1 A;  1M90 C;  1XTD A;  4X65 Q;  3T1H Q;  2YTX A;  3K80 C;  3U58 A;  4LFA L;  2E2J H;  1YHA A;  2GVA A;  2MNA A;  5IP7 H;  4DUZ L;  2K5H A;  4A3B G;  4OON A;  2R92 G;  4RMF A;  1MIU A;  3RZD H;  1UE1 A;  1PH1 A;  1X3F A;  5JEA G;  3KF6 B;  1PH6 A;  2R7D A;  2WAQ G;  3J81 j;  1SFO H;  1QVF A;  3CP0 A;  3GTL H;  3CC7 A;  4LW1 A;  1K3R A;  1VQ4 A;  2NVQ H;  2VQE L;  3STB D;  2WAQ E;  2UUC Q;  3HOU G;  1G29 1;  3I4N H;  5M3M H;  1VQL A;  3PV0 A;  4A3I H;  4YWL A;  1Q86 C;  1U0L A;  4GOP B;  1RL2 A;  4MZ9 A;  3CQZ H;  3K7A H;  3PUZ A;  2B29 A;  4X62 L;  4OXP A;  1EFW A;  4LF4 Q;  4LF5 Q;  4JV5 Q;  1YIJ A;  5M5W H;  3S2D H;  1YVC A;  2UXD L;  2I5L X;  1LTL A;  3CCJ A;  5GAD C;  2IX0 A;  1LM0 A;  4LF7 L;  1JE5 A;  1YIT A;  1X65 A;  4X65 L;  1IL2 A;  2K4K A;  4DPG A;  4BY1 H;  2ALY B;  4QJF A;  1XMO Q;  2YV5 A;  1YNX A;  3AYH B;  1Y1W G;  1G51 A;  1VQA A;  2I5M X;  3SGI A;  2RF4 A;  2ZM6 Q;  3ZJY C;  1EWI A;  5FLX c;  4HJ9 A;  4A3J H;  3TRE A;  3FKI G;  1NTG A;  3PIP A;  1MJE A;  1SRO A;  1HNW L;  1Q82 C;  5C0X I;  2LXK A;  3GDE A;  4J15 A;  2NN6 G;  3CCU A;  3TS0 A;  4GOP C;  2LXJ A;  4YCV A;  4UP9 A;  2OCE A;  2A19 A;  4H02 A;  2WFW A;  4B3R Q;  4A3C H;  3L0O A;  2JEB I;  2K75 A;  4IJL A;  5M3F G;  4BBS H;  4JI7 Q;  5JEA J;  2BA0 A;  2JJQ A;  2Y0S G;  4JV5 L;  4NXN L;  4YCU A;  3GTP H;  4X6A H;  3J80 c;  5AJ3 L;  3RN5 A;  2HT1 A;  3J7Z C;  3W5O A;  1VQ6 A;  4IOA A;  3I2Z A;  3U50 C;  1UE6 A;  3F2D A;  1XMO L;  2ZM6 L;  2AKW B;  5FJ8 H;  5GQO A;  4K0K Q;  3HKZ E;  3K81 C;  4GN5 A;  4DK3 C;  1VQO A;  3KFU A;  2VQF Q;  4JI6 Q;  2K50 A;  3KDF A;  4BY7 H;  2JA5 G;  1GM5 A;  5M3M G;  1NBW A;  2KBN A;  1NY4 A;  4DV0 Q;  4A3I G;  4B3R L;  3KOJ A;  2WP8 J;  3FHW A;  1VQM A;  4OWT B;  1K8A C;  3J81 i;  4JI7 L;  2R7F A;  1YZ6 A;  3HKS A;  1ASZ A;  3KJO A;  4A93 H;  3CCS A;  4DR4 Q;  4BY1 G;  1IBM Q;  3PF4 A;  3HOX G;  1VQ8 A;  4O2D A;  1TWF H;  4DV6 L;  2KCT A;  2Q2I A;  3T1Y Q;  3L7Z C;  4BBR H;  4C2M H;  1YJW A;  1BKB A;  3I4M H;  1PH4 A;  3CMA A;  3MEF A;  4K0K L;  1D8L A;  4DV3 Q;  1KRS A;  2RHS B;  5C44 H;  2ES2 A;  1SN8 A;  2EXD A;  3PO3 H;  4JI8 L;  2EIF A;  1JJ2 A;  3M7N A;  2NVY H;  1CSQ A;  2IHE A;  4QL5 A;  4LF5 L;  3FP9 A;  3NEN A;  2KCM A;  1AH9 A;  2DGY A;  3HOZ H;  1WCM H;  4LF8 L;  2AWO A;  1GVP A;  3E0E A;  3HFZ B;  2UXB Q;  3ULL A;  4JYA Q;  1BBU A;  2E2H H;  3RLN A;  3TS2 A;  3NEL A;  3S16 H;  1I6H H;  5JJL A;  4QQB X;  4DR4 L;  1RIP A;  1IBM L;  2ZTE A;  4LF6 L;  4LFB L;  2HHH L;  2ZTC A;  4YWK A;  3OTO L;  4APV A;  1EQQ A;  1C7Y A;  1UE5 A;  4UP7 A;  1PFS A;  1VQ9 A;  3BU2 A;  5IY0 A;  2N3S A;  4WJ3 M;  4P73 A;  4IJH A;  4DV3 L;  5LMN L;  3M9B A;  4C3H H;  4B3M L;  2F52 A;  5LMN W;  1T9H A;  2CCZ A;  3TQY A;  2ZJP A;  5GAE C;  1JJG A;  3CCQ A;  3L2P A;  3PUY A;  1IZ6 A;  3AFP A;  2ASB A;  1GKH A;  1KQS A;  2UXB L;  4JYA L;  1Q1B A;  2JE6 I;  2MFI A;  4GKK L;  4A93 G;  4WJ4 A;  4Y7N H;  2YU9 H;  3EBE A;  2JA9 A;  4A3D H;  1E7Z A;  3K7U C;  3PUW A;  4OX9 Q;  2ID0 A;  4JCV E;  1K9M C;  4IOC A;  3GD7 A;  1UWV A;  3UDF A;  4LFB Q;  3IRB A;  3HOV G;  3PO2 H;  5C44 G;  1HNW Q;  3EN2 A;  2NN6 I;  3H0G H;  4GLA C;  3F1Z A;  3PO3 G;  1H95 A;  1HNZ L;  2R93 H;  2N49 A;  2I5H A;  1N36 Q;  4JOI C;  1K73 C;  1NE3 A;  2CFM A;  1HR0 W;  1YJN A;  2Z6K A;  1KHI A;  4QGU A;  4NB3 A;  4JI3 Q;  4UY8 C;  3W1B A;  1WI5 A;  1VS0 A;  1MJC A;  3H3V H;  4QY7 A;  5HGQ A;  4DUY Q;  2B63 H;  4QIW E;  1AE2 A;  1TWC H;  4LWC A;  1L0W A;  4P71 A;  5H1S E;  4PZ6 A;  4NXN Q;  1M1K C;  5AJ3 Q;  4GNX B;  2E2I H;  1B8A A;  2RCN A;  2JA8 G;  3DM3 A;  2K52 A;  2UUA L;  4P75 A;  3CXC A;  1E1T A;  1NMF A;  3S15 H;  4R4C A;  2R6G A;  1V9P A;  3CW2 C;  3S1N H;  4OX9 L;  1VQC A;  1KIX A;  5C4X G;  5IT9 c;  2HIV A;  1OXT A;  3D0F A;  4PG3 A;  4DV5 L;  4DR2 Q;  4AIM A;  1XPO A;  2JQO A;  4R4O A;  3U4V A;  3M85 A;  3CME A;  3JAM c;  4HJ5 A;  1W3S A;  1O7I A;  3KJP A;  1FVI A;  4IPD A;  2BH2 A;  3PIO A;  4IPC A;  1N36 L;  2QGQ A;  4KHP Q;  1KAW A;  1OXX K;  4GNX C;  1LUZ A;  1C9O A;  3RZO H;  1Y14 B;  4ME3 A;  4JI3 L;  4HID A;  1CSP A;  3S1Q H;  1EQR A;  1UEB A;  4TQU S;  4A4I A;  1Q7Y C;  3CCL A;  1CKM A;  4DUY L;  2DUD A;  1YI2 A;  2UUB L;  1SRU A;  1EIF A;  1NJI C;  1E1O A;  4YY3 Q;  2PNH A;  1PH3 A;  2OWO A;  4LFC Q;  5JJK A;  1TWG H;  5IP9 H;  1P8L A;  4A3D G;  4JC0 A;  3AFQ A;  4BA2 I;  3HKZ G;  5IP7 G;  4DV6 Q;  4L5R C;  5E7N A;  3S24 A;  3S1R H;  1X9N A;  1X3E A;  3PO2 G;  2NZH A;  1OXS C;  5IYB H;  4A75 A;  4DR2 L;  3NEM A;  1EYG A;  2KEN A;  2R93 G;  4DAM A;  4JI8 Q;  1HZA A;  2ZJQ A;  4LF9 Q;  2VL6 A;  3RNU A;  3D31 A; 
#chains in the Genus database with same CATH topology
 3UE0 A;  1VQF A;  1HA6 A;  1PMR A;  2JSO A;  4DV7 Q;  2LSS A;  1GUG A;  2MUY A;  1TT2 A;  4X3S A;  4ULL A;  4ZKC B;  2QA4 A;  2F0L A;  4LF8 Q;  4C1N K;  4B08 A;  3TP6 A;  4ALP A;  4BXX H;  4AQY Q;  2KQ3 A;  1SYB A;  4B3S Q;  3LWU A;  2ICE C;  4LFC L;  3X3M A;  1K0R A;  2A73 B;  4DAY A;  1EEF D;  2WB1 E;  1PH8 A;  1N8R C;  4A3J G;  1MGS A;  4LJZ C;  3OTO Q;  4R8N A;  3HOV B;  2I0Q A;  3VYT A;  5IGF A;  5ELO A;  2IW3 A;  1E3P A;  5LMN Q;  1IBL L;  2Z9H A;  4LF9 L;  1B2T A;  4DR3 Q;  2PI2 A;  1B44 D;  1SLJ A;  3GTM B;  1DOL A;  4C56 C;  5BR8 L;  1LYL A;  4UHV A;  5KGU A;  3J7A V;  2JA8 B;  5IP9 G;  2HQL A;  4UP8 A;  2L5T A;  2N8N A;  1VQ7 A;  5FJ8 G;  4NKL A;  2R7Z H;  2YTY A;  2E5L L;  2K5V A;  1HNZ Q;  2NVX H;  2L15 A;  1EWH A;  1R4Q B;  1HCZ A;  5C0X J;  1ESR A;  3GTO H;  1B3A A;  2YU9 B;  5CC4 A;  4KHV A;  2B2U C;  1YEZ A;  4X64 Q;  4DR1 L;  1AZP A;  3RMH A;  3T53 B;  1I94 L;  1STY A;  2PW7 A;  2KCC A;  2RQX A;  4F8M A;  3PO2 B;  2UU9 L;  2JA6 H;  2EYM A;  3ULP A;  4JK1 C;  3GTL B;  1V1P B;  3NBI A;  1KTK A;  3HOZ G;  4JI4 L;  1N32 L;  1N9W A;  2B2Y A;  1YNJ D;  3A7A B;  1IXR A;  1F2Z A;  4ZKB B;  3BZK A;  4K2K A;  1XTC D;  4KD4 A;  1VQI A;  3SHL A;  3U4Z A;  2A8V A;  3GTK H;  3AB9 A;  2QEJ C;  3PUV A;  2E75 C;  1FNW A;  4A3J B;  1N33 Q;  3P7J A;  3EFX D;  4IAL A;  1OXV A;  5C4H A;  3J7A 5;  3CF5 A;  2SEB D;  4NP5 A;  1Q12 A;  4PMW A;  3A7L A;  5JPN C;  1SNQ A;  3K59 A;  1PRT C;  1FGU A;  2Z0S A;  4JBK A;  4LNQ A;  3MVV A;  3GQB A;  4DR5 L;  2RHQ B;  2IWH A;  1ZYR D;  1KDA A;  1PH2 A;  1TWG B;  5CV6 A;  3TEH B;  3WWV A;  1EQV A;  3J81 c;  4R1J A;  1WYD A;  3RN2 A;  4PZ8 A;  4XTC S;  1BUV T;  4EQN A;  5J3B A;  2F0E A;  2PPB C;  1KDC A;  3UDI A;  1JT8 A;  1IBL Q;  4A3M G;  3P1H A;  2UUC L;  2BOS A;  3I72 A;  2F0H A;  2KA7 A;  1GHJ A;  1GUT A;  1RD9 D;  2B2V A;  2Q2H A;  3DM1 A;  4HCE A;  1ILQ A;  1B53 A;  3A8K E;  4LF4 L;  2F4I A;  4LUZ A;  2HDM A;  4DV4 L;  4N8X 1;  1WTR A;  1TWA H;  4EQO A;  1IYJ B;  1TWH B;  3EQL C;  2K14 A;  1SMX A;  4OEM B;  4CBV A;  2HIX A;  1VQJ A;  2C9O A;  2N78 A;  1WTW A;  1XJV A;  3RLF A;  5C0X G;  3NBH B;  1QJO A;  1VMC A;  2E5L Q;  2DNE A;  3GP7 A;  4NXM Q;  2NVY B;  4LUO A;  3PGZ A;  1XPR A;  4MNO A;  4DF7 A;  5IE8 A;  4A3G H;  5IWA L;  3HOZ B;  3N6R A;  1FL0 A;  1NCV A;  3AQQ A;  3H6M A;  3UDG A;  4YHH L;  1GUW A;  2NVT H;  2R61 A;  2ENB A;  5KNB A;  3JC6 6;  5EPK A;  1VQH A;  2F4V L;  1GJX A;  3BVG A;  3PUX A;  4WJW A;  3F2B A;  1QNU A;  2F0P A;  4GS3 A;  3G48 A;  5IGG A;  1Z7T A;  4JI5 L;  2PMZ E;  4PZ7 A;  1V43 A;  4KN7 C;  1SMY D;  4E6I A;  2V1C C;  4RCN A;  1HQM C;  1XX8 A;  1L0X B;  1YNN D;  4A3L G;  2H5X A;  4LFA Q;  4Y7N B;  2EDG A;  1TU2 B;  1KNE A;  3MXP A;  3L9A X;  3KLR A;  1QUQ B;  4R4T A;  1HNX L;  2A74 C;  2Q2T A;  5A2Q E;  1QZH A;  1QE6 A;  4A3M B;  3HEJ A;  1SE4 A;  2E8G A;  1F9R A;  2VQE Q;  1TQO A;  3SE0 A;  1LT3 D;  1KL9 A;  1QVG A;  3HZX A;  2B2T C;  1X54 A;  4FXG C;  1Z47 A;  2NBF A;  1HRJ A;  4PMC A;  1OTC A;  2UXD Q;  5J1Z A;  4DR5 Q;  5FLM G;  2K01 A;  3UE1 A;  1M90 C;  1XTD A;  1NR4 A;  1Q90 A;  3U58 A;  2E2J H;  4ID6 A;  3S15 B;  5E1F A;  4A3B G;  3S1N B;  5CV8 A;  2R92 G;  2RDH A;  1MIU A;  1SNC A;  1UE1 A;  5JEA G;  1KNA A;  3R2I A;  5FK9 C;  1PH6 A;  3OSO A;  3PQI A;  4K8I A;  3CP0 A;  3H3V C;  4LW1 A;  1K3R A;  2UUC Q;  1LO5 D;  3MEH A;  1G29 1;  5DNF A;  3I4N H;  2Z4H A;  5M3M H;  1VQL A;  2J0T D;  2KHS A;  4YWL A;  4I7A A;  1U0L A;  2PQE A;  2CQA A;  3NP8 A;  2B29 A;  4LF4 Q;  4JV5 Q;  3C3L A;  1LTL A;  2IX0 A;  1IL2 A;  4X65 L;  3A55 A;  4BY1 H;  3M7N A;  4U68 A;  1ROD A;  1VQA A;  1Y1W G;  3S1R B;  5FLX c;  2PMZ B;  3FKI G;  3PIP A;  1MJE A;  4QB4 A;  5C0X I;  4J15 A;  1BCP C;  3SK8 A;  2MGS A;  2EY6 A;  1CZW A;  4DK0 A;  2OCE A;  5LL6 S;  2WFW A;  1PZK D;  4IUN A;  1FR3 A;  2K75 A;  4IJL A;  1WTH A;  1BXT A;  2A5H A;  1BOS A;  4X6A H;  4NXN L;  3GTP H;  3J80 c;  3W5O A;  1EFI D;  4IOA A;  2ZM6 L;  4K0K Q;  2DNC A;  3K81 C;  4GN5 A;  2K05 A;  2EYP A;  5M5Y B;  2K50 A;  3KDF A;  3FRP B;  1GM5 A;  4EGV A;  1NBW A;  1TVX A;  3FHW A;  3DUZ A;  2F0W A;  2XN9 C;  3J81 i;  5CV5 A;  3M4Y A;  1JOO A;  4DR4 Q;  1IBM Q;  4O2D A;  2PW5 A;  1K83 B;  5ELC A;  4A3B B;  2R92 B;  3JAM E;  2Q2I A;  2PCF B;  2K5Q A;  1YJW A;  1BKB A;  3CMA A;  1SDF A;  1D8L A;  1PXU A;  2IPK D;  2K04 A;  2ES2 A;  4OEL B;  1I4Q A;  3A8J E;  4DK1 A;  3SK6 A;  1WCM H;  5JJZ A;  1GVP A;  4JYA Q;  4F7X A;  2DN8 A;  3RLN A;  4EVO A;  4JW0 A;  4XYQ A;  3S16 H;  4IZ8 A;  5J22 A;  1RIP A;  1Y1W B;  1EY8 A;  4LF6 L;  1LLR D;  5M5X B;  3FKI B;  1UE5 A;  2A6H C;  1VQ9 A;  4I65 A;  4P73 A;  4IJH A;  4OIJ A;  4C3H H;  1WD0 A;  2EZV A;  5IGB A;  5LMN W;  2EE1 A;  4H0L C;  1HUM A;  1VF7 A;  3CCQ A;  3U9S A;  5ELD A;  2ASB A;  3NTI A;  2MFI A;  4A93 G;  2LY7 A;  3K7U C;  1K9M C;  3M3Y B;  5E4W C;  5C44 G;  3H0G H;  4GLA C;  3F1Z A;  2WKC A;  5CBE E;  3RNU A;  4X3U A;  1N36 Q;  2I5H A;  2HQE A;  1K73 C;  2Z6K A;  4KY6 A;  3VR6 A;  1U4L A;  2F03 A;  3H3V H;  4OHJ A;  4QY7 A;  2B63 H;  4QIW E;  3S2H B;  1L0W A;  4NXN Q;  3W2D A;  4WOR A;  4RHR A;  3URY A;  1ILP A;  4P75 A;  3OMG A;  3H94 A;  5CV7 A;  4OX9 L;  1KIX A;  2EJG C;  4DR2 Q;  5FO8 B;  2F0N A;  1O7Y A;  2JQO A;  4R4O A;  3U4V A;  1ZEQ X;  3M85 A;  2AUJ D;  4HJ5 A;  1EZ8 A;  4O1N A;  4IPC A;  1OXX K;  3TN2 A;  3D4D A;  3OMC A;  4JI3 L;  3ND8 A;  2WAC A;  2BDN A;  4CDD C;  4HID A;  1EQR A;  4A4I A;  1Q7Y C;  4R8I A;  1HFN A;  2OWO A;  1ET9 A;  1E1O A;  1PH3 A;  1EYC A;  3NK9 A;  1KAB A;  3DWA A;  2Q8I B;  3D6W A;  4A3D G;  3AFQ A;  3HKZ G;  3VYU A;  5IP7 G;  1VMP A;  4B9W A;  4HTH A;  3Q24 A;  2HCC A;  4XT1 B;  1S5E D;  5IYB H;  2K6A A;  3OOC A;  2KEN A;  4DAM A;  2ZJQ A;  1HZA A;  3R93 A;  4IUP A;  1LTR D;  1S5F D;  4Q5V A;  4KHZ A;  4L5S A;  4POG A;  1VQE A;  2ZXR A;  1CKN A;  4IFD J;  1X32 A;  1VQP A;  4A93 B;  1HZC A;  3IFD A;  4YY3 L;  1AW7 A;  4DNI A;  4JI1 Q;  1TWF B;  1S4Z A;  4LF6 Q;  2YTV A;  4H13 C;  2RCF A;  3S14 H;  4ODG A;  5C44 B;  3BVM A;  1AN8 A;  4P2C B;  4A3K H;  1IW7 C;  3D8G A;  1YJ9 A;  1CTM A;  1IBK L;  1BCP D;  5ELB A;  2MQH A;  3J80 i;  3M4O B;  1I3Q B;  4DV7 L;  1LT5 D;  3EIV A;  3C1F A;  5IYD H;  4BBS G;  2E2H B;  3K8A A;  1I6H B;  4AQY L;  2YYZ A;  4B3S L;  1SR3 A;  1G91 A;  3MWY W;  4IUR A;  4JG2 A;  1WTV A;  1S3O A;  1G6Z A;  1TY0 A;  2PQA A;  4UPA A;  2NTS A;  5CMD A;  1BQQ T;  3I55 A;  3EA6 A;  4DV1 Q;  4DR3 L;  2RKS A;  2PNR C;  3MA2 B;  1V1Q A;  3TP7 A;  4IPG A;  1A3U A;  2L12 A;  1G6P A;  3QOJ A;  3I3C A;  5BN4 A;  2F0D A;  2XWJ B;  5EKK A;  2F0V A;  4RGN A;  1X56 A;  4A3D B;  3HKZ B;  1D6E C;  2D62 A;  4KLK A;  1N34 L;  3GO5 A;  3RZD B;  1PTO B;  2CWP A;  1JQY D;  4BBR G;  3S1M H;  3I4M G;  2NN6 H;  3SEB A;  3MC0 B;  1F2L A;  2PI2 E;  5JJI A;  2B8F A;  4HIM A;  1SAP A;  4XYO A;  1U9R A;  4GKJ Q;  3BDO A;  2SNM A;  2JK8 A;  2F0Q A;  1AZQ A;  4RWS C;  5IT9 L;  2RA4 A;  4PMB A;  1ONL A;  1VCI A;  1GD7 A;  1S5D D;  4X64 L;  4OGQ C;  1M4V A;  1YHB A;  3OWE B;  2R7Z G;  4IFD G;  1PYS B;  4IQZ A;  2A6H D;  1B50 A;  4A76 A;  4X3K A;  4CGY B;  4GLX A;  2BE5 C;  2JA5 H;  1LV9 A;  2MO1 A;  1E22 A;  1ENC A;  1K8G A;  3KF6 A;  3J80 L;  1XXG A;  1H9S A;  5LMU Q;  3SXH A;  1EQT A;  4BBS B;  1EOT A;  4DK6 C;  4GN3 B;  4YCW A;  4OWW B;  1PFM A;  1EEI D;  2CWA A;  1PH5 A;  2JA7 H;  3GTQ H;  4A3F H;  1B9N A;  3HOX H;  5IYC H;  4GOP A;  2CH4 W;  1D7Q A;  3PSI A;  2ZJR A;  1N33 L;  1BBW A;  2P5Z X;  5I6Y A;  2XSC A;  2JA6 G;  1WTX A;  3L3O C;  1A0I A;  3I91 A;  2F0M A;  3ERS X;  1IBK Q;  2BH8 A;  4DAP A;  1HZ9 A;  3TZU A;  1SNO A;  4DAY B;  1R9T H;  1K3B C;  3VR5 A;  2A69 C;  4JI0 Q;  1STH A;  2A68 D;  2F0K A;  3KYH C;  3QWN A;  2WB1 G;  4Y52 H;  4X3T A;  2Y0S E;  1VQB A;  3HOW H;  1LT6 D;  3H91 A;  4DR7 L;  5GAH C;  3I4O A;  1CFM A;  2GN5 A;  4BBR B;  3I4M B;  3KLS A;  1OXU A;  2CQO A;  1DOK A;  1LT4 D;  1V1O A;  4B3T Q;  1CQF A;  2OTJ A;  1IKM A;  4P74 A;  3GTJ H;  3I4L A;  1A62 A;  5A35 A;  5KYL A;  4K5X A;  4ZQ3 A;  1O78 A;  5J39 A;  3PCO B;  1H9K A;  4NPS A;  3DHQ A;  4UDU C;  4RKB A;  5FOB B;  1W6K A;  1SSO A;  3QB3 A;  3G6E A;  2K5D A;  3K6O A;  3IL8 A;  3WOE A;  2WII B;  2EPB A;  2AWN A;  1G8Z D;  1N34 Q;  1UNS A;  4G4K A;  3R8B A;  4KY7 A;  2R7Z B;  3HOV H;  1EYD A;  4FF2 A;  1JB7 A;  1KRT A;  1TS3 A;  3PF5 A;  2NVX B;  1J8I A;  4IUT A;  1YBY A;  1FNU A;  4DGZ A;  4NXM L;  2MP1 A;  1MI2 A;  5E3F A;  4AH6 A;  3GTM H;  2IHF A;  4QCL A;  1C4Q A;  4HR7 B;  3HOU H;  1CT1 D;  3KK7 A;  3CPF A;  1RTO A;  2C5C A;  4GZY C;  2BA1 A;  2WKD A;  1U5K A;  2NZO A;  4HIK A;  3CRL C;  5I9P A;  2JA8 H;  3BJU A;  3IFT A;  4HIO A;  3A5Z B;  4Q0F A;  4RAU C;  3T1Y L;  1JWS D;  5DLQ E;  1JC7 A;  4NMZ A;  1I50 H;  2F0U A;  3DEO A;  1Z6H A;  2JA6 B;  2A1A A;  2JP1 A;  4IFD I;  3C2P A;  1Y8P B;  4EQ5 A;  5CV4 A;  2QF7 A;  4A3G G;  2F0G A;  4TSS A;  3KBX A;  1D5Z C;  4X62 Q;  5M3F H;  2TSS A;  3CHB D;  1E2Z A;  2WB1 B;  2YTX A;  1CM9 A;  4LFA L;  2JN4 A;  3BG3 A;  1YHA A;  2GVA A;  1J9O A;  1U4P A;  4OON A;  4RMF A;  1ICW A;  5ELE A;  3J81 j;  3GTL H;  1D1I A;  4RKL A;  1I4H A;  4PV1 C;  1VQ4 A;  2VQE L;  4IUQ A;  1K8M A;  1JWM D;  1W6J A;  3PV0 A;  4A3I H;  1RL2 A;  4K14 A;  2SDF A;  3K7A H;  3K5O A;  3PUZ A;  5C5L A;  1QNK A;  2UXD L;  3DWQ A;  1YVC A;  1JOR A;  2I5L X;  4UAI A;  2LFN A;  1X65 A;  4KN4 C;  1F9S A;  2B39 A;  5IGE A;  1CA6 A;  2YV5 A;  4DR7 Q;  5C5M A;  2RF4 A;  4A3J H;  4HJ9 A;  1EWI A;  1LTB D;  3TRE A;  4DNR B;  1LTA D;  1STA A;  2LXK A;  2EVB A;  3CCU A;  3TS0 A;  4NDX A;  4OIK A;  1GUS A;  5ISR A;  1XWE A;  2O5J C;  4JI7 Q;  5JEA J;  4C3I G;  4G7H C;  2JJQ A;  4JV5 L;  4YCU A;  5G3L F;  3RN5 A;  5AJ3 L;  4HCS A;  5I2Y A;  3N52 A;  3SR1 A;  1VQ6 A;  2NTT A;  1UE6 A;  3F2D A;  2K33 A;  2CH4 A;  5FJ8 H;  3KUP A;  2L4N A;  2IX3 A;  1KLG D;  4DK3 C;  2EY2 A;  5EQ0 A;  4U67 3;  3KFU A;  5KND A;  4PNY A;  4A3G B;  3TSS A;  1LAB A;  5M3M G;  2KBN A;  5FKA C;  2BE5 D;  1NY4 A;  3S17 B;  1BR9 A;  1PFB A;  2K1B A;  5FO9 B;  2XWB B;  3HKS A;  2AQ2 B;  2SOB A;  4BY1 G;  3QJY A;  2NZ1 D;  3T1Y Q;  1RF2 D;  4C2M H;  4RH6 A;  2AUK A;  1PH4 A;  4K0K L;  5KEE A;  4DV3 Q;  2RHS B;  1SN8 A;  3VA7 A;  3NTH A;  3PO3 H;  4JI8 L;  2EIF A;  2NVY H;  1CSQ A;  2IHE A;  4J6H A;  4LF5 L;  2KCM A;  1AH9 A;  3NBH A;  5L37 A;  3HOZ H;  1NUC A;  4ZUI A;  1NNX A;  4DNT B;  5CV9 A;  5JJL A;  4K6L A;  2FJ2 A;  4QQB X;  4DR4 L;  1IBM L;  1HQR D;  4LFB L;  2HHH L;  2CVR A;  1PTO F;  3O13 A;  2LS0 1;  1EQQ A;  1C7Y A;  1PFS A;  5D3I B;  3VYS A;  1S5C D;  4DA2 A;  4WJ3 M;  3M9B A;  5C4J B;  4I7Z C;  3MFY A;  3TQY A;  3E6Z X;  4QMG A;  2ZJP A;  1JJG A;  2KEC A;  2B2U A;  4C3I B;  1GKH A;  4JYA L;  4M8A A;  4CHT B;  4Y7N H;  1EY6 A;  3EBE A;  4ABN A;  1LTI D;  5EJW A;  1E7Z A;  3PUW A;  2ID0 A;  2M9V A;  3K57 A;  4IOC A;  3GD7 A;  4QF4 A;  3IRB A;  2R93 H;  3K58 A;  4RHS A;  4JOI C;  1NE3 A;  1TS4 A;  4FXK C;  5M3M B;  4QGU A;  4NB3 A;  2HUG A;  3QG1 A;  3W1B A;  1VS0 A;  5HGQ A;  4DUY Q;  3NXW A;  4P71 A;  1QB5 D;  1M1K C;  5AJ3 Q;  4GNX B;  4BY1 B;  1B8A A;  1GOZ A;  1U4R A;  2UUA L;  3MXN A;  1A3T A;  3S15 H;  4R4C A;  1V9P A;  3S1N H;  5C0X H;  5C4X G;  5IT9 c;  4DV5 L;  3I90 A;  2VB3 X;  1SYC A;  2B8G A;  3MXG A;  4CDE C;  1W3S A;  1FVI A;  4IPD A;  3W3A A;  2BH2 A;  3PIO A;  1N36 L;  2QGQ A;  1SNM A;  4KHP Q;  1KAW A;  5DM6 3;  3RZO H;  1Y14 B;  2EYO A;  2K03 A;  4ME3 A;  1CKM A;  1CHP D;  2DUD A;  1SRU A;  3C46 A;  5EKI A;  3A56 A;  4RA8 A;  1PZJ D;  3VR2 A;  1P8L A;  4JC0 A;  3GTG B;  1BO0 A;  1S5B D;  3S1R H;  4MIU A;  3FEW X;  2NZH A;  1OXS C;  5DAU A;  4A75 A;  4DR2 L;  1EYG A;  1CK1 A;  1SE2 A;  4JI8 Q;  1SND A;  2VL6 A;  5IIF A;  3D31 A;  5FO7 B;  3OYY A;  1VDZ A;  4C3J H;  4LF5 Q;  3G4S A;  2XTI A;  2EOT A;  3OW7 A;  1PRT D;  1B9M A;  2B63 G;  2IY5 B;  5C3E H;  2FXQ A;  4A3L H;  1X55 A;  1Y69 U;  4IUU A;  4LK1 C;  1HZB A;  2L11 A;  4LFB Q;  1KD1 C;  2D0P A;  2HHH Q;  1B7Y B;  3VDY A;  2RDG A;  1ZXT A;  1QVC A;  1STE A;  3ERQ A;  4YIJ A;  4EX5 A;  4FDB A;  4LMQ D;  3F2C A;  5M5Y H;  1JMC A;  3W1G A;  1VQK A;  1XMQ L;  4A3C G;  1PV4 A;  2Z8L A;  3A0J A;  5EKL A;  4X66 Q;  2GVB A;  3J81 E;  5FLM H;  3S16 B;  1B70 B;  2F3I A;  1L1O B;  5GRO A;  3BZC A;  4JI1 L;  4YWM A;  1SXT A;  1NSN S;  3A8I E;  1K83 H;  4A3B H;  2R92 H;  5C4X B;  3X3N A;  5IOD A;  4DV2 L;  4ZRZ A;  4TVA B;  4KI0 A;  1HR0 Q;  4OO1 H;  2O4X A;  3VYR A;  2OQK A;  1Y1V H;  3MXU A;  1F2M A;  1I4X A;  4BY7 G;  4BA1 I;  1PYB A;  5T1I A;  2H1E A;  2OTL A;  1MKH A;  2V4D A;  3HOY H;  2O5I C;  5ELF A;  4JI2 Q;  2WV6 D;  2N88 A;  4G7O C;  1Y1W H;  2UUA Q;  3U9O A;  1SYG A;  1XNR Q;  5M5X H;  1M8A A;  1VQ5 A;  1KLU D;  3T56 B;  4L5T A;  4DV5 Q;  1ICF B;  3PIO 3;  1CQV A;  2B2T A;  3GV3 A;  4XXE A;  1SFO B;  2KHJ A;  4O0A A;  2NVQ B;  4DV1 L;  1X3Q A;  2KOL A;  5HY6 A;  5K36 H;  3G7L A;  1JJC B;  3IAY A;  3T13 A;  1TII D;  4L8J A;  2B63 B;  3ULJ A;  5IYD G;  3CQZ B;  1XNQ Q;  5M5W B;  3S2D B;  1HTP A;  1XPU A;  1PTO C;  1J5E L;  4O42 A;  4CDF C;  4AYB G;  1STG A;  3JAM L;  2HCI A;  2J7Z A;  3FVQ A;  3LGJ A;  3OWF A;  4JBW A;  4JOI A;  1Q8I A;  3M3Y H;  4AYB E;  1F77 A;  4P72 A;  4EQP A;  3G71 A;  4DFA A;  3CCV A;  2QEX A;  1EIG A;  2CHB D;  2VUM H;  1Q1E A;  3DLL A;  4ZK9 B;  2F0J A;  3VA5 A;  1CA5 A;  1FJG Q;  4GKJ L;  2M00 A;  2GA4 B;  4V19 0;  4JPB W;  1GUN A;  1EIY B;  1PVO A;  4GLV B;  3H3V I;  2D0O A;  2PZW A;  3I73 A;  3S2H H;  1DGS A;  1E24 A;  3T1H L;  3Q23 A;  1WFQ A;  3SDZ A;  3E9I A;  1K28 A;  1Q3L A;  4IUV A;  1HPC A;  2EY5 A;  1K0S A;  3B6Y A;  1EY5 A;  1CKN B;  1PA6 A;  1CUK A;  1JOQ A;  1A2U A;  1CZG A;  1FNV A;  4BY7 B;  4FXD A;  4M1U B;  1WOC A;  5COR A;  4XQQ A;  1XMQ Q;  3UDX A;  5KYI A;  5LMU L;  5ELN A;  1GO3 E;  2F0O A;  1DYQ A;  4KJO A;  2RDF A;  1HJP A;  4TKO B;  1WD1 A;  3EVQ A;  4QUC A;  1JOK A;  3H15 A;  4DV2 Q;  2LMC B;  4J8Q A;  3S9W A;  4LAA A;  3BS1 A;  4OWX B;  3BVZ A;  1I4G A;  2IT1 A;  1DCZ A;  3MZ5 A;  4QIW B;  4ZUJ A;  2M2L A;  4A3E H;  4JI0 L;  5COY A;  2FIN B;  4J1M A;  2JA7 G;  4KMU C;  2VZA A;  3OIP A;  2PQA B;  4GN4 B;  4A3F G;  5FLX E;  2Q8R E;  2IL8 A;  3LWE A;  1QG7 A;  4AYB B;  4N9T A;  5IYC G;  3CCR A;  3CD6 A;  5EAY A;  1J6Q A;  1QIL A;  1I4R A;  2MO0 A;  3G6J B;  2ICI A;  5IGC A;  4LUV A;  4B3T L;  2VQF L;  2OF1 A;  5IOC A;  4JI6 L;  4HJA A;  2UXC Q;  1VQG A;  3TDQ A;  4DV0 L;  3ONA B;  2X6G A;  3M4O H;  1I3Q H;  1BVS A;  3J80 E;  2PO4 A;  1WJJ A;  2JEA I;  1TY2 A;  1Z9F A;  1DXM A;  5M9O A;  5K5P A;  2VNU D;  1QOH A;  4BXX G;  3A5U A;  1J5E Q;  4K8J A;  3KF8 B;  3HOW G;  4DUZ Q;  1KC8 C;  2EYL A;  5NUC A;  3CRK C;  3S1M B;  2AHO B;  1U4M A;  3K5N A;  3FPP A;  2EYF A;  2I46 A;  3CCE A;  3WDN A;  5CBA E;  2XGT A;  3QO2 A;  1PH7 A;  4R4I A;  1C0A A;  1ML0 D;  1XYI A;  1H9M A;  2KJX A;  1PRT F;  1CKO A;  2XRS D;  1X6O A;  1TWC B;  3TBI B;  4LF7 Q;  2QIL A;  1MSH A;  4XIG S;  4CJ2 C;  3T1H Q;  2E2I B;  3K80 C;  1JCK B;  2B2Y C;  5IP7 H;  1AFP A;  5KIX A;  5D14 A;  3RZD H;  1PTO H;  1X3F A;  1DOM A;  3KF6 B;  1H9S B;  3TP8 A;  1QVF A;  2DY8 A;  3CC7 A;  1HTL D;  4R9W A;  3HOU G;  1MD2 D;  1Q86 C;  4RGO S;  1K8O A;  4GOP B;  3S1Q B;  4K5V A;  4X62 L;  2EY1 A;  1EFW A;  3GTQ B;  2JA7 B;  3OIQ A;  1YIJ A;  4A3F B;  5GAD C;  1JE5 A;  5C3X A;  2IJ0 A;  5I6W A;  2ALY B;  1XMO Q;  1YNX A;  3AYH B;  3SGI A;  3ZJY C;  3CKI B;  1L0Y B;  3ZYY X;  1A15 A;  1O7L A;  1DD2 A;  1HNW L;  1Q82 C;  3GDE A;  3UI2 A;  2FMC A;  4YCV A;  4UP9 A;  2A19 A;  4JVZ A;  4B3R Q;  4ZCK A;  3R3O A;  1WTQ A;  5M3F G;  4BBS H;  4MTK A;  2BA0 A;  2Y0S G;  2HT1 A;  3HOW B;  1MBY A;  2B2V C;  3J7Z C;  2OEO A;  3I2Z A;  3U50 C;  4QUF A;  1SE3 A;  1I4P A;  2ZXO A;  1G2T A;  1VQO A;  4RFB A;  2VQF Q;  3A54 A;  4CJ1 B;  4JI6 Q;  3P75 A;  5EBD A;  4DV0 Q;  4A3I G;  3RUZ A;  3KOJ A;  1Y8N B;  1ENA A;  1VQM A;  5E4X A;  1YNN C;  2WIN B;  1K8A C;  4JI7 L;  1KAA A;  2X69 A;  1EY7 A;  2R7F A;  1YZ6 A;  3OPO A;  5C3W A;  3PF4 A;  2JXM B;  1AEX A;  1VQ8 A;  4DV6 L;  2G9D A;  2KCT A;  1H9J A;  4BBR H;  4FNF A;  3I4M H;  3TME A;  5D3D A;  1KRS A;  2K32 A;  2DJG C;  3NSW A;  2EYH A;  1IYV A;  3HOU B;  4KD3 A;  2F0S A;  3FP9 A;  1FGB D;  3E0J A;  2J4X A;  2QW7 A;  3E0E A;  1PFN A;  3HFZ B;  4MHE A;  2UXB Q;  3GTO B;  1BBU A;  3D4R A;  3DEP A;  3TS2 A;  3NEL A;  3LNN A;  2DY7 A;  5EPL A;  1KDB A;  2ZTE A;  3J7Y W;  4YWK A;  3Q22 A;  1I50 B;  4APV A;  2QDB A;  4IFD H;  5TSS A;  4DV3 L;  2FHT A;  4B3M L;  2F52 A;  3AMU A;  1T9H A;  2RVL A;  1ET6 A;  2CCZ A;  1IW7 D;  4RGT A;  5M3F B;  4G7Z C;  1IZ6 A;  1KQS A;  2Y0S B;  3GV6 A;  1Q1B A;  2F0T A;  4FF3 A;  4GKK L;  2Z6B A;  3GTK B;  2YU9 H;  2JA9 A;  4ZYS A;  1F2Y A;  4KKU A;  4JCV E;  2EXZ A;  1UWV A;  3UDF A;  1HNW Q;  3AU7 A;  3HGB A;  3PO2 H;  3DMU A;  4DXF A;  3PO3 G;  4ZAI A;  1H95 A;  3NWT A;  2N49 A;  1HR0 W;  1YJN A;  2TMP A;  3EJI A;  1BCP F;  1KHI A;  4A3I B;  2K7V A;  3K7A B;  3T4A C;  2VXW A;  3K5M A;  5HUR A;  1V1P A;  4LWC A;  1GUO A;  3TP5 A;  4PZ6 A;  3V96 A;  1JWU D;  2SNS A;  1Y8O B;  2RCN A;  3NTK A;  2K52 A;  4WFN 3;  3CXC A;  1NMF A;  1RKN A;  1EWC A;  5EGT A;  2R6G A;  3CW2 C;  3MHB A;  4PG3 A;  2MJ8 A;  1BDO A;  4AIM A;  2CW0 C;  3JAM c;  1PYW D;  1HHV A;  1O7I A;  2L0C A;  4H7B A;  2KEE A;  3E5S A;  1SYD A;  5T1G A;  4CKE A;  4GNX C;  1LUZ A;  3LX0 A;  5I9O A;  1H9R A;  1CSP A;  4G57 A;  1UEB A;  2A6E C;  4DUY L;  4NW2 A;  2UUB L;  1NJI C;  1T5X D;  4LFC Q;  2PNH A;  1WTO A;  1TWG H;  1TWA B;  5IP9 H;  3I70 A;  1STN A;  3HP3 A;  4DV6 Q;  4L5R C;  2E2D C;  2HD3 A;  4FF1 A;  1C48 A;  5CGK A;  1X9N A;  1X3E A;  4ILW A;  3NEM A;  2R93 G;  4HSP A;  4LF9 Q;  1RTN A;  3ITP A;  1O80 A;  4KHP L;  1YHQ A;  3I4N G;  3MTS A;  1NMG A;  3NUC A;  5BR8 Q;  1EOV A;  3IKJ A;  1E0B A;  5LL6 X;  1D5X C;  1RHP A;  5GAG C;  3AEV A;  4KV6 A;  3FMC A;  3RLO A;  2NVT B;  1TWH H;  1DZ1 A;  4C2M B;  4DXG A;  1VF5 C;  1UE7 A;  4MN3 A;  1S72 A;  2EYJ A;  5I2X A;  3TRZ A;  2F1M A;  3PO3 B;  1SYE A;  1SBB B;  3OW2 A;  4B3M Q;  3RR5 A;  1PH9 A;  4CKB A;  3S17 H;  2ZXP A;  1I5F A;  2VS1 A;  5LHY 1;  1CHQ D;  1LTS D;  3A74 A;  3CPW A;  4GKK Q;  2A69 D;  2EQS A;  4PQX A;  4FO2 A;  3K5L A;  2CKZ B;  4DR1 Q;  1I94 Q;  1QZG A;  2UU9 Q;  4XDX A;  3FPU B;  5C4Z A;  2MPM A;  1QCB D;  3STB C;  1HH2 P;  1SJH D;  2R3Z A;  4C3J G;  3ERO A;  4BWG B;  2N55 A;  4MTN A;  1EYA A;  1ESF A;  1L1O C;  4JI4 Q;  1N32 Q;  2PYK A;  2OXP A;  2K28 A;  5C3E G;  1HFG A;  4RG1 A;  4X66 L;  4XQJ A;  2XNA C;  3D4W A;  4DR6 L;  2E2J B;  1KXL A;  2KCN A;  1E2V A;  1EUJ A;  1IL8 A;  1FD7 D;  2FFK B;  5DEH A;  4JBJ A;  3I56 A;  2OQ0 A;  2I07 B;  2R93 B;  2NUC A;  5C4J H;  1SE8 A;  1HR0 L;  2K5N A;  4A3M H;  2G9H D;  5EPJ A;  1VQD A;  3RD4 A;  1BF4 A;  1QUQ A;  1JB3 A;  4N9P A;  3I4N B;  1WTP A;  4HJ8 A;  3MXN B;  1EZ6 A;  3Q8D A;  1WCM G;  4C3I H;  2KHI A;  1PRT B;  2ZTD A;  4DKA C;  2Z6K C;  2UUB Q;  4IPH A;  4K5W A;  4JI2 L;  2ATW A;  1P16 A;  1XNR L;  3F2U A;  1I6V C;  4DAV A;  3CU7 A;  5JPM C;  3MFG A;  2F3V A;  5KNC A;  2VY3 A;  3NE5 B;  4OO1 G;  4C3H G;  1Y1V G;  4KKT A;  1GXD C;  2RSN A;  5F2D A;  3RZO B;  4POF A;  3M4P A;  2IX1 A;  2RBM A;  3NWS A;  1EY0 A;  4KJN A;  1XNQ L;  3MAQ A;  1SYF A;  3GTP B;  3HOY G;  4DV4 Q;  4JBM A;  3ND9 A;  3DXJ C;  5CYU A;  2OT2 A;  3CAM A;  3CC2 A;  2B2W C;  2BDO A;  4CDC C;  3KDF B;  1L2F A;  4GNX A;  5A2Q L;  1A8V A;  3HS0 C;  3K0Y A;  3H0G G;  5HGT A;  5C6A A;  3CCM A;  4C3J B;  5K36 G;  5IWA Q;  1FJG L;  3I7F A;  3Q0A A;  5C3E B;  5DM7 3;  1PDQ A;  2XIW A;  2VW9 A;  4YHH Q;  1PLF A;  2AMC B;  3V2T A;  1V8Q A;  4HMI A;  3BZD B;  3JAM i;  2VB2 X;  3ICE A;  3GTG H;  1S40 A;  2F4V Q;  3K0X A;  1Q81 C;  1IKL A;  1EY4 A;  4RGM A;  1Q8K A;  4JI5 Q;  4R4Q A;  2NB0 A;  2QKI C;  2VUM G;  4ME5 A;  2CW0 D;  1VQN A;  2QCP X;  1SEB D;  4FVM A;  1A2T A;  1WCM B;  4Z9C B;  2KVM A;  1AP0 A;  2AQ1 B;  4IO9 A;  3FDT A;  2A6E D;  1B1Z A;  1X3G A;  4DR6 Q;  1AE3 A;  4HN7 A;  1ASY A;  1HNX Q;  1IHZ A;  1W2B A;  1F9Q A;  5JEA H;  1UEA B;  1JE4 A;  5IYB G;  2RSO A;  4C3H B;  1A63 A;  1Y1V B;  3J7A F;  3QOL A;  1NAP A;  4CKC A;  3BYT B;  5JAV A;  1LTG D;  1OO9 B;  1RCV D;  3QR8 A;  1B3Q A;  3KLW A;  1ENF A;  1E2W A;  3ER0 A;  3E9H A;  3HOY B;  4L5Q A;  1R4P B;  2DJF C;  2X6L A;  3F8T A;  4B9X A;  1TXY A;  4HJ7 A;  2F0F A;  5C4X H;  2L1B A;  3PMF A;  3FKI H;  4K6D A;  1L1O A;  4F87 A;  5JVH 3;  3H0G B;  4A3K G;  4K2L A;  2PZU A;  4OO1 I;  4HMJ A;  2C35 B;  4BS9 A;  3M4Q A;  3CC4 A;  2UXC L;  2HDL A;  2KUM A;  2XRQ D;  1C8C A;  4OL7 A;  1PHJ A;  4A3E G;  2B3G A;  1EU4 A;  2Q2U A;  2G5D A;  1Q46 A;  1QWY A;  4X65 Q;  3PIP 3;  2MNA A;  4DUZ L;  1IYU A;  2H4O A;  2K5H A;  3HG9 A;  1SJE D;  1RDP D;  1PH1 A;  3WOF A;  2R7D A;  3T51 B;  2WAQ G;  1SFO H;  2VUM B;  3NPP A;  2NVQ H;  3STB D;  2WAQ E;  4S3S A;  2BCO A;  1II3 A;  2A68 C;  2K5W A;  3TZD A;  4MZ9 A;  3CQZ H;  1BCP B;  3J81 L;  4OXP A;  1RJT A;  4XQN A;  5M5W H;  3S2D H;  3CCJ A;  4LF7 L;  1LM0 A;  1YIT A;  1HXY D;  3HRZ C;  2AQ3 B;  2K4K A;  2E74 C;  3I8Z A;  4DPG A;  2NWG A;  4QJF A;  1G51 A;  2I5M X;  2D9U A;  4XT3 B;  2JYO A;  5EBC A;  2ZM6 Q;  1NTG A;  1UUP A;  3SK5 A;  1SRO A;  2MHV A;  1WVL A;  2NN6 G;  2D5D A;  4GOP C;  1NR2 A;  3VR3 A;  2LXJ A;  3V05 A;  1CI3 M;  4H02 A;  4A3C H;  3L0O A;  5I4D A;  2JEB I;  2B2W A;  1MSG A;  1D5M C;  1HA5 A;  3KLS X;  4KY5 A;  2F3W A;  1O7Z A;  1XMO L;  2AKW B;  5CR3 A;  3S14 B;  5GQO A;  3HKZ E;  5JOB A;  5KRU A;  4A3K B;  1DM0 B;  4DN4 M;  2XVS A;  4BY7 H;  2JA5 G;  1B4O A;  4ZLT F;  4B3R L;  1EIH A;  1TKW B;  2WP8 J;  4A3E B;  4OWT B;  1FYC A;  5JVG 3;  1ASZ A;  1TS5 A;  3KJO A;  4A93 H;  3CCS A;  5IT9 E;  4V0B A;  3HOX G;  1TWF H;  1BNZ A;  3L7Z C;  1T5E A;  3NHH A;  3OHX C;  3BDC A;  3MEF A;  2QDL A;  2WAQ B;  3BDL A;  5C44 H;  2LKV A;  1A6X A;  2EXD A;  3H09 A;  2Z4I A;  5BN5 A;  1TR5 A;  1JJ2 A;  1BBX C;  4L63 B;  4QL5 A;  3NEN A;  1YNJ C;  2DGY A;  2L55 A;  4LF8 L;  2AWO A;  3ULL A;  1D2B A;  2E2H H;  2ZT9 C;  2L9H A;  3T16 A;  1I6H H;  1PZI D;  2FMM A;  4HED A;  2ZTC A;  4KTA A;  3OTO L;  4UP7 A;  5BN3 A;  1EU3 A;  3BU2 A;  4L6T B;  5IY0 A;  2N3S A;  4CJ0 B;  5LMN L;  3D3R A;  3R2T A;  1ZKO A;  3D6C A;  3NQI A;  3SVM A;  1LAC A;  3P20 A;  1HUN A;  4H44 C;  5GAE C;  1GHK A;  1ZYR C;  3SK4 A;  3PUY A;  3L2P A;  2EJM A;  3AFP A;  1A3V A;  2UXB L;  5D65 A;  5G3L D;  3E3X A;  2JE6 I;  2EJF C;  1MHW C;  1DJR D;  4WJ4 A;  4HSV A;  4A3D H;  3QIA A;  3NQT A;  5AFW A;  4KK7 A;  4OX9 Q;  2D2C C;  4C1N I;  1JIC A;  3M7G A;  3KF8 A;  4HAE A;  3HOV G;  1SNP A;  3KBG A;  3EN2 A;  4IN3 A;  2NN6 I;  4RCO A;  1HNZ L;  3BYY B;  2JA5 B;  2CFM A;  1STB A;  2F0I A;  4JI3 Q;  4UY8 C;  1TS2 A;  1WI5 A;  4N8F A;  1MJC A;  4F88 A;  4FYD A;  1LTT D;  1DON A;  1AE2 A;  1TWC H;  3DWP A;  5FLX L;  5H1S E;  2PZT A;  4WRD A;  5IGD A;  2E2I H;  3HOX B;  2JA8 G;  3DM3 A;  2NYZ D;  1E1T A;  4KKS A;  1EL0 A;  1VQC A;  2HIV A;  1OXT A;  3D0F A;  1XPO A;  3CME A;  2KED A;  3Q6S A;  3KJP A;  1F9P A;  4FP5 D;  1EY9 A;  1C9O A;  1R9T B;  4TRD A;  2O2L D;  3S1Q H;  3CCL A;  4TQU S;  3VR4 A;  1D1K A;  1X3P A;  1YI2 A;  1EIF A;  4YY3 Q;  2Z1C A;  5JJK A;  4FF4 A;  4BA2 I;  1PTO D;  2E76 C;  5E7N A;  3S24 A;  1G2S A;  3PO2 G;  4DU9 A;  3C1E A;  2Q8T A;  1UAP A;  3GTJ B;  1SMY C;  1JR0 D; 
#chains in the Genus database with same CATH homology
 4KHZ A;  4KHP L;  3OYY A;  1VQF A;  3UE0 A;  4C3J H;  3G4S A;  2XTI A;  4DV7 Q;  1YHQ A;  2LSS A;  1VQE A;  1NMG A;  4L5S A;  5BR8 Q;  4POG A;  3I4N G;  1EOV A;  2QA4 A;  1CKN A;  4LF8 Q;  2B63 G;  4IFD J;  2IY5 B;  5C3E H;  2FXQ A;  1VQP A;  1HZC A;  4ALP A;  4BXX H;  4AQY Q;  5GAG C;  3AEV A;  4B3S Q;  1X55 A;  4A3L H;  4YY3 L;  4LFC L;  4DNI A;  4JI1 Q;  1K0R A;  3RLO A;  4LF6 Q;  1HZB A;  2YTV A;  1TWH H;  2WB1 E;  2D0P A;  1PH8 A;  1B7Y B;  1KD1 C;  3VDY A;  2HHH Q;  1N8R C;  4A3J G;  3S14 H;  3OTO Q;  1UE7 A;  1S72 A;  3TRZ A;  2I0Q A;  1QVC A;  4EX5 A;  4FDB A;  4A3K H;  5ELO A;  3OW2 A;  1E3P A;  5LMN Q;  1IBL L;  3F2C A;  4B3M Q;  5M5Y H;  1YJ9 A;  1IBK L;  4DR3 Q;  2PI2 A;  4LF9 L;  1SLJ A;  2MQH A;  3RR5 A;  3J80 i;  1PH9 A;  3W1G A;  1JMC A;  4DV7 L;  3EIV A;  1XMQ L;  1VQK A;  3S17 H;  4A3C G;  5BR8 L;  5IYD H;  1LYL A;  1PV4 A;  1I5F A;  3A0J A;  4X66 Q;  2VS1 A;  2GVB A;  4BBS G;  5FLM H;  3A74 A;  3K8A A;  3CPW A;  1B70 B;  4AQY L;  4GKK Q;  2YYZ A;  2EQS A;  4B3S L;  2F3I A;  5IP9 G;  1L1O B;  1SR3 A;  5GRO A;  2HQL A;  3BZC A;  4JI1 L;  2CKZ B;  4UP8 A;  2N8N A;  4YWM A;  4DR1 Q;  1I94 Q;  1K83 H;  4JG2 A;  2R92 H;  4A3B H;  1VQ7 A;  1S3O A;  5FJ8 G;  4DV2 L;  1QZG A;  2PQA A;  4TVA B;  4UPA A;  2UU9 Q;  2R7Z H;  2YTY A;  2E5L L;  4KI0 A;  3STB C;  2K5V A;  1HR0 Q;  3I55 A;  1HH2 P;  1HNZ Q;  2NVX H;  2OQK A;  1Y1V H;  4DV1 Q;  2L15 A;  4DR3 L;  4BY7 G;  1V1Q A;  4MTN A;  4IPG A;  1L1O C;  4JI4 Q;  5C0X J;  4BA1 I;  1N32 Q;  1G6P A;  1PYB A;  5C3E G;  4RG1 A;  4X66 L;  3GTO H;  2OTL A;  1MKH A;  3HOY H;  4JI2 Q;  1X56 A;  4DR6 L;  1YEZ A;  1Y1W H;  1KXL A;  2UUA Q;  4X64 Q;  4DR1 L;  1XNR Q;  2D62 A;  5M5X H;  4KLK A;  1N34 L;  1EUJ A;  3GO5 A;  1I94 L;  1VQ5 A;  4JBJ A;  2CWP A;  4L5T A;  4BBR G;  3I56 A;  4DV5 Q;  3I4M G;  3S1M H;  2OQ0 A;  2UU9 L;  2JA6 H;  2PI2 E;  3ULP A;  5JJI A;  2KHJ A;  4HIM A;  5C4J H;  1SE8 A;  1HR0 L;  2K5N A;  4A3M H;  4O0A A;  4DV1 L;  1VQD A;  1QUQ A;  4GKJ Q;  5HY6 A;  1JJC B;  4HJ8 A;  3MXN B;  3HOZ G;  3ULJ A;  5IYD G;  3Q8D A;  4JI4 L;  1N9W A;  1XNQ Q;  1WCM G;  2JK8 A;  4C3I H;  1N32 L;  2KHI A;  2ZTD A;  4DKA C;  1IXR A;  1XPU A;  2Z6K C;  3BZK A;  1J5E L;  2UUB Q;  4IPH A;  1VQI A;  3U4Z A;  3GTK H;  4JI2 L;  2A8V A;  1VCI A;  4AYB G;  1GD7 A;  3LGJ A;  1P16 A;  4JBW A;  4X64 L;  3PUV A;  1XNR L;  4JOI A;  1N33 Q;  2ATW A;  3M3Y H;  4AYB E;  1OXV A;  3J7A 5;  1YHB A;  4P72 A;  3G71 A;  3CF5 A;  2R7Z G;  2VY3 A;  3CCV A;  1PYS B;  4IFD G;  1Q12 A;  2QEX A;  4PMW A;  4OO1 G;  4A76 A;  2VUM H;  4GLX A;  1Q1E A;  1Y1V G;  2JA5 H;  3DLL A;  2Z0S A;  1FGU A;  4JBK A;  2MO1 A;  4GKJ L;  1E22 A;  1FJG Q;  1K8G A;  4POF A;  3KF6 A;  3M4P A;  4LNQ A;  2IX1 A;  5LMU Q;  1EIY B;  1PVO A;  4DK6 C;  4GLV B;  4GN3 B;  1XNQ L;  4DR5 L;  2D0O A;  2RHQ B;  4YCW A;  3H3V I;  4OWW B;  2CWA A;  1DGS A;  1E24 A;  1PH5 A;  2JA7 H;  3GTQ H;  3S2H H;  1PH2 A;  4DV4 Q;  4A3F H;  3T1H L;  4JBM A;  3HOY G;  3TEH B;  3WWV A;  3CAM A;  5IYC H;  3HOX H;  1WFQ A;  3E9I A;  3J81 c;  4GOP A;  3CC2 A;  1D7Q A;  4R1J A;  1WYD A;  3PSI A;  2ZJR A;  3RN2 A;  3KDF B;  1BBW A;  1L2F A;  4PZ8 A;  4XTC S;  1N33 L;  3B6Y A;  4GNX A;  5J3B A;  2JA6 G;  1A8V A;  3UDI A;  1JT8 A;  1CKN B;  1PA6 A;  1CUK A;  3H0G G;  1IBL Q;  1A0I A;  4A3M G;  3CCM A;  3ERS X;  1IBK Q;  2UUC L;  2BH8 A;  5K36 G;  5IWA Q;  1FJG L;  1HZ9 A;  1WOC A;  2Q2H A;  1R9T H;  4DAY B;  1XMQ Q;  3I7F A;  3UDX A;  5LMU L;  4JI0 Q;  4LF4 L;  5ELN A;  1GO3 E;  2VW9 A;  4YHH Q;  1HJP A;  2AMC B;  3KYH C;  4LUZ A;  4DV4 L;  2WB1 G;  4Y52 H;  1TWA H;  2Y0S E;  1VQB A;  1IYJ B;  3HOW H;  2K14 A;  1SMX A;  5GAH C;  3JAM i;  4DR7 L;  3ICE A;  2HIX A;  3I4O A;  3GTG H;  1S40 A;  2F4V Q;  3H15 A;  1VQJ A;  2GN5 A;  3K0X A;  2N78 A;  1XJV A;  1Q81 C;  3RLF A;  4DV2 Q;  5C0X G;  1OXU A;  1Q8K A;  3NBH B;  2CQO A;  2E5L Q;  4R4Q A;  4B3T Q;  4JI5 Q;  4NXM Q;  2OTJ A;  2VUM G;  4P74 A;  4LUO A;  4OWX B;  3PGZ A;  3GTJ H;  1A62 A;  1XPR A;  2IT1 A;  4MNO A;  1VQN A;  5IE8 A;  4A3G H;  5IWA L;  3PCO B;  4NPS A;  1FL0 A;  4A3E H;  3AQQ A;  3UDG A;  4JI0 L;  4IO9 A;  2JA7 G;  2VZA A;  2PQA B;  4GN4 B;  4YHH L;  3G6E A;  4A3F G;  5IYC G;  1X3G A;  3CCR A;  3CD6 A;  5EAY A;  2NVT H;  1AE3 A;  1J6Q A;  4DR6 Q;  4DR7 Q;  1ASY A;  2MO0 A;  3JC6 6;  2AWN A;  1HNX Q;  1N34 Q;  1VQH A;  2F4V L;  1W2B A;  3HOV H;  3PUX A;  1JB7 A;  1KRT A;  3F2B A;  4GS3 A;  4LUV A;  3G48 A;  5IYB G;  3PF5 A;  4JI5 L;  4B3T L;  1A63 A;  1YBY A;  2VQF L;  2PMZ E;  4JI6 L;  4NXM L;  4PZ7 A;  4HJA A;  1V43 A;  4AH6 A;  2UXC Q;  3GTM H;  2IHF A;  1VQG A;  3HOU H;  4DV0 L;  3CPF A;  1I3Q H;  3M4O H;  1BVS A;  2V1C C;  3KLW A;  1WJJ A;  2JEA I;  1Z9F A;  3ER0 A;  3E9H A;  4L5Q A;  2BA1 A;  2VNU D;  4BXX G;  1U5K A;  2NZO A;  3A5U A;  1J5E Q;  4HIK A;  4A3L G;  3KF8 B;  2H5X A;  4LFA Q;  2JA8 H;  3HOW G;  3BJU A;  3F8T A;  4DUZ Q;  1TXY A;  1KC8 C;  4HIO A;  4HJ7 A;  3A5Z B;  3T1Y L;  1QUQ B;  4R4T A;  5DLQ E;  5C4X H;  2AHO B;  1HNX L;  3FKI H;  1I50 H;  2A1A A;  2Q2T A;  1L1O A;  1QZH A;  3CCE A;  4IFD I;  4A3K G;  2XGT A;  1PH7 A;  4R4I A;  4OO1 I;  2E8G A;  4EQ5 A;  2VQE Q;  2C35 B;  1C0A A;  3M4Q A;  3CC4 A;  4A3G G;  2UXC L;  1KL9 A;  1QVG A;  1X54 A;  1Z47 A;  1CKO A;  1PHJ A;  5M3F H;  4X62 Q;  2B3G A;  4A3E G;  1X6O A;  1OTC A;  2Q2U A;  2UXD Q;  4DR5 Q;  4LF7 Q;  5FLM G;  1Q46 A;  4XIG S;  3UE1 A;  1M90 C;  1XTD A;  4X65 Q;  3T1H Q;  2YTX A;  3K80 C;  3U58 A;  4LFA L;  2E2J H;  1YHA A;  2GVA A;  2MNA A;  5IP7 H;  4DUZ L;  2K5H A;  4A3B G;  4OON A;  2R92 G;  4RMF A;  1MIU A;  3RZD H;  1UE1 A;  1PH1 A;  1X3F A;  5JEA G;  3KF6 B;  1PH6 A;  2R7D A;  2WAQ G;  3J81 j;  1SFO H;  1QVF A;  3CP0 A;  3GTL H;  3CC7 A;  4LW1 A;  1K3R A;  1VQ4 A;  2NVQ H;  2VQE L;  3STB D;  2WAQ E;  2UUC Q;  3HOU G;  1G29 1;  3I4N H;  5M3M H;  1VQL A;  3PV0 A;  4A3I H;  4YWL A;  1Q86 C;  1U0L A;  4GOP B;  1RL2 A;  4MZ9 A;  3CQZ H;  3K7A H;  3PUZ A;  2B29 A;  4X62 L;  4OXP A;  1EFW A;  4LF4 Q;  4LF5 Q;  4JV5 Q;  1YIJ A;  5M5W H;  3S2D H;  1YVC A;  2UXD L;  2I5L X;  1LTL A;  3CCJ A;  5GAD C;  2IX0 A;  1LM0 A;  4LF7 L;  1JE5 A;  1YIT A;  1X65 A;  4X65 L;  1IL2 A;  2K4K A;  4DPG A;  4BY1 H;  2ALY B;  4QJF A;  1XMO Q;  2YV5 A;  1YNX A;  3AYH B;  1Y1W G;  1G51 A;  1VQA A;  2I5M X;  3SGI A;  2RF4 A;  2ZM6 Q;  3ZJY C;  1EWI A;  5FLX c;  4HJ9 A;  4A3J H;  3TRE A;  3FKI G;  1NTG A;  3PIP A;  1MJE A;  1SRO A;  1HNW L;  1Q82 C;  5C0X I;  2LXK A;  3GDE A;  4J15 A;  2NN6 G;  3CCU A;  3TS0 A;  4GOP C;  2LXJ A;  4YCV A;  4UP9 A;  2OCE A;  2A19 A;  4H02 A;  2WFW A;  4B3R Q;  4A3C H;  3L0O A;  2JEB I;  2K75 A;  4IJL A;  5M3F G;  4BBS H;  4JI7 Q;  5JEA J;  2BA0 A;  2JJQ A;  2Y0S G;  4JV5 L;  4NXN L;  4YCU A;  3GTP H;  4X6A H;  3J80 c;  5AJ3 L;  3RN5 A;  2HT1 A;  3J7Z C;  3W5O A;  1VQ6 A;  4IOA A;  3I2Z A;  3U50 C;  1UE6 A;  3F2D A;  1XMO L;  2ZM6 L;  2AKW B;  5FJ8 H;  5GQO A;  4K0K Q;  3HKZ E;  3K81 C;  4GN5 A;  4DK3 C;  1VQO A;  3KFU A;  2VQF Q;  4JI6 Q;  2K50 A;  3KDF A;  4BY7 H;  2JA5 G;  1GM5 A;  5M3M G;  1NBW A;  2KBN A;  1NY4 A;  4DV0 Q;  4A3I G;  4B3R L;  3KOJ A;  2WP8 J;  3FHW A;  1VQM A;  4OWT B;  1K8A C;  3J81 i;  4JI7 L;  2R7F A;  1YZ6 A;  3HKS A;  1ASZ A;  3KJO A;  4A93 H;  3CCS A;  4DR4 Q;  4BY1 G;  1IBM Q;  3PF4 A;  3HOX G;  1VQ8 A;  4O2D A;  1TWF H;  4DV6 L;  2KCT A;  2Q2I A;  3T1Y Q;  3L7Z C;  4BBR H;  4C2M H;  1YJW A;  1BKB A;  3I4M H;  1PH4 A;  3CMA A;  3MEF A;  4K0K L;  1D8L A;  4DV3 Q;  1KRS A;  2RHS B;  5C44 H;  2ES2 A;  1SN8 A;  2EXD A;  3PO3 H;  4JI8 L;  2EIF A;  1JJ2 A;  3M7N A;  2NVY H;  1CSQ A;  2IHE A;  4QL5 A;  4LF5 L;  3FP9 A;  3NEN A;  2KCM A;  1AH9 A;  2DGY A;  3HOZ H;  1WCM H;  4LF8 L;  2AWO A;  1GVP A;  3E0E A;  3HFZ B;  2UXB Q;  3ULL A;  4JYA Q;  1BBU A;  2E2H H;  3RLN A;  3TS2 A;  3NEL A;  3S16 H;  1I6H H;  5JJL A;  4QQB X;  4DR4 L;  1RIP A;  1IBM L;  2ZTE A;  4LF6 L;  4LFB L;  2HHH L;  2ZTC A;  4YWK A;  3OTO L;  4APV A;  1EQQ A;  1C7Y A;  1UE5 A;  4UP7 A;  1PFS A;  1VQ9 A;  3BU2 A;  5IY0 A;  2N3S A;  4WJ3 M;  4P73 A;  4IJH A;  4DV3 L;  5LMN L;  3M9B A;  4C3H H;  4B3M L;  2F52 A;  5LMN W;  1T9H A;  2CCZ A;  3TQY A;  2ZJP A;  5GAE C;  1JJG A;  3CCQ A;  3L2P A;  3PUY A;  1IZ6 A;  3AFP A;  2ASB A;  1GKH A;  1KQS A;  2UXB L;  4JYA L;  1Q1B A;  2JE6 I;  2MFI A;  4GKK L;  4A93 G;  4WJ4 A;  4Y7N H;  2YU9 H;  3EBE A;  2JA9 A;  4A3D H;  1E7Z A;  3K7U C;  3PUW A;  4OX9 Q;  2ID0 A;  4JCV E;  1K9M C;  4IOC A;  3GD7 A;  1UWV A;  3UDF A;  4LFB Q;  3IRB A;  3HOV G;  3PO2 H;  5C44 G;  1HNW Q;  3EN2 A;  2NN6 I;  3H0G H;  4GLA C;  3F1Z A;  3PO3 G;  1H95 A;  1HNZ L;  2R93 H;  2N49 A;  2I5H A;  1N36 Q;  4JOI C;  1K73 C;  1NE3 A;  2CFM A;  1HR0 W;  1YJN A;  2Z6K A;  1KHI A;  4QGU A;  4NB3 A;  4JI3 Q;  4UY8 C;  3W1B A;  1WI5 A;  1VS0 A;  1MJC A;  3H3V H;  4QY7 A;  5HGQ A;  4DUY Q;  2B63 H;  4QIW E;  1AE2 A;  1TWC H;  4LWC A;  1L0W A;  4P71 A;  5H1S E;  4PZ6 A;  4NXN Q;  1M1K C;  5AJ3 Q;  4GNX B;  2E2I H;  1B8A A;  2RCN A;  2JA8 G;  3DM3 A;  2K52 A;  2UUA L;  4P75 A;  3CXC A;  1E1T A;  1NMF A;  3S15 H;  4R4C A;  2R6G A;  1V9P A;  3CW2 C;  3S1N H;  4OX9 L;  1VQC A;  1KIX A;  5C4X G;  5IT9 c;  2HIV A;  1OXT A;  3D0F A;  4PG3 A;  4DV5 L;  4DR2 Q;  4AIM A;  1XPO A;  2JQO A;  4R4O A;  3U4V A;  3M85 A;  3CME A;  3JAM c;  4HJ5 A;  1W3S A;  1O7I A;  3KJP A;  1FVI A;  4IPD A;  2BH2 A;  3PIO A;  4IPC A;  1N36 L;  2QGQ A;  4KHP Q;  1KAW A;  1OXX K;  4GNX C;  1LUZ A;  1C9O A;  3RZO H;  1Y14 B;  4ME3 A;  4JI3 L;  4HID A;  1CSP A;  3S1Q H;  1EQR A;  1UEB A;  4TQU S;  4A4I A;  1Q7Y C;  3CCL A;  1CKM A;  4DUY L;  2DUD A;  1YI2 A;  2UUB L;  1SRU A;  1EIF A;  1NJI C;  1E1O A;  4YY3 Q;  2PNH A;  1PH3 A;  2OWO A;  4LFC Q;  5JJK A;  1TWG H;  5IP9 H;  1P8L A;  4A3D G;  4JC0 A;  3AFQ A;  4BA2 I;  3HKZ G;  5IP7 G;  4DV6 Q;  4L5R C;  5E7N A;  3S24 A;  3S1R H;  1X9N A;  1X3E A;  3PO2 G;  2NZH A;  1OXS C;  5IYB H;  4A75 A;  4DR2 L;  3NEM A;  1EYG A;  2KEN A;  2R93 G;  4DAM A;  4JI8 Q;  1HZA A;  2ZJQ A;  4LF9 Q;  2VL6 A;  3RNU A;  3D31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...