3FP9A

Crystal structure of intern domain of proteasome-associated atpase, mycobacterium tuberculosis
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
150
structure length
150
Chain Sequence
PSGYGVLLATHDDDTVDVFTSGRKMRLTCSPNIDAASLKKGQTVRLNEALTVVEAGTFEAVGEISTLREILADGHRALVVGHADEERVVWLADPLIAEDLPDGLPEALNDDTRPRKLRPGDSLLVDTKAGYAFERIPKAEVEDLVLEELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights on the Mycobacterium tuberculosis Proteasomal ATPase Mpa.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Proteasome-associated ATPase
total genus 28
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2009-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16450 Prot_ATP_ID_OB Proteasomal ATPase OB C-terminal domain
A PF17758 Prot_ATP_OB_N Proteasomal ATPase OB N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3fp9A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3fp9A01
3CCMA 1ASYA 2HHHL 4X6AH 1PFSA 2HQLA 4IPGA 1WYDA 1QZHA 4L5QA 1HZAA 2N8NA 1L1OC 2YTXA 1Q8KA 3KF6B 2ASBA 2A19A 3JAMc 1BBWA 1U0LA 3NBHB 3M85A 4NXMQ 1Q12A 1UE7A 2QGQA 4LFCL 4IJHA 1EWIA 1PH5A 2MO1A 4R1JA 1Q81C 1HZBA 4IPCA 5C4JH 4O2DA 2E2JH 4Y52H 4JG2A 3W1BA 1LYLA 2VQFL 2FXQA 1EYGA 5GROA 4BXXH 1HH2P 1PYBA 3G6EA 1RIPA 1SE8A 4R4TA 1IBKL 1WCMG 2D0OA 4GN4B 3PUZA 1VQGA 2LXJA 2R7ZG 4WJ4A 3CCRA 1AE2A 1D8LA 3CQZH 4IPHA 4OONA 3GTOH 4YCVA 2RCNA 1IBLL 1PV4A 5IWAQ 5JEAJ 4IO9A 1JJ2A 1I94L 3GTMH 1G291 1YEZA 2LSSA 5FLMG 3I55A 2JA8G 2PQAA 4B3RL 1Q82C 3BU2A 2UUCQ 3F2DA 4HJAA 1HR0W 2HIVA 4A76A 4K0KL 2ALYB 3DM3A 2K4KA 4LF7L 5FJ8H 1VQIA 2BH2A 1PH8A 4LF6L 2N78A 3KF6A 5M3MG 1YHBA 3S17H 3PSIA 1MJCA 1K83H 2R7DA 1LM0A 4DV2L 4KHPQ 4GKKL 3AFQA 1EIFA 1CKNA 3UDIA 1VQMA 1TWFH 1X6OA 2A1AA 2Z6KC 5C4XG 4DV1Q 1C7YA 1A63A 4PZ7A 2HT1A 4AYBG 1JMCA 3L7ZC 3FP9A 1VQJA 1UE1A 3OYYA 5FLMH 2E5LL 3I4OA 2JA8H 4DR4Q 1I6HH 1J5EQ 4DV3L 1PH7A 3VDYA 4JI2L 1K8AC 2R92H 3W5OA 2VQEQ 5BR8L 3M7NA 2RHSB 4JOIA 4JI0L 4LF6Q 3MEFA 4LFAQ 1FJGL 4BA2I 4K0KQ 1H95A 1IYJB 5GADC 4JI4Q 4KI0A 2XTIA 3ULLA 3T1HL 1PVOA 2IT1A 4DV4Q 4OO1I 1JJCB 4JV5L 3RR5A 2JK8A 1YHQA 1NTGA 2YTVA 1W2BA 5IYBG 3J81c 4UPAA 1I94Q 1I50H 2JA7H 3GTKH 1E24A 4JC0A 3CC4A 1M90C 4X62L 2CQOA 4KHZA 2K5HA 3TREA 5IWAL 2OTLA 2UUAQ 1JT8A 1OXVA 5IYBH 1N33Q 3PO3H 1K8GA 4IFDG 2WB1E 2VZAA 3CCLA 3J81i 3F1ZA 2NVTH 2Z0SA 3A74A 4C2MH 1YHAA 2BH8A 4UY8C 4AIMA 3CF5A 3J7ZC 3KYHC 4A4IA 2VNUD 1KD1C 1PH9A 1W3SA 3A5UA 5IYDG 3Q8DA 1EUJA 4OX9L 4GKJL 1A8VA 4DAMA 4YCUA 4A3EG 3ZJYC 3S1RH 4JI5L 4LFCQ 4BY7H 1Y1VH 2PI2A 4UP7A 4JOIC 4X66L 2VW9A 1IL2A 3L0OA 3D0FA 3CAMA 5E7NA 4HJ8A 3IRBA 5IE8A 2ATWA 1Z47A 1SROA 1TWGH 1I3QH 2QEXA 4A3DH 1L1OA 1VQ9A 4LF9L 3S16H 2N49A 1B70B 1C9OA 3K7UC 2OCEA 3CPWA 3J7A5 1CKMA 1XPRA 1GKHA 3KDFB 2K14A 2IX1A 4PZ8A 1YJWA 1OXSC 1NMFA 1TWCH 2NN6I 2CWAA 3RLOA 5AJ3Q 3HOYH 1SN8A 2JA7G 5IP7G 3U4ZA 4DR1L 1WCMH 1CKOA 4DR5L 1Y1VG 4XTCS 5JJLA 2UU9L 4GLAC 3H3VI 1SMXA 2KHJA 4JYAL 4YWMA 5BR8Q 4BBSG 2WB1G 3PIOA 4JI7L 1RL2A 5LMNL 5DLQE 2K50A 2HIXA 2WFWA 2ZM6L 2E8GA 3ULJA 3M9BA 4DNIA 2IY5B 3W1GA 3S1MH 4A3BH 4GN5A 3CC2A 1PH4A 2YTYA 1PA6A 4YHHL 1VQ5A 4OWTB 1J5EL 3F2BA 1X56A 4GS3A 1G51A 3STBD 1FL0A 2E5LQ 1KQSA 1QVGA 4DR1Q 1VQPA 3HOVH 2R92G 2WAQE 3NEMA 1AE3A 1IZ6A 2VL6A 2GVBA 3J80i 2NVXH 2YV5A 2V1CC 4AH6A 4DV0L 1VQ6A 4BBRH 4OXPA 1QZGA 3OTOQ 4IFDI 3AFPA 2UXDQ 3I4NH 4QQBX 1X3EA 1G6PA 3KDFA 4BY7G 3HOVG 2QA4A 4AYBE 3U58A 3H0GH 3EIVA 1N32L 2JA9A 4A3MH 1V9PA 2E2IH 1Q1EA 2CFMA 1XNRL 2UUBL 2B29A 2D0PA 2AHOB 1X3GA 4R4OA 4JI1Q 4QY7A 3M4QA 1EQRA 1VQHA 4QIWE 4TVAB 4GNXA 1MIUA 2ZTDA 4DR2L 1YI2A 2UUCL 4B3TQ 2Y0SE 4POGA 3GTQH 4JYAQ 4UP9A 3G48A 4OO1G 1CKNB 5FLXc 3CCQA 4PG3A 1SFOH 3I4MG 4QGUA 4NB3A 2HHHQ 1BVSA 4AQYL 2OTJA 2RHQB 5K36G 3H0GG 4FDBA 1O7IA 4DV7L 1YJNA 2EIFA 3PUVA 4NXML 2K5NA 4LF5Q 2R6GA 1EQQA 4BBRG 3HOZH 2RF4A 1N33L 1L0WA 1HR0L 1KHIA 3ULPA 1PH6A 1D7QA 5GQOA 3F8TA 2EQSA 1L2FA 5GAHC 3CXCA 3HKZE 1KC8C 1VS0A 1PH3A 4C3JH 2DGYA 3RNUA 1XNQQ 2UXBQ 3PUXA 1VQCA 4DV7Q 3A0JA 1TXYA 3HKZG 2PMZE 1V43A 4A3BG 1PH1A 3NENA 4B3MQ 3J80c 4A3CH 4DR7Q 4NXNQ 2KBNA 4GN3B 5C0XG 4JI3L 3EN2A 5C44H 1KAWA 1M1KC 4JBWA 3STBC 1YZ6A 4GNXB 1FGUA 1HZ9A 3UE1A 2OQ0A 5M5YH 4B3TL 1YNXA 2KCTA 4A3CG 2VQEL 1T9HA 1HNWL 1LTLA 5LMUL 4L5RC 4LWCA 3I4NG 1FVIA 4O0AA 2AWOA 4R4CA 3J81j 4TQUS 2Q2UA 1YBYA 3KFUA 1EOVA 1Y14B 3H3VH 3I4MH 4LFBQ 1YITA 4A3KG 5IY0A 4GKKQ 1S3OA 4R4QA 4LFBL 1BKBA 1J6QA 2Q2IA 4XIGS 1Z9FA 5H1SE 4POFA 1EFWA 2JA6G 5C0XJ 4DR6Q 2E2HH 4JV5Q 2A8VA 4DR2Q 3M3YH 4BBSH 4B3SL 1Y1WG 3S14H 1WJJA 4HIDA 1VQAA 3I56A 4P72A 3GTJH 3M4OH 1IXRA 5C0XI 2DUDA 3PCOB 2Q2TA 2BA0A 3F2CA 4HIMA 4JI0Q 1GD7A 4B3RQ 3CW2C 1L1OB 4JI2Q 3DLLA 1E1TA 1B7YB 2NZOA 3RLNA 1HNZQ 2UXDL 1JJGA 4P73A 3PGZA 2MQHA 4B3ML 5M3MH 2VUMH 1NMGA 3K8AA 1KRSA 3TS0A 4A3DG 2ZJQA 3K80C 4H02A 4A3LH 3OW2A 2LXKA 4B3SQ 1YIJA 2ID0A 1UE6A 5IT9c 1X55A 3KJOA 2NVYH 3HOXH 4LF9Q 4A3IG 2JEAI 1QVFA 3HOUH 4DV5L 1N34L 3S2HH 3NELA 3E9HA 4A3MG 1KRTA 2ZTEA 5EAYA 1SR3A 1I5FA 4DR5Q 3S1QH 4ME3A 4DK3C 1KL9A 2GN5A 3HOXG 1HNXL 1V1QA 1AH9A 3H15A 4A93G 1OXXK 1CUKA 3PUWA 4PZ6A 3UDXA 5IP9G 5M5WH 1GO3E 3GD7A 4PMWA 4X64Q 2AMCB 3CC7A 5LMNQ 1CSPA 5LMUQ 2EXDA 3T1YL 1PHJA 4IFDJ 4LUOA 5ELOA 2NZHA 1YVCA 3AQQA 5GAEC 1N36L 2KCMA 4P75A 4YWLA 1TWHH 1QUQB 2K5VA 4X66Q 1VQ4A 4GOPA 3PF5A 4LF8Q 3LGJA 3CMEA 4LNQA 1NBWA 3B6YA 3KJPA 2F3IA 2VQFQ 5M3FH 3T1YQ 3D31A 4IPDA 3GTLH 2IHFA 1OXUA 1HZCA 3CPFA 1VQFA 3PIPA 1N32Q 4EQ5A 4AQYQ 1EIYB 4JI6L 4LUVA 1XJVA 3UDFA 5JEAG 3E0EA 4X65L 2ES2A 3I2ZA 4YWKA 1OTCA 5HGQA 5C44G 2ZJPA 1VQEA 1GVPA 2GVAA 4A75A 1WFQA 5IYDH 4DUZL 3CCUA 4A3GG 2Q2HA 2MFIA 2UUBQ 2C35B 3K7AH 2UXCL 2JE6I 4LUZA 4YHHQ 4BY1H 4L5SA 2OQKA 2PI2E 4NPSA 5C3EG 4DV3Q 4JBMA 1ASZA 2VS1A 1U5KA 4ALPA 4DV0Q 3OTOL 3FKIG 1HNZL 2JA5H 1VCIA 1E22A 3KF8B 3U50C 1JB7A 1Q1BA 1UE5A 4JCVE 2ZJRA 4DV4L 4BY1G 1XMQL 1IBMQ 2OWOA 3RLFA 1VQ8A 4JI4L 2KHIA 2Z6KA 2XGTA 2CWPA 4DV1L 4A3JG 4RG1A 4A3GH 1XNRQ 1HNWQ 3GTGH 5LMNW 2B3GA 4MTNA 4GOPB 3S15H 4P71A 2NN6G 1OXTA 4BA1I 4A93H 3CCJA 2I0QA 1P16A 3M4PA 1VQDA 1B8AA 3K0XA 4HIOA 4GOPC 1YJ9A 4YCWA 5IP7H 1XMOL 2UU9Q 2K75A 3TQYA 3S1NH 2H5XA 1X9NA 4RMFA 4DKAC 2F4VQ 2L15A 3GTPH 2Y0SG 5JJKA 3FKIH 2JA5G 3RN2A 3BZKA 5M5XH 1TWAH 4DAYB 5M3FG 1X3FA 1XNQL 1Q7YC 3AEVA 4KHPL 1A62A 1UEBA 4YY3Q 1IBLQ 3HKSA 4DPGA 2F52A 3JC66 4DK6C 4X65Q 1K73C 4HIKA 5ELNA 4DR4L 3AYHB 3GDEA 3I7FA 1VQOA 3KLWA 4OWWB 3HOUG 1XTDA 3MXNB 4A3IH 4LF5L 2JQOA 3ICEA 2AKWB 3FHWA 1VQLA 2JJQA 2IHEA 2WP8J 3HFZB 2CCZA 3UE0A 2R7ZH 3PO2G 2UXBL 1E1OA 4KLKA 3L2PA 2MO0A 5IP9H 3JAMi 4LW1A 4C3HH 1C0AA 3CCSA 4JI6Q 3G4SA 4IJLA 4A3KH 4JI3Q 4NXNL 3K81C 1IBKQ 2YU9H 3WWVA 5AJ3L 3EBEA 2JA6H 3HOYG 3CD6A 4DV5Q 4HJ9A 1N34Q 3TS2A 4JI5Q 3PO3G 4QL5A 4JI1L 1Y1WH 3KOJA 1K3RA 4L5TA 4DR3L 4A3LG 1E7ZA 3HOWH 1S72A 1PYSB 2UUAL 4LF8L 4X64L 3G71A 2I5LX 1HR0Q 1HNXQ 3PO2H 4DR3Q 3BZCA 5IYCH 1N36Q 1KIXA 3GO5A 4A3FG 1Q86C 3S24A 2B63H 1K0RA 2AWNA 1DGSA 2PNHA 4GLXA 2N3SA 3RZDH 4EX5A 4A3EH 3ER0A 1WOCA 2R93G 4OX9Q 4DUYL 1BBUA 1X54A 5FJ8G 4Y7NH 1JE5A 4QJFA 3CCVA 1VQBA 2F4VL 3BJUA 1HJPA 1E3PA 2CKZB 4J15A 1X65A 4JI8Q 3SGIA 4X62Q 4DV6Q 2I5HA 1NE3A 1SRUA 2MNAA 1XMOQ 1N9WA 1S40A 1GM5A 4IOCA 4JBKA 3HOZG 3CMAA 1Q46A 1NY4A 2BA1A 3T1HQ 5C4XH 1QUQA 2IX0A 1N8RC 1LUZA 1KXLA 4JI7Q 4P74A 4HJ7A 4LFAL 1XMQQ 4DV2Q 1R9TH 2YYZA 1XPUA 5JJIA 4YY3L 5J3BA 3PV0A 4C3IH 4DR6L 2VUMG 2R93H 4LF4Q 3PF4A 3S2DH 4BXXG 3TEHB 1VQNA 2B63G 4R4IA 2UXCQ 3CCEA 1CSQA 1A0IA 2JEBI 1PH2A 3A5ZB 1NJIC 5HY6A 1WI5A 3ERSX 4UP8A 4DUZQ 2ZTCA 4A3JH 1VQ7A 4OWXB 4HJ5A 1QVCA 4MZ9A 1FJGQ 1MJEA 3UDGA 3HOWG 1P8LA 2KENA 1XPOA 3PUYA 4LF7Q 5GAGC 1UWVA 3RN5A 4DUYQ 5C3EH 2K52A 2I5MX 3CP0A 1IBML 2ZM6Q 4A3FH 3U4VA 4DR7L 2R7FA 2WAQG 4GLVB 2VY3A 3TRZA 2NVQH 1MKHA 4GNXC 4MNOA 3RZOH 4APVA 4WJ3M 4JI8L 1SLJA 4GKJQ 1VQKA 4DV6L 4LF4L 4JBJA 5IYCG 2D62A 3E9IA 4IOAA 2PQAB 1K9MC
chains in the Genus database with same CATH superfamily
4KHVA 3CCMA 3HOUB 1T5XD 1JWMD 1LACA 3HOXB 4CKCA 1FR3A 3NBHB 5C0XH 4DFAA 3M85A 2K5QA 3V96A 2VUMB 1Q12A 2QGQA 2E2JH 2EYLA 2FINB 5CBAE 2QKIC 2B2VC 1HH2P 1PYBA 3M4OB 3W2DA 4LK1C 3QJYA 1SE8A 1IBKL 5AFWA 1PLFA 2EYFA 3PUZA 4HTHA 2EJGC 1VQGA 3P1HA 4WJ4A 3GTOH 4K8IA 4OONA 2RCNA 1TIID 1WVLA 1PV4A 5IWAQ 1G291 2A69C 2Q8IB 5F2DA 4HJAA 2HIVA 5FO9B 4LF7L 5M3MG 3S17H 1B3AA 1GXDC 5C4XG 3DWAA 3UDIA 1TWFH 2A1AA 3CHBD 4KK7A 5EPLA 2HT1A 4AYBG 4DXFA 1UE1A 1I6HH 2E5LL 1Q3LA 3GP7A 1IKLA 1XWEA 4JI2L 1X32A 3W5OA 5BR8L 3M7NA 1BNZA 4LF6Q 3MEFA 4PMCA 4LFAQ 4K0KQ 1EYDA 1HUMA 1ILPA 1B2TA 3K6OA 2IPKD 3S2HB 1K8MA 2IT1A 1VMCA 4JV5L 2M2LA 1BF4A 1W2BA 1K28A 5IYBG 3A54A 2JA7H 5M3MB 4QMGA 4X62L 1PDQA 2ZXRA 2F0PA 1EY8A 2J4XA 5IYBH 1N33Q 3PO3H 2WB1E 3MTSA 2Z0SA 4UDUC 2NVTH 2K1BA 3H0GB 1FNUA 3OHXC 1H9SB 1STAA 1CZGA 2F4IA 4A4IA 5IOCA 1E2WA 1V1OA 3IKJA 3Q8DA 4DAPA 2L4NA 4GKJL 4A3EG 4YCUA 5HURA 3ZJYC 4LFCQ 4UP7A 5K36H 1F9PA 2DY7A 3HG9A 4BWGB 1BXTA 2VW9A 1IL2A 3L0OA 4MHEA 5E7NA 5IE8A 4K5XA 1I3QH 3SK4A 3C46A 4JVZA 3S16H 2F0QA 3K7UC 4EGVA 3J7A5 3HOYH 2NN6I 2KEEA 2JA7G 3U4ZA 3F2UA 1BDOA 4YWMA 5BR8Q 2WAQB 4UHVA 2HIXA 3NE5B 3OIPA 2NZ1D 1WTOA 3SK8A 3L9AX 4DU9A 1LV9A 3CC2A 1B1ZA 1SYEA 5CV6A 1VQ5A 3VYRA 2Q8RE 3JAML 3F2BA 4GS3A 3T51B 1SJED 4C3JG 1J5EL 2PQEA 1PRTB 3NEMA 3S1RB 2RQXA 1GUWA 2V1CC 3OTOQ 1SNDA 2E2IB 1EY4A 1N32L 3VYUA 3EIVA 2JA9A 2WV6D 1L0XB 2K05A 1XNRL 3BVGA 2UUBL 2NVXB 2D0PA 2AHOB 2FMMA 4TVAB 3HOVB 4X3TA 2QEJC 4JYAQ 1YNJD 2EZVA 1PTOF 1HTPA 1STHA 1BVSA 1EQVA 2E76C 2RHQB 3NWSA 1EEFD 3VYSA 2N55A 2K5NA 4LF5Q 1EQQA 4K6LA 1Z6HA 4BBRG 3URYA 5ELDA 2DY8A 1HR0L 2A69D 3NP8A 1PH6A 4RWSC 3HKZE 2UXBQ 1TWCB 4DV7Q 1VQCA 2K04A 2F0VA 1TXYA 1D6EC 1PH1A 1JQYD 4A3CH 4DR7Q 1K83B 1A3TA 2B2YC 4GN3B 4JI3L 2IL8A 4OELB 5CV7A 5C0XG 1M1KC 4A3DB 1D1IA 4B9XA 4XT3B 1HZ9A 3H91A 3FPUB 2X6GA 1T9HA 2C5CA 3BYYB 1B50A 1BCPF 5LMUL 3Q24A 1TS2A 4LWCA 4R4CA 1K8OA 4WFN3 2DJGC 1EOVA 2NBFA 2EYPA 2XNAC 4LFBL 1RD9D 5JVG3 1JR0D 3BVZA 2A8VA 4HIDA 1LO5D 3M4OH 1IXRA 3PCOB 1STYA 1MHWC 1GD7A 2CH4A 2WB1B 3RLNA 2WINB 1D5MC 4ZRZA 2MQHA 1Y8NB 2EXZA 4B3ML 1I50B 1FNWA 3GTKB 3H94A 4A3DG 1LTBD 3K80C 4H02A 3QOLA 3OW2A 2LY7A 5C4HA 1GUNA 4A3IG 1F2YA 1KRTA 3E3XA 4KD3A 1SR3A 1WTRA 1KL9A 1TR5A 3HOXG 1AH9A 2Z1CA 2R92B 1VMPA 1CUKA 3PUWA 3UDXA 2NVQB 1ENCA 2QW7A 3VA5A 1RF2D 2EE1A 3AQQA 5CR3A 1N36L 4RA8A 1A3UA 4G7ZC 2PO4A 1TWHH 3OMGA 5ELEA 2K5VA 4RH6A 1EY6A 2VQFQ 3T1YQ 3S2DB 3D31A 2XN9C 1PXUA 1N32Q 4AQYQ 1XJVA 3LWEA 4H13C 3UDFA 4HMJA 3CQZB 2ES2A 1IW7C 3I2ZA 4LJZC 2VXWA 4YWKA 2LMCB 1EU3A 5NUCA 4KTAA 4RHSA 1EFID 4A75A 1VQEA 2WACA 5IYDH 4DUZL 1SYDA 1IHZA 3DWQA 2UUBQ 5IIFA 4YHHQ 4L5SA 2A68D 3EQLC 2L9HA 3AU7A 5C3EG 4DV3Q 2RCFA 2A6HD 5EKKA 3U50C 1UE5A 4IQZA 5J22A 3Q23A 1VQ8A 4JI4L 1SE3A 2Z6KA 4A3JG 1GHJA 4RG1A 1XNRQ 1HNWQ 3GTGH 2JYOA 2NN6G 3PO2B 5D3IB 2Z4HA 3K0XA 5E1FA 1XMOL 2H5XA 3TZUA 2KCCA 3GTPH 1YNNC 2Y0SG 5A2QL 3FKIH 3LX0A 3BDCA 3LNNA 2B2WC 5FLXE 2XVSA 3BZKA 1TWAH 1YNJC 2JA6B 5D65A 4CGYB 5C3EB 1QILA 1IBLQ 4DGZA 4X65Q 4FYDA 5ELNA 3EA6A 4EVOA 5KEEA 4A3JB 5J39A 2AKWB 3FHWA 3A8IE 2K01A 2IHEA 2R7ZH 1WD0A 5L37A 2UXBL 1E1OA 4KLKA 2MO0A 4C3HH 1O7LA 4JI6Q 3C2PA 4A3KH 3J81E 3I4LA 3WWVA 5AJ3L 4X3SA 2BCOA 4DV5Q 4HJ9A 3CD6A 3TS2A 1XYIA 1PFNA 3O13A 1X3QA 3KOJA 4DR3L 1AZQA 4DNTB 1E7ZA 4CJ1B 1IYVA 1F2MA 4LF8L 3TDQA 3G71A 4HN7A 1HNXQ 3HP3A 1TVXA 3PO2H 4HEDA 3A7AB 1ESRA 3S15B 5IYCH 4Q5VA 3X3MA 5JPMC 1Q86C 4Y7NB 2AWNA 2CW0D 2N3SA 3A8JE 4A3EH 4C3IG 3NBIA 4QJFA 1ZXTA 2HCCA 1LTID 1VQBA 2F4VL 3ITPA 3OSOA 2CKZB 3SGIA 1R4QB 4JI8Q 1AN8A 1NE3A 2Z8LA 2F0HA 5BN4A 1PMRA 4IOCA 4JBKA 3CMAA 1RODA 5CC4A 2PYKA 2BDOA 2TSSA 1QUQA 1LUZA 2RA4A 1XMQQ 3DMUA 3PV0A 3QO2A 1O7ZA 1X3PA 3FDTA 3PF4A 5A35A 3GTLB 3TEHB 2ENBA 5M3FB 1VQNA 2B63G 1PTOB 3R93A 2UXCQ 1CSQA 1A0IA 5T1IA 3A5ZB 3V2TA 1WI5A 3MXGA 4DUZQ 1VQ7A 4HJ5A 1FJGQ 2RSNA 2F0SA 2KUMA 1TWHB 2KENA 4HSVA 3AMUA 4KN7C 1KLUD 5GAGC 2B2UA 3MXUA 4DUYQ 5C3EH 3N52A 4KJNA 2AUJD 3U4VA 4WJ3M 4GNXC 1UAPA 4DV6L 4JBJA 3GTPB 1S5CD 2EJMA 5CMDA 1EQTA 1ICWA 3Q6SA 2AQ1B 4A93B 2N8NA 4FVMA 2ASBA 3AB9A 1BBWA 2K5WA 2LS01 4IFDH 4KMUC 1EWIA 3NWTA 1Q81C 1DZ1A 4R8NA 3TBIB 4Y52H 1XXGA 5G3LF 2A73B 1BO0A 2FXQA 1KNEA 1EYGA 5GROA 4BXXH 2KQ3A 4HCEA 5EKIA 1HQRD 1Y8PB 4OIKA 4GN4B 5EGTA 4FF3A 2R7ZG 4IPHA 2PW7A 4HMIA 4YCVA 1IBLL 2F0FA 1LTSD 1YEZA 3A7LA 1B9NA 1Q82C 3MC0B 2F0UA 4K5WA 4KKUA 5ELBA 3KLRA 2XWBB 1PH8A 1EY0A 2N78A 3KF6A 1YHBA 1K83H 2R7DA 2ZXPA 4O1NA 1LT3D 1CKNA 2Z6KC 3JAME 3H6MA 1BCPD 4OO1H 3V05A 3FP9A 1QNKA 2K28A 3BS1A 5FLMH 4DXGA 3R3OA 4DV3L 1PH7A 2AQ2B 2WKDA 2RHSB 4JOIA 3UI2A 4JI0L 1H95A 2KECA 4JI4Q 4KI0A 2XTIA 1PVOA 4OO1I 2HQEA 2NUCA 2JK8A 3KBGA 2YTVA 4M1UB 5CV4A 1I94Q 1E24A 4HSPA 3IFTA 1M90C 2EJFC 1LABA 3ND8A 5IWAL 1H9JA 3LWUA 1DJRD 5C6AA 1OXVA 5CV5A 4XT1B 3J81i 5LL6X 1E2ZA 5HGTA 2FJ2A 3CF5A 3J7ZC 1KDCA 1SEBD 3T56B 3I4NB 2VNUD 3A5UA 3DWPA 4ZLTF 3I4MB 3I70A 2E2DC 4OX9L 1A8VA 4DAMA 1DM0B 1AP0A 4BY7H 1S5DD 1EIGA 1RKNA 1U4MA 4A3BB 4J8QA 1SNMA 2ATWA 4NMZA 4N8FA 1L1OA 1MGSA 1O78A 4JK1C 1C9OA 1GKHA 4O42A 2K14A 2IX1A 1G2TA 5AJ3Q 1SN8A 2KOLA 5IP7G 2L11A 4DR5L 5IGFA 4H0LC 1Q8IA 2K33A 3MHBA 5CBEE 4BBSG 2RKSA 1C8CA 1QJOA 2F0OA 5LMNL 5DLQE 4U673 2K50A 2ZM6L 4DA2A 2E8GA 3ULJA 3M9BA 1IL8A 2XWJB 3HKZB 3QWNA 3S1MH 3VR4A 3R2TA 4YHHL 1ESFA 4KN4C 2E5LQ 2BDNA 4Z9CB 1QVGA 1VQPA 3HOVH 2R92G 3ZYYX 1IZ6A 1TY2A 4TSSA 3AFPA 2UXDQ 3TZDA 3I4NH 1NAPA 3KDFA 2NN6H 3NXWA 4RKBA 4A3MH 1V9PA 1Q1EA 2CFMA 3CRKC 1B4OA 1LT5D 2HDLA 4WJWA 1VQHA 4DR2L 2ZTDA 1DYQA 4UP9A 4PQXA 4OO1G 4KD4A 3I4MG 4NB3A 2HHHQ 2MGSA 4RKLA 2Q8TA 4IUTA 3H0GG 2EIFA 4L8JA 2R6GA 2J0TD 1AEXA 1F9SA 5C3WA 1N33L 5EBDA 5I4DA 3ULPA 5I9PA 2JA8B 1D7QA 5KYIA 2EQSA 2F0GA 1B3QA 3SR1A 3CXCA 1KC8C 1VS0A 3RNUA 1W6KA 3A0JA 3HKZG 2F0NA 1LTRD 1K3BC 3J80c 4P2CB 4B3MQ 3DEOA 3DXJC 1XX8A 1IYUA 4GNXB 3UE1A 1HPCA 2OQ0A 5M5YH 2PNRC 1YNXA 3BDLA 4A3CG 4TKOB 3KLSX 4ME5A 2IX3A 2ZXOA 2TMPA 1FVIA 3J81j 4TQUS 3GTMB 3MXNA 1STBA 3G6JB 3I4MH 4C1NI 3D4DA 1TT2A 4A3KG 3GTOB 5IY0A 2CH4W 4XIGS 5H1SE 1Z9FA 4POFA 1NNXA 4B3SL 4PNYA 1K0SA 1IW7D 3H3VC 1KTKA 3VR3A 5C0XI 3DLLA 5I6WA 2E2JB 1DONA 2EY5A 3I3CA 2G9DA 3PGZA 4OIJA 1NMGA 4F88A 4A3LH 2B2YA 3EFXD 3HZXA 1UE6A 5IT9c 2NVYH 2JEAI 3S2HH 3HOUH 1N34L 1SYFA 3NQIA 1AW7A 2NTSA 2I46A 4DR5Q 4ME3A 4DK3C 3OWFA 3H15A 3D4WA 3TP5A 5M5WH 3RZOB 1GO3E 3GD7A 4QB4A 5LMNQ 1CSPA 5LMUQ 2EXDA 1BR9A 4LUOA 5ELOA 2LKVA 1DOLA 1EYAA 4N9TA 2KCMA 4YWLA 5KNDA 1HCZA 3S17B 1FYCA 3CMEA 2ICEC 4KKTA 3KJPA 3DUZA 5EBCA 5M3FH 5IGEA 4IPDA 1DXMA 2IHFA 5C5MA 1OXUA 5T1GA 1VQFA 3PIPA 3QR8A 1SNPA 5G3LD 4K8JA 3KUPA 1OTCA 1QB5D 2RBMA 3FPPA 1WFQA 3K5OA 3CCUA 1QOHA 4A3GG 1JICA 2NTTA 4MTKA 2C35B 4BY1H 1GJXA 2K03A 2K5DA 3OTOL 2JA5H 1VCIA 2JP1A 2QF7A 1KNAA 1JB7A 1Q1BA 4A3EB 2KJXA 4BY1G 1IBMQ 2KHIA 4DV1L 3K57A 2CWPA 4IUPA 3N6RA 4MTNA 2B3GA 4GOPB 2CW0C 1O7YA 4P71A 1EZ8A 3S15H 5IGDA 3CCJA 3M4PA 1H9MA 1VQDA 1WTWA 5IP7H 2LFNA 2K75A 1RJTA 4RMFA 4DKAC 2L15A 1Y1WB 4KY6A 5M5XH 5M3FG 1X3FA 1Q7YC 1ZYRC 3NUCA 2F03A 3MWYW 1HFGA 4F7XA 5IT9L 2A6EC 4C3HB 1BOSA 3JC66 3OW7A 4DK6C 2OEOA 4HIKA 1CTMA 3TN2A 4A3IB 3HFZB 2WP8J 2CCZA 4FXGC 3L2PA 3JAMi 4V190 1C0AA 2A5HA 4JI3Q 3K81C 1R9TB 2JA6H 1PFMA 1KLGD 3HOYG 1QNUA 2E75C 1Y1WH 3MXPA 3ND9A 5JOBA 3M7GA 4DNRB 4A3LG 4IUUA 2UUAL 2I5LX 4ULLA 4YIJA 4DAYA 1LTTD 3KBXA 1N36Q 3GO5A 1A2UA 3S24A 1EYCA 4GLXA 4OHJA 5CYUA 2MJ8A 4JPBW 4KKSA 5I6YA 1Y8OB 4DUYL 5FJ8G 4OX9Q 5ELCA 4FF4A 4CDDC 1YNND 3J80L 3MZ5A 2H4OA 3CCVA 1I4HA 5IODA 4G4KA 3HOZG 2HCIA 1NY4A 3NSWA 2I07B 3Q22A 3T1HQ 4EQPA 1J8IA 2BOSA 1N8RC 2EVBA 1CI3M 1KXLA 4JI7Q 2RDGA 4DV2Q 1XPUA 1MSHA 2VUMG 4UAIA 1MSGA 3NTKA 3S2DH 1CHPD 2VB3X 1JC7A 1QWYA 5KIXA 2Y0SB 4A3JH 2EYOA 1B44D 1KDBA 1O80A 5LHY1 3UDGA 1EU4A 4LF7Q 1RDPD 3OOCA 3RN5A 2EYJA 5JPNC 1F77A 3EVQA 4A3FH 4GLVB 3TRZA 3RZOH 4C3HG 1VQKA 2D62A 3E9IA 4IOAA 1V1PB 3S9WA 3S1QB 1A2TA 1ASYA 2HHHL 4X6AH 1PFSA 2HQLA 3P75A 4IPGA 2NVYB 1WYDA 4CDEC 1STEA 1HZAA 4L5QA 2MUYA 3GTGB 4A3GB 2IJ0A 4U68A 3KF6B 3BZDB 1MI2A 4IJHA 4R1JA 4HAEA 1JE4A 1HZBA 4IPCA 5C4JH 4O2DA 4CJ0B 4K5VA 3W1BA 1LYLA 4XYOA 2VQFL 3K0YA 1W6JA 3G6EA 1RIPA 4R4TA 3SHLA 2E2HB 1SYCA 5ELFA 3DEPA 2LXJA 2Z6BA 1AE2A 3CQZH 4RGMA 1EL0A 5JEAJ 1JJ2A 1I94L 3KLSA 2JA8G 1CZWA 3I55A 1HA5A 3R8BA 1ET6A 3TP7A 1RTOA 5J1ZA 1I4XA 4ZK9B 1PZKD 2ALYB 3K5NA 3DM3A 2BH2A 2EDGA 4LF6L 3QOJA 3T4AC 1MJCA 4GKKL 3PIO3 1EIFA 1X6OA 1C7YA 4PZ7A 4C3JB 1ZYRD 3L7ZC 1VQJA 3D8GA 3OYYA 2XRSD 2JA8H 4DR4Q 1VF7A 2EPBA 3ERQA 1SE2A 3TMEA 1K8AC 2VQEQ 4B9WA 2F0TA 5C5LA 1FJGL 1CT1D 1IYJB 5GADC 1E2VA 1JJCB 2F3VA 4B08A 3IL8A 3RR5A 1PTOC 3J81c 4UPAA 1I50H 3SXHA 4JC0A 3CC4A 4KHZA 2OTLA 1JT8A 4OL7A 4ZYSA 4IFDG 4K14A 2VZAA 3HS0C 1QG7A 3CCLA 3F1ZA 4XQJA 3A74A 1G6ZA 1YHAA 2F1MA 4UY8C 4AIMA 3OWEB 3Q0AA 1KD1C 1PH9A 4L63B 1W3SA 5IYDG 1QCBD 4PMBA 4JI5L 1ENAA 2PI2A 3QG1A 4X66L 1SJHD 3D0FA 1II3A 3P20A 3CAMA 4HJ8A 1U4PA 3QIAA 2KCNA 1TKWB 1Z47A 1BCPC 1SROA 1TWGH 1VQ9A 2N49A 1B70B 2OCEA 1CKMA 3KDFB 2Z9HA 2K6AA 4PZ8A 1YJWA 1TWCH 2CWAA 4G7HC 2NYZD 5C3XA 1WCMH 4DR1L 4XTCS 2PW5A 2UU9L 4GLAC 4F8MA 3H3VI 4X3UA 1OO9B 1BCPB 1ICFB 4ZCKA 1JOQA 3PIOA 2PZUA 1RL2A 5BN3A 4LAAA 2WFWA 3G7LA 3E0JA 2IY5B 3W1GA 5KNCA 1SBBB 2B2VA 4GN5A 1PA6A 4OWTB 2MP1A 1G51A 3STBD 1KQSA 3MA2B 2WAQE 4BY7B 1FNVA 1HRJA 1AE3A 4IZ8A 2VL6A 2GVBA 2NVXH 2YV5A 2F0EA 4DV0L 1VQ6A 4BBRH 3P7JA 4OXPA 1QZGA 1HFNA 4A3MB 4QQBX 1X3EA 1G6PA 3U9OA 1LT4D 3U58A 3H0GH 2E2IH 3TP8A 4R4OA 4JI1Q 4QY7A 1EQRA 1JOKA 4QIWE 2QCPX 1MIUA 4GNXA 2H1EA 2K32A 2Y0SE 1TY0A 3NQTA 4POGA 1CKNB 4ID6A 3CCQA 1SFOH 2OTJA 3S1MB 3NTIA 1TS5A 4J6HA 2MHVA 4FDBA 4FP5D 1O7IA 1I4GA 4DV7L 4NXML 1EIHA 1SMYD 2E74C 1TS4A 2RF4A 4HCSA 1I6HB 5GQOA 1WCMB 3F8TA 1L2FA 4DN4M 1TQOA 3HOYB 3FRPB 1D2BA 1S5BD 1ML0D 2FFKB 3SDZA 4NXNQ 5C44H 3S16B 3VR2A 1KAWA 4CKEA 1JWSD 1I4QA 1YZ6A 1FGUA 4B3TL 1UUPA 1LTLA 4CKBA 2A74C 4L5RC 4O0AA 2AWOA 3D4RA 1YBYA 3KFUA 1SNQA 1AZPA 4QCLA 2JSOA 1GUGA 1YITA 4LFBQ 4ZQ3A 1BKBA 1J6QA 2Q2IA 2F0MA 4RAUC 1EFWA 2JA6G 3D6WA 3S14H 1Y1WG 4BBSH 3SVMA 1WJJA 2NVTB 1VQAA 3I56A 4P72A 2O5JC 2DUDA 2OXPA 2Q2TA 3F2CA 4JI0Q 4TRDA 3CW2C 1L1OB 1E1TA 5JJZA 2NZOA 3D3RA 1GUOA 1HNZQ 4FXDA 1S4ZA 5C4JB 3BG3A 1DCZA 3IAYA 5M3MH 2VUMH 3MFGA 3TS0A 2KEDA 2VB2X 3I72A 4NW2A 4J1MA 2DJFC 1X55A 3KJOA 3J7AF 1QVFA 3NELA 3E9HA 4RCOA 2CVRA 5EAYA 3S1QH 1QE6A 4WORA 4A93G 4X64Q 3CC7A 4F87A 2AMCB 1PHJA 4IFDJ 3T1YL 1MBYA 1ENFA 1TWFB 4P75A 2D2CC 3A56A 2EY6A 4GOPA 1NBWA 3DHQA 3B6YA 2F3IA 5DM63 3GTLH 2F0KA 2J7ZA 1HZCA 1STNA 3CPFA 3K5LA 2CQAA 4C3IB 4EQ5A 1EIYB 4JI6L 5DM73 2Z4IA 1SYGA 1STGA 2O2LD 4LMQD 2M00A 2ZJPA 1GVPA 2GVAA 3I90A 1IKMA 2MFIA 5FLXL 2IW3A 2JE6I 1C4QA 4ILWA 1M8AA 2PI2E 4JBMA 4ODGA 2VS1A 1HNZL 1HXYD 4DV0Q 1BBXC 4ZUIA 1E22A 4JCVE 4DV4L 4A3GH 4K2KA 1GUSA 3WOEA 3BDOA 1OXTA 2GA4B 4A93H 4V0BA 3NBHA 1P16A 3NPPA 5I2YA 4DAVA 4HIOA 2UU9Q 4YCWA 3WOFA 3BYTB 2F4VQ 5JJKA 2JA5G 3RN2A 4QUFA 4L6TB 4DAYB 4RGOS 2EYHA 5EJWA 4KHPL 4A3KB 4DPGA 4MIUA 1F2LA 4DR4L 3KLWA 3HOUG 1XTDA 2R7ZB 1PZJD 3MXNB 4A3IH 3L3OC 5CORA 2JJQA 3PO2G 2BE5C 3UE0A 2X6LA 1FGBD 3KF8A 3VYTA 4LW1A 5TSSA 1Q90A 2OT2A 4IJLA 4NXNL 1IBKQ 3EBEA 1N34Q 2V4DA 4S3SA 4JI5Q 5C4XB 3PO3G 4JI1L 1U4LA 4L5TA 2C9OA 3I73A 2PZTA 4CBVA 3HOWH 1F9QA 1PFBA 5EPKA 3H09A 4DR3Q 1B9MA 2AQ3B 4A3FG 4XXEA 2B63H 2F3WA 2KVMA 1K0RA 4I7ZC 1DGSA 4XQNA 3RZDH 3RZDB 4CDCC 4EX5A 3ER0A 3K5MA 3U9SA 4Y7NH 3J81L 5BN5A 5M9OA 1R4PB 2SNMA 3BJUA 1HJPA 1E3PA 1XMOQ 3A8KE 1GM5A 2MNAA 1SE4A 3HOWB 3VR6A 1Q46A 1V1PA 2SNSA 3E6ZX 2A6ED 3NTHA 4LFAL 2YU9B 2YYZA 1DD2A 5JJIA 4OEMB 5J3BA 1LTAD 3OIQA 4C3IH 4DR6L 1WTPA 4LF4Q 2SOBA 5IT9E 4BXXG 1FD7D 1HTLD 2JEBI 1PH2A 1NJIC 1NUCA 5HY6A 1JB3A 3ERSX 4IN3A 5DEHA 1QVCA 1P8LA 3KK7A 5EKLA 4G57A 3OPOA 2K52A 2I5MX 2JN4A 1IBML 1VF5C 1SAPA 2WAQG 4H44C 1TWAB 1WTHA 5M5XB 2NVQH 1MKHA 4ABNA 1MD2D 4GKJQ 1GOZA 1G91A 5IYCG 3T53B 2D5DA 1F2ZA 5IGGA 1HUNA 1K9MC 5JAVA 4HR7B 3S1NB 5EPJA 4CJ2C 4IUVA 2EOTA 2B2WA 1QZHA 2P5ZX 4KJOA 1L1OC 2YTXA 1Q8KA 1XTCD 3SK6A 3MAQA 2A19A 3JAMc 1U0LA 4NXMQ 1UE7A 3BVMA 1HQMC 4K6DA 4LFCL 3EJIA 4E6IA 1PH5A 2MO1A 2AUKA 1D5ZC 5JVH3 1EY9A 3CRLC 2N88A 4RGNA 1Z7TA 4JG2A 4BY1B 3K7AB 2L1BA 1Y69U 1G8ZD 1PRTD 1SXTA 3S14B 4NDXA 1WCMG 2D0OA 5A2QE 2EY2A 4I7AA 3CCRA 1D8LA 1CA5A 4IALA 4IO9A 3GTMH 1JWUD 2LSSA 2WIIB 5FLMG 2K7VA 2PQAA 5CV9A 4B3RL 3BU2A 2UUCQ 3F2DA 3I91A 3SE0A 1NR2A 1HR0W 4A76A 4K0KL 2K4KA 5FJ8H 1VQIA 3T13A 4WRDA 4NP5A 2HD3A 2PMZB 1CQVA 3PSIA 5C44B 4KHPQ 1LM0A 4DV2L 1TS3A 5KNBA 2DNEA 3AFQA 3M4YA 1VQMA 4DV1Q 1A63A 2L12A 2FMCA 1JMCA 1I4PA 3I4OA 5K5PA 5M5WB 1J5EQ 2R92H 3VDYA 3HEJA 3HOZB 4BA2I 3FVQA 1BUVT 3ULLA 3T1HL 4DV4Q 2BE5D 4X3KA 2G5DA 1YHQA 5FK9C 1NTGA 5KRUA 3GTKH 2CHBD 2HDMA 1CK1A 2CQOA 2K5HA 3TREA 3GV3A 1SFOB 2UUAQ 1WTQA 1NR4A 2XRQD 2L5TA 1K8GA 3GTJB 5CGKA 2QILA 1NSNS 4BBSB 2QDBA 3M3YB 4C2MH 1I4RA 2BH8A 1F9RA 2F0IA 3KYHC 1EWHA 1SNCA 1EUJA 4PV1C 3S1RH 1Y1VH 4JW0A 3VA7A 1H9KA 4JOIC 1UNSA 1PYWD 1DOKA 1D1KA 5M5YB 3X3NA 3IRBA 1S5ED 5I9OA 1SSOA 2QEXA 4A3DH 1RHPA 4LF9L 1CHQD 3CPWA 1XPRA 5C4ZA 1OXSC 1NMFA 3RLOA 2RVLA 1CKOA 1Y1VG 5JJLA 3EROA 1SMYC 1SMXA 2KHJA 4JYAL 5KYLA 2F0WA 2WB1G 2PCFB 4FF2A 4JI7L 1H9SA 3MEHA 4QF4A 3C3LA 1E0BA 1TWGB 1A6XA 4DNIA 2WKCA 1TU2B 4A3BH 1PH4A 2YTYA 4N9PA 1X56A 2PZWA 1FL0A 5ISRA 1EZ6A 3GTQB 4DR1Q 1I6VC 1RTNA 3VR5A 3J80i 4AH6A 4KY5A 4IFDI 4BY7G 3HOVG 2QA4A 4AYBE 2PPBC 4C2MB 4BBRB 3R2IA 1EY7A 2B29A 4ZAIA 1X3GA 4Q0FA 1EEID 3M4QA 1L0YB 2R61A 4FO2A 2UUCL 1M4VA 1YI2A 4B3TQ 3GTQH 3G48A 4IUNA 1J9OA 5FLXc 4PG3A 4QGUA 4ZKCB 2DN8A 5LL6S 4AQYL 2JA7B 2O4XA 1ONLA 5K36G 1KDAA 1PRTC 1JCKB 4EQNA 1YJNA 3PUVA 3CKIB 4QUCA 3T16A 3HOZH 1L0WA 1KHIA 4C56C 3WDNA 5GAHC 1PH3A 1XNQQ 4C3JH 2DGYA 3E5SA 1EWCA 2RDHA 3K58A 3PUXA 4XQQA 2PMZE 1V43A 5D3DA 1DOMA 4A3BG 1VDZA 3NENA 2G9HD 5FO7B 2KBNA 3EN2A 1I3QB 3RD4A 4JBWA 3STBC 1SYBA 2L0CA 2KCTA 2VQEL 1KAAA 1HNWL 1WTVA 2F0JA 2EYMA 4GZYC 3I4NG 1Y1VB 4N8X1 2Q2UA 4K2LA 1Y14B 3H3VH 1CM9A 3K59A 4GKKQ 1S3OA 3OMCA 4R4QA 1AFPA 4DR6Q 5C0XJ 1G2SA 2E2HH 4JV5Q 3M3YH 4DR2Q 5DNFA 5COYA 3I8ZA 3GTJH 1A15A 5DAUA 3HRZC 2BA0A 4HIMA 3PO3B 4B3RQ 5D14A 4JI2Q 4RCNA 1B7YB 1SNOA 2UXDL 3ONAB 1JJGA 4P73A 2A68C 3J7YW 4R9WA 2F0DA 3J7AV 3K8AA 1KRSA 2ZJQA 3CU7A 3HGBA 2OF1A 2A6HC 2LXKA 3J80E 2ID0A 1YIJA 4B3SQ 3HOXH 4LF9Q 1T5EA 1ZEQX 1CFMA 4DV5L 1LTGD 4A3MG 2ZT9C 2ZTEA 1I5FA 2X69A 4QIWB 1ZKOA 4DF7A 2GN5A 1HNXL 1V1QA 2B2UC 5IGBA 1OXXK 4PZ6A 4DK0A 5IP9G 4PMWA 5FO8B 3A55A 4I65A 4A3FB 1NCVA 2NZHA 1YVCA 1RCVD 5GAEC 4MN3A 1C48A 2D9UA 1QUQB 1BQQT 2XIWA 3NHHA 1JORA 4IURA 4X66Q 2NWGA 3PF5A 1VQ4A 5E3FA 4LF8Q 3LGJA 1CA6A 2F0LA 4LNQA 5CV8A 2B2TA 3MFYA 3W3AA 3SK5A 2R93B 4LUVA 2RSOA 1B53A 5JEAG 3E0EA 4X65L 2ICIA 1EOTA 3NK9A 1ET9A 5E4XA 5HGQA 5C44G 4G7OC 1PRTF 2Q2HA 2XSCA 4CDFC 3K7AH 4IUQA 2UXCL 4LUZA 2OQKA 4NPSA 1D5XC 4FNFA 4ALPA 1U5KA 1LLRD 4RFBA 1ASZA 3FKIG 4FXKC 3KF8B 2ZJRA 3PIP3 2FHTA 1XMQL 2OWOA 1PZID 3RLFA 2XGTA 3PQIA 4AYBB 1KABA 5LMNW 1H9RA 4BA1I 1U4RA 2I0QA 4GOPC 1YJ9A 1B8AA 3GQBA 3S1NH 2B2TC 3TQYA 5JEAH 1X9NA 1S5FD 1GUTA 2O5IC 4FF1A 4NKLA 1XNQL 3AEVA 1A62A 1UEBA 2QDLA 4YY3Q 1WTXA 5FKAC 4XYQA 3HKSA 2F52A 1K73C 3AYHB 3GDEA 3I7FA 1VQOA 4OWWB 4C1NK 2SEBD 3MVVA 4LF5L 2JQOA 3ICEA 2R3ZA 1VQLA 1PTOH 3C1EA 1LT6D 1PTOD 5IP9H 2EY1A 3QB3A 5IGCA 3CCSA 2NB0A 3G4SA 2M9VA 4DK1A 2YU9H 3D6CA 3RMHA 3SEBA 3IFDA 4KY7A 3PMFA 4QL5A 1K3RA 4RHRA 4OGQC 1PYSB 1S72A 4X64L 5EQ0A 1HR0Q 2KHSA 4ZUJA 4CHTB 3RUZA 3BZCA 5I2XA 1KIXA 1HA6A 2KA7A 2PNHA 1UEAB 3C1FA 4KV6A 1EY5A 1SDFA 1WOCA 2R93G 2JXMB 1BBUA 1X54A 5KGUA 3FMCA 2JA5B 2B63B 1CQFA 1JE5A 4RGTA 3TP6A 4BS9A 2B8GA 4M8AA 4J15A 4X62Q 4DV6Q 1X65A 2SDFA 2I5HA 1SRUA 1S40A 1N9WA 3FEWX 4XDXA 1HHVA 2BA1A 1WD1A 2HUGA 1ILQA 1V8QA 4ZKBB 5C4XH 1JOOA 2IX0A 4P74A 4HJ7A 1R9TH 2B8FA 2RDFA 4YY3L 2R93H 2B39A 5FOBB 4H7BA 4R4IA 2L55A 2IWHA 3CCEA 3DM1A 1A3VA 5E4WC 4UP8A 3GV6A 2ZTCA 1U9RA 4OWXB 4MZ9A 1MJEA 3HOWG 1XPOA 3PUYA 1UWVA 2DNCA 3CP0A 2ZM6Q 4DR7L 2R7FA 2VY3A 1GHKA 4R8IA 4MNOA 4APVA 4JI8L 1SLJA 3TSSA 4EQOA 3FKIB 4LF4L 2PQAB 2MPMA
chains in the Genus database with same CATH topology
3CCMA 1ASYA 2HHHL 4X6AH 1PFSA 2HQLA 4IPGA 1WYDA 1QZHA 4L5QA 1HZAA 2N8NA 1L1OC 2YTXA 1Q8KA 3KF6B 2ASBA 2A19A 3JAMc 1BBWA 1U0LA 3NBHB 3M85A 4NXMQ 1Q12A 1UE7A 2QGQA 4LFCL 4IJHA 1EWIA 1PH5A 2MO1A 4R1JA 1Q81C 1HZBA 4IPCA 5C4JH 4O2DA 2E2JH 4Y52H 4JG2A 3W1BA 1LYLA 2VQFL 2FXQA 1EYGA 5GROA 4BXXH 1HH2P 1PYBA 3G6EA 1RIPA 1SE8A 4R4TA 1IBKL 1WCMG 2D0OA 4GN4B 3PUZA 1VQGA 2LXJA 2R7ZG 4WJ4A 3CCRA 1AE2A 1D8LA 3CQZH 4IPHA 4OONA 3GTOH 4YCVA 2RCNA 1IBLL 1PV4A 5IWAQ 5JEAJ 4IO9A 1JJ2A 1I94L 3GTMH 1G291 1YEZA 2LSSA 5FLMG 3I55A 2JA8G 2PQAA 4B3RL 1Q82C 3BU2A 2UUCQ 3F2DA 4HJAA 1HR0W 2HIVA 4A76A 4K0KL 2ALYB 3DM3A 2K4KA 4LF7L 5FJ8H 1VQIA 2BH2A 1PH8A 4LF6L 2N78A 3KF6A 5M3MG 1YHBA 3S17H 3PSIA 1MJCA 1K83H 2R7DA 1LM0A 4DV2L 4KHPQ 4GKKL 3AFQA 1EIFA 1CKNA 3UDIA 1VQMA 1TWFH 1X6OA 2A1AA 2Z6KC 5C4XG 4DV1Q 1C7YA 1A63A 4PZ7A 2HT1A 4AYBG 1JMCA 3L7ZC 3FP9A 1VQJA 1UE1A 3OYYA 5FLMH 2E5LL 3I4OA 2JA8H 4DR4Q 1I6HH 1J5EQ 4DV3L 1PH7A 3VDYA 4JI2L 1K8AC 2R92H 3W5OA 2VQEQ 5BR8L 3M7NA 2RHSB 4JOIA 4JI0L 4LF6Q 3MEFA 4LFAQ 1FJGL 4BA2I 4K0KQ 1H95A 1IYJB 5GADC 4JI4Q 4KI0A 2XTIA 3ULLA 3T1HL 1PVOA 2IT1A 4DV4Q 4OO1I 1JJCB 4JV5L 3RR5A 2JK8A 1YHQA 1NTGA 2YTVA 1W2BA 5IYBG 3J81c 4UPAA 1I94Q 1I50H 2JA7H 3GTKH 1E24A 4JC0A 3CC4A 1M90C 4X62L 2CQOA 4KHZA 2K5HA 3TREA 5IWAL 2OTLA 2UUAQ 1JT8A 1OXVA 5IYBH 1N33Q 3PO3H 1K8GA 4IFDG 2WB1E 2VZAA 3CCLA 3J81i 3F1ZA 2NVTH 2Z0SA 3A74A 4C2MH 1YHAA 2BH8A 4UY8C 4AIMA 3CF5A 3J7ZC 3KYHC 4A4IA 2VNUD 1KD1C 1PH9A 1W3SA 3A5UA 5IYDG 3Q8DA 1EUJA 4OX9L 4GKJL 1A8VA 4DAMA 4YCUA 4A3EG 3ZJYC 3S1RH 4JI5L 4LFCQ 4BY7H 1Y1VH 2PI2A 4UP7A 4JOIC 4X66L 2VW9A 1IL2A 3L0OA 3D0FA 3CAMA 5E7NA 4HJ8A 3IRBA 5IE8A 2ATWA 1Z47A 1SROA 1TWGH 1I3QH 2QEXA 4A3DH 1L1OA 1VQ9A 4LF9L 3S16H 2N49A 1B70B 1C9OA 3K7UC 2OCEA 3CPWA 3J7A5 1CKMA 1XPRA 1GKHA 3KDFB 2K14A 2IX1A 4PZ8A 1YJWA 1OXSC 1NMFA 1TWCH 2NN6I 2CWAA 3RLOA 5AJ3Q 3HOYH 1SN8A 2JA7G 5IP7G 3U4ZA 4DR1L 1WCMH 1CKOA 4DR5L 1Y1VG 4XTCS 5JJLA 2UU9L 4GLAC 3H3VI 1SMXA 2KHJA 4JYAL 4YWMA 5BR8Q 4BBSG 2WB1G 3PIOA 4JI7L 1RL2A 5LMNL 5DLQE 2K50A 2HIXA 2WFWA 2ZM6L 2E8GA 3ULJA 3M9BA 4DNIA 2IY5B 3W1GA 3S1MH 4A3BH 4GN5A 3CC2A 1PH4A 2YTYA 1PA6A 4YHHL 1VQ5A 4OWTB 1J5EL 3F2BA 1X56A 4GS3A 1G51A 3STBD 1FL0A 2E5LQ 1KQSA 1QVGA 4DR1Q 1VQPA 3HOVH 2R92G 2WAQE 3NEMA 1AE3A 1IZ6A 2VL6A 2GVBA 3J80i 2NVXH 2YV5A 2V1CC 4AH6A 4DV0L 1VQ6A 4BBRH 4OXPA 1QZGA 3OTOQ 4IFDI 3AFPA 2UXDQ 3I4NH 4QQBX 1X3EA 1G6PA 3KDFA 4BY7G 3HOVG 2QA4A 4AYBE 3U58A 3H0GH 3EIVA 1N32L 2JA9A 4A3MH 1V9PA 2E2IH 1Q1EA 2CFMA 1XNRL 2UUBL 2B29A 2D0PA 2AHOB 1X3GA 4R4OA 4JI1Q 4QY7A 3M4QA 1EQRA 1VQHA 4QIWE 4TVAB 4GNXA 1MIUA 2ZTDA 4DR2L 1YI2A 2UUCL 4B3TQ 2Y0SE 4POGA 3GTQH 4JYAQ 4UP9A 3G48A 4OO1G 1CKNB 5FLXc 3CCQA 4PG3A 1SFOH 3I4MG 4QGUA 4NB3A 2HHHQ 1BVSA 4AQYL 2OTJA 2RHQB 5K36G 3H0GG 4FDBA 1O7IA 4DV7L 1YJNA 2EIFA 3PUVA 4NXML 2K5NA 4LF5Q 2R6GA 1EQQA 4BBRG 3HOZH 2RF4A 1N33L 1L0WA 1HR0L 1KHIA 3ULPA 1PH6A 1D7QA 5GQOA 3F8TA 2EQSA 1L2FA 5GAHC 3CXCA 3HKZE 1KC8C 1VS0A 1PH3A 4C3JH 2DGYA 3RNUA 1XNQQ 2UXBQ 3PUXA 1VQCA 4DV7Q 3A0JA 1TXYA 3HKZG 2PMZE 1V43A 4A3BG 1PH1A 3NENA 4B3MQ 3J80c 4A3CH 4DR7Q 4NXNQ 2KBNA 4GN3B 5C0XG 4JI3L 3EN2A 5C44H 1KAWA 1M1KC 4JBWA 3STBC 1YZ6A 4GNXB 1FGUA 1HZ9A 3UE1A 2OQ0A 5M5YH 4B3TL 1YNXA 2KCTA 4A3CG 2VQEL 1T9HA 1HNWL 1LTLA 5LMUL 4L5RC 4LWCA 3I4NG 1FVIA 4O0AA 2AWOA 4R4CA 3J81j 4TQUS 2Q2UA 1YBYA 3KFUA 1EOVA 1Y14B 3H3VH 3I4MH 4LFBQ 1YITA 4A3KG 5IY0A 4GKKQ 1S3OA 4R4QA 4LFBL 1BKBA 1J6QA 2Q2IA 4XIGS 1Z9FA 5H1SE 4POFA 1EFWA 2JA6G 5C0XJ 4DR6Q 2E2HH 4JV5Q 2A8VA 4DR2Q 3M3YH 4BBSH 4B3SL 1Y1WG 3S14H 1WJJA 4HIDA 1VQAA 3I56A 4P72A 3GTJH 3M4OH 1IXRA 5C0XI 2DUDA 3PCOB 2Q2TA 2BA0A 3F2CA 4HIMA 4JI0Q 1GD7A 4B3RQ 3CW2C 1L1OB 4JI2Q 3DLLA 1E1TA 1B7YB 2NZOA 3RLNA 1HNZQ 2UXDL 1JJGA 4P73A 3PGZA 2MQHA 4B3ML 5M3MH 2VUMH 1NMGA 3K8AA 1KRSA 3TS0A 4A3DG 2ZJQA 3K80C 4H02A 4A3LH 3OW2A 2LXKA 4B3SQ 1YIJA 2ID0A 1UE6A 5IT9c 1X55A 3KJOA 2NVYH 3HOXH 4LF9Q 4A3IG 2JEAI 1QVFA 3HOUH 4DV5L 1N34L 3S2HH 3NELA 3E9HA 4A3MG 1KRTA 2ZTEA 5EAYA 1SR3A 1I5FA 4DR5Q 3S1QH 4ME3A 4DK3C 1KL9A 2GN5A 3HOXG 1HNXL 1V1QA 1AH9A 3H15A 4A93G 1OXXK 1CUKA 3PUWA 4PZ6A 3UDXA 5IP9G 5M5WH 1GO3E 3GD7A 4PMWA 4X64Q 2AMCB 3CC7A 5LMNQ 1CSPA 5LMUQ 2EXDA 3T1YL 1PHJA 4IFDJ 4LUOA 5ELOA 2NZHA 1YVCA 3AQQA 5GAEC 1N36L 2KCMA 4P75A 4YWLA 1TWHH 1QUQB 2K5VA 4X66Q 1VQ4A 4GOPA 3PF5A 4LF8Q 3LGJA 3CMEA 4LNQA 1NBWA 3B6YA 3KJPA 2F3IA 2VQFQ 5M3FH 3T1YQ 3D31A 4IPDA 3GTLH 2IHFA 1OXUA 1HZCA 3CPFA 1VQFA 3PIPA 1N32Q 4EQ5A 4AQYQ 1EIYB 4JI6L 4LUVA 1XJVA 3UDFA 5JEAG 3E0EA 4X65L 2ES2A 3I2ZA 4YWKA 1OTCA 5HGQA 5C44G 2ZJPA 1VQEA 1GVPA 2GVAA 4A75A 1WFQA 5IYDH 4DUZL 3CCUA 4A3GG 2Q2HA 2MFIA 2UUBQ 2C35B 3K7AH 2UXCL 2JE6I 4LUZA 4YHHQ 4BY1H 4L5SA 2OQKA 2PI2E 4NPSA 5C3EG 4DV3Q 4JBMA 1ASZA 2VS1A 1U5KA 4ALPA 4DV0Q 3OTOL 3FKIG 1HNZL 2JA5H 1VCIA 1E22A 3KF8B 3U50C 1JB7A 1Q1BA 1UE5A 4JCVE 2ZJRA 4DV4L 4BY1G 1XMQL 1IBMQ 2OWOA 3RLFA 1VQ8A 4JI4L 2KHIA 2Z6KA 2XGTA 2CWPA 4DV1L 4A3JG 4RG1A 4A3GH 1XNRQ 1HNWQ 3GTGH 5LMNW 2B3GA 4MTNA 4GOPB 3S15H 4P71A 2NN6G 1OXTA 4BA1I 4A93H 3CCJA 2I0QA 1P16A 3M4PA 1VQDA 1B8AA 3K0XA 4HIOA 4GOPC 1YJ9A 4YCWA 5IP7H 1XMOL 2UU9Q 2K75A 3TQYA 3S1NH 2H5XA 1X9NA 4RMFA 4DKAC 2F4VQ 2L15A 3GTPH 2Y0SG 5JJKA 3FKIH 2JA5G 3RN2A 3BZKA 5M5XH 1TWAH 4DAYB 5M3FG 1X3FA 1XNQL 1Q7YC 3AEVA 4KHPL 1A62A 1UEBA 4YY3Q 1IBLQ 3HKSA 4DPGA 2F52A 3JC66 4DK6C 4X65Q 1K73C 4HIKA 5ELNA 4DR4L 3AYHB 3GDEA 3I7FA 1VQOA 3KLWA 4OWWB 3HOUG 1XTDA 3MXNB 4A3IH 4LF5L 2JQOA 3ICEA 2AKWB 3FHWA 1VQLA 2JJQA 2IHEA 2WP8J 3HFZB 2CCZA 3UE0A 2R7ZH 3PO2G 2UXBL 1E1OA 4KLKA 3L2PA 2MO0A 5IP9H 3JAMi 4LW1A 4C3HH 1C0AA 3CCSA 4JI6Q 3G4SA 4IJLA 4A3KH 4JI3Q 4NXNL 3K81C 1IBKQ 2YU9H 3WWVA 5AJ3L 3EBEA 2JA6H 3HOYG 3CD6A 4DV5Q 4HJ9A 1N34Q 3TS2A 4JI5Q 3PO3G 4QL5A 4JI1L 1Y1WH 3KOJA 1K3RA 4L5TA 4DR3L 4A3LG 1E7ZA 3HOWH 1S72A 1PYSB 2UUAL 4LF8L 4X64L 3G71A 2I5LX 1HR0Q 1HNXQ 3PO2H 4DR3Q 3BZCA 5IYCH 1N36Q 1KIXA 3GO5A 4A3FG 1Q86C 3S24A 2B63H 1K0RA 2AWNA 1DGSA 2PNHA 4GLXA 2N3SA 3RZDH 4EX5A 4A3EH 3ER0A 1WOCA 2R93G 4OX9Q 4DUYL 1BBUA 1X54A 5FJ8G 4Y7NH 1JE5A 4QJFA 3CCVA 1VQBA 2F4VL 3BJUA 1HJPA 1E3PA 2CKZB 4J15A 1X65A 4JI8Q 3SGIA 4X62Q 4DV6Q 2I5HA 1NE3A 1SRUA 2MNAA 1XMOQ 1N9WA 1S40A 1GM5A 4IOCA 4JBKA 3HOZG 3CMAA 1Q46A 1NY4A 2BA1A 3T1HQ 5C4XH 1QUQA 2IX0A 1N8RC 1LUZA 1KXLA 4JI7Q 4P74A 4HJ7A 4LFAL 1XMQQ 4DV2Q 1R9TH 2YYZA 1XPUA 5JJIA 4YY3L 5J3BA 3PV0A 4C3IH 4DR6L 2VUMG 2R93H 4LF4Q 3PF4A 3S2DH 4BXXG 3TEHB 1VQNA 2B63G 4R4IA 2UXCQ 3CCEA 1CSQA 1A0IA 2JEBI 1PH2A 3A5ZB 1NJIC 5HY6A 1WI5A 3ERSX 4UP8A 4DUZQ 2ZTCA 4A3JH 1VQ7A 4OWXB 4HJ5A 1QVCA 4MZ9A 1FJGQ 1MJEA 3UDGA 3HOWG 1P8LA 2KENA 1XPOA 3PUYA 4LF7Q 5GAGC 1UWVA 3RN5A 4DUYQ 5C3EH 2K52A 2I5MX 3CP0A 1IBML 2ZM6Q 4A3FH 3U4VA 4DR7L 2R7FA 2WAQG 4GLVB 2VY3A 3TRZA 2NVQH 1MKHA 4GNXC 4MNOA 3RZOH 4APVA 4WJ3M 4JI8L 1SLJA 4GKJQ 1VQKA 4DV6L 4LF4L 4JBJA 5IYCG 2D62A 3E9IA 4IOAA 2PQAB 1K9MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM A;  1ASY A;  2HHH L;  4X6A H;  1PFS A;  2HQL A;  4IPG A;  1WYD A;  1QZH A;  4L5Q A;  1HZA A;  2N8N A;  1L1O C;  2YTX A;  1Q8K A;  3KF6 B;  2ASB A;  2A19 A;  3JAM c;  1BBW A;  1U0L A;  3NBH B;  3M85 A;  4NXM Q;  1Q12 A;  1UE7 A;  2QGQ A;  4LFC L;  4IJH A;  1EWI A;  1PH5 A;  2MO1 A;  4R1J A;  1Q81 C;  1HZB A;  4IPC A;  5C4J H;  4O2D A;  2E2J H;  4Y52 H;  4JG2 A;  3W1B A;  1LYL A;  2VQF L;  2FXQ A;  1EYG A;  5GRO A;  4BXX H;  1HH2 P;  1PYB A;  3G6E A;  1RIP A;  1SE8 A;  4R4T A;  1IBK L;  1WCM G;  2D0O A;  4GN4 B;  3PUZ A;  1VQG A;  2LXJ A;  2R7Z G;  4WJ4 A;  3CCR A;  1AE2 A;  1D8L A;  3CQZ H;  4IPH A;  4OON A;  3GTO H;  4YCV A;  2RCN A;  1IBL L;  1PV4 A;  5IWA Q;  5JEA J;  4IO9 A;  1JJ2 A;  1I94 L;  3GTM H;  1G29 1;  1YEZ A;  2LSS A;  5FLM G;  3I55 A;  2JA8 G;  2PQA A;  4B3R L;  1Q82 C;  3BU2 A;  2UUC Q;  3F2D A;  4HJA A;  1HR0 W;  2HIV A;  4A76 A;  4K0K L;  2ALY B;  3DM3 A;  2K4K A;  4LF7 L;  5FJ8 H;  1VQI A;  2BH2 A;  1PH8 A;  4LF6 L;  2N78 A;  3KF6 A;  5M3M G;  1YHB A;  3S17 H;  3PSI A;  1MJC A;  1K83 H;  2R7D A;  1LM0 A;  4DV2 L;  4KHP Q;  4GKK L;  3AFQ A;  1EIF A;  1CKN A;  3UDI A;  1VQM A;  1TWF H;  1X6O A;  2A1A A;  2Z6K C;  5C4X G;  4DV1 Q;  1C7Y A;  1A63 A;  4PZ7 A;  2HT1 A;  4AYB G;  1JMC A;  3L7Z C;  3FP9 A;  1VQJ A;  1UE1 A;  3OYY A;  5FLM H;  2E5L L;  3I4O A;  2JA8 H;  4DR4 Q;  1I6H H;  1J5E Q;  4DV3 L;  1PH7 A;  3VDY A;  4JI2 L;  1K8A C;  2R92 H;  3W5O A;  2VQE Q;  5BR8 L;  3M7N A;  2RHS B;  4JOI A;  4JI0 L;  4LF6 Q;  3MEF A;  4LFA Q;  1FJG L;  4BA2 I;  4K0K Q;  1H95 A;  1IYJ B;  5GAD C;  4JI4 Q;  4KI0 A;  2XTI A;  3ULL A;  3T1H L;  1PVO A;  2IT1 A;  4DV4 Q;  4OO1 I;  1JJC B;  4JV5 L;  3RR5 A;  2JK8 A;  1YHQ A;  1NTG A;  2YTV A;  1W2B A;  5IYB G;  3J81 c;  4UPA A;  1I94 Q;  1I50 H;  2JA7 H;  3GTK H;  1E24 A;  4JC0 A;  3CC4 A;  1M90 C;  4X62 L;  2CQO A;  4KHZ A;  2K5H A;  3TRE A;  5IWA L;  2OTL A;  2UUA Q;  1JT8 A;  1OXV A;  5IYB H;  1N33 Q;  3PO3 H;  1K8G A;  4IFD G;  2WB1 E;  2VZA A;  3CCL A;  3J81 i;  3F1Z A;  2NVT H;  2Z0S A;  3A74 A;  4C2M H;  1YHA A;  2BH8 A;  4UY8 C;  4AIM A;  3CF5 A;  3J7Z C;  3KYH C;  4A4I A;  2VNU D;  1KD1 C;  1PH9 A;  1W3S A;  3A5U A;  5IYD G;  3Q8D A;  1EUJ A;  4OX9 L;  4GKJ L;  1A8V A;  4DAM A;  4YCU A;  4A3E G;  3ZJY C;  3S1R H;  4JI5 L;  4LFC Q;  4BY7 H;  1Y1V H;  2PI2 A;  4UP7 A;  4JOI C;  4X66 L;  2VW9 A;  1IL2 A;  3L0O A;  3D0F A;  3CAM A;  5E7N A;  4HJ8 A;  3IRB A;  5IE8 A;  2ATW A;  1Z47 A;  1SRO A;  1TWG H;  1I3Q H;  2QEX A;  4A3D H;  1L1O A;  1VQ9 A;  4LF9 L;  3S16 H;  2N49 A;  1B70 B;  1C9O A;  3K7U C;  2OCE A;  3CPW A;  3J7A 5;  1CKM A;  1XPR A;  1GKH A;  3KDF B;  2K14 A;  2IX1 A;  4PZ8 A;  1YJW A;  1OXS C;  1NMF A;  1TWC H;  2NN6 I;  2CWA A;  3RLO A;  5AJ3 Q;  3HOY H;  1SN8 A;  2JA7 G;  5IP7 G;  3U4Z A;  4DR1 L;  1WCM H;  1CKO A;  4DR5 L;  1Y1V G;  4XTC S;  5JJL A;  2UU9 L;  4GLA C;  3H3V I;  1SMX A;  2KHJ A;  4JYA L;  4YWM A;  5BR8 Q;  4BBS G;  2WB1 G;  3PIO A;  4JI7 L;  1RL2 A;  5LMN L;  5DLQ E;  2K50 A;  2HIX A;  2WFW A;  2ZM6 L;  2E8G A;  3ULJ A;  3M9B A;  4DNI A;  2IY5 B;  3W1G A;  3S1M H;  4A3B H;  4GN5 A;  3CC2 A;  1PH4 A;  2YTY A;  1PA6 A;  4YHH L;  1VQ5 A;  4OWT B;  1J5E L;  3F2B A;  1X56 A;  4GS3 A;  1G51 A;  3STB D;  1FL0 A;  2E5L Q;  1KQS A;  1QVG A;  4DR1 Q;  1VQP A;  3HOV H;  2R92 G;  2WAQ E;  3NEM A;  1AE3 A;  1IZ6 A;  2VL6 A;  2GVB A;  3J80 i;  2NVX H;  2YV5 A;  2V1C C;  4AH6 A;  4DV0 L;  1VQ6 A;  4BBR H;  4OXP A;  1QZG A;  3OTO Q;  4IFD I;  3AFP A;  2UXD Q;  3I4N H;  4QQB X;  1X3E A;  1G6P A;  3KDF A;  4BY7 G;  3HOV G;  2QA4 A;  4AYB E;  3U58 A;  3H0G H;  3EIV A;  1N32 L;  2JA9 A;  4A3M H;  1V9P A;  2E2I H;  1Q1E A;  2CFM A;  1XNR L;  2UUB L;  2B29 A;  2D0P A;  2AHO B;  1X3G A;  4R4O A;  4JI1 Q;  4QY7 A;  3M4Q A;  1EQR A;  1VQH A;  4QIW E;  4TVA B;  4GNX A;  1MIU A;  2ZTD A;  4DR2 L;  1YI2 A;  2UUC L;  4B3T Q;  2Y0S E;  4POG A;  3GTQ H;  4JYA Q;  4UP9 A;  3G48 A;  4OO1 G;  1CKN B;  5FLX c;  3CCQ A;  4PG3 A;  1SFO H;  3I4M G;  4QGU A;  4NB3 A;  2HHH Q;  1BVS A;  4AQY L;  2OTJ A;  2RHQ B;  5K36 G;  3H0G G;  4FDB A;  1O7I A;  4DV7 L;  1YJN A;  2EIF A;  3PUV A;  4NXM L;  2K5N A;  4LF5 Q;  2R6G A;  1EQQ A;  4BBR G;  3HOZ H;  2RF4 A;  1N33 L;  1L0W A;  1HR0 L;  1KHI A;  3ULP A;  1PH6 A;  1D7Q A;  5GQO A;  3F8T A;  2EQS A;  1L2F A;  5GAH C;  3CXC A;  3HKZ E;  1KC8 C;  1VS0 A;  1PH3 A;  4C3J H;  2DGY A;  3RNU A;  1XNQ Q;  2UXB Q;  3PUX A;  1VQC A;  4DV7 Q;  3A0J A;  1TXY A;  3HKZ G;  2PMZ E;  1V43 A;  4A3B G;  1PH1 A;  3NEN A;  4B3M Q;  3J80 c;  4A3C H;  4DR7 Q;  4NXN Q;  2KBN A;  4GN3 B;  5C0X G;  4JI3 L;  3EN2 A;  5C44 H;  1KAW A;  1M1K C;  4JBW A;  3STB C;  1YZ6 A;  4GNX B;  1FGU A;  1HZ9 A;  3UE1 A;  2OQ0 A;  5M5Y H;  4B3T L;  1YNX A;  2KCT A;  4A3C G;  2VQE L;  1T9H A;  1HNW L;  1LTL A;  5LMU L;  4L5R C;  4LWC A;  3I4N G;  1FVI A;  4O0A A;  2AWO A;  4R4C A;  3J81 j;  4TQU S;  2Q2U A;  1YBY A;  3KFU A;  1EOV A;  1Y14 B;  3H3V H;  3I4M H;  4LFB Q;  1YIT A;  4A3K G;  5IY0 A;  4GKK Q;  1S3O A;  4R4Q A;  4LFB L;  1BKB A;  1J6Q A;  2Q2I A;  4XIG S;  1Z9F A;  5H1S E;  4POF A;  1EFW A;  2JA6 G;  5C0X J;  4DR6 Q;  2E2H H;  4JV5 Q;  2A8V A;  4DR2 Q;  3M3Y H;  4BBS H;  4B3S L;  1Y1W G;  3S14 H;  1WJJ A;  4HID A;  1VQA A;  3I56 A;  4P72 A;  3GTJ H;  3M4O H;  1IXR A;  5C0X I;  2DUD A;  3PCO B;  2Q2T A;  2BA0 A;  3F2C A;  4HIM A;  4JI0 Q;  1GD7 A;  4B3R Q;  3CW2 C;  1L1O B;  4JI2 Q;  3DLL A;  1E1T A;  1B7Y B;  2NZO A;  3RLN A;  1HNZ Q;  2UXD L;  1JJG A;  4P73 A;  3PGZ A;  2MQH A;  4B3M L;  5M3M H;  2VUM H;  1NMG A;  3K8A A;  1KRS A;  3TS0 A;  4A3D G;  2ZJQ A;  3K80 C;  4H02 A;  4A3L H;  3OW2 A;  2LXK A;  4B3S Q;  1YIJ A;  2ID0 A;  1UE6 A;  5IT9 c;  1X55 A;  3KJO A;  2NVY H;  3HOX H;  4LF9 Q;  4A3I G;  2JEA I;  1QVF A;  3HOU H;  4DV5 L;  1N34 L;  3S2H H;  3NEL A;  3E9H A;  4A3M G;  1KRT A;  2ZTE A;  5EAY A;  1SR3 A;  1I5F A;  4DR5 Q;  3S1Q H;  4ME3 A;  4DK3 C;  1KL9 A;  2GN5 A;  3HOX G;  1HNX L;  1V1Q A;  1AH9 A;  3H15 A;  4A93 G;  1OXX K;  1CUK A;  3PUW A;  4PZ6 A;  3UDX A;  5IP9 G;  5M5W H;  1GO3 E;  3GD7 A;  4PMW A;  4X64 Q;  2AMC B;  3CC7 A;  5LMN Q;  1CSP A;  5LMU Q;  2EXD A;  3T1Y L;  1PHJ A;  4IFD J;  4LUO A;  5ELO A;  2NZH A;  1YVC A;  3AQQ A;  5GAE C;  1N36 L;  2KCM A;  4P75 A;  4YWL A;  1TWH H;  1QUQ B;  2K5V A;  4X66 Q;  1VQ4 A;  4GOP A;  3PF5 A;  4LF8 Q;  3LGJ A;  3CME A;  4LNQ A;  1NBW A;  3B6Y A;  3KJP A;  2F3I A;  2VQF Q;  5M3F H;  3T1Y Q;  3D31 A;  4IPD A;  3GTL H;  2IHF A;  1OXU A;  1HZC A;  3CPF A;  1VQF A;  3PIP A;  1N32 Q;  4EQ5 A;  4AQY Q;  1EIY B;  4JI6 L;  4LUV A;  1XJV A;  3UDF A;  5JEA G;  3E0E A;  4X65 L;  2ES2 A;  3I2Z A;  4YWK A;  1OTC A;  5HGQ A;  5C44 G;  2ZJP A;  1VQE A;  1GVP A;  2GVA A;  4A75 A;  1WFQ A;  5IYD H;  4DUZ L;  3CCU A;  4A3G G;  2Q2H A;  2MFI A;  2UUB Q;  2C35 B;  3K7A H;  2UXC L;  2JE6 I;  4LUZ A;  4YHH Q;  4BY1 H;  4L5S A;  2OQK A;  2PI2 E;  4NPS A;  5C3E G;  4DV3 Q;  4JBM A;  1ASZ A;  2VS1 A;  1U5K A;  4ALP A;  4DV0 Q;  3OTO L;  3FKI G;  1HNZ L;  2JA5 H;  1VCI A;  1E22 A;  3KF8 B;  3U50 C;  1JB7 A;  1Q1B A;  1UE5 A;  4JCV E;  2ZJR A;  4DV4 L;  4BY1 G;  1XMQ L;  1IBM Q;  2OWO A;  3RLF A;  1VQ8 A;  4JI4 L;  2KHI A;  2Z6K A;  2XGT A;  2CWP A;  4DV1 L;  4A3J G;  4RG1 A;  4A3G H;  1XNR Q;  1HNW Q;  3GTG H;  5LMN W;  2B3G A;  4MTN A;  4GOP B;  3S15 H;  4P71 A;  2NN6 G;  1OXT A;  4BA1 I;  4A93 H;  3CCJ A;  2I0Q A;  1P16 A;  3M4P A;  1VQD A;  1B8A A;  3K0X A;  4HIO A;  4GOP C;  1YJ9 A;  4YCW A;  5IP7 H;  1XMO L;  2UU9 Q;  2K75 A;  3TQY A;  3S1N H;  2H5X A;  1X9N A;  4RMF A;  4DKA C;  2F4V Q;  2L15 A;  3GTP H;  2Y0S G;  5JJK A;  3FKI H;  2JA5 G;  3RN2 A;  3BZK A;  5M5X H;  1TWA H;  4DAY B;  5M3F G;  1X3F A;  1XNQ L;  1Q7Y C;  3AEV A;  4KHP L;  1A62 A;  1UEB A;  4YY3 Q;  1IBL Q;  3HKS A;  4DPG A;  2F52 A;  3JC6 6;  4DK6 C;  4X65 Q;  1K73 C;  4HIK A;  5ELN A;  4DR4 L;  3AYH B;  3GDE A;  3I7F A;  1VQO A;  3KLW A;  4OWW B;  3HOU G;  1XTD A;  3MXN B;  4A3I H;  4LF5 L;  2JQO A;  3ICE A;  2AKW B;  3FHW A;  1VQL A;  2JJQ A;  2IHE A;  2WP8 J;  3HFZ B;  2CCZ A;  3UE0 A;  2R7Z H;  3PO2 G;  2UXB L;  1E1O A;  4KLK A;  3L2P A;  2MO0 A;  5IP9 H;  3JAM i;  4LW1 A;  4C3H H;  1C0A A;  3CCS A;  4JI6 Q;  3G4S A;  4IJL A;  4A3K H;  4JI3 Q;  4NXN L;  3K81 C;  1IBK Q;  2YU9 H;  3WWV A;  5AJ3 L;  3EBE A;  2JA6 H;  3HOY G;  3CD6 A;  4DV5 Q;  4HJ9 A;  1N34 Q;  3TS2 A;  4JI5 Q;  3PO3 G;  4QL5 A;  4JI1 L;  1Y1W H;  3KOJ A;  1K3R A;  4L5T A;  4DR3 L;  4A3L G;  1E7Z A;  3HOW H;  1S72 A;  1PYS B;  2UUA L;  4LF8 L;  4X64 L;  3G71 A;  2I5L X;  1HR0 Q;  1HNX Q;  3PO2 H;  4DR3 Q;  3BZC A;  5IYC H;  1N36 Q;  1KIX A;  3GO5 A;  4A3F G;  1Q86 C;  3S24 A;  2B63 H;  1K0R A;  2AWN A;  1DGS A;  2PNH A;  4GLX A;  2N3S A;  3RZD H;  4EX5 A;  4A3E H;  3ER0 A;  1WOC A;  2R93 G;  4OX9 Q;  4DUY L;  1BBU A;  1X54 A;  5FJ8 G;  4Y7N H;  1JE5 A;  4QJF A;  3CCV A;  1VQB A;  2F4V L;  3BJU A;  1HJP A;  1E3P A;  2CKZ B;  4J15 A;  1X65 A;  4JI8 Q;  3SGI A;  4X62 Q;  4DV6 Q;  2I5H A;  1NE3 A;  1SRU A;  2MNA A;  1XMO Q;  1N9W A;  1S40 A;  1GM5 A;  4IOC A;  4JBK A;  3HOZ G;  3CMA A;  1Q46 A;  1NY4 A;  2BA1 A;  3T1H Q;  5C4X H;  1QUQ A;  2IX0 A;  1N8R C;  1LUZ A;  1KXL A;  4JI7 Q;  4P74 A;  4HJ7 A;  4LFA L;  1XMQ Q;  4DV2 Q;  1R9T H;  2YYZ A;  1XPU A;  5JJI A;  4YY3 L;  5J3B A;  3PV0 A;  4C3I H;  4DR6 L;  2VUM G;  2R93 H;  4LF4 Q;  3PF4 A;  3S2D H;  4BXX G;  3TEH B;  1VQN A;  2B63 G;  4R4I A;  2UXC Q;  3CCE A;  1CSQ A;  1A0I A;  2JEB I;  1PH2 A;  3A5Z B;  1NJI C;  5HY6 A;  1WI5 A;  3ERS X;  4UP8 A;  4DUZ Q;  2ZTC A;  4A3J H;  1VQ7 A;  4OWX B;  4HJ5 A;  1QVC A;  4MZ9 A;  1FJG Q;  1MJE A;  3UDG A;  3HOW G;  1P8L A;  2KEN A;  1XPO A;  3PUY A;  4LF7 Q;  5GAG C;  1UWV A;  3RN5 A;  4DUY Q;  5C3E H;  2K52 A;  2I5M X;  3CP0 A;  1IBM L;  2ZM6 Q;  4A3F H;  3U4V A;  4DR7 L;  2R7F A;  2WAQ G;  4GLV B;  2VY3 A;  3TRZ A;  2NVQ H;  1MKH A;  4GNX C;  4MNO A;  3RZO H;  4APV A;  4WJ3 M;  4JI8 L;  1SLJ A;  4GKJ Q;  1VQK A;  4DV6 L;  4LF4 L;  4JBJ A;  5IYC G;  2D62 A;  3E9I A;  4IOA A;  2PQA B;  1K9M C; 
#chains in the Genus database with same CATH topology
 4KHV A;  3CCM A;  3HOU B;  1T5X D;  1JWM D;  1LAC A;  3HOX B;  4CKC A;  1FR3 A;  3NBH B;  5C0X H;  4DFA A;  3M85 A;  2K5Q A;  3V96 A;  2VUM B;  1Q12 A;  2QGQ A;  2E2J H;  2EYL A;  2FIN B;  5CBA E;  2QKI C;  2B2V C;  1HH2 P;  1PYB A;  3M4O B;  3W2D A;  4LK1 C;  3QJY A;  1SE8 A;  1IBK L;  5AFW A;  1PLF A;  2EYF A;  3PUZ A;  4HTH A;  2EJG C;  1VQG A;  3P1H A;  4WJ4 A;  3GTO H;  4K8I A;  4OON A;  2RCN A;  1TII D;  1WVL A;  1PV4 A;  5IWA Q;  1G29 1;  2A69 C;  2Q8I B;  5F2D A;  4HJA A;  2HIV A;  5FO9 B;  4LF7 L;  5M3M G;  3S17 H;  1B3A A;  1GXD C;  5C4X G;  3DWA A;  3UDI A;  1TWF H;  2A1A A;  3CHB D;  4KK7 A;  5EPL A;  2HT1 A;  4AYB G;  4DXF A;  1UE1 A;  1I6H H;  2E5L L;  1Q3L A;  3GP7 A;  1IKL A;  1XWE A;  4JI2 L;  1X32 A;  3W5O A;  5BR8 L;  3M7N A;  1BNZ A;  4LF6 Q;  3MEF A;  4PMC A;  4LFA Q;  4K0K Q;  1EYD A;  1HUM A;  1ILP A;  1B2T A;  3K6O A;  2IPK D;  3S2H B;  1K8M A;  2IT1 A;  1VMC A;  4JV5 L;  2M2L A;  1BF4 A;  1W2B A;  1K28 A;  5IYB G;  3A54 A;  2JA7 H;  5M3M B;  4QMG A;  4X62 L;  1PDQ A;  2ZXR A;  2F0P A;  1EY8 A;  2J4X A;  5IYB H;  1N33 Q;  3PO3 H;  2WB1 E;  3MTS A;  2Z0S A;  4UDU C;  2NVT H;  2K1B A;  3H0G B;  1FNU A;  3OHX C;  1H9S B;  1STA A;  1CZG A;  2F4I A;  4A4I A;  5IOC A;  1E2W A;  1V1O A;  3IKJ A;  3Q8D A;  4DAP A;  2L4N A;  4GKJ L;  4A3E G;  4YCU A;  5HUR A;  3ZJY C;  4LFC Q;  4UP7 A;  5K36 H;  1F9P A;  2DY7 A;  3HG9 A;  4BWG B;  1BXT A;  2VW9 A;  1IL2 A;  3L0O A;  4MHE A;  5E7N A;  5IE8 A;  4K5X A;  1I3Q H;  3SK4 A;  3C46 A;  4JVZ A;  3S16 H;  2F0Q A;  3K7U C;  4EGV A;  3J7A 5;  3HOY H;  2NN6 I;  2KEE A;  2JA7 G;  3U4Z A;  3F2U A;  1BDO A;  4YWM A;  5BR8 Q;  2WAQ B;  4UHV A;  2HIX A;  3NE5 B;  3OIP A;  2NZ1 D;  1WTO A;  3SK8 A;  3L9A X;  4DU9 A;  1LV9 A;  3CC2 A;  1B1Z A;  1SYE A;  5CV6 A;  1VQ5 A;  3VYR A;  2Q8R E;  3JAM L;  3F2B A;  4GS3 A;  3T51 B;  1SJE D;  4C3J G;  1J5E L;  2PQE A;  1PRT B;  3NEM A;  3S1R B;  2RQX A;  1GUW A;  2V1C C;  3OTO Q;  1SND A;  2E2I B;  1EY4 A;  1N32 L;  3VYU A;  3EIV A;  2JA9 A;  2WV6 D;  1L0X B;  2K05 A;  1XNR L;  3BVG A;  2UUB L;  2NVX B;  2D0P A;  2AHO B;  2FMM A;  4TVA B;  3HOV B;  4X3T A;  2QEJ C;  4JYA Q;  1YNJ D;  2EZV A;  1PTO F;  1HTP A;  1STH A;  1BVS A;  1EQV A;  2E76 C;  2RHQ B;  3NWS A;  1EEF D;  3VYS A;  2N55 A;  2K5N A;  4LF5 Q;  1EQQ A;  4K6L A;  1Z6H A;  4BBR G;  3URY A;  5ELD A;  2DY8 A;  1HR0 L;  2A69 D;  3NP8 A;  1PH6 A;  4RWS C;  3HKZ E;  2UXB Q;  1TWC B;  4DV7 Q;  1VQC A;  2K04 A;  2F0V A;  1TXY A;  1D6E C;  1PH1 A;  1JQY D;  4A3C H;  4DR7 Q;  1K83 B;  1A3T A;  2B2Y C;  4GN3 B;  4JI3 L;  2IL8 A;  4OEL B;  5CV7 A;  5C0X G;  1M1K C;  4A3D B;  1D1I A;  4B9X A;  4XT3 B;  1HZ9 A;  3H91 A;  3FPU B;  2X6G A;  1T9H A;  2C5C A;  3BYY B;  1B50 A;  1BCP F;  5LMU L;  3Q24 A;  1TS2 A;  4LWC A;  4R4C A;  1K8O A;  4WFN 3;  2DJG C;  1EOV A;  2NBF A;  2EYP A;  2XNA C;  4LFB L;  1RD9 D;  5JVG 3;  1JR0 D;  3BVZ A;  2A8V A;  4HID A;  1LO5 D;  3M4O H;  1IXR A;  3PCO B;  1STY A;  1MHW C;  1GD7 A;  2CH4 A;  2WB1 B;  3RLN A;  2WIN B;  1D5M C;  4ZRZ A;  2MQH A;  1Y8N B;  2EXZ A;  4B3M L;  1I50 B;  1FNW A;  3GTK B;  3H94 A;  4A3D G;  1LTB D;  3K80 C;  4H02 A;  3QOL A;  3OW2 A;  2LY7 A;  5C4H A;  1GUN A;  4A3I G;  1F2Y A;  1KRT A;  3E3X A;  4KD3 A;  1SR3 A;  1WTR A;  1KL9 A;  1TR5 A;  3HOX G;  1AH9 A;  2Z1C A;  2R92 B;  1VMP A;  1CUK A;  3PUW A;  3UDX A;  2NVQ B;  1ENC A;  2QW7 A;  3VA5 A;  1RF2 D;  2EE1 A;  3AQQ A;  5CR3 A;  1N36 L;  4RA8 A;  1A3U A;  4G7Z C;  2PO4 A;  1TWH H;  3OMG A;  5ELE A;  2K5V A;  4RH6 A;  1EY6 A;  2VQF Q;  3T1Y Q;  3S2D B;  3D31 A;  2XN9 C;  1PXU A;  1N32 Q;  4AQY Q;  1XJV A;  3LWE A;  4H13 C;  3UDF A;  4HMJ A;  3CQZ B;  2ES2 A;  1IW7 C;  3I2Z A;  4LJZ C;  2VXW A;  4YWK A;  2LMC B;  1EU3 A;  5NUC A;  4KTA A;  4RHS A;  1EFI D;  4A75 A;  1VQE A;  2WAC A;  5IYD H;  4DUZ L;  1SYD A;  1IHZ A;  3DWQ A;  2UUB Q;  5IIF A;  4YHH Q;  4L5S A;  2A68 D;  3EQL C;  2L9H A;  3AU7 A;  5C3E G;  4DV3 Q;  2RCF A;  2A6H D;  5EKK A;  3U50 C;  1UE5 A;  4IQZ A;  5J22 A;  3Q23 A;  1VQ8 A;  4JI4 L;  1SE3 A;  2Z6K A;  4A3J G;  1GHJ A;  4RG1 A;  1XNR Q;  1HNW Q;  3GTG H;  2JYO A;  2NN6 G;  3PO2 B;  5D3I B;  2Z4H A;  3K0X A;  5E1F A;  1XMO L;  2H5X A;  3TZU A;  2KCC A;  3GTP H;  1YNN C;  2Y0S G;  5A2Q L;  3FKI H;  3LX0 A;  3BDC A;  3LNN A;  2B2W C;  5FLX E;  2XVS A;  3BZK A;  1TWA H;  1YNJ C;  2JA6 B;  5D65 A;  4CGY B;  5C3E B;  1QIL A;  1IBL Q;  4DGZ A;  4X65 Q;  4FYD A;  5ELN A;  3EA6 A;  4EVO A;  5KEE A;  4A3J B;  5J39 A;  2AKW B;  3FHW A;  3A8I E;  2K01 A;  2IHE A;  2R7Z H;  1WD0 A;  5L37 A;  2UXB L;  1E1O A;  4KLK A;  2MO0 A;  4C3H H;  1O7L A;  4JI6 Q;  3C2P A;  4A3K H;  3J81 E;  3I4L A;  3WWV A;  5AJ3 L;  4X3S A;  2BCO A;  4DV5 Q;  4HJ9 A;  3CD6 A;  3TS2 A;  1XYI A;  1PFN A;  3O13 A;  1X3Q A;  3KOJ A;  4DR3 L;  1AZQ A;  4DNT B;  1E7Z A;  4CJ1 B;  1IYV A;  1F2M A;  4LF8 L;  3TDQ A;  3G71 A;  4HN7 A;  1HNX Q;  3HP3 A;  1TVX A;  3PO2 H;  4HED A;  3A7A B;  1ESR A;  3S15 B;  5IYC H;  4Q5V A;  3X3M A;  5JPM C;  1Q86 C;  4Y7N B;  2AWN A;  2CW0 D;  2N3S A;  3A8J E;  4A3E H;  4C3I G;  3NBI A;  4QJF A;  1ZXT A;  2HCC A;  1LTI D;  1VQB A;  2F4V L;  3ITP A;  3OSO A;  2CKZ B;  3SGI A;  1R4Q B;  4JI8 Q;  1AN8 A;  1NE3 A;  2Z8L A;  2F0H A;  5BN4 A;  1PMR A;  4IOC A;  4JBK A;  3CMA A;  1ROD A;  5CC4 A;  2PYK A;  2BDO A;  2TSS A;  1QUQ A;  1LUZ A;  2RA4 A;  1XMQ Q;  3DMU A;  3PV0 A;  3QO2 A;  1O7Z A;  1X3P A;  3FDT A;  3PF4 A;  5A35 A;  3GTL B;  3TEH B;  2ENB A;  5M3F B;  1VQN A;  2B63 G;  1PTO B;  3R93 A;  2UXC Q;  1CSQ A;  1A0I A;  5T1I A;  3A5Z B;  3V2T A;  1WI5 A;  3MXG A;  4DUZ Q;  1VQ7 A;  4HJ5 A;  1FJG Q;  2RSN A;  2F0S A;  2KUM A;  1TWH B;  2KEN A;  4HSV A;  3AMU A;  4KN7 C;  1KLU D;  5GAG C;  2B2U A;  3MXU A;  4DUY Q;  5C3E H;  3N52 A;  4KJN A;  2AUJ D;  3U4V A;  4WJ3 M;  4GNX C;  1UAP A;  4DV6 L;  4JBJ A;  3GTP B;  1S5C D;  2EJM A;  5CMD A;  1EQT A;  1ICW A;  3Q6S A;  2AQ1 B;  4A93 B;  2N8N A;  4FVM A;  2ASB A;  3AB9 A;  1BBW A;  2K5W A;  2LS0 1;  4IFD H;  4KMU C;  1EWI A;  3NWT A;  1Q81 C;  1DZ1 A;  4R8N A;  3TBI B;  4Y52 H;  1XXG A;  5G3L F;  2A73 B;  1BO0 A;  2FXQ A;  1KNE A;  1EYG A;  5GRO A;  4BXX H;  2KQ3 A;  4HCE A;  5EKI A;  1HQR D;  1Y8P B;  4OIK A;  4GN4 B;  5EGT A;  4FF3 A;  2R7Z G;  4IPH A;  2PW7 A;  4HMI A;  4YCV A;  1IBL L;  2F0F A;  1LTS D;  1YEZ A;  3A7L A;  1B9N A;  1Q82 C;  3MC0 B;  2F0U A;  4K5W A;  4KKU A;  5ELB A;  3KLR A;  2XWB B;  1PH8 A;  1EY0 A;  2N78 A;  3KF6 A;  1YHB A;  1K83 H;  2R7D A;  2ZXP A;  4O1N A;  1LT3 D;  1CKN A;  2Z6K C;  3JAM E;  3H6M A;  1BCP D;  4OO1 H;  3V05 A;  3FP9 A;  1QNK A;  2K28 A;  3BS1 A;  5FLM H;  4DXG A;  3R3O A;  4DV3 L;  1PH7 A;  2AQ2 B;  2WKD A;  2RHS B;  4JOI A;  3UI2 A;  4JI0 L;  1H95 A;  2KEC A;  4JI4 Q;  4KI0 A;  2XTI A;  1PVO A;  4OO1 I;  2HQE A;  2NUC A;  2JK8 A;  3KBG A;  2YTV A;  4M1U B;  5CV4 A;  1I94 Q;  1E24 A;  4HSP A;  3IFT A;  1M90 C;  2EJF C;  1LAB A;  3ND8 A;  5IWA L;  1H9J A;  3LWU A;  1DJR D;  5C6A A;  1OXV A;  5CV5 A;  4XT1 B;  3J81 i;  5LL6 X;  1E2Z A;  5HGT A;  2FJ2 A;  3CF5 A;  3J7Z C;  1KDC A;  1SEB D;  3T56 B;  3I4N B;  2VNU D;  3A5U A;  3DWP A;  4ZLT F;  3I4M B;  3I70 A;  2E2D C;  4OX9 L;  1A8V A;  4DAM A;  1DM0 B;  1AP0 A;  4BY7 H;  1S5D D;  1EIG A;  1RKN A;  1U4M A;  4A3B B;  4J8Q A;  1SNM A;  2ATW A;  4NMZ A;  4N8F A;  1L1O A;  1MGS A;  1O78 A;  4JK1 C;  1C9O A;  1GKH A;  4O42 A;  2K14 A;  2IX1 A;  1G2T A;  5AJ3 Q;  1SN8 A;  2KOL A;  5IP7 G;  2L11 A;  4DR5 L;  5IGF A;  4H0L C;  1Q8I A;  2K33 A;  3MHB A;  5CBE E;  4BBS G;  2RKS A;  1C8C A;  1QJO A;  2F0O A;  5LMN L;  5DLQ E;  4U67 3;  2K50 A;  2ZM6 L;  4DA2 A;  2E8G A;  3ULJ A;  3M9B A;  1IL8 A;  2XWJ B;  3HKZ B;  3QWN A;  3S1M H;  3VR4 A;  3R2T A;  4YHH L;  1ESF A;  4KN4 C;  2E5L Q;  2BDN A;  4Z9C B;  1QVG A;  1VQP A;  3HOV H;  2R92 G;  3ZYY X;  1IZ6 A;  1TY2 A;  4TSS A;  3AFP A;  2UXD Q;  3TZD A;  3I4N H;  1NAP A;  3KDF A;  2NN6 H;  3NXW A;  4RKB A;  4A3M H;  1V9P A;  1Q1E A;  2CFM A;  3CRK C;  1B4O A;  1LT5 D;  2HDL A;  4WJW A;  1VQH A;  4DR2 L;  2ZTD A;  1DYQ A;  4UP9 A;  4PQX A;  4OO1 G;  4KD4 A;  3I4M G;  4NB3 A;  2HHH Q;  2MGS A;  4RKL A;  2Q8T A;  4IUT A;  3H0G G;  2EIF A;  4L8J A;  2R6G A;  2J0T D;  1AEX A;  1F9S A;  5C3W A;  1N33 L;  5EBD A;  5I4D A;  3ULP A;  5I9P A;  2JA8 B;  1D7Q A;  5KYI A;  2EQS A;  2F0G A;  1B3Q A;  3SR1 A;  3CXC A;  1KC8 C;  1VS0 A;  3RNU A;  1W6K A;  3A0J A;  3HKZ G;  2F0N A;  1LTR D;  1K3B C;  3J80 c;  4P2C B;  4B3M Q;  3DEO A;  3DXJ C;  1XX8 A;  1IYU A;  4GNX B;  3UE1 A;  1HPC A;  2OQ0 A;  5M5Y H;  2PNR C;  1YNX A;  3BDL A;  4A3C G;  4TKO B;  3KLS X;  4ME5 A;  2IX3 A;  2ZXO A;  2TMP A;  1FVI A;  3J81 j;  4TQU S;  3GTM B;  3MXN A;  1STB A;  3G6J B;  3I4M H;  4C1N I;  3D4D A;  1TT2 A;  4A3K G;  3GTO B;  5IY0 A;  2CH4 W;  4XIG S;  5H1S E;  1Z9F A;  4POF A;  1NNX A;  4B3S L;  4PNY A;  1K0S A;  1IW7 D;  3H3V C;  1KTK A;  3VR3 A;  5C0X I;  3DLL A;  5I6W A;  2E2J B;  1DON A;  2EY5 A;  3I3C A;  2G9D A;  3PGZ A;  4OIJ A;  1NMG A;  4F88 A;  4A3L H;  2B2Y A;  3EFX D;  3HZX A;  1UE6 A;  5IT9 c;  2NVY H;  2JEA I;  3S2H H;  3HOU H;  1N34 L;  1SYF A;  3NQI A;  1AW7 A;  2NTS A;  2I46 A;  4DR5 Q;  4ME3 A;  4DK3 C;  3OWF A;  3H15 A;  3D4W A;  3TP5 A;  5M5W H;  3RZO B;  1GO3 E;  3GD7 A;  4QB4 A;  5LMN Q;  1CSP A;  5LMU Q;  2EXD A;  1BR9 A;  4LUO A;  5ELO A;  2LKV A;  1DOL A;  1EYA A;  4N9T A;  2KCM A;  4YWL A;  5KND A;  1HCZ A;  3S17 B;  1FYC A;  3CME A;  2ICE C;  4KKT A;  3KJP A;  3DUZ A;  5EBC A;  5M3F H;  5IGE A;  4IPD A;  1DXM A;  2IHF A;  5C5M A;  1OXU A;  5T1G A;  1VQF A;  3PIP A;  3QR8 A;  1SNP A;  5G3L D;  4K8J A;  3KUP A;  1OTC A;  1QB5 D;  2RBM A;  3FPP A;  1WFQ A;  3K5O A;  3CCU A;  1QOH A;  4A3G G;  1JIC A;  2NTT A;  4MTK A;  2C35 B;  4BY1 H;  1GJX A;  2K03 A;  2K5D A;  3OTO L;  2JA5 H;  1VCI A;  2JP1 A;  2QF7 A;  1KNA A;  1JB7 A;  1Q1B A;  4A3E B;  2KJX A;  4BY1 G;  1IBM Q;  2KHI A;  4DV1 L;  3K57 A;  2CWP A;  4IUP A;  3N6R A;  4MTN A;  2B3G A;  4GOP B;  2CW0 C;  1O7Y A;  4P71 A;  1EZ8 A;  3S15 H;  5IGD A;  3CCJ A;  3M4P A;  1H9M A;  1VQD A;  1WTW A;  5IP7 H;  2LFN A;  2K75 A;  1RJT A;  4RMF A;  4DKA C;  2L15 A;  1Y1W B;  4KY6 A;  5M5X H;  5M3F G;  1X3F A;  1Q7Y C;  1ZYR C;  3NUC A;  2F03 A;  3MWY W;  1HFG A;  4F7X A;  5IT9 L;  2A6E C;  4C3H B;  1BOS A;  3JC6 6;  3OW7 A;  4DK6 C;  2OEO A;  4HIK A;  1CTM A;  3TN2 A;  4A3I B;  3HFZ B;  2WP8 J;  2CCZ A;  4FXG C;  3L2P A;  3JAM i;  4V19 0;  1C0A A;  2A5H A;  4JI3 Q;  3K81 C;  1R9T B;  2JA6 H;  1PFM A;  1KLG D;  3HOY G;  1QNU A;  2E75 C;  1Y1W H;  3MXP A;  3ND9 A;  5JOB A;  3M7G A;  4DNR B;  4A3L G;  4IUU A;  2UUA L;  2I5L X;  4ULL A;  4YIJ A;  4DAY A;  1LTT D;  3KBX A;  1N36 Q;  3GO5 A;  1A2U A;  3S24 A;  1EYC A;  4GLX A;  4OHJ A;  5CYU A;  2MJ8 A;  4JPB W;  4KKS A;  5I6Y A;  1Y8O B;  4DUY L;  5FJ8 G;  4OX9 Q;  5ELC A;  4FF4 A;  4CDD C;  1YNN D;  3J80 L;  3MZ5 A;  2H4O A;  3CCV A;  1I4H A;  5IOD A;  4G4K A;  3HOZ G;  2HCI A;  1NY4 A;  3NSW A;  2I07 B;  3Q22 A;  3T1H Q;  4EQP A;  1J8I A;  2BOS A;  1N8R C;  2EVB A;  1CI3 M;  1KXL A;  4JI7 Q;  2RDG A;  4DV2 Q;  1XPU A;  1MSH A;  2VUM G;  4UAI A;  1MSG A;  3NTK A;  3S2D H;  1CHP D;  2VB3 X;  1JC7 A;  1QWY A;  5KIX A;  2Y0S B;  4A3J H;  2EYO A;  1B44 D;  1KDB A;  1O80 A;  5LHY 1;  3UDG A;  1EU4 A;  4LF7 Q;  1RDP D;  3OOC A;  3RN5 A;  2EYJ A;  5JPN C;  1F77 A;  3EVQ A;  4A3F H;  4GLV B;  3TRZ A;  3RZO H;  4C3H G;  1VQK A;  2D62 A;  3E9I A;  4IOA A;  1V1P B;  3S9W A;  3S1Q B;  1A2T A;  1ASY A;  2HHH L;  4X6A H;  1PFS A;  2HQL A;  3P75 A;  4IPG A;  2NVY B;  1WYD A;  4CDE C;  1STE A;  1HZA A;  4L5Q A;  2MUY A;  3GTG B;  4A3G B;  2IJ0 A;  4U68 A;  3KF6 B;  3BZD B;  1MI2 A;  4IJH A;  4R1J A;  4HAE A;  1JE4 A;  1HZB A;  4IPC A;  5C4J H;  4O2D A;  4CJ0 B;  4K5V A;  3W1B A;  1LYL A;  4XYO A;  2VQF L;  3K0Y A;  1W6J A;  3G6E A;  1RIP A;  4R4T A;  3SHL A;  2E2H B;  1SYC A;  5ELF A;  3DEP A;  2LXJ A;  2Z6B A;  1AE2 A;  3CQZ H;  4RGM A;  1EL0 A;  5JEA J;  1JJ2 A;  1I94 L;  3KLS A;  2JA8 G;  1CZW A;  3I55 A;  1HA5 A;  3R8B A;  1ET6 A;  3TP7 A;  1RTO A;  5J1Z A;  1I4X A;  4ZK9 B;  1PZK D;  2ALY B;  3K5N A;  3DM3 A;  2BH2 A;  2EDG A;  4LF6 L;  3QOJ A;  3T4A C;  1MJC A;  4GKK L;  3PIO 3;  1EIF A;  1X6O A;  1C7Y A;  4PZ7 A;  4C3J B;  1ZYR D;  3L7Z C;  1VQJ A;  3D8G A;  3OYY A;  2XRS D;  2JA8 H;  4DR4 Q;  1VF7 A;  2EPB A;  3ERQ A;  1SE2 A;  3TME A;  1K8A C;  2VQE Q;  4B9W A;  2F0T A;  5C5L A;  1FJG L;  1CT1 D;  1IYJ B;  5GAD C;  1E2V A;  1JJC B;  2F3V A;  4B08 A;  3IL8 A;  3RR5 A;  1PTO C;  3J81 c;  4UPA A;  1I50 H;  3SXH A;  4JC0 A;  3CC4 A;  4KHZ A;  2OTL A;  1JT8 A;  4OL7 A;  4ZYS A;  4IFD G;  4K14 A;  2VZA A;  3HS0 C;  1QG7 A;  3CCL A;  3F1Z A;  4XQJ A;  3A74 A;  1G6Z A;  1YHA A;  2F1M A;  4UY8 C;  4AIM A;  3OWE B;  3Q0A A;  1KD1 C;  1PH9 A;  4L63 B;  1W3S A;  5IYD G;  1QCB D;  4PMB A;  4JI5 L;  1ENA A;  2PI2 A;  3QG1 A;  4X66 L;  1SJH D;  3D0F A;  1II3 A;  3P20 A;  3CAM A;  4HJ8 A;  1U4P A;  3QIA A;  2KCN A;  1TKW B;  1Z47 A;  1BCP C;  1SRO A;  1TWG H;  1VQ9 A;  2N49 A;  1B70 B;  2OCE A;  1CKM A;  3KDF B;  2Z9H A;  2K6A A;  4PZ8 A;  1YJW A;  1TWC H;  2CWA A;  4G7H C;  2NYZ D;  5C3X A;  1WCM H;  4DR1 L;  4XTC S;  2PW5 A;  2UU9 L;  4GLA C;  4F8M A;  3H3V I;  4X3U A;  1OO9 B;  1BCP B;  1ICF B;  4ZCK A;  1JOQ A;  3PIO A;  2PZU A;  1RL2 A;  5BN3 A;  4LAA A;  2WFW A;  3G7L A;  3E0J A;  2IY5 B;  3W1G A;  5KNC A;  1SBB B;  2B2V A;  4GN5 A;  1PA6 A;  4OWT B;  2MP1 A;  1G51 A;  3STB D;  1KQS A;  3MA2 B;  2WAQ E;  4BY7 B;  1FNV A;  1HRJ A;  1AE3 A;  4IZ8 A;  2VL6 A;  2GVB A;  2NVX H;  2YV5 A;  2F0E A;  4DV0 L;  1VQ6 A;  4BBR H;  3P7J A;  4OXP A;  1QZG A;  1HFN A;  4A3M B;  4QQB X;  1X3E A;  1G6P A;  3U9O A;  1LT4 D;  3U58 A;  3H0G H;  2E2I H;  3TP8 A;  4R4O A;  4JI1 Q;  4QY7 A;  1EQR A;  1JOK A;  4QIW E;  2QCP X;  1MIU A;  4GNX A;  2H1E A;  2K32 A;  2Y0S E;  1TY0 A;  3NQT A;  4POG A;  1CKN B;  4ID6 A;  3CCQ A;  1SFO H;  2OTJ A;  3S1M B;  3NTI A;  1TS5 A;  4J6H A;  2MHV A;  4FDB A;  4FP5 D;  1O7I A;  1I4G A;  4DV7 L;  4NXM L;  1EIH A;  1SMY D;  2E74 C;  1TS4 A;  2RF4 A;  4HCS A;  1I6H B;  5GQO A;  1WCM B;  3F8T A;  1L2F A;  4DN4 M;  1TQO A;  3HOY B;  3FRP B;  1D2B A;  1S5B D;  1ML0 D;  2FFK B;  3SDZ A;  4NXN Q;  5C44 H;  3S16 B;  3VR2 A;  1KAW A;  4CKE A;  1JWS D;  1I4Q A;  1YZ6 A;  1FGU A;  4B3T L;  1UUP A;  1LTL A;  4CKB A;  2A74 C;  4L5R C;  4O0A A;  2AWO A;  3D4R A;  1YBY A;  3KFU A;  1SNQ A;  1AZP A;  4QCL A;  2JSO A;  1GUG A;  1YIT A;  4LFB Q;  4ZQ3 A;  1BKB A;  1J6Q A;  2Q2I A;  2F0M A;  4RAU C;  1EFW A;  2JA6 G;  3D6W A;  3S14 H;  1Y1W G;  4BBS H;  3SVM A;  1WJJ A;  2NVT B;  1VQA A;  3I56 A;  4P72 A;  2O5J C;  2DUD A;  2OXP A;  2Q2T A;  3F2C A;  4JI0 Q;  4TRD A;  3CW2 C;  1L1O B;  1E1T A;  5JJZ A;  2NZO A;  3D3R A;  1GUO A;  1HNZ Q;  4FXD A;  1S4Z A;  5C4J B;  3BG3 A;  1DCZ A;  3IAY A;  5M3M H;  2VUM H;  3MFG A;  3TS0 A;  2KED A;  2VB2 X;  3I72 A;  4NW2 A;  4J1M A;  2DJF C;  1X55 A;  3KJO A;  3J7A F;  1QVF A;  3NEL A;  3E9H A;  4RCO A;  2CVR A;  5EAY A;  3S1Q H;  1QE6 A;  4WOR A;  4A93 G;  4X64 Q;  3CC7 A;  4F87 A;  2AMC B;  1PHJ A;  4IFD J;  3T1Y L;  1MBY A;  1ENF A;  1TWF B;  4P75 A;  2D2C C;  3A56 A;  2EY6 A;  4GOP A;  1NBW A;  3DHQ A;  3B6Y A;  2F3I A;  5DM6 3;  3GTL H;  2F0K A;  2J7Z A;  1HZC A;  1STN A;  3CPF A;  3K5L A;  2CQA A;  4C3I B;  4EQ5 A;  1EIY B;  4JI6 L;  5DM7 3;  2Z4I A;  1SYG A;  1STG A;  2O2L D;  4LMQ D;  2M00 A;  2ZJP A;  1GVP A;  2GVA A;  3I90 A;  1IKM A;  2MFI A;  5FLX L;  2IW3 A;  2JE6 I;  1C4Q A;  4ILW A;  1M8A A;  2PI2 E;  4JBM A;  4ODG A;  2VS1 A;  1HNZ L;  1HXY D;  4DV0 Q;  1BBX C;  4ZUI A;  1E22 A;  4JCV E;  4DV4 L;  4A3G H;  4K2K A;  1GUS A;  3WOE A;  3BDO A;  1OXT A;  2GA4 B;  4A93 H;  4V0B A;  3NBH A;  1P16 A;  3NPP A;  5I2Y A;  4DAV A;  4HIO A;  2UU9 Q;  4YCW A;  3WOF A;  3BYT B;  2F4V Q;  5JJK A;  2JA5 G;  3RN2 A;  4QUF A;  4L6T B;  4DAY B;  4RGO S;  2EYH A;  5EJW A;  4KHP L;  4A3K B;  4DPG A;  4MIU A;  1F2L A;  4DR4 L;  3KLW A;  3HOU G;  1XTD A;  2R7Z B;  1PZJ D;  3MXN B;  4A3I H;  3L3O C;  5COR A;  2JJQ A;  3PO2 G;  2BE5 C;  3UE0 A;  2X6L A;  1FGB D;  3KF8 A;  3VYT A;  4LW1 A;  5TSS A;  1Q90 A;  2OT2 A;  4IJL A;  4NXN L;  1IBK Q;  3EBE A;  1N34 Q;  2V4D A;  4S3S A;  4JI5 Q;  5C4X B;  3PO3 G;  4JI1 L;  1U4L A;  4L5T A;  2C9O A;  3I73 A;  2PZT A;  4CBV A;  3HOW H;  1F9Q A;  1PFB A;  5EPK A;  3H09 A;  4DR3 Q;  1B9M A;  2AQ3 B;  4A3F G;  4XXE A;  2B63 H;  2F3W A;  2KVM A;  1K0R A;  4I7Z C;  1DGS A;  4XQN A;  3RZD H;  3RZD B;  4CDC C;  4EX5 A;  3ER0 A;  3K5M A;  3U9S A;  4Y7N H;  3J81 L;  5BN5 A;  5M9O A;  1R4P B;  2SNM A;  3BJU A;  1HJP A;  1E3P A;  1XMO Q;  3A8K E;  1GM5 A;  2MNA A;  1SE4 A;  3HOW B;  3VR6 A;  1Q46 A;  1V1P A;  2SNS A;  3E6Z X;  2A6E D;  3NTH A;  4LFA L;  2YU9 B;  2YYZ A;  1DD2 A;  5JJI A;  4OEM B;  5J3B A;  1LTA D;  3OIQ A;  4C3I H;  4DR6 L;  1WTP A;  4LF4 Q;  2SOB A;  5IT9 E;  4BXX G;  1FD7 D;  1HTL D;  2JEB I;  1PH2 A;  1NJI C;  1NUC A;  5HY6 A;  1JB3 A;  3ERS X;  4IN3 A;  5DEH A;  1QVC A;  1P8L A;  3KK7 A;  5EKL A;  4G57 A;  3OPO A;  2K52 A;  2I5M X;  2JN4 A;  1IBM L;  1VF5 C;  1SAP A;  2WAQ G;  4H44 C;  1TWA B;  1WTH A;  5M5X B;  2NVQ H;  1MKH A;  4ABN A;  1MD2 D;  4GKJ Q;  1GOZ A;  1G91 A;  5IYC G;  3T53 B;  2D5D A;  1F2Z A;  5IGG A;  1HUN A;  1K9M C;  5JAV A;  4HR7 B;  3S1N B;  5EPJ A;  4CJ2 C;  4IUV A;  2EOT A;  2B2W A;  1QZH A;  2P5Z X;  4KJO A;  1L1O C;  2YTX A;  1Q8K A;  1XTC D;  3SK6 A;  3MAQ A;  2A19 A;  3JAM c;  1U0L A;  4NXM Q;  1UE7 A;  3BVM A;  1HQM C;  4K6D A;  4LFC L;  3EJI A;  4E6I A;  1PH5 A;  2MO1 A;  2AUK A;  1D5Z C;  5JVH 3;  1EY9 A;  3CRL C;  2N88 A;  4RGN A;  1Z7T A;  4JG2 A;  4BY1 B;  3K7A B;  2L1B A;  1Y69 U;  1G8Z D;  1PRT D;  1SXT A;  3S14 B;  4NDX A;  1WCM G;  2D0O A;  5A2Q E;  2EY2 A;  4I7A A;  3CCR A;  1D8L A;  1CA5 A;  4IAL A;  4IO9 A;  3GTM H;  1JWU D;  2LSS A;  2WII B;  5FLM G;  2K7V A;  2PQA A;  5CV9 A;  4B3R L;  3BU2 A;  2UUC Q;  3F2D A;  3I91 A;  3SE0 A;  1NR2 A;  1HR0 W;  4A76 A;  4K0K L;  2K4K A;  5FJ8 H;  1VQI A;  3T13 A;  4WRD A;  4NP5 A;  2HD3 A;  2PMZ B;  1CQV A;  3PSI A;  5C44 B;  4KHP Q;  1LM0 A;  4DV2 L;  1TS3 A;  5KNB A;  2DNE A;  3AFQ A;  3M4Y A;  1VQM A;  4DV1 Q;  1A63 A;  2L12 A;  2FMC A;  1JMC A;  1I4P A;  3I4O A;  5K5P A;  5M5W B;  1J5E Q;  2R92 H;  3VDY A;  3HEJ A;  3HOZ B;  4BA2 I;  3FVQ A;  1BUV T;  3ULL A;  3T1H L;  4DV4 Q;  2BE5 D;  4X3K A;  2G5D A;  1YHQ A;  5FK9 C;  1NTG A;  5KRU A;  3GTK H;  2CHB D;  2HDM A;  1CK1 A;  2CQO A;  2K5H A;  3TRE A;  3GV3 A;  1SFO B;  2UUA Q;  1WTQ A;  1NR4 A;  2XRQ D;  2L5T A;  1K8G A;  3GTJ B;  5CGK A;  2QIL A;  1NSN S;  4BBS B;  2QDB A;  3M3Y B;  4C2M H;  1I4R A;  2BH8 A;  1F9R A;  2F0I A;  3KYH C;  1EWH A;  1SNC A;  1EUJ A;  4PV1 C;  3S1R H;  1Y1V H;  4JW0 A;  3VA7 A;  1H9K A;  4JOI C;  1UNS A;  1PYW D;  1DOK A;  1D1K A;  5M5Y B;  3X3N A;  3IRB A;  1S5E D;  5I9O A;  1SSO A;  2QEX A;  4A3D H;  1RHP A;  4LF9 L;  1CHQ D;  3CPW A;  1XPR A;  5C4Z A;  1OXS C;  1NMF A;  3RLO A;  2RVL A;  1CKO A;  1Y1V G;  5JJL A;  3ERO A;  1SMY C;  1SMX A;  2KHJ A;  4JYA L;  5KYL A;  2F0W A;  2WB1 G;  2PCF B;  4FF2 A;  4JI7 L;  1H9S A;  3MEH A;  4QF4 A;  3C3L A;  1E0B A;  1TWG B;  1A6X A;  4DNI A;  2WKC A;  1TU2 B;  4A3B H;  1PH4 A;  2YTY A;  4N9P A;  1X56 A;  2PZW A;  1FL0 A;  5ISR A;  1EZ6 A;  3GTQ B;  4DR1 Q;  1I6V C;  1RTN A;  3VR5 A;  3J80 i;  4AH6 A;  4KY5 A;  4IFD I;  4BY7 G;  3HOV G;  2QA4 A;  4AYB E;  2PPB C;  4C2M B;  4BBR B;  3R2I A;  1EY7 A;  2B29 A;  4ZAI A;  1X3G A;  4Q0F A;  1EEI D;  3M4Q A;  1L0Y B;  2R61 A;  4FO2 A;  2UUC L;  1M4V A;  1YI2 A;  4B3T Q;  3GTQ H;  3G48 A;  4IUN A;  1J9O A;  5FLX c;  4PG3 A;  4QGU A;  4ZKC B;  2DN8 A;  5LL6 S;  4AQY L;  2JA7 B;  2O4X A;  1ONL A;  5K36 G;  1KDA A;  1PRT C;  1JCK B;  4EQN A;  1YJN A;  3PUV A;  3CKI B;  4QUC A;  3T16 A;  3HOZ H;  1L0W A;  1KHI A;  4C56 C;  3WDN A;  5GAH C;  1PH3 A;  1XNQ Q;  4C3J H;  2DGY A;  3E5S A;  1EWC A;  2RDH A;  3K58 A;  3PUX A;  4XQQ A;  2PMZ E;  1V43 A;  5D3D A;  1DOM A;  4A3B G;  1VDZ A;  3NEN A;  2G9H D;  5FO7 B;  2KBN A;  3EN2 A;  1I3Q B;  3RD4 A;  4JBW A;  3STB C;  1SYB A;  2L0C A;  2KCT A;  2VQE L;  1KAA A;  1HNW L;  1WTV A;  2F0J A;  2EYM A;  4GZY C;  3I4N G;  1Y1V B;  4N8X 1;  2Q2U A;  4K2L A;  1Y14 B;  3H3V H;  1CM9 A;  3K59 A;  4GKK Q;  1S3O A;  3OMC A;  4R4Q A;  1AFP A;  4DR6 Q;  5C0X J;  1G2S A;  2E2H H;  4JV5 Q;  3M3Y H;  4DR2 Q;  5DNF A;  5COY A;  3I8Z A;  3GTJ H;  1A15 A;  5DAU A;  3HRZ C;  2BA0 A;  4HIM A;  3PO3 B;  4B3R Q;  5D14 A;  4JI2 Q;  4RCN A;  1B7Y B;  1SNO A;  2UXD L;  3ONA B;  1JJG A;  4P73 A;  2A68 C;  3J7Y W;  4R9W A;  2F0D A;  3J7A V;  3K8A A;  1KRS A;  2ZJQ A;  3CU7 A;  3HGB A;  2OF1 A;  2A6H C;  2LXK A;  3J80 E;  2ID0 A;  1YIJ A;  4B3S Q;  3HOX H;  4LF9 Q;  1T5E A;  1ZEQ X;  1CFM A;  4DV5 L;  1LTG D;  4A3M G;  2ZT9 C;  2ZTE A;  1I5F A;  2X69 A;  4QIW B;  1ZKO A;  4DF7 A;  2GN5 A;  1HNX L;  1V1Q A;  2B2U C;  5IGB A;  1OXX K;  4PZ6 A;  4DK0 A;  5IP9 G;  4PMW A;  5FO8 B;  3A55 A;  4I65 A;  4A3F B;  1NCV A;  2NZH A;  1YVC A;  1RCV D;  5GAE C;  4MN3 A;  1C48 A;  2D9U A;  1QUQ B;  1BQQ T;  2XIW A;  3NHH A;  1JOR A;  4IUR A;  4X66 Q;  2NWG A;  3PF5 A;  1VQ4 A;  5E3F A;  4LF8 Q;  3LGJ A;  1CA6 A;  2F0L A;  4LNQ A;  5CV8 A;  2B2T A;  3MFY A;  3W3A A;  3SK5 A;  2R93 B;  4LUV A;  2RSO A;  1B53 A;  5JEA G;  3E0E A;  4X65 L;  2ICI A;  1EOT A;  3NK9 A;  1ET9 A;  5E4X A;  5HGQ A;  5C44 G;  4G7O C;  1PRT F;  2Q2H A;  2XSC A;  4CDF C;  3K7A H;  4IUQ A;  2UXC L;  4LUZ A;  2OQK A;  4NPS A;  1D5X C;  4FNF A;  4ALP A;  1U5K A;  1LLR D;  4RFB A;  1ASZ A;  3FKI G;  4FXK C;  3KF8 B;  2ZJR A;  3PIP 3;  2FHT A;  1XMQ L;  2OWO A;  1PZI D;  3RLF A;  2XGT A;  3PQI A;  4AYB B;  1KAB A;  5LMN W;  1H9R A;  4BA1 I;  1U4R A;  2I0Q A;  4GOP C;  1YJ9 A;  1B8A A;  3GQB A;  3S1N H;  2B2T C;  3TQY A;  5JEA H;  1X9N A;  1S5F D;  1GUT A;  2O5I C;  4FF1 A;  4NKL A;  1XNQ L;  3AEV A;  1A62 A;  1UEB A;  2QDL A;  4YY3 Q;  1WTX A;  5FKA C;  4XYQ A;  3HKS A;  2F52 A;  1K73 C;  3AYH B;  3GDE A;  3I7F A;  1VQO A;  4OWW B;  4C1N K;  2SEB D;  3MVV A;  4LF5 L;  2JQO A;  3ICE A;  2R3Z A;  1VQL A;  1PTO H;  3C1E A;  1LT6 D;  1PTO D;  5IP9 H;  2EY1 A;  3QB3 A;  5IGC A;  3CCS A;  2NB0 A;  3G4S A;  2M9V A;  4DK1 A;  2YU9 H;  3D6C A;  3RMH A;  3SEB A;  3IFD A;  4KY7 A;  3PMF A;  4QL5 A;  1K3R A;  4RHR A;  4OGQ C;  1PYS B;  1S72 A;  4X64 L;  5EQ0 A;  1HR0 Q;  2KHS A;  4ZUJ A;  4CHT B;  3RUZ A;  3BZC A;  5I2X A;  1KIX A;  1HA6 A;  2KA7 A;  2PNH A;  1UEA B;  3C1F A;  4KV6 A;  1EY5 A;  1SDF A;  1WOC A;  2R93 G;  2JXM B;  1BBU A;  1X54 A;  5KGU A;  3FMC A;  2JA5 B;  2B63 B;  1CQF A;  1JE5 A;  4RGT A;  3TP6 A;  4BS9 A;  2B8G A;  4M8A A;  4J15 A;  4X62 Q;  4DV6 Q;  1X65 A;  2SDF A;  2I5H A;  1SRU A;  1S40 A;  1N9W A;  3FEW X;  4XDX A;  1HHV A;  2BA1 A;  1WD1 A;  2HUG A;  1ILQ A;  1V8Q A;  4ZKB B;  5C4X H;  1JOO A;  2IX0 A;  4P74 A;  4HJ7 A;  1R9T H;  2B8F A;  2RDF A;  4YY3 L;  2R93 H;  2B39 A;  5FOB B;  4H7B A;  4R4I A;  2L55 A;  2IWH A;  3CCE A;  3DM1 A;  1A3V A;  5E4W C;  4UP8 A;  3GV6 A;  2ZTC A;  1U9R A;  4OWX B;  4MZ9 A;  1MJE A;  3HOW G;  1XPO A;  3PUY A;  1UWV A;  2DNC A;  3CP0 A;  2ZM6 Q;  4DR7 L;  2R7F A;  2VY3 A;  1GHK A;  4R8I A;  4MNO A;  4APV A;  4JI8 L;  1SLJ A;  3TSS A;  4EQO A;  3FKI B;  4LF4 L;  2PQA B;  2MPM A; 
#chains in the Genus database with same CATH homology
 3CCM A;  1ASY A;  2HHH L;  4X6A H;  1PFS A;  2HQL A;  4IPG A;  1WYD A;  1QZH A;  4L5Q A;  1HZA A;  2N8N A;  1L1O C;  2YTX A;  1Q8K A;  3KF6 B;  2ASB A;  2A19 A;  3JAM c;  1BBW A;  1U0L A;  3NBH B;  3M85 A;  4NXM Q;  1Q12 A;  1UE7 A;  2QGQ A;  4LFC L;  4IJH A;  1EWI A;  1PH5 A;  2MO1 A;  4R1J A;  1Q81 C;  1HZB A;  4IPC A;  5C4J H;  4O2D A;  2E2J H;  4Y52 H;  4JG2 A;  3W1B A;  1LYL A;  2VQF L;  2FXQ A;  1EYG A;  5GRO A;  4BXX H;  1HH2 P;  1PYB A;  3G6E A;  1RIP A;  1SE8 A;  4R4T A;  1IBK L;  1WCM G;  2D0O A;  4GN4 B;  3PUZ A;  1VQG A;  2LXJ A;  2R7Z G;  4WJ4 A;  3CCR A;  1AE2 A;  1D8L A;  3CQZ H;  4IPH A;  4OON A;  3GTO H;  4YCV A;  2RCN A;  1IBL L;  1PV4 A;  5IWA Q;  5JEA J;  4IO9 A;  1JJ2 A;  1I94 L;  3GTM H;  1G29 1;  1YEZ A;  2LSS A;  5FLM G;  3I55 A;  2JA8 G;  2PQA A;  4B3R L;  1Q82 C;  3BU2 A;  2UUC Q;  3F2D A;  4HJA A;  1HR0 W;  2HIV A;  4A76 A;  4K0K L;  2ALY B;  3DM3 A;  2K4K A;  4LF7 L;  5FJ8 H;  1VQI A;  2BH2 A;  1PH8 A;  4LF6 L;  2N78 A;  3KF6 A;  5M3M G;  1YHB A;  3S17 H;  3PSI A;  1MJC A;  1K83 H;  2R7D A;  1LM0 A;  4DV2 L;  4KHP Q;  4GKK L;  3AFQ A;  1EIF A;  1CKN A;  3UDI A;  1VQM A;  1TWF H;  1X6O A;  2A1A A;  2Z6K C;  5C4X G;  4DV1 Q;  1C7Y A;  1A63 A;  4PZ7 A;  2HT1 A;  4AYB G;  1JMC A;  3L7Z C;  3FP9 A;  1VQJ A;  1UE1 A;  3OYY A;  5FLM H;  2E5L L;  3I4O A;  2JA8 H;  4DR4 Q;  1I6H H;  1J5E Q;  4DV3 L;  1PH7 A;  3VDY A;  4JI2 L;  1K8A C;  2R92 H;  3W5O A;  2VQE Q;  5BR8 L;  3M7N A;  2RHS B;  4JOI A;  4JI0 L;  4LF6 Q;  3MEF A;  4LFA Q;  1FJG L;  4BA2 I;  4K0K Q;  1H95 A;  1IYJ B;  5GAD C;  4JI4 Q;  4KI0 A;  2XTI A;  3ULL A;  3T1H L;  1PVO A;  2IT1 A;  4DV4 Q;  4OO1 I;  1JJC B;  4JV5 L;  3RR5 A;  2JK8 A;  1YHQ A;  1NTG A;  2YTV A;  1W2B A;  5IYB G;  3J81 c;  4UPA A;  1I94 Q;  1I50 H;  2JA7 H;  3GTK H;  1E24 A;  4JC0 A;  3CC4 A;  1M90 C;  4X62 L;  2CQO A;  4KHZ A;  2K5H A;  3TRE A;  5IWA L;  2OTL A;  2UUA Q;  1JT8 A;  1OXV A;  5IYB H;  1N33 Q;  3PO3 H;  1K8G A;  4IFD G;  2WB1 E;  2VZA A;  3CCL A;  3J81 i;  3F1Z A;  2NVT H;  2Z0S A;  3A74 A;  4C2M H;  1YHA A;  2BH8 A;  4UY8 C;  4AIM A;  3CF5 A;  3J7Z C;  3KYH C;  4A4I A;  2VNU D;  1KD1 C;  1PH9 A;  1W3S A;  3A5U A;  5IYD G;  3Q8D A;  1EUJ A;  4OX9 L;  4GKJ L;  1A8V A;  4DAM A;  4YCU A;  4A3E G;  3ZJY C;  3S1R H;  4JI5 L;  4LFC Q;  4BY7 H;  1Y1V H;  2PI2 A;  4UP7 A;  4JOI C;  4X66 L;  2VW9 A;  1IL2 A;  3L0O A;  3D0F A;  3CAM A;  5E7N A;  4HJ8 A;  3IRB A;  5IE8 A;  2ATW A;  1Z47 A;  1SRO A;  1TWG H;  1I3Q H;  2QEX A;  4A3D H;  1L1O A;  1VQ9 A;  4LF9 L;  3S16 H;  2N49 A;  1B70 B;  1C9O A;  3K7U C;  2OCE A;  3CPW A;  3J7A 5;  1CKM A;  1XPR A;  1GKH A;  3KDF B;  2K14 A;  2IX1 A;  4PZ8 A;  1YJW A;  1OXS C;  1NMF A;  1TWC H;  2NN6 I;  2CWA A;  3RLO A;  5AJ3 Q;  3HOY H;  1SN8 A;  2JA7 G;  5IP7 G;  3U4Z A;  4DR1 L;  1WCM H;  1CKO A;  4DR5 L;  1Y1V G;  4XTC S;  5JJL A;  2UU9 L;  4GLA C;  3H3V I;  1SMX A;  2KHJ A;  4JYA L;  4YWM A;  5BR8 Q;  4BBS G;  2WB1 G;  3PIO A;  4JI7 L;  1RL2 A;  5LMN L;  5DLQ E;  2K50 A;  2HIX A;  2WFW A;  2ZM6 L;  2E8G A;  3ULJ A;  3M9B A;  4DNI A;  2IY5 B;  3W1G A;  3S1M H;  4A3B H;  4GN5 A;  3CC2 A;  1PH4 A;  2YTY A;  1PA6 A;  4YHH L;  1VQ5 A;  4OWT B;  1J5E L;  3F2B A;  1X56 A;  4GS3 A;  1G51 A;  3STB D;  1FL0 A;  2E5L Q;  1KQS A;  1QVG A;  4DR1 Q;  1VQP A;  3HOV H;  2R92 G;  2WAQ E;  3NEM A;  1AE3 A;  1IZ6 A;  2VL6 A;  2GVB A;  3J80 i;  2NVX H;  2YV5 A;  2V1C C;  4AH6 A;  4DV0 L;  1VQ6 A;  4BBR H;  4OXP A;  1QZG A;  3OTO Q;  4IFD I;  3AFP A;  2UXD Q;  3I4N H;  4QQB X;  1X3E A;  1G6P A;  3KDF A;  4BY7 G;  3HOV G;  2QA4 A;  4AYB E;  3U58 A;  3H0G H;  3EIV A;  1N32 L;  2JA9 A;  4A3M H;  1V9P A;  2E2I H;  1Q1E A;  2CFM A;  1XNR L;  2UUB L;  2B29 A;  2D0P A;  2AHO B;  1X3G A;  4R4O A;  4JI1 Q;  4QY7 A;  3M4Q A;  1EQR A;  1VQH A;  4QIW E;  4TVA B;  4GNX A;  1MIU A;  2ZTD A;  4DR2 L;  1YI2 A;  2UUC L;  4B3T Q;  2Y0S E;  4POG A;  3GTQ H;  4JYA Q;  4UP9 A;  3G48 A;  4OO1 G;  1CKN B;  5FLX c;  3CCQ A;  4PG3 A;  1SFO H;  3I4M G;  4QGU A;  4NB3 A;  2HHH Q;  1BVS A;  4AQY L;  2OTJ A;  2RHQ B;  5K36 G;  3H0G G;  4FDB A;  1O7I A;  4DV7 L;  1YJN A;  2EIF A;  3PUV A;  4NXM L;  2K5N A;  4LF5 Q;  2R6G A;  1EQQ A;  4BBR G;  3HOZ H;  2RF4 A;  1N33 L;  1L0W A;  1HR0 L;  1KHI A;  3ULP A;  1PH6 A;  1D7Q A;  5GQO A;  3F8T A;  2EQS A;  1L2F A;  5GAH C;  3CXC A;  3HKZ E;  1KC8 C;  1VS0 A;  1PH3 A;  4C3J H;  2DGY A;  3RNU A;  1XNQ Q;  2UXB Q;  3PUX A;  1VQC A;  4DV7 Q;  3A0J A;  1TXY A;  3HKZ G;  2PMZ E;  1V43 A;  4A3B G;  1PH1 A;  3NEN A;  4B3M Q;  3J80 c;  4A3C H;  4DR7 Q;  4NXN Q;  2KBN A;  4GN3 B;  5C0X G;  4JI3 L;  3EN2 A;  5C44 H;  1KAW A;  1M1K C;  4JBW A;  3STB C;  1YZ6 A;  4GNX B;  1FGU A;  1HZ9 A;  3UE1 A;  2OQ0 A;  5M5Y H;  4B3T L;  1YNX A;  2KCT A;  4A3C G;  2VQE L;  1T9H A;  1HNW L;  1LTL A;  5LMU L;  4L5R C;  4LWC A;  3I4N G;  1FVI A;  4O0A A;  2AWO A;  4R4C A;  3J81 j;  4TQU S;  2Q2U A;  1YBY A;  3KFU A;  1EOV A;  1Y14 B;  3H3V H;  3I4M H;  4LFB Q;  1YIT A;  4A3K G;  5IY0 A;  4GKK Q;  1S3O A;  4R4Q A;  4LFB L;  1BKB A;  1J6Q A;  2Q2I A;  4XIG S;  1Z9F A;  5H1S E;  4POF A;  1EFW A;  2JA6 G;  5C0X J;  4DR6 Q;  2E2H H;  4JV5 Q;  2A8V A;  4DR2 Q;  3M3Y H;  4BBS H;  4B3S L;  1Y1W G;  3S14 H;  1WJJ A;  4HID A;  1VQA A;  3I56 A;  4P72 A;  3GTJ H;  3M4O H;  1IXR A;  5C0X I;  2DUD A;  3PCO B;  2Q2T A;  2BA0 A;  3F2C A;  4HIM A;  4JI0 Q;  1GD7 A;  4B3R Q;  3CW2 C;  1L1O B;  4JI2 Q;  3DLL A;  1E1T A;  1B7Y B;  2NZO A;  3RLN A;  1HNZ Q;  2UXD L;  1JJG A;  4P73 A;  3PGZ A;  2MQH A;  4B3M L;  5M3M H;  2VUM H;  1NMG A;  3K8A A;  1KRS A;  3TS0 A;  4A3D G;  2ZJQ A;  3K80 C;  4H02 A;  4A3L H;  3OW2 A;  2LXK A;  4B3S Q;  1YIJ A;  2ID0 A;  1UE6 A;  5IT9 c;  1X55 A;  3KJO A;  2NVY H;  3HOX H;  4LF9 Q;  4A3I G;  2JEA I;  1QVF A;  3HOU H;  4DV5 L;  1N34 L;  3S2H H;  3NEL A;  3E9H A;  4A3M G;  1KRT A;  2ZTE A;  5EAY A;  1SR3 A;  1I5F A;  4DR5 Q;  3S1Q H;  4ME3 A;  4DK3 C;  1KL9 A;  2GN5 A;  3HOX G;  1HNX L;  1V1Q A;  1AH9 A;  3H15 A;  4A93 G;  1OXX K;  1CUK A;  3PUW A;  4PZ6 A;  3UDX A;  5IP9 G;  5M5W H;  1GO3 E;  3GD7 A;  4PMW A;  4X64 Q;  2AMC B;  3CC7 A;  5LMN Q;  1CSP A;  5LMU Q;  2EXD A;  3T1Y L;  1PHJ A;  4IFD J;  4LUO A;  5ELO A;  2NZH A;  1YVC A;  3AQQ A;  5GAE C;  1N36 L;  2KCM A;  4P75 A;  4YWL A;  1TWH H;  1QUQ B;  2K5V A;  4X66 Q;  1VQ4 A;  4GOP A;  3PF5 A;  4LF8 Q;  3LGJ A;  3CME A;  4LNQ A;  1NBW A;  3B6Y A;  3KJP A;  2F3I A;  2VQF Q;  5M3F H;  3T1Y Q;  3D31 A;  4IPD A;  3GTL H;  2IHF A;  1OXU A;  1HZC A;  3CPF A;  1VQF A;  3PIP A;  1N32 Q;  4EQ5 A;  4AQY Q;  1EIY B;  4JI6 L;  4LUV A;  1XJV A;  3UDF A;  5JEA G;  3E0E A;  4X65 L;  2ES2 A;  3I2Z A;  4YWK A;  1OTC A;  5HGQ A;  5C44 G;  2ZJP A;  1VQE A;  1GVP A;  2GVA A;  4A75 A;  1WFQ A;  5IYD H;  4DUZ L;  3CCU A;  4A3G G;  2Q2H A;  2MFI A;  2UUB Q;  2C35 B;  3K7A H;  2UXC L;  2JE6 I;  4LUZ A;  4YHH Q;  4BY1 H;  4L5S A;  2OQK A;  2PI2 E;  4NPS A;  5C3E G;  4DV3 Q;  4JBM A;  1ASZ A;  2VS1 A;  1U5K A;  4ALP A;  4DV0 Q;  3OTO L;  3FKI G;  1HNZ L;  2JA5 H;  1VCI A;  1E22 A;  3KF8 B;  3U50 C;  1JB7 A;  1Q1B A;  1UE5 A;  4JCV E;  2ZJR A;  4DV4 L;  4BY1 G;  1XMQ L;  1IBM Q;  2OWO A;  3RLF A;  1VQ8 A;  4JI4 L;  2KHI A;  2Z6K A;  2XGT A;  2CWP A;  4DV1 L;  4A3J G;  4RG1 A;  4A3G H;  1XNR Q;  1HNW Q;  3GTG H;  5LMN W;  2B3G A;  4MTN A;  4GOP B;  3S15 H;  4P71 A;  2NN6 G;  1OXT A;  4BA1 I;  4A93 H;  3CCJ A;  2I0Q A;  1P16 A;  3M4P A;  1VQD A;  1B8A A;  3K0X A;  4HIO A;  4GOP C;  1YJ9 A;  4YCW A;  5IP7 H;  1XMO L;  2UU9 Q;  2K75 A;  3TQY A;  3S1N H;  2H5X A;  1X9N A;  4RMF A;  4DKA C;  2F4V Q;  2L15 A;  3GTP H;  2Y0S G;  5JJK A;  3FKI H;  2JA5 G;  3RN2 A;  3BZK A;  5M5X H;  1TWA H;  4DAY B;  5M3F G;  1X3F A;  1XNQ L;  1Q7Y C;  3AEV A;  4KHP L;  1A62 A;  1UEB A;  4YY3 Q;  1IBL Q;  3HKS A;  4DPG A;  2F52 A;  3JC6 6;  4DK6 C;  4X65 Q;  1K73 C;  4HIK A;  5ELN A;  4DR4 L;  3AYH B;  3GDE A;  3I7F A;  1VQO A;  3KLW A;  4OWW B;  3HOU G;  1XTD A;  3MXN B;  4A3I H;  4LF5 L;  2JQO A;  3ICE A;  2AKW B;  3FHW A;  1VQL A;  2JJQ A;  2IHE A;  2WP8 J;  3HFZ B;  2CCZ A;  3UE0 A;  2R7Z H;  3PO2 G;  2UXB L;  1E1O A;  4KLK A;  3L2P A;  2MO0 A;  5IP9 H;  3JAM i;  4LW1 A;  4C3H H;  1C0A A;  3CCS A;  4JI6 Q;  3G4S A;  4IJL A;  4A3K H;  4JI3 Q;  4NXN L;  3K81 C;  1IBK Q;  2YU9 H;  3WWV A;  5AJ3 L;  3EBE A;  2JA6 H;  3HOY G;  3CD6 A;  4DV5 Q;  4HJ9 A;  1N34 Q;  3TS2 A;  4JI5 Q;  3PO3 G;  4QL5 A;  4JI1 L;  1Y1W H;  3KOJ A;  1K3R A;  4L5T A;  4DR3 L;  4A3L G;  1E7Z A;  3HOW H;  1S72 A;  1PYS B;  2UUA L;  4LF8 L;  4X64 L;  3G71 A;  2I5L X;  1HR0 Q;  1HNX Q;  3PO2 H;  4DR3 Q;  3BZC A;  5IYC H;  1N36 Q;  1KIX A;  3GO5 A;  4A3F G;  1Q86 C;  3S24 A;  2B63 H;  1K0R A;  2AWN A;  1DGS A;  2PNH A;  4GLX A;  2N3S A;  3RZD H;  4EX5 A;  4A3E H;  3ER0 A;  1WOC A;  2R93 G;  4OX9 Q;  4DUY L;  1BBU A;  1X54 A;  5FJ8 G;  4Y7N H;  1JE5 A;  4QJF A;  3CCV A;  1VQB A;  2F4V L;  3BJU A;  1HJP A;  1E3P A;  2CKZ B;  4J15 A;  1X65 A;  4JI8 Q;  3SGI A;  4X62 Q;  4DV6 Q;  2I5H A;  1NE3 A;  1SRU A;  2MNA A;  1XMO Q;  1N9W A;  1S40 A;  1GM5 A;  4IOC A;  4JBK A;  3HOZ G;  3CMA A;  1Q46 A;  1NY4 A;  2BA1 A;  3T1H Q;  5C4X H;  1QUQ A;  2IX0 A;  1N8R C;  1LUZ A;  1KXL A;  4JI7 Q;  4P74 A;  4HJ7 A;  4LFA L;  1XMQ Q;  4DV2 Q;  1R9T H;  2YYZ A;  1XPU A;  5JJI A;  4YY3 L;  5J3B A;  3PV0 A;  4C3I H;  4DR6 L;  2VUM G;  2R93 H;  4LF4 Q;  3PF4 A;  3S2D H;  4BXX G;  3TEH B;  1VQN A;  2B63 G;  4R4I A;  2UXC Q;  3CCE A;  1CSQ A;  1A0I A;  2JEB I;  1PH2 A;  3A5Z B;  1NJI C;  5HY6 A;  1WI5 A;  3ERS X;  4UP8 A;  4DUZ Q;  2ZTC A;  4A3J H;  1VQ7 A;  4OWX B;  4HJ5 A;  1QVC A;  4MZ9 A;  1FJG Q;  1MJE A;  3UDG A;  3HOW G;  1P8L A;  2KEN A;  1XPO A;  3PUY A;  4LF7 Q;  5GAG C;  1UWV A;  3RN5 A;  4DUY Q;  5C3E H;  2K52 A;  2I5M X;  3CP0 A;  1IBM L;  2ZM6 Q;  4A3F H;  3U4V A;  4DR7 L;  2R7F A;  2WAQ G;  4GLV B;  2VY3 A;  3TRZ A;  2NVQ H;  1MKH A;  4GNX C;  4MNO A;  3RZO H;  4APV A;  4WJ3 M;  4JI8 L;  1SLJ A;  4GKJ Q;  1VQK A;  4DV6 L;  4LF4 L;  4JBJ A;  5IYC G;  2D62 A;  3E9I A;  4IOA A;  2PQA B;  1K9M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...