3FPEA

Crystal structure of mtnas in complex with thermonicotianamine
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
264
structure length
264
Chain Sequence
SCYIYWDKIKRIASRLEGMNYHFDEMDTSGVMPLLDEIEEIAHDSTIDFESAKHILDDAEMNHALSLIRKFYVNLGMKLEMEKAQEVIESDSPWETLRSFYFYPRYLELLKNEAALGRFRRGERAVFIGGGPLPLTGILLSHVYGMRVNVVEIEPDIAELSRKVIEGLGVDGVNVITGDETVIDGLEFDVLMVAALAEPKRRVFRNIHRYVDTETRIIYRTYTGMRAILYAPVSDDDITGFRRAGVVLPSGKVNNTSVLVFKCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic snapshots of iterative substrate translocations during nicotianamine synthesis in Archaea
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Biosynthetic protein, transferase
molecule keywords Putative uncharacterized protein
total genus 99
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03059 NAS Nicotianamine synthase protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3fpeA00
1YF3A 2EG5A 3GRZA 2FPOA 2P3LA 3SM3A 4R6XA 4RTSA 3O4FA 2I9KA 5E2BA 4K6MA 3MQ2A 3PFHA 2P41A 5EMJA 2JHPA 3A7DA 2ZTHA 3NMUF 2NXEA 2XVMA 2AVNA 3BUSA 3F4KA 3HVJA 4KIFA 3RW9A 5IKMA 1OR8A 4Y30A 4OQDA 1NV9A 1ZKDA 2KW5A 3BWBA 2WA1A 2HMYB 1QAOA 2IPXA 2P1DA 1XDSA 4WXHA 3WSTA 3OZTA 3ELYA 3B3GA 4PGHA 5CM2Z 1NE2A 3B3FA 3KPYA 1JQDA 5E8RA 2IH5A 3FTEA 3HCCA 5EQJB 4PIMA 1D2CA 2EJUA 3MCZA 4GC5A 1DCTA 5E1MA 3HA3A 5DRTA 2K4MA 3SVZA 5CCBA 4XUDA 1NT2A 3DXZA 2OYRA 3M33A 4YV2A 5BW5A 4DA4A 3P2EA 5EGSA 4E2XA 4DF3A 1L3BA 2BR3A 2DULA 3KU1A 4LG1A 4X63A 4DCMA 5K0FA 1L3IA 3GJYA 2G71A 1WXWA 4EQZA 1F38A 1I4WA 2XVAA 4PONA 1YZHA 3GWZA 3Q7EA 2BR5A 3GO4A 4RTLA 4M7RA 3HCEA 2YUIA 3LDGA 5EIFA 3UJ7A 3CC8A 5CVUA 2C7QA 3FUTA 4FT4A 4E33A 4V0RA 3R0QA 2VDUE 3RODA 1H1DA 1JQ3A 1G60A 2ZBPA 3EEYA 5HILA 2HTEA 2V7EA 1XDUA 2NYUA 5DM0A 3T7SA 5CD1A 4C03A 3JWIA 3ERCA 4OBXA 5KQRA 2YXDA 3QOXA 3MB5A 5DTMA 3KKZA 2XYRA 1ORIA 3KPVA 4GUAA 3HCFA 2C7PA 5K0NA 1SQFA 1JG2A 1YB2A 3VC2A 3AY0A 2O0LA 2UYQA 4FSDA 2O05A 4BLUA 3KQSA 4RSRA 3DXXA 5DM1A 3MHTA 1Q0TA 4EVIA 4DM3A 1VQ1A 4P7FA 4GOLD 2GB4A 2LD4A 3UJ8A 2I7CA 5DX1A 3LBFA 3KR0A 3SMQA 4GOMD 3OE4A 4AZSA 4DCGA 1XCJA 2PX2A 1X1BA 3QV2A 4QQNA 5CVJA 3KQWA 4R8SA 3KQQA 3V8VA 3FUUA 2PX8A 3DXYA 1QAQA 3OCJA 3P2KA 4U7TB 1QAMA 1YUBA 2YX1A 5FULA 2P7HA 3EVFA 4Z2YA 3EMBA 2CKDA 3I58A 4BY9E 3ELUA 5ICEA 2JH8A 2FYTA 2G70A 4E70A 1FPQA 2JH9A 4F85A 3OZRA 5E2AA 5FQNA 3PLAE 3GRRA 4V0QA 3AWIA 5EHGA 4F86A 2PT9A 1R74A 3R6TA 2GH1A 2UYCA 2P7IA 3OU7A 4XUEA 5EZQA 3B3JA 2ZZNA 5KS2A 1YFLA 2O07A 4C08A 1BOOA 2IIPA 4CTJA 3UA3A 4A6DA 3LCCA 5DPMA 5ERGB 4R05A 4C07A 4JXJA 3M6VA 1TW2A 2QYOA 3I53A 5EG5A 4YV1A 2VDWA 4LWPA 4GOND 3GDHA 3UJDA 3FZGA 4QPNA 3U81A 1HMYA 1N7IA 1XVAA 4BP3A 3LL7A 5GOZA 5GM1A 1D2HA 1G6Q1 2AOWA 3TQSA 1BC5A 3HVKA 1ZQ9A 5DWQA 2ZIGA 1KHHA 1INLA 4MQ4A 3FPGA 4PGGA 1AQIA 2FCAA 2ZBRA 4F84A 4PWYA 2ZZKA 3EGIA 3LDFA 1UWVA 4FZVA 3UFBA 3FUXA 2HR1A 5CVEA 3MERA 3M6XA 4OA5A 4AZVA 5CCXA 2AN4A 5E8JA 3T7TA 2QRVB 3EEOA 4RVDA 2FRXA 1JQEA 2AOUB 1O9HA 5EEGA 4BLVA 2JG3A 2PJDA 5F2KA 1RJFA 2VP3A 4FSXA 1SUSA 2PWYA 1JTFA 1YFJA 2ESRA 3BZBA 3GCZA 1VP9A 3KQPA 5DT2A 5EMKA 5LQKA 3C6MA 4OBWA 5FHQA 5H02A 2IDJA 2YXEA 3G5LA 4IWNA 5DXJA 2ONZA 3TRKA 5HIKA 3HA7A 2EJTA 3C6KA 3DUWA 1UIRA 4E31A 3TOSA 4QQKA 1G38A 2JHAA 1JG1A 5GIPE 2AS0A 2V74B 1SQGA 2QM3A 3CBGA 5C1IA 5K0BA 4BLWA 5CIYA 3UZUA 2P3QA 4HTFB 3EGVA 2P40A 1QZZA 2EX4A 4FS8A 5F2NA 4HTFA 2Z6UA 3M70A 4H0NA 5GP1A 2OXTA 4MHTA 5LQNA 3CCFA 3DP7A 2QRVA 2BH2A 4AZWA 3MGGA 2NNWB 1HNNA 3NWEA 5BXYA 2PV0A 3PVCA 4QVKA 3H2BA 1JG3A 2PX5A 5EMLA 5P8WA 2ADMA 2PT6A 3BWYA 3HVIA 1X19A 1RI1A 3HCBA 4GQBA 1T43A 1BKYA 2XYQA 3GRUA 3E7PA 3GRVA 4RWZA 3G2OA 1M6YA 4RTJA 5EZSA 2AOUA 4KRGA 4ER7A 2GA9A 5FTWA 1R6AA 1O9GA 2EFJA 2O57A 3FPFA 4R6WA 3I64A 4X41A 5ICFA 3VC1A 5LQUA 2IH2A 2XYVA 4AX8A 3LECA 3NTVA 1KPGA 4YV0A 4CWAA 1RI5A 4M38A 3BKXA 3CKKA 4Y2HA 5GM2A 3JWGA 3NWBA 1MHTA 3ANXA 4BP1A 2OB2A 2Q41A 3PX3A 4FR0A 3BWMA 3NVMB 1KR5A 1NW3A 3G8BA 3LHDA 5DX0A 3ELDA 1N2XA 4L7VA 5EOVA 3C3PA 3VYWA 4DQ0A 1WY7A 5C0OE 2H00A 1KIAA 1P1BA 3BKWA 4UOEA 2FHPA 2ZVJA 5K09A 5FA5A 1P39A 2QE6A 3JWJA 3TKYA 3SGLA 4RTOA 1UFKA 3T7RA 3ME5A 3FTDA 4AZTA 3I5UA 1JG4A 2YR0A 1PJZA 3LCUA 4X60A 5D1NA 5E9QA 2CMGA 1Z3CA 1NW5A 4GOOD 3NW9A 5FADA 5HIIA 4GEKA 2Z6AA 5C9ZA 5K03A 4WVLA 3ORHA 3L8DA 4LWOA 2UZ4A 4PCLA 2YXLA 2OKCA 3DMFA 1IY9A 3LCVB 3LKZA 4QDKA 4PCAA 4YMHA 1XJ5A 3A7EA 3HP7A 3PTAA 5GIOE 1EG2A 1AQJA 2IBSA 3MTEA 1ORHA 3CJQA 1KPHA 1F3LA 1X1DA 3KQMA 2WA2A 1VIDA 4A6EA 5DSTA 2IH4A 4ER6A 4ZTBA 5K0EA 5DX8A 2I6GA 1NKVA 1YZ3A 3DLIA 5DRYA 3NJRA 3E8SA 3FPHA 4QTUB 5KYGA 2ZBQA 1KYZA 2AOTB 3EMDA 5FHRA 3KQOA 4CKCA 1RJGA 5T64A 5E9JA 1SKMA 1KYWA 2PBFA 3KPWA 1KXZA 2OPBA 2C7RA 3G89A 5FA8A 3TMAA 2BM8A 5GINE 3IYLW 2QY6A 4P7JA 4RTRA 1DL5A 4RTKA 4MIKA 2ZWVA 4HG2A 4C06A 2CL5A 3G7UA 3UJCA 1WS6A 4PYOA 5KQSA 4LECA 5EEHA 4OQEA 3G5TA 2VZ9A 2PSSA 3M6UA 5EKUA 5E1DA 5DTQA 1L1EA 4G56A 5LQAA 4E2ZA 3P8ZA 2P35A 3K0BA 3OE5A 2H1RA 3K6RA 4DMGA 4CXMA 2B9EA 2XBMA 4E2YA 4ER3A 3FPEA 4PYKA 1AF7A 2GS9A 3HM2A 1N7JA 3CVOA 3T0IA 3G2PA 3OU2A 1L3CA 2NXNA 4PYNA 2PGXA 3P9IA 5EKXA 2OB1A 1P1CA 3HCAA 2I62A 3Q87B 2AOXA 4GF5A 2NP6A 3G88A 5K0GA 5EC8A 1RI3A 2ONYA 4RTQA 4GBED 3FYCA 3LPMA 5T67A 3EVDA 3IV6A 1M6EX 1FP2A 3P97A 1NBHA 1TPYA 4POOA 3KR9A 1ZG3A 4QPPA 1ZHFA 3SSNA 5HZMA 3GIWA 2ERCA 4QDJA 5D1HA 5DM2A 3HCDA 1VLMA 5EHIA 3EPPA 5E1BA 2OO3A 4KW7A 5EVJA 3SSOA 1U2ZA 1EQAA 1RI4A 3NDJA 4HSGA 4PIPA 4CKBA 3DH0A 2BZGA 2BR4A 3LBYA 4X61A 4ISCA 3UBTA 1NW7A 3SR4A 2B78A 3LGAA 5K05A 2YVLA 2PXCA 5CVVA 3E05A 2IBTA 1P91A 4RYLA 2OZVA 3G8AA 5HIMA 2Y1XA 2YQZA 5LQJA 5B1SA 5MHTA 2IFTA 2ZULA 2E5WA 4GC9A 2ZIFA 2AR0A 2PXXA 1V39A 4IV0A 5ICGA 10MHA 5LR6A 2GAFA 3FYDA 4QTTB 3UA4A 3SX0A 2H11A 3OFKA 4P7GA 1PRYA 2OY0A 3JWHA 2NXCA 4X1OA 2ZSUA 3BGVA 2JJQA 3ELWA 3P9KA 4AUKA 3GRYA 3QOWA 2N47A 4C04A 1IM8A 2CMHA 1VL5A 2AVDA 5HOQA 4YUXA 5K0JA 2G72A 2IP2A 3A25A 1R00A 2Z6QA 5K0LA 2F8LA 5FCDA 4PYQA 3TFWA 1G55A 4DKJA 1JTEA 3MCTA 3PB3A 4IV8A 2R6ZA 1EIZA 4RVGA 1JR4A 3KPJA 2B2CA 4YUVA 2A14A 3FUVA 1FBNA 2GLUA 3CGGA 5EMMA 3EVEA 5K01A 3KR2A 3HEMA 2IDKA 3RIEA 1EJ0A 2PY6A 1EJ6A 4RTNA 3BT7A 4MWZA 3SSMA 4RV9A 3UJBA 4PNEA 4OX9Y 4ER0A 2AZTA 3EVGA 4HGYA 1D2GA 1QANA 2AN3A 2PWPA 3BWCA 3DOUA 4ER5A 2G1PA 1I1NA 1X1CA 1XXLA 1X1AA 3DULA 4R8RA 3P71T 3M4XA 2C7OA 1IXKA 3KPUA 2P8JA 5KVAA 2B25A 2BM9A 3AXTA 4KWCA 5DM4A 3UWPA 3BXOA 5T6BA 3HVHA 1FP1D 3GXOA 3ID6C 4MTLA 5HFJA 3C3YA 1NW8A 3NVKI 3REOA 3EVCA 3P9NA 5BP7A 3GU3A 3THSA 5DXAA 1TW3A 3EVBA 1R8YA 1RJEA 3FRHA 2NP7A 3MAGA 3GGDA 3OFJA 2YTZA 3R9XB 1R8XA 1NW6A 2PXAA 3UJAA 2ZCJA 2AOVA 3G2QA 3KQTA 5LQRA 4KIGA 1ZGAA 5BW4A 4E30A 2UYOA 3PT9A 4B17A 3D2LA 1B42A 4PYJA 3DTNA 1QYRA 3KQYA 4FT2A 2PKWA 3O7WA 4RVFA 3FTFA 5FUBA 3A26A 2AN5A 3UJ6A 1WZNA 3HA5A 4OA8A 5DLYA 4CTKA 2JHCA 1FJXA 1VPTA 1SVUA 1G8AA 4CKEA 5CUQA 2VDVE 3HTXA 3LX6A 3DMGA 5IH3A 4QVGA 2HNKA 4EK9A 3FTCA 1Q0SA 5E9WA 1O54A 3LDUA 4YUZA 5JR3A 5JUWA 1SG9A 3FPJA 1L9KA 3MTIA 4EKGA 3FRIA 3ER9A 4RTMA 3TR6A 5CVDA 1XDZA 1XTPA 4E32A 3B5IA 3AJDA 2DPMA 2ZLBA 2HV9A 4XUCA 5DSXA 3CJTA 3LSTA 3AXSA 4KDCA 5GWXA 5M5BA 2ZZMA 3TPZA 3E23A 2P3OA 3DR5A 3OPNA 3A4TA 3THRA 4P7KA 3C0KA 3TM4A 3IEIA 4PYIA 7MHTA 3DLCA 4YMGA 4EMSA 4RVHA 3TKAA 3KHKA 3OU6A 3P2IA 3DMHA 4RX1A 4E2WA 2IGTA 3BGIA 4KDRA 3GNLA 1RJDA 1Y8CA 3PX2A 3PFGA 2O06A 1WXXA 5G02A 2B3TA 4PYMA 2UYHA 3FUWA 3VSEA 1KP9A 4KVZA 9MHTA 2PLWA 1NBIA 3BGDA 4O29A 4YUYA 5DTRA 3S68A 5FWAA 5ICCA 3B7PA 2ZIEA 1M0EA 5FQOA 3TM5A 4PINA 4M37A 1ZGJA 3LKDA 4HGZA 2WK1A 2FK7A 4HRAA 5FWDA 5HIJA 2VS1A 1G8SA 1JSXA 2PX4A 2Y1WA 3OZSA 3SXJA 3X0DA 3PS9A 2ORED 2GPYA 3R3HA 1VE3A 4XCXA 4PYLA 2OBFA 3I9FA 1DUSA 2PVCA 5K0CA 3KQVA 4EKIA 5LSAA 5LQCA 4RTPA 1SUIA 5U4XA 4ATNA 1EAMA 4M36A 4C4AA 2CWWA 3NDIA 4FP9A 1MJFA 3IHTA 4FGZA 3O31A 1I9GA 2ZFUA 1RI2A 4HC4A 4IKPA 4DZRA 5F2OA 1VBFA 2G8NA 1BHJA 3P9CA 5HEKA 4C05A 4P58A 5EIWA 3V97A 4YUWA 3M6WA 5E1OA 1WG8A 1XCLA 2ZW9A 3EGEA 3A27A 5K8VA 3ER8A 1R18A 2ZWAA 3HNRA 3R24A 5EPEA 1AV6A 2R3SA 8MHTA 1NV8A 3B89A 3CJRA 3EVAA 2AOTA 3G2MA 2NXJA 4HH4A 1KPIA 1VP3A 3UJ9A 4U7PB 3EVZA 3KR1A 2HWKA 4NECA 3TLJA 2FK8A 1JSZA
chains in the Genus database with same CATH superfamily
2XRMA 4J1SA 4M0UA 3NX4A 1AXEA 1E18A 1X92A 1KEVA 4E03A 5JCJA 5A03A 1QTIA 3H5LA 4OXYA 2IF2A 4RTSA 1HLFA 1RFGE 1T36A 5BSGA 3RT7A 5BSUA 3ZZ1A 4ZK2A 3GDOA 3KFXA 1KNQA 2QYTA 3W4IA 2O2ZA 1SR8A 4ZEMA 4IOKA 4Y30A 4Z8XA 1KFEB 2ATCA 4JT9A 5CYOA 1S6YA 4HDMA 1E1QD 1ULSA 1ZRNA 1X2BA 4TKVA 4EY4A 4RIEA 5JJCA 2IH5A 1AMOA 3E82A 4OY3A 2PEYA 5HKAA 1ODKA 3M89A 3SCZA 1F0YA 2DPYA 1JUDA 2FCRA 4Z86A 1Q1GA 4Q66C 4CTMA 2EYUA 1UEIA 1TE2A 2XXAA 5AVSA 3VO1A 4I3HA 3G2JA 4C4RA 4X90A 1H22A 1GNQA 2ZUUA 2WY2D 4O4LF 2A57A 3EVTA 3DE5X 3BHMA 2B8WA 3I1IA 3K0KA 3H9GA 3A2NA 2CV2A 4XWTA 2R8PA 2GZHA 3LDGA 1IULA 5FLEX 2X77A 4ONEA 5E9AA 5B1IA 4ZDIA 4DLUA 1RXSA 2GM3A 3PCRB 3ESBA 4NC9A 3PXGA 3RODA 4CG1A 4UU1A 4DJJA 1BDIA 3AESA 1O4VA 2NYUA 2YBDA 3ZBQA 2RKWA 3SF0A 2P4EA 3TQIA 3IQWA 4FYHA 4MB0A 1ZUNB 5CPFA 3P26A 2PQ0A 2I3AA 2R5WA 1M7HA 5SYNA 4UBMA 821PA 2PZEA 4O25A 1YDGA 4URVR 5IHXA 2Z2JA 5H81A 2O0LA 2FZVA 2HT6A 1OFHA 2VQDA 3TK1A 4BLUA 1PEDA 2V6GA 3G17A 1RXIA 3OM8A 4XDHA 4MR7A 5DM1A 2Q8NA 3AQ4A 4YAIA 4P7FA 1PS0A 3TSYA 3KJZA 4DLVA 4V39A 1YC2A 3AEQB 1M2WA 3KR0A 2W22A 5T7BA 3GLUA 4HBZA 4B6OA 5L6MB 5GJWC 3KQQA 4RIFA 4H6VA 3LJKA 2G1UA 3DB2A 1F7VA 1U0RA 2UYYA 1Z56C 2C59A 3ORYA 4HLUA 4PXYA 1YUBA 2DWPA 3H9CA 3IPLA 1J00A 4JQCA 5CT9A 3VAYA 3RLFA 1GITA 2V7PA 2YCLA 1UEJA 1V8BA 1VRWA 4P86A 4X85A 4QSHA 3QP9A 4IY1A 4LOHA 2WMDA 4TXHA 5HIAA 2BZ1A 1BXRA 4WNIA 2I1QA 4BMYA 2AJDA 4WMLA 3K1AB 3KVVA 3UK7A 4KLNA 1XVVA 2PRZA 4PG8A 2P62A 2VTKA 4RXUA 1L4GA 3R7BA 3PNSA 1X86B 3WRXA 5BWLA 4UZEA 4ZCTA 2HA4A 4PBTA 4GYJA 4AZ3A 1QGED 4MUMA 4AJ1A 4FFDA 1Y4UA 4PZ9A 3UT0A 3Q5EA 2BGLA 4LWPA 4EGQA 3PEFA 2PRYA 1D03A 1C30A 1ILWA 4LJLA 2Z4RA 4ACBA 4AKIA 1T5HX 1E9SA 1VSVA 4AKGA 1LJLA 1WHSB 2WYVA 4D4LA 4H3KB 1O8BA 4B31A 4B3FX 5HS4A 4AULA 1OB2A 4LY6A 3Q3VA 1EVYA 4G85A 3MTQA 3FVVA 4M83A 4MKRA 5IKEA 3KYCB 2OT3B 2VWPA 2ATVA 3K0CA 2FCAA 2AJCA 5TQ0A 4CFZA 3AJ9A 1ND5A 1FXWF 3OO1A 4RSHA 1J8YF 4P84A 4RJKA 4UM8B 2HIAA 3SS8A 5CNJA 3M6XA 3DPIA 4GI1A 4XCQA 5I5GA 2HMUA 3UOAB 4RVDA 5IJZA 1L9XA 3L6BA 1XK6A 4AF8A 4QBKA 4U7HA 5FPKA 3Q2IA 5AVYA 3C3WA 1X7DA 5DT2A 3L06A 5KU1A 1PR9A 3I62A 5FHQA 1TNDA 1S89A 3THXA 2GN9A 2IDJA 4IIXA 3PFIA 1SXPA 2HYIC 2DTEA 1VGVA 2ZRFA 1KJ8A 1WL8A 3BK7A 2BDUA 3MCAA 1N78A 1FSFA 2VDMB 4B82A 2HTFA 4XEHA 4O02B 2DPXA 3FUCA 2G1AA 2AS0A 3G0OA 3OQVA 1XD9A 4ENRA 2MINA 3ROXA 4HTFB 3C74A 4HTFA 1SCAA 5AIAA 3U9SA 1PU2A 2B4RO 3E22B 4RD1A 2C7VA 3EWNA 3JVIA 1JKJA 2XVXA 4MB6A 3LC7O 4OGFA 2ID7A 1ZFNA 1Z5WA 4G0XA 5JTUA 3KCQA 1X6VA 3LF2A 1DKLA 3FETA 3QU5A 5K3EA 5ALVA 2FW1A 1N5JA 2ZYVX 1A95A 4BYGA 5F3DA 3HB5X 1R6BX 4HDRA 4WCFC 2VHQA 3DE1X 5KTPA 2HJRA 3L7JA 1JPUA 2LRHA 3C1AA 4UNSA 3NBUA 2A30A 2BBWA 1DS6A 5LNK1 3O8DA 1GNTA 1Y6RA 4EYGA 1NBWB 2B30A 4HZIA 5EIBD 4KPUA 1R9JA 3LPCA 3ZXYA 1O9GA 4MUXA 2ODBA 4OI4A 1GA1A 2VUUA 3VC1A 3P52A 4BMOB 4B35A 4CM7A 2F64A 1DPGA 4DUZB 1EBBA 2H54A 2LUOA 2ZRGA 3CEJA 3PUIA 5GM2A 1LTHR 5KQLA 1VPVA 1CVLA 2YWRA 3JWGA 3JZMA 3E9CA 4IYJA 3WBBA 4P0QB 1J5XA 2HDHA 1A1SA 5I3ZA 4FIDA 4BP1A 1JECA 1K08A 2OB2A 4JLWA 4IZ6A 3D6FA 1E58A 1HDOA 1U3GA 3FWKA 4IMIB 5BUZA 1JLKA 2A6PA 4PLHA 3Q0TA 1OYOA 4ZYYA 3PJRA 1P5ZB 4IILA 4G1VA 3N8NA 1A97A 4FFPA 4ND2A 3WQHA 1ZRSA 3R1IA 1Z08A 2FF5A 4ITRC 2C2HA 3ZHSA 4HDNA 3FJOA 4HH1A 3C85A 4ERXA 1E7YA 2GOYA 2CBGA 1ZESA 5M7EA 3PTZA 5K3CA 5CDFE 3IAFA 5A5DA 3K1AA 3U49A 4II3A 2OENG 3OJOA 4WLOA 1A71A 3FW1A 2R5FA 1C0EA 3VJMA 2ZYIA 4Q7EA 2ZKLA 4LCBA 3E84A 4WKNA 3KXDA 5FADA 4KITB 3PDHA 1GU0A 2GARA 1EB8A 5M34A 2CNLA 1PGPA 5CHEA 3DMFA 5ALPA 2W4MA 4R41A 3HP7A 4C76A 1WKVA 5GIOE 3H2KA 3M83A 1H1LB 1K6MA 2VYND 2Y76A 4X24A 4KWTA 1TA4A 3AC0A 3HP4A 3O3OB 4HAWA 4K9MA 1KFCB 4RD3A 3GDFA 1NJFA 1JU3A 3EB9A 2FP4B 4QHTA 1ISMA 1NUPA 3N58A 3U26A 3PWZA 1GRVA 4R01A 3LO8A 3NJRA 4AMVA 4QTUB 3QBTA 3ZLUA 4HZUA 3UH0A 1QLHA 3U48A 2ZIAA 1W52X 3WGYA 3D5TA 1Z6AA 2OQVA 1IZYA 2WP8J 4W1SA 4LF6B 5HK8A 2EKLA 1Y6GA 1TO2E 3L7BA 3QNWA 3LOUA 5EVCA 2IOFA 1KXZA 4J0IA 2OPBA 3AM1A 5IRCD 4G0VA 3NBXX 2BM8A 4YPFA 4PC6A 4ZD6A 1GYQA 1ONSA 4HNVA 2XR1A 3OOEA 2VJAA 5FFNA 6YASA 5CB8A 1UZMA 1NOIA 5KHAA 1MDFA 4PYOA 3JQGB 3ETGA 3ZQ6A 4LJ9A 2GK6A 2GF9A 2Q1WA 5FORA 4DR5B 3HLYA 5KYYA 1IRIA 4ETNA 1PDOA 3K2IA 2OHXA 1OHHD 5ALWA 4DG5A 4TX1A 4YWJA 5KYNA 4TMKA 1DKNA 1MOSA 1GUAA 2VRBA 1S7GA 1VDMA 3HM2A 4RE5A 2FAXA 2P0AA 2EL9A 1DAMA 1RRCA 2IZ6A 2PGXA 5CEJA 1AKWA 1X7WB 4AROA 1N57A 3QE9Y 4FDMA 3NJ4A 3JPYA 3VR5A 4R1OA 1XWIA 1RI3A 2HCJB 1MNQA 4P4LA 4WXRA 1KDZA 4AS1A 4OQNA 3L0DA 3ROMA 4CMIA 2B94A 2R2GA 5C1BA 1H8ED 2IGBA 3IV6A 4FKMA 3P97A 2ZRLA 2BIFA 1FDTA 1MXFA 1ZG3A 1ZHFA 3LSYA 4K40A 2ERCA 4QDJA 1IN5A 3ROTA 4UVEA 3ZIUA 4BTLA 1XAGA 4B4KA 2VJDA 3ZHZA 1GFZA 4OFBA 1NW7A 2YFYA 2YVQA 4UATA 1T4CA 4JSTA 3HKDB 4D4JA 2YVLA 2Z3VA 4NK5A 4BMPB 9GPBA 2I4OA 2JAOA 1LLUA 3ITEA 2AC7A 4J3JA 2YQZA 3I92A 3QUSA 2IFTA 2XKKA 1K1EA 2XQIA 1LKZA 1M2OA 3AEZA 1CY6A 1KOJA 1ZIOA 4MLPA 2WTUA 3O9VA 1LS6A 1Y3BE 2AA3A 1VIYA 4WLUA 1J20A 1UK9A 4LC1A 4ZYTA 1BQ3A 4EG6A 3GRYA 1LTQA 1Q44A 1YL6A 3EFBA 3PD7A 4M53A 4PX3A 3ORQA 2H7XA 2CE7A 1A2OA 1KO7A 2Y3IA 2FN8A 2XB6A 4TTAA 3MFYA 3X1JA 4GLBA 4CDNA 1EFTA 1CWUA 4CLEA 5CYPA 2PM8A 8OHMA 3SDBA 2ZT5A 3IMKA 5B53A 2B2CA 4B3XA 1UK8A 3GC6A 3WLKX 4XIFA 3U37A 3EPHA 2QAGB 1G2OA 3GVCA 1EJ0A 1CULC 3N05A 3RIEA 3FSGA 4OBEA 4IICA 4ZZ2A 3EXIB 3TL2A 5A62A 3THXB 2C07A 2BKXA 2OHOA 3BMNB 4QUGA 4OX9Y 1E2FA 3SEZA 4HGYA 3SF8A 5COBA 3RKRA 5IABA 1PVOA 3L07A 1TZCA 1Z0SA 5EGNA 4CF7A 2FUKA 2BE7A 3QEMA 1AQNA 4LBWA 3TLZA 1RC8A 2ZI4A 5A5VA 1KJWA 4Q02A 1LU9A 5KOJB 2WTXA 4R2XA 5A3SA 3WK4A 2IHKA 1PLJA 1J1UA 3WMFA 2YJ3A 2P11A 5KJCA 3P9NA 2E2WA 2QGFA 3C1OA 3H5OA 4Q3OA 1HRDA 4URZR 1BD3A 1DO8A 1R8YA 4HSEA 3VSCA 2Z6VA 1GKKA 4D0RA 3G13A 5AW1A 5BWNA 1EMDA 2AH5A 3UJAA 4F6RB 4D25A 4BWVA 1GG2A 1ZEJA 1YB5A 5J4YA 1ZGAA 1TGYA 1H93A 2CHGA 4B17A 4F7WA 4D46A 4PYJA 2NU9B 3ZDZB 3WTBA 1HDYA 4XGRA 4Z9YA 3PGLA 4MWSA 2Q4BA 5DYNA 4P22A 4B75A 2FPUA 5F1KA 3TQTA 1VMIA 2GK7A 4IKEA 1KFKB 2P77A 2ZJ7A 4I55B 2X4GA 4CQMB 3IE2A 1RZUA 4DA7A 2IXAA 3OPVA 2FWPA 3RF6A 2P1RA 4LVUA 4MYCA 2B5VA 5IBPA 4HAXA 4X6YA 3AZPA 1AUXA 3FTCA 2RGEA 4NCJA 1CY7A 1EVZA 1Y7HA 1THGA 3FPJA 4KBGA 2ASVA 2ZB3A 2YVKA 2C1XA 1O94D 3TSAA 1DIAA 2X6TA 1JP7A 2IV7A 4O4IB 2Q6VA 3F7MA 3PP8A 4LOIA 5JS1A 4PV7A 1AJEA 2GNPA 2QU8A 3F6EX 2D4AA 3RUCA 2V54A 3TM4A 3L0YA 1MC8A 1JQBA 3BCRA 5AVUA 3IEIA 4FB4A 3AT1A 3GNTA 1DC7A 4Y6LA 1CQPA 2RSLA 3A2MA 3A1UA 1VCMA 5TPZA 3ZD9A 4ZHQF 5J47A 4QC2A 4Q9NA 2IGTA 3KP1A 4K6CA 4YXFA 3WHIA 1PT9A 4PSKA 3QG5A 3LC1O 1ZA1A 1PUXA 3L92A 3BTOA 3FGPA 3LO5A 4RKEA 4PYMA 1Z4KA 4BX2A 5CA0B 1B7GO 2COUA 5ALZA 1DNPA 1V5WA 2XTMA 4DSAA 1ZK3A 3S2UA 3SR3A 3D4PA 4N5NA 1JJ7A 4FUTA 2HZBA 3HNOA 1O89A 2ANCA 2PZAA 2XNHA 3D2BA 3MRXA 3RFUA 4TL6A 4Q1FA 4N7MA 3K8ZA 4WA7A 4ARSA 3P9PA 1RWWA 1ECCA 2LR0A 5AM5A 4X71A 2BGUA 4EG1A 4O3FA 3TSZA 1NUHA 2Q0XA 4G65A 1YIOA 2Q07A 4L9SA 4NZPA 3F5DA 3DHVA 4BQIA 5HRUA 1CUEA 2R97A 1MGOA 2WLTA 1Y63A 2YC2C 3A1EA 4V24A 2OBXA 3NO4A 2RGAA 4LHVA 1K68A 4LXIA 2AMVA 2MIIA 2P78A 3O4HA 4LKRA 1GRQA 5EJFA 1VMDA 4BMNA 4C05A 1EGAA 5G0WA 3ZE9A 3HKCA 3RBAA 1ZMOA 4DLYA 1VG9B 3OQPA 4U6NA 1XZDA 1M8JA 4PR3A 1QKJA 2CUNA 2ECQA 5EFZA 3SY8A 5K8VA 3OIFA 5JASA 1HTTA 3SVLA 1EFVB 4OQZA 3CN7A 3EVAA 3MJCA 2J45A 2OMEA 1DMRA 3COWA 3ZK8A 2PMDA 1XU7A 2I3GA 3DEZA 1ZJWA 3KR1A 2W6NA 4Q3KA 5ECGC 3RADC 4QT4A 3DVLA 4NMWA 4GLOA 4TV9B 5KQMA 2OORA 3A1SA 3M81A 1Y82A 5I4BA 2VCHA 2Q46A 3ZHOA 2DFTA 4EHAA 2FPWA 5TGDA 1JLRA 4AF6A 5H3CA 2Q3FA 4MOWA 4J2OA 5JATA 4K6MA 5MFZA 1U9IA 1QH1B 4CMKA 3ANTA 2NWQA 2Y99A 5J5VA 3E4DA 3IUSA 4UNRA 2RHRA 3F4KA 4XAQA 5IG2A 1VGRA 2E48A 3KVOA 5IMBA 2AC2A 2O8FA 1JR2A 3TW0A 4F97A 1W1UA 5B6JA 2WG0A 3JRWA 2YL2A 2Z0MA 3ELYA 4XLLA 4X20B 4YPOA 2H0QA 2EX1A 1JQDA 4PZLA 4G4SP 1VJRA 2W4QA 1VL8A 4I4IA 1U0HC 1PSDA 4FKZA 2K7FA 4KQFA 5EESA 1Z5PA 3T5TA 4N8DA 3VZQA 1FRQA 1YRHA 3TWOA 5JI3E 3EX7C 2ZI5A 5DN6A 1PNQA 3GAAA 4XD2A 1VMEA 3K31A 3O0DA 5SV2A 4V0KA 3GG9A 3PXAA 5E7QA 1IJEA 5BVHA 5K0FA 3BM5A 4IWXA 4TVOA 1W85A 3RU3A 1M2GA 3I9JA 3QVJA 1YS4A 4KO4S 1M0TA 3F4BA 5LIRA 2OD7A 2EKBA 3GB9A 5JD3A 4HWPA 3R9IA 5FUMA 3B78A 1QQ7A 3INRA 5LP6A 3I8SA 4ZCQA 2TMKA 3WYEA 2BR5A 1ZP6A 3MD0A 4IDQA 4O0MA 3BJZA 4QPDA 4JHXA 4CKBB 3MJVA 4Z5XA 2NMVA 1J22A 1J2TA 1K2WA 2VDQB 4MWBA 3RSQA 3K2EA 2Y68A 3CC8A 3WLMA 4I50F 1Y0BA 2H4XA 1U31A 4ZOCA 3Q88A 3ZV4A 1WIWA 5SYMA 4E33A 4EY6A 5HILA 1KBZA 1XDUA 1RTKA 1QORA 4WT7A 3ZWAA 2YV1A 1O8CA 4C03A 2WAXA 3CM0A 1Z4NA 3K9BA 4C43A 5HUJA 5HG0A 1OIVA 1ORIA 1EGHA 5LA6F 4FXOA 4CLHA 1DBVO 2V4UA 4AMZA 2VZ0A 3M2PA 1IBLB 2ENUA 2FP3A 5AW8A 1JDVA 4H4DA 2YHIA 3LGSA 1Z16A 2W2NA 3H9EO 4J0QA 4JBXA 3TZ6A 5LOVF 3CW2A 3FMFA 3CKMA 2JGKA 2JARA 2VPXA 2F17A 4M0KA 1ZVKA 3PHCA 3CX3A 1GZVA 5B2EA 4YCMA 3ANSA 4UBKA 1FJGB 2PX2A 2Z08A 4ZT6A 4R8SA 5K3AA 3N2KA 4NZMA 1XTQA 4HXEB 2PX8A 5CT5A 1KVQA 3ZKAA 1WMBA 1G66A 3SKXA 3LUKA 4NMLA 2H48A 4U7TB 2O8BB 1KI7A 4RGYA 4TYPA 1C4WA 5HW0A 4WZAE 2VNAA 1NU8A 4L2IA 3JQ7A 1G6HA 4RZHA 4CIXA 3RTAA 1A9TA 4II7A 1KJJA 2QVGA 1XCBA 3ZGNA 1G6OA 5CDHA 1UOQA 3CSUA 4CMBA 1QCZA 1FZQA 3FFBA 4LQLA 2W0MA 1V3QE 2OPHA 2P7IA 3LVQE 3NYIA 3AIOA 4IX9A 4D0GA 5ALGA 2EEZA 3GCDA 4BLQA 4A27A 4C08A 2JJ1D 2JH3A 3QUAA 1U2RA 4WZBA 5B4TA 3I4FA 3GR6A 1NI3A 1XLUA 1JS1X 1AV7A 3NAGA 4JAVC 4RMGA 1QRRA 1KYQA 3CRNA 3KYDB 1DRWA 4Z4FA 1J0DA 1GPAA 4WCVA 3UUFA 1Q50A 1DDIA 5SY4A 4K2AA 1TU4A 3QELB 4IDPA 4BCDA 4CU2A 5GPBA 1W6RA 1NZDA 3L4BA 4ZVKA 1T5BA 5A0VA 3QPUA 3BHIA 4LK2A 3M9WA 3Q12A 3PRHA 4B71A 4LXUA 1CIVA 1KHHA 3IIMA 3KSMA 4AI6A 3OCYA 4QTYA 4N5HX 2YNMD 2VO1A 3UMJA 2XUFA 3C1TA 3QA3E 1QCYA 4JA2A 2I2WA 2AN4A 2IDMA 2QHXA 3KVNA 1SIBE 2CDNA 2VYVD 5EEGA 4GL2A 3JRXA 4M0CA 1RZVA 5AO9A 3WDMA 1IWBB 1DBRA 1CEXA 2LE0A 3ZS8A 4B6EA 3HO6A 5EMKA 1L4FA 1SOVA 1L7EA 5K6AC 1F9EA 3AKEA 3IJ5A 4G6ZA 4B73A 4E2FA 2NXWA 1W5FA 3CQ9A 3D7MA 4TLCA 2AYYA 3FB4A 3BF8A 3ZWYA 3GD7A 4MMZB 3WAKA 3KEGA 3VBEA 1CQWA 2PNJA 2F4NA 3FPKA 4J0FA 1Y8RA 2I71A 1LBQA 3H5NA 3NCTA 3JYNA 3V32A 5KOHA 3PCXA 4NIMA 5DOVA 2XOKD 4BLWA 5J2UA 1C0IA 3K1JA 2V4ZA 1MTOA 3ZIDA 3RPEA 3UJHA 5ARBA 1YS2X 4FCVA 1EUDA 2F1KA 1WU7A 4LVCA 3R40A 2H16A 4LQDA 1L7DA 4H0FA 3RASA 3X2EA 5ERXA 4YRIA 2WQ6A 4OJKA 1GTSA 3H05A 2P9QA 2JAUA 4PHHA 3WS7A 4R8VA 1TRKA 3OZVA 4RKYA 1C2YA 4B6SA 5IMSA 2NG1A 5FBHA 2H3EA 2IBMA 3HCBA 1KQNA 3E7PA 1EK5A 1NN3A 2C92A 3D5QA 3G9XA 3LXUX 2X0DA 1FDOA 1MPTA 3K09C 4F21A 1N36B 1TD9A 3A9CA 5BWBA 1R6AA 3P9ZA 4NP6A 1QG6A 3U4QA 1G4HA 3AFOA 1Z9BA 1SKYB 1AY0A 1ZJYA 1CUZA 4YV0A 3N7TA 3CG0A 3JS5A 3LLUA 1RI5A 4B2IA 2F9LA 3ESRA 1W1IA 5AM3A 2RAUA 2YIDA 1RPNA 4FFOA 3D8RA 2O8EA 2RE8A 1M67A 1RC0A 2EW1A 4PC7A 5EP2A 5TQ2B 3X1WA 2R86A 5TT1A 5FIUA 3DNPA 3RIGA 3HBMA 1SB9A 5BR1A 4OK5A 1KKLA 3IDZA 4QUJA 1P44A 1E79D 2G9RA 1V8DA 3M4NA 2GQ0A 2J09A 4GRDA 2JF0A 4WAUA 3EZ7A 4BC1A 3SQMA 2WWYA 1JFRA 4HEA1 1MEEA 2GEJA 2ILVA 3TUJC 4EG5A 5JEEA 2FX3A 3B3AA 4XVRA 4B7UA 3JTEA 3UY4A 4RSGA 3IQGX 4EZIA 3K9LA 3NHZA 3ADPA 1UFKA 1N75A 4RTOA 5GZ3A 1I2ZA 3FRJA 1TMOA 2ORIA 1F60A 2R48A 3RC1A 4RPIA 2C2BA 4DMUB 2BFEA 5ITWA 2NVUA 1Z3CA 1VL6A 5ALEA 3CA8A 2KBEA 5EZ6B 4DQXA 4Q4AB 1XEAA 1NLFA 1D1QA 1TYDE 4ROTA 3KFVA 5DTIA 2YRFA 1VHQA 2ODQA 4NBUA 1E79A 2G83A 3GH1A 1LGYA 1VYTA 1SIWA 5FBKA 2O2HA 5D3KA 3TYXA 3UMSA 2CFOA 3V2IA 3ZDBA 1BA2A 2X22A 2VOEA 4RK6A 5CXXA 2Q21A 3WL6A 1H8HA 2A1IA 2WA2A 3RSLA 1QHXA 1JEAA 3UFXA 2PRKA 3H5VA 3NEPX 2QLMA 2O1SA 1GPH1 2VA9A 3NG1A 2NO1A 5DVZA 1RRKA 4U7WA 4E5KA 5CFMA 4FYKA 3LRTA 4DWWA 1XPOA 5KYGA 2JIOA 2I3BA 3IXLA 5C5DA 1Y6JA 4EY5A 3DNMA 4NPCA 5DI3A 3KQOA 4D96A 3B6IA 1KAMA 4AQYB 1XCGB 3BZWA 2ZJ0A 4M9XA 4ZYUA 1WTCA 3WKBA 1V5GA 2QROA 4Y2XA 2O1EA 3B2QA 3TAXA 1P3Y1 1I5EA 2XMCA 2PH7A 2UUBB 1S8OA 4DIEA 3OQHA 3ZWOA 5LD2C 1KK0A 1DQPA 3E3OA 4Y2UA 2EL7A 2XQKA 3TAUA 5FPSA 1JIIA 1IWOA 2PUHA 3T3GA 2H1WA 2QPOA 3RU2A 3DWFA 3QE0A 4GPTA 4E2ZA 3OURA 5DNUA 2TRSB 3AVPA 1V41E 5IYZF 2SKEA 5HMLA 1RMQA 2WUDA 4BNMA 1HZZA 1JWBB 3FPEA 3JAWB 1HEYA 3ENKA 4RO0A 2QR2A 4DEVA 1L3CA 2F3QA 3OIVA 1OI4A 4MULA 3KQKA 1KOFA 3BA6A 2FN4A 1Y42X 3HCAA 2Q0HA 4NZZA 1XMIA 3TD6A 4JB3A 3N0WA 3UQZA 5L53A 2PE5A 4DDMA 1Z6QA 3MIIA 4JLOA 1CZLA 2ONYA 1GUDA 3OCWA 1SU6A 1H0HA 5JS2A 3FYCA 1T5SA 3TTUA 3IILA 3VVLA 3DHWC 4HDSA 4IIYA 1NBHA 2W2LD 4R7TA 4D8UA 4C7VA 5JVDF 3GIWA 4FEEA 3F6PA 1A88A 4Z4IA 1A8PA 1W96A 1CY1A 1FNCA 1X7ZA 1XQ9A 3DVAA 4KW7A 3CX6A 2OV4A 4G23A 2CMFA 2BM0A 4LI3X 1B1AA 1Z0JA 3N74A 5TC4A 1WVGA 3CUWA 2GHRA 2IU4A 2I3DA 4CV3A 2NSLA 4F4HA 3FOEC 2AG8A 3Q8MA 2VHCA 1KMIY 5HIMA 4FKBA 3SR0A 1E8DA 1PSZA 4XM0A 1DQNA 2M9MA 4XRRA 4ZMRA 4XWWA 1NQUA 2VG8A 2ZYWX 3EIFA 4K86A 2ZIFA 4DJTA 4TMTA 3PL1A 3KE9A 4EHIA 5ICGA 3O73A 4M1OA 4XWGA 1LNQA 3VNUA 5BQXA 4I4TB 2DUMA 4KO1S 1PN3A 3L2OB 5JLAA 4CFSA 4JU8A 4YDQA 4UC0A 1P1IA 4XASA 5ALQA 4DV3B 1XAHA 2V0CA 1J8QA 3S1AA 2XIJA 1BFDA 3T3PB 3JQEA 2ZYDA 2N47A 2GD2A 2QN3A 4ZXPA 2AVDA 1MOZA 2PZGA 1LTKA 5F52A 3C1UA 1E2JA 1U1FA 1ORTA 3LX5A 3TMYA 3LC0A 1E6KA 1SXHA 3TTXA 1X9HA 1EINA 2WPDD 4PYQA 1JTEA 2W6ID 3N0VA 4MZXA 4PN7A 3MM4A 4X91A 1E20A 4KDEA 1BZYA 1M6VB 3Q7QA 3A6KA 4EI8A 2BCGY 3LKBA 1QU3A 5JJBA 3A0RB 4Q1BA 3IB3A 1M66A 1JKMA 2GRJA 3OOYA 3GNQA 4GBJA 4I5GA 4KQEA 2AMJA 4XDGA 1L4NA 4Z7JA 1U8AA 5ITSA 1NJ8A 2QMYA 3GQBB 1BE8A 4W5NA 4TZ0A 1Z83A 2I2FA 4UASA 2HF9A 1XTJA 3RSCA 3C3KA 2ABWA 5J4KA 4EATA 2AN3A 3AHHA 3DOUA 4UTOA 1E2HA 4A3SA 3LL4A 2RHCA 2ZRDA 4IIDA 3JYHA 3MBOA 1QRDA 4JGIA 1W36D 2C7OA 5CK4A 5KVAA 1EWKA 2CLOB 2GVNA 5E6RA 3L77A 1WZ2A 2IJGX 1ZOSA 5J4LA 1JPVA 3GXOA 5KQRA 1OFTA 3MQFA 4HNAB 4IUDS 3P0RA 4OHPA 1G21B 4U2BA 4AN0A 2A59A 1L5SA 4JNKA 1EUDB 2G25A 4QXPA 3RC3A 1TGVA 3MAGA 3PQ5A 4MRMB 1RKXA 4V1CB 1HSOA 2VP5A 1MB9A 4ESEA 2YTZA 2YZKA 2RH5A 4X1IB 4JLDA 3X1YA 3F74A 3G23A 2FKNA 5CGQB 3STXA 3MGCA 4HEJA 1QSGA 4XYMA 1IUKA 3NFYA 4PR0A 4UUBA 3VPSA 4UAVA 5DO9A 1AGXA 3C24A 1SPBS 3HA5A 2X2FA 4NNPA 4WKPA 4XGQA 4FLEA 3MIZA 4L6CA 1JFTA 4GSYA 1KETA 5FOVA 3HTXA 4OLAA 5HDQA 1S2DA 1WP9A 4QOGA 1M2NA 2MHCA 4UUOA 5CDYA 3H3XA 1JEJA 1K5PA 1V6CA 1M1NB 2QORA 3FRIA 1FVHA 3GBSA 3D3WB 2JGJA 2Y0CA 3CJTA 3V4SA 3I9MA 5CFNA 3O91A 3OIGA 2WSYB 1ESEA 2RGUA 1DOZA 4S3MA 3SU8A 4INOA 1G3QA 1Z8DA 3AR7A 4ARIA 8GPBA 2DLNA 2JASA 3DAHA 3OPYI 2IODA 1H42A 3WBFA 1UFVA 3DLCA 4BAUA 1XNQB 1TF5A 3Q15C 4RVHA 1HPLA 4MRSA 3ZBPA 1XL0A 1NI4A 3P2IA 3DMHA 3AR3A 3P27A 2WF7A 3A05A 3E9NA 1UMDB 3HJGA 1PTKA 4UOQA 2C2YA 4RHFA 1PDWA 3SIPA 3WRVA 2ODPA 1JF8A 4Y98A 3C45A 3TH5A 2YMLA 1O58A 4HV4A 5LP6C 4L0MA 2F3SA 3KOUA 1NBIA 4BZXA 4F3NA 1T2CA 2IHNA 1OA1A 3CLVA 5A5EA 4BNUA 5IBCA 3QBDA 2ZJBA 3A3YA 1FOEB 3IBSA 4XARA 4D3ZA 1BN6A 5FWXA 2WK1A 2FK7A 4D92A 2PX4A 1GRRA 4I2NA 5D84A 2ZYAA 3FWHA 3SDZA 1TF7A 1JVNA 2HWXA 3NTXA 3UCFA 1MB4A 3MJTA 4BRUA 5IXYA 3BDIA 2RGGA 2PVCA 2J32A 4KQCA 4X0EA 1DKRA 3KKPA 2IQ5A 3VV3A 4IUBS 4QGHA 1GSHA 1VDZA 2XA1A 4Q82A 5NLLA 4Y9DA 1CUIA 4Q7QA 1GDTA 2VDOB 3GFQA 1Z5NA 1PG5A 2CF5A 4HC4A 4E7PA 1KVUA 2HJVA 4E6EA 1RHKA 3JCZA 1RIFA 5EY5B 1XZEA 4V03A 4IBOA 2VT3A 4YRTA 2UVQA 5AM1A 3QF4B 2QD2A 3OPMA 1A9RA 2GJSA 3MT8A 5CM8B 3ER8A 1R18A 2HFJA 2QRKA 3ET4A 1NOKA 1ZD3A 3KYCA 1QH9A 4G5SA 4IVQA 4MW7A 3WOHA 4MKGA 3B89A 1VG8A 4IJQA 3DCNA 5BR4A 2C2MA 2Y2UA 5IXSA 4CJXA 1E3JA 3BF7A 2XCSB 2C77A 2DXIA 5LMNB 1E69A 1JEYB 3PZRA 2IZ5A 1NQWA 2PQMA 4BLPA 2W6CX 1Y1PA 2IKSA 1XCPA 4LE0A 3P19A 5EIHA 5FPTA 1KYVA 4CR8A 3EXEA 2FPOA 4BE9A 1QP8A 3NHYA 4HWRA 2EZTA 1C1HA 1AK2A 4ZREA 2I1WA 1RU3A 1UXOA 5EE0A 3V8QA 3MQ2A 4BNKA 4BVFA 3V1MA 5EZYF 3T0GA 1OBHA 2H65A 1JI3A 2W6OA 3ZZNA 5T6MA 1GQOA 2HMYB 3MUNA 3ZYCA 2I7DA 1XDGA 1GSIA 3QE2A 1K88A 3FAZA 3H2JA 4W7SA 5CM2Z 3TSWA 3COZA 1JWAB 1Z36A 1X0XA 2H1CA 1RRVA 2QD3A 2QNBA 2WTBA 1W25A 1B76A 3R3SA 5FR2A 5SZJA 3E61A 3C6YA 4KK4A 1QMGA 4YQEA 3H99A 4DWOA 2G5CA 2O8EB 1JSRA 4FTWA 4OTZA 1TADA 3DOIA 1NT2A 3NV9A 1S0UA 2RK6A 1O08A 5IW8A 2A0FA 2FSVA 3RHFA 5JAMA 1GTRA 3TLXA 3AEQA 3WNZA 2B7BA 1KMHB 3PQ2A 2C96A 3EZLA 4D5GA 1V1RA 2O48X 1JG7A 3FPAA 1YJXA 1DV1A 1SQSA 1Z73A 4FOTA 1CX9B 2YCBA 5ALHA 1G5PA 2K87A 4BNZA 5CXUA 4J16C 1I6LA 1UK6A 3ND7A 4PVCA 3TF5A 1F0NA 4JDUA 1A9PA 1EI9A 4LYGA 4A0QA 4E4RA 3T5CA 2ZBFA 4OKSA 4FMDF 3T7DA 1B14A 3Q5GA 4AJOA 3V3KA 3KWFA 3IGFA 4RU1A 2HSGA 4GZ5A 3KHSA 1AZSC 2VWGA 2AFRA 1OXXK 1XB2A 3QMMA 1G5QA 2XRYA 3CZ4A 1GIAA 5J2UB 4R9NA 4XOUA 1YB2A 3JWPA 1UKEA 4DCSA 3I2FA 3QEKA 2UYQA 2XSZA 2CKMA 4DWJA 4EO7A 1L4EA 2HDOA 3F6YA 3DXXA 1EP3B 3KQSA 3LC2O 4KMOA 3WISA 3MHTA 4HLUC 4RFSB 4KYIB 2Q50A 2XUJA 3DAFA 3IULA 1K8YB 4JC4A 1IOVA 1AE1A 1T2EA 4ZAVA 4H3HB 3IQFA 4QQNA 3P1JA 1XFAA 2ON6A 4DV5B 1SEPA 2B83A 1N2JA 4MV4A 3EUEA 2VEOA 3FDXA 1YR8A 1N2ZA 2BFPA 3N39C 3OEWA 4Q47A 4K28A 1UBTS 1K3TA 1G18A 1XA4A 2OC4A 4NHOA 4Z2YA 2YXBA 3AB8A 2FUG1 3NBAA 4R2JA 3UENA 5KYTA 4DUGA 3ZVNA 1TM5E 5ALYA 3JD0A 2FYTA 4MRNA 1FPQA 3K0AB 2RGNC 1UFQA 3KOWA 1D0IA 4FQ7A 5E2AA 2JD0A 1CV2A 3M7IA 1LK7A 4N12A 2PT9A 2UYCA 2G40A 3GL9A 5AVWA 4BFLA 2BUAA 1XIVA 2C2OA 4Z1MA 3HMKA 4RGVA 4BEVA 3A3OA 1WF6A 3EPJA 5I9TA 2AD1A 4UAGA 4XYBA 4HUQA 3N8GA 2AR9A 4DDVA 3NHJA 1NN5A 5LKAA 2O2CA 3WZ2A 2A58A 3OT5A 4YV1A 1TUIA 4GW3A 4R31A 2IXDA 5DASA 3NTQA 4PG7A 4F4IA 2V59A 4IL5A 1T6YA 1RWMA 5BN4A 4BL5A 4GPIB 3QBVA 4RELA 3LLVA 1ZHHA 4I8IA 5GOZA 3PWTA 4L07A 1U5BA 1SCDA 2V6IA 5IJWA 3H4TA 4BGVA 1NZFA 1E5LA 3E35A 3DBIA 4BZZA 2VQSA 3HI4A 5DH9A 4EW1A 4HVAA 3I2KA 5FAXA 1QZXA 1HQDA 2YASA 4ZJZA 3VM6A 2O54A 1E3DA 1US8A 1EVIA 1FMCA 4KU4A 4ZU1X 3UFBA 1BU5A 4C1BA 5LMUB 1OVGA 1QYXA 1OC4A 5IANA 1LSJA 2JLQA 5FNVB 3EEOA 5KSWB 5F2KA 1W8DA 3SIRA 4FYJA 2IPNA 4F5YA 3U4HA 1BH2A 2VH1A 3S44A 1XYGA 4C21A 1U2GA 4V0SA 3AUFA 1OTXA 1S2IA 3AERB 2BKUA 3B2EA 2JK1A 1AHIA 1HDCA 3MRVA 3SQLA 4NNJA 5BSVA 2GR9A 1TU3A 3OF2A 2F1IA 3VR2D 2J30A 1QH8B 4A2WA 3I6QA 3T1YB 2H06A 3OEYA 2BFBA 1V7PC 3OIDA 3PDJA 3ZQUA 2GM9A 1LBHA 2PL5A 1Y3CE 3EGVA 1RMTA 5JMPA 5U9CA 4ZYLA 2AKAB 5CBPA 4L4UA 2OXTA 2H5LA 5B4VA 4BRSA 4PNHA 2PKRA 3STUA 4I50B 3Q2OA 2ZKIA 4J90A 4XIGS 4TV8B 2IDZA 5EMLA 3WLEA 2PLFA 2G7MC 1VB3A 2ZSBA 3HVIA 1U4OA 1U2DC 1ZS9A 1GV1A 3OE7D 1R5NA 5FI1B 1KEEA 2L42A 1RI1A 3FSJX 4G2TA 1UH5A 4GMHA 1UFRA 1TUBB 2P6RA 4O3MA 3E5NA 1SU8A 5GJCA 3NUQA 2QVBA 3JRNA 2CJYA 2AUTA 2BFWA 5LOVB 4RHUA 3GMDA 3D1LA 3EXIA 1ZCZA 3V4OA 3NTVA 1Y3HA 1KI8A 3RVDA 4QVIA 3R9WA 1V7QA 3GEDA 5TARA 4H35A 1OI7A 1LLCA 1QF9A 3VX4A 3KHUA 3IS3A 3S4YA 7REQB 3CSSA 5IFLA 3KBBA 3B38A 4JX9A 3ZZUA 2QN6A 3U7GA 2PTHA 3MXOA 3TUIC 3PX3A 4Q7KA 3RS0A 1Z2NX 1RKBA 2WU0A 3HN6A 3OM1A 5TR9A 1Q0PA 1PR1A 3GT4A 1RABA 3BFPA 3BWMA 4ND4A 4CG0A 4YCSA 1JAZA 1R10A 3Q7TA 3VH3A 2FQWA 2O0HA 3BVPA 4J6EA 1RM3A 5FYQA 5I6DA 2XX3A 4GI3A 5KJ1A 2IZ0A 2H2GA 4JD5A 2ZJAA 1A5BB 3C3XA 2J6BA 3ZK9A 2P0EA 3ORSA 1KGDA 1NVMB 2QQFA 1T6ZA 4OL0A 1YVPA 4FNAA 3TZKA 1I4LD 1P39A 1CY4A 2FQXA 3EIWA 4LJ6A 5K3OA 1QIMA 2V7VA 3I9V1 3T99A 3VAZA 3ZHQA 1QRSA 1C8LA 1Q5PA 3K1YA 1I1QB 2POQX 4O4JF 2YR0A 5ERYA 1Z6PA 5LB2A 2OGUA 1UQRA 3QZUA 2CXXA 4JUBA 2UYGA 1GKYA 2BMVA 2H3HA 4ZVPA 3MT7A 1ZJJA 2IKQA 1T1JA 2Q1XA 2V6JA 4HUQB 1QK3A 1XZMA 1KQPA 2Z9DA 4I99A 4R0NA 5JQGA 1SCKA 5KIAA 3RYCA 3OOWA 4JBNA 4JI7B 4CMCA 1BMQA 2W6IA 3R7SA 2ZR9A 1JJAA 1YU6A 1EFVA 4DQDA 3TZHA 1UAYA 3M3PA 3CJQA 1P62B 5LWQA 1KPHA 4MIEA 3OLWA 1UM8A 3EIEA 4JC5A 1YACA 1ADBA 3Q10A 4A6EA 3RVSA 1FK8A 1O97D 1OXTA 1SVMA 2CY0A 2JAHA 5C80A 4RJTA 2OAEA 4US1R 4YVFA 3IR5A 4LHXA 5FHRA 1OLXB 5JS6A 5KJFA 5EMNA 2SICE 1UPAA 1Q21A 2WMOB 3FCOA 4NCXA 1WABA 3ICOA 4YV7A 1TQDA 3EQ9A 3OOHA 3K4HA 4W1QA 5F5NA 2GPNA 2R66A 1LSSA 4GO1A 4RCYA 5KEIA 1Q7CA 4W9NC 1EH5A 4YHHB 4IAOA 5I01A 4EPRA 1KI4A 3S27A 2JBWA 2ISQA 1DJNA 4LF4B 3PJDA 2C5FA 3ANLA 3KJQA 5FBRB 3M6UA 1YVEI 1YONA 2J5QA 4YJHB 3AZOA 1RQ2A 4LMRA 5E1DA 4E5UA 4EG7A 1VM6A 5DYIA 2XWBF 4ZEVA 2PIAA 4JIMA 2Z98A 2D59A 3F3SA 4UHHA 4ZO7A 1SHJA 4V1CA 1FW6A 1WP4A 2Z09A 2B34A 3C15C 4JI6B 2VAWA 3LY5A 3K0EA 4H1HA 3S2IA 3BRWD 4Z53A 3U56A 3CUSA 3OJFA 4MI1A 4UM9D 3X43A 5K9ZA 4PCVA 3HJNA 3HJFA 1VJCA 2EC5A 3D2CA 2ETVA 2ZRPA 1LBEA 3IP5A 3MWDA 4I8XA 4L4RA 4LSGA 2NP6A 1UM9A 5EC8A 4N3CA 2WHQA 1IL0A 1ORRA 1ULHA 2NOAA 3A3NA 3DZ8A 3OPXA 2GN8A 3MS2A 4PAGA 3TQOA 1P1FA 1USVA 4MYHA 4EJ6A 5AQ1A 3H9UA 2VUIB 5DHPA 4XGIA 2G06A 1QUEA 5EVJA 3CH6A 1KSFX 4M8KA 3PT5A 4BU0A 1QPGA 2Z5FA 4B09A 1KTIA 2ZSDA 1IG0A 3U4IA 4YJGA 4ZQBA 4B76A 4IRMA 5B64A 3T5DA 2H2WA 1K4KA 3GV0A 4NJEB 4GZ6A 2IPMA 1X7XA 2OZVA 1RXCA 2X3FA 3IA2A 1GG9A 3E0QA 5ENDA 4FEGA 3L8CA 4FDAA 4B3TB 1JAYA 1VA5A 2WVHA 2NZJA 2KLBA 4UQLA 1C7ZA 1WUJS 4LGCA 1O5OA 5CP8A 1IBKB 3FYDA 1EBUA 1F4LA 4N49A 2C9DA 4AYWA 3KQHA 3E2PA 4KVAA 2GZAA 3I5MA 3AHIA 4RLHA 1W2HA 3U3MA 4R71A 2ADOA 1LCIA 2A0YA 3GJ0A 1QP7A 2P4UA 4JFRA 2HXGA 3H11A 1JDZA 4R1MA 4RK1A 3RC9A 5K0JA 5JYDA 2PJUA 3ZPXA 1V26A 2D8MA 3E03A 4AY6A 4BCCA 1DWQA 4CR6A 2WWIA 4D8YA 4BVAA 1XTZA 4XX0B 1QGUB 2VF2A 2HRDA 1OX6A 4KQWA 3R44A 5AW4A 2HQSA 1HT1E 4YUVA 3ZBUA 3UGTA 5LPNA 1AS2A 1X8KA 2WHYA 1PCXA 1C0LA 4Q93A 5EQTA 1P1JA 3FY4A 4UUAA 3N53A 2WUWE 3BJMA 3B6EA 1EDBA 3KRTA 4PG4A 2RGWA 1AHNA 4WN3A 3HQ4O 3TJZA 5HOEA 3KB1A 1IHUA 5AVVA 4IMRA 4LHEA 4TZKA 3SDSA 4M55A 3W5AA 1RRPA 1HDEA 4GEGA 4INPA 4MVJE 1L8QA 4LXYA 4P1ZA 3WJ2A 3QVGB 1ISSA 3P71T 1J0CA 3M4XA 3P5SA 4Q24A 5DNWA 5KSZA 3UW1A 5DNYB 5JZSA 1J07A 3SOZA 1M1XB 1WSDA 3BXOA 4YROA 1KJIA 2B37A 1SC4A 1QZUA 3L7CA 3R5HA 4JJ4A 3RT1A 1C7RA 3TBKA 2OAGA 3HEBA 2C5GA 2H0AA 1P61B 2H7VA 4OXRA 3JQ8A 4MLDA 1MIHA 1H8HD 3W9UA 1Q57A 1N5IA 5IVPA 4KE9A 3TBFA 2ZEJA 4WY8A 4CKXA 4BVEA 3TQCA 2H9IA 4QNMA 5TDHA 2I7VA 5BW4A 3FPCA 3QOYA 3HRHA 1Y5LA 4URYR 3DTNA 3NEYA 3P96A 3H6HA 4OMDA 4FT2A 4KIUA 4KLAA 4C2TA 2O2GA 1UWCA 2AN5A 3MT0A 5D5QA 5A9SB 3HXMA 3KKLA 4WRRA 1MAAA 2NU8A 5BNWA 1UL1X 1XU4A 4FYYA 4B4DA 1X8XA 3JAKB 3R41A 4EZEA 1T3TA 3QYPA 5CCEA 3WK8A 2VQFB 3F47A 4I36A 4TS9A 5FI3A 4LZNA 1CU1A 5BORA 2BSQA 2P0YA 1VL0A 2Y8EA 3EEIA 3IJEB 4LNAA 1IBCA 4G86A 4LKOA 1H0RA 4JUIA 5ENVA 2ZTSA 2GEUA 3IPYA 4FQ8A 1X38A 3VDRA 3DBLA 4MYTA 5AI0A 5EIBC 4C0XA 3HBNA 3WLRA 3WGMA 5K5EA 5LNK6 1A2BA 5K3DA 3AVXA 1ISFA 3SNKA 1JU9A 4ZO4A 4JMLA 4BE4A 1BS9A 1WHSA 1CUCA 3ELBA 4FJ2A 7MHTA 3IAHA 3ENQA 3VYSB 2VEDA 4UEWA 5HDBB 4TWAA 1P9OA 4JH0A 2X0EA 3TKAA 3KHKA 4G36A 5LDDC 1HTBA 1GU1A 2QVYX 1RWPA 1XLVA 3C6QA 3QBEA 2QD4A 4G89A 5EJMA 4IDHA 4YALA 5ECYA 1S2GA 3PX2A 5LLDA 3LUFA 3QFRA 2IUTA 4JVLA 2VYVA 3PFGA 3ZHXA 1UBLS 2OGZA 2Y27A 1WXXA 1S2NA 2AJLI 2BGMA 4Q9LA 3IE1A 2A78A 3VSEA 1GG8A 2X0RA 3LQ2A 2HF2A 4ZI5A 2NSHA 2IU3A 4LYJA 1H2ZA 1LLFA 4H18A 4KPFC 1OFVA 2NX2A 2AYXA 3A3PA 5FWAA 4FX5A 1EJ2A 1FDIA 4M37A 1OSNA 4WZAB 1RQXA 5EXSA 4JUFA 1A8IA 2HI0A 2CHFA 2HCFA 4H6WA 1C41A 1U11A 1QWOA 5IT4A 2ORED 4JP5A 2A5LA 4XCXA 4C0BA 4YNBA 3O8LA 1P4AA 2OOSA 2PUJA 2HA5A 1BVRA 3P9RA 2P3SA 5C1OA 1HNXB 2WIBA 3OEEA 5K8TA 5PNTA 1GZ7A 1GRNA 1EAMA 2JIZD 4M36A 2H4FA 1QR6A 4MVJG 2Y93A 3PEUA 5IKPA 4EB6B 3E3LA 4IGIA 2FPRA 3TW8A 5C37A 3WGNA 4EB6A 5KAPA 3V97A 3IMCA 3A70A 4PAQA 4YAWA 2JIDA 1BGVA 3G8YA 1P2SA 4V2UA 1HLDA 3RVOA 1EM8A 3VVMA 4NFSA 2BSAA 2Z3WA 1DT5A 2VHWA 3R5KA 4Q5IA 5LBUA 3RAPR 3GJRA 4JI3B 3G2MA 4LBYA 3SBOA 3WL3A 3N86A 5DYGA 4JVSB 3BFXA 5AYVA 1J2JA 3DE0X 5KNBA 1TCCA 2XDQB 1GLNA 1NVAA 3FBTA 3BMOA 4MROA 2CW5A 4H7KA 2W70A 1LPNA 4DA6A 2G5PA 2JCSA 5A3VA 4NARA 4CL3A 4CHTA 4LI0A 4U2GA 2EEPA 2QEQA 5EHNA 1J1IA 3U7FB 1SBTA 2OV6A 2WP0A 3O2QB 4UBJA 5IT9A 4ETWA 1A98A 3A1CA 1OX4A 3B53X 2OBYA 1JEEA 2HN9A 2W2XA 4F1WA 1W2WB 3W34A 1BHSA 4EKYA 1B2RA 1C2TA 1O2DA 2AG6A 2DHCA 5EMJA 4JITA 3KYJB 4PNZA 3KIPA 1XMQB 5EJ8A 4CQNA 2XVMA 3EARA 4MKHA 3CFYA 4NYJQ 4US2R 4ARBA 4D44A 3Q4GA 3S3TA 2WYWA 2KW5A 4M6WA 3W90A 4C6SA 4PFKA 4RY0A 4MYRA 3I1FA 1FNSA 1N8NA 4OXNA 4D79A 5AJVB 5T4FA 4YCCA 1RLIA 3ZLJA 1L5KA 3LUBA 2Z9CA 3M5DA 3W1VA 1XA0A 1XC7A 2RGRA 3ZCRA 2I6QA 4YCDA 3T06B 3LFUA 3S8YA 2F3UA 1IBSA 1Q7TA 3M1LA 3E5HA 1VJTA 3M9LA 2OLJA 3SIWA 2NUAB 3BRQA 3ITKA 4E2XA 4DF3A 1NLYA 1IY1A 2Y0PA 1JIXA 3F6BX 3KU1A 3ILSA 4FK8A 2NUPA 1O6FA 5H59A 3AYXB 3HKCB 4Z9BA 2VK4A 4QATA 3FVQA 3ZCXA 3AUSA 2DUWA 5DBFA 3HO8A 3GO4A 4H17A 2Z2KA 4OYLA 2NU8B 3WP1B 4RTLA 4F96A 1P0CA 5EYPB 4DY4A 5JH7F 1RXWA 4CM9A 1QVVA 4P83A 3UJ7A 5F7JA 4BO8A 5CVUA 2ZAYA 3N2GA 3O7MA 1OIXA 2OCBA 1H1DA 1NDUA 2ZBPA 1DINA 4M99A 1YC5A 2V7EA 5HJ5A 5LZ9A 1TD1A 1S1MA 3ETHA 2IPLA 4G37A 4X44A 2JIMA 5I7FA 1G8HA 2RJOA 3K8QA 3ND8A 1Y5IA 4LGMA 3KPVA 1XTSA 3PFNA 4UTPA 5J9FA 5JSZA 5HKBA 4O2AA 1UXKA 4OREX 3WVNA 4PZCA 4QDZA 4NQZA 1CB7A 4D3YA 3VZRA 1U9IC 3PGJA 2C7BA 3VHXA 4HQ0A 2XE8A 3RYTC 3I73A 4KR9A 2GF2A 5JH7A 3E8XA 2HA6A 3GUHA 3UV3A 1G5TA 2GB4A 2I7CA 1I3KA 4KP7A 3BHNA 4DCGA 5A71A 1CZHA 1GNVA 1PJQA 4D99A 2FUEA 3D59A 3R09A 4HTAA 3I76A 4BX3A 3AEUA 1E6WA 1GFIA 2FPMA 4YO7A 1BAPA 1ODFA 5GVRA 4BX9A 3EIUA 4NEGA 4NBRA 1Z6YA 3OUZA 4N5LA 5E0OA 5LLSA 1SBIA 4DRZA 4EYKA 4RMNA 4KFSA 2G70A 4W99A 4WJKB 1CB0A 4CEHA 1YQTA 4BZQA 5ADHA 4TWRA 4UTZA 5TQ0B 4B9EA 3W2HA 3EASA 2YFKA 4I55F 1PX2A 2R87A 2ZRQA 3WY9A 1FU7A 4QEKA 4RPKA 5JPCA 2JGDB 3LK6A 9ABPA 1YFLA 4UFPA 4DMHA 3PUKA 3VISA 1E66A 3UKDA 4JXJA 3NAQA 1WKCA 3NP9A 4OHRA 3I53A 1PT7A 3K9HA 5F5XA 2ZYHA 1KAOA 4GMXA 1R16A 5IULC 1BE0A 2XUDA 1RYYA 2RKBA 4MSUA 4Q9JA 5DP2A 4RNCA 3UJDA 3MPOA 5IDWA 2WICA 3KV3O 2BFOA 4FOSA 2GPBA 3EIHA 2AJ8A 4IVNA 1F2UB 1Y6FA 2FOLA 4HMOA 3WLJA 1Q0HA 4HK4A 2H63A 1BC5A 1HUQA 2KPOA 3HDVA 5DWQA 5BSRA 1M8KA 1SBYA 2C97A 2WJGA 2YY7A 3W77A 2XB8A 5BY2A 2GAJA 1SK9A 3WK6A 2ZJ5A 1EVLA 1BA3A 4ZN6A 2WSSA 3R6GA 1FNMA 1I4EB 4RV4A 5CCXA 1T9ZA 3TTYA 4EA8A 2DH5A 3LP6A 4L15A 3S7ZA 3FOFC 2FQQA 2EHDA 3H17A 3U39A 5CA0F 1JQEA 2AOUB 4R9VA 4JYAB 1WXGA 2IWHA 3FX2A 4DRXB 3EBPA 4CKEB 1O94A 2OO5C 4NNOA 3NHMA 4U0JA 5KC9A 3ICVA 4BB0A 1AZLA 3OZDA 3I45A 3MWEA 1OAAA 2R1TA 3L1HA 2MYUA 1KERA 3AL3A 3RFXA 1K3UB 3QF4A 1A9XB 5H80A 1E64A 5JZ9A 2VHEA 2JATA 1OBOA 5LU9A 1SXJC 2GFHA 1NVFA 1RXUA 2HX1A 3IAS1 1MJGA 2PZBA 4FIZA 5DYWA 3VC3A 3HWX1 2QM3A 1F4VA 1CS0B 1R15A 1OA0A 3OEHA 3WAGA 3DE4X 1ZIPA 4WKGA 1Z6TA 3GPBA 4TTPA 5B30A 4KG7A 1RHUA 1UDXA 2QRJA 1HMPA 3CCFA 1UDRA 3DCJA 3MK31 5DEIA 3TJRA 5CFLA 1GTJ1 1TECE 3PDCA 4KH0A 4ZT4A 1AZWA 3PVCA 1MRZA 3KXIA 1RE1A 2AZMA 2P75A 4GWLA 3WBKA 1WXEA 5P8WA 2F1JA 2Y9PB 3QGMA 4P3KA 2KHZA 3E58A 5H70A 2PMKA 2UZ1B 2GKGA 2P90A 1EZZA 2Q49A 2W6ZA 4RGQA 3GRVA 4Y9UA 5EPOA 1RYBA 5CVCA 1FF9A 3TLAA 3OTOB 1KARA 4OQPA 1UBJS 3K7EA 2GA9A 5TJHA 1NFFA 3B20A 5KQGA 1KZGB 4FFBB 2EFJA 1CP2A 5JPIA 1JDJA 3QH4A 2OHVA 2NU7B 1FFAA 4ETIA 4I4CA 5CEEA 1QIIA 3RUFA 4CG3A 2UAGA 3SQNA 1P7WA 3GUCA 4MVJD 4Y2HA 5KTYA 3VSAA 4AW9A 3ZXSA 4YC7A 2O0KA 1Q0UA 1YB7A 5CDGA 4NLLA 3U4CA 4CM5A 1G59A 5KYXA 2EJCA 2WNHA 1HXHA 1PWXA 2J7PD 3C8ZA 4MQEB 4O5AA 4RW0A 3ZWNA 3IKTA 3TVTA 1BTOA 4QFMA 1I4DD 4GQAA 4WN9A 3I01M 3JQPA 3JW8A 2P9HA 5IDYA 4CCWA 4EFKA 3M3DA 4V38A 5ITVA 1GYRA 2D0DA 2LGJA 3P0FA 3S2SA 4K5QA 5KAMA 4CMJA 3WDLA 1CIPA 1DCKA 1WXDA 4OD0A 5FFFA 3TNFA 2ZBDA 1NPDA 2NT3A 4X65B 3II6X 1YQXA 3BD7A 5KYXB 1O0BA 1XYVA 2DHQA 3HJHA 1W19A 2NAFA 3IIEA 4L27A 3KWMA 3JY6A 1FQWA 3LA6A 4CI9A 1E94E 1F6DA 1FTYA 1RAAA 2AYZA 3HCNA 3PQ3A 1PW7A 3OBBA 4K9QA 3T7CA 2FW6A 1YZNA 5G0VA 3VVBA 5IEBA 3FDJA 3NW9A 1FPMA 4GEKA 3ZH2A 5C9ZA 3MD9A 3VSBA 4EPTA 5HCNA 5K03A 2H31A 3CIFA 2O8VA 2FFHA 2IZ1A 2ZJ1A 1CXZA 1OBFO 1QIHA 1ULAA 1C29B 4RD4A 4DWVA 1MQ8B 2ENWA 3C5HA 3HCPA 4Z3DA 1NQXA 1VIMA 3Q41A 3BWEA 5DNDA 4ZVOA 2IBSA 1U3FA 5JCOA 1MOQA 2NSJA 4FYPA 1SB8A 5KYWB 1DRUA 1ODCA 3E9ZA 1WPRA 3NH9A 4FR5A 4I8DA 4URWR 3QSGA 3JQFA 2VI5A 1U8CB 3DL4A 4ER6A 1V6AA 3R0VA 4MI3A 2YWXA 3O8OB 1FVOA 5K0EA 1N2CE 3PICA 1QHFA 2QX4A 1AKUA 3QJYA 3M49A 4HR7A 5HA5A 3UH1A 1OVMA 2C8VA 5C8DA 3BE5A 1TCBA 1WCIA 3UG7A 2JDIA 4YLGA 4JFAA 2AFHE 3ZLBA 4CKCA 3ICWA 4TYQA 5AUPB 1VYVA 1NVBA 4RETA 4ZEXA 3U7HB 3T5MA 1IPHA 4RFLA 1K4YA 1ZNZA 5FUQA 1BKSB 5BSHA 2G77B 4ZAZA 3VV2A 1NMXA 4RNDB 3CX4A 3W2GA 4UCQA 5AVKA 2MSNA 4MVCA 4EPVA 5TXGA 2V7TA 2WWHA 3GLGB 3FB1A 2PSSA 1ACMA 4EJMA 3HYLA 2JAWA 5BSFA 2IU0A 1T3SA 2JAQA 5EUCA 4FFNA 4Y6QA 3FSEA 3JASB 2CFSA 4N39A 3RJ5A 5AVTA 1T9BA 2DY0A 4H7IA 4CXMA 4ER3A 5AHOA 4TLMB 3RFVA 4BJ1A 3OSZA 1AF7A 4ICIA 4IDCA 4WZAA 3RB8A 3WRWA 4ZOLB 4R1UA 1JFFA 4TV8F 4GWKA 4NU0A 1T15A 3FLEA 4AKSA 4J16A 2FX5A 2NZUG 4ZCLA 4G8DA 4NEQA 5SZIA 6NULA 1NR7A 4P82A 1JR3A 2G0AA 2BFDA 2WVGA 4C2BA 2WQ7A 1T1SA 1JQJC 1MX1A 3ONEA 4ENQA 3EVDA 4I4TA 4KXWA 3HUFA 1J09A 3AFIA 4O1IA 3WJ1A 1LH0A 2XVYA 4YRZA 1TPYA 4L1KA 3TZEA 2IYUA 2R84A 4HQKA 4PM4A 2PKQO 2Y6UA 2W2VA 1QBKC 2A8YA 1WZIA 5JS8A 5A3RA 3GEIA 1OILA 1U1EA 1RI4A 4L85A 3ZU5A 4XVHA 1W5TA 5EJ2A 3PD0A 4XXHA 1F8YA 2WIGA 3WGHA 3UBTA 3R8XA 2WPDA 4UNQA 1GQ2A 1GGFA 1L7QA 4KXFB 2DTDA 1V6SA 3H2HA 3M6LA 1UINA 2YIJA 4Q18A 4Q1VA 4Y2RA 1L7PA 2E5WA 4JROA 4D5EA 1EIWA 2QIOA 5DBHX 4BFVA 4IOLA 1IPEA 1ZD9A 4YO8A 5DEOA 1R2QA 5FOQA 1DXYA 2I66A 2TECE 3ANNA 2P67A 3OQ6A 3JWHA 4FB5A 4G0ZA 5ES3A 3QVMA 1OLSB 1N9GA 2CMHA 5KJ6A 1KZ1A 3IEXA 3UUEA 1RJ9A 4AXXA 4WW0A 5K99A 2XB4A 2YWFA 2EQ5A 2VNIA 2YWGA 3HDHA 4I1OA 4OHXA 4R2HA 3N87A 3VDQA 2WJJA 5G3ZA 4BCBA 1LJ8A 5C32A 4MUJA 2FWBA 2QMHA 3SHOA 1S3SA 1JR3E 2QUAA 3ZIAD 4A8JB 5KNBH 1UANA 2H92A 2CDAA 2C9OA 3I32A 2FGJA 3O3MB 3G1TA 1KS9A 5A05A 4WBNF 5EHQA 2VCEA 3CLTC 1OCEA 3GRFA 2QL9A 2IYEA 3HEMA 3UKOA 2IZZA 3LUAA 2CL7X 1S4MA 4F4DA 2DQKA 2C94A 2QGNA 4EITA 4NG5A 1ZMTA 1R9GA 1CHNA 4RV9A 4BB5A 3FNHA 2BAGA 2J3LA 3ZGLA 1O96A 1YBVA 4WBXC 4ER5A 3PC4A 2ZITA 2W83A 3DOOA 4JLKA 1WAMA 2OZLB 4GKBA 5I45A 4RZIA 3VPCA 1YE8A 5BRAA 5FL7D 1NVKA 3EQZA 2PKCA 4HNSA 2YS6A 1Y9EA 2CXRA 5DM4A 5JAZA 5JMTA 4MVXA 3UMGA 2XLCA 2HEGA 3NZEA 4J91A 2WJ3A 1CERA 1G3UA 2WJPA 4W5WA 3Q8WA 3GF4A 1OBCA 1MIOA 3HKEB 3L84A 4JEHA 3KEFA 2NP7A 3ROQA 5K4AA 1IFXA 1Y5RA 1MW9X 1PEAA 4K03A 1NBAA 2Q5OA 5DN9A 4MUYA 3X2SA 3UAXA 1Z2CA 4DTCA 3IHLA 2CJPA 1B42A 2P9TA 4FEAA 4BRZA 3V4RA 4D81A 2C0CA 3UYLA 4DA0A 4R5MA 2RG1A 1R5OA 1IEQA 1YQ9A 1FJXA 4AZ3B 1SH7A 3PNOA 3IL2A 4YP0A 4MWEA 4RA9A 5H82A 3R7FA 4BFWA 3VFDA 3I34X 3R3VA 4AJ2A 4JIGA 2CUTA 1E2MA 2EIHA 5C5IA 2VTDA 1TFRA 3PQ6A 1GKUB 2RCYA 5IKOA 4EKGA 1SC9A 4L95C 3VX3A 4ZWNA 1CQIB 3CNEA 2WWVD 3S1LA 4PTZA 4XWKA 3AJDA 4NPAA 2EWVA 1UXIA 3CURA 2X1LA 1EK0A 1H1TA 3FZNA 5EE1A 5T3YA 2VF4X 3PGMA 2CBXA 4J0CA 4NJEA 1BOFA 3PU6A 2A0XA 3QVUA 4TROA 5M5BA 3DT9A 4DAEA 1BDHA 3Q7SA 2W48A 3A4TA 3FLBA 4LV8B 1NVUQ 4YRKA 1IQRA 2YYAA 1P0MA 4PRLA 1GTG1 5JJ5A 1IN1A 1EM8B 3T1QA 1FP7A 1ZGHA 1GR1A 1N3BA 2WKQA 2OCIA 5LBIA 2HDNB 4E2WA 2O14A 2J3JA 4HPXB 4BZPA 1NI5A 2J9GA 2REBA 2ZXEA 4K6HA 2C0QA 2UDPA 1UMCB 2B20A 2B3TA 3BSSA 3QX9A 4BPBA 4M0FA 1KRHA 1SCBA 4UHCA 4RD0A 3U3XA 2GMWA 5KDOA 5H0IA 3J81k 4EI7A 3S68A 1J0EA 1ZAKA 4ZCIA 4HQ6A 3VI3B 4HFRA 5B55A 1Z6ZA 1C9DB 1Y9AA 5HIJA 1UODA 3D64A 1GN9A 3QITA 5ALDA 1ODSA 4JOSA 3IQEA 2N0SA 1FFBA 1M72A 3F5SA 3INNA 1E62A 3A6EA 2OK8A 4W82A 2ZUFA 1ML4A 2FW8A 2EFDB 4IH1A 1NN0A 1VIVA 1HC7A 2R6FA 3AHFA 2YVUA 3NDIA 4NYIR 4NX2A 4XW2A 3B1YA 2ZUSA 5EE5B 3TDKA 4ANFA 3ZHUA 4LXTA 4EMTA 5KTRA 4NBTA 2FEPA 3SQWA 3MJHA 4BO2A 4KUHA 5A4MS 5C1DA 1KMNA 1E7RA 2PPLA 5EIWA 3W8EA 1L8LA 1WPXA 4EG3A 5JJIA 3SXUA 2ZW9A 4CM8B 1U0GA 5LJLA 3PA8A 1ECBA 4KRFA 2DRIA 3LIPA 3WK5A 1E96A 5KCMA 1V7CA 3L5OA 2HW8A 4M54A 5CB4B 1JA0A 1V4VA 3NV7A 1SKUA 2GD6A 2X40A 3MRSA 1VP3A 4PS0A 1T13A 4KYVA 3O4VA 2R6AA 3SWWA 4N40A 1VE9A 4RDCA 3ETCA 3L04A 1VKHA 1J70A 4IJVA 4EB8A 4RM3A 3R5JA 5LDGA 1P4GA 3HE3A 3R3ZA 3IOYA 3WKEA 2O8CA 4J7XA 2ZVDA 3K3PA 1CJVC 3S2ZA 5F1YA 4DW8A 3AP3A 3E7DA 2P2ZA 2CLMB 4BAZA 1MT3A 4FGUA 1F6WA 5E2BA 1NU6A 1FFGA 2A9OA 2EBWA 1PZNA 2FN3A 1V47A 1PWYE 3U4GA 3NMUF 3BRWA 4KXLA 1TLLA 3L7YA 3UHPA 4QU9A 1T5IA 1ATZA 5I9SA 4DHEA 2YV4A 4EI2A 1DUVG 2A9KA 5EIOA 5JDIA 3NM6B 1P5HA 1Z6XA 4MGZR 2WF9A 1V8PA 5AKZA 1Z8FA 2NU7A 3QKSA 2B0CA 5DM60 5BN3A 2QN1A 2XGMA 3EFOA 3HKDA 3LUHA 2HDWA 4R54A 5E8RA 2ZTLA 1J23A 1V2HE 1P29A 3DLPX 4I4TF 1J8FA 4YREA 2MCFA 2XE4A 5MGNA 1TF2A 2C4NA 3V1UA 1FS5A 3DFMA 1YKGA 4BFCA 3Q5DA 4RANA 4L5JA 4YRQA 1ML3A 1MAWA 1UDCA 2VQEB 2HJ9A 3KKEA 1RNLA 5F3RA 1WD7A 5AI4A 2KI5A 5B58T 3TW4A 3W5HA 1MXHA 4LHYA 2ZK7A 3KCNA 4A15A 4FI3F 2V8OA 3HB9A 2YDYA 2IYOA 5JHHB 4MINA 2WB4A 4PONA 1GA4A 3IAM6 2N1BA 3TXAA 4JJZA 5G53C 4M7RA 1S7CA 2IYXA 3HCEA 3ZNNA 1OGYA 1IY8A 3EOZA 4Y1RA 4MWOA 1GPNA 2RHOA 2VDUE 1G3MA 1GL9B 3LBIA 2PLRA 4PLWA 2C31A 5LIPA 4AD8A 1AKYA 1RYZA 3FYHA 4U2CA 4OBXA 1AGRA 1VLQA 4LYFA 4QL3A 5AOVA 5EJGA 1JA1A 4TVBA 5EAIA 2WYHA 2IP1A 1BDJA 3KKZA 1TYEB 3ENNA 3GYBA 3EPRA 1KF0A 3DKVA 1PNOA 1HEIA 2WDPA 3R0IA 5FEMA 2LWIA 4LOKA 4FYWA 1PZMA 3RVBA 1I32A 2ZM6B 1E61A 1NQ5A 4LY3A 3DR3A 5EUBA 1J8DA 4RMHA 3CVXA 4LV5B 3D6JA 4KAXA 5DP1A 4JZYA 3TB6A 4I50A 4WGFA 3UJ8A 2YZ7A 3UOWA 1U3WA 3NCHA 1NP7A 4I6JA 5DX1A 5HFAA 3EXFA 3NOOA 4GKJB 1GSOA 3L49A 2YQ5A 5CVJA 5EXPA 3WWEA 5MF6A 1KC3A 1L4UA 4C3UA 1JDSA 3MNFA 3L8GA 1OUMA 3QIVA 4TRJA 1KQGA 1XRSB 2EFEB 1BE1A 3BB3A 1W4BA 3VC7A 4RXTA 1EFCA 3GA7A 1E3SA 3ELUA 1WDKA 1OLUB 4H1WA 1LPPA 2WSBA 4HHEA 3V4FA 2H2DA 1JQLB 3KM0A 1KP3A 2SCUA 2G7ZA 1AQLA 4F86A 2CNDA 3KUDA 1TZMA 4DIOA 3GYGA 2GH1A 1WCIB 3F49S 4EHLA 3MW8A 2PA3A 4NZNA 1DGQA 2C8JA 2BN4A 4XEUA 1JVSA 4CTJA 1E1QA 3O8NA 3R76A 4UREA 1JLMA 1IRXA 1N2CB 1DHRA 1XZQA 1Y9ZA 4Y3UA 1FVXA 3TBHA 3LLCA 3CONA 4CIBA 3H97A 3T7AA 1F14A 4N5MA 4P4NA 4KGVA 4YRJA 3GJ6A 2AFIE 3WKAA 3CN9A 3LL7A 1RACA 2HHCA 2B9VA 1MC5A 1E60A 4FPXA 2UUPA 4NF2A 5HJEA 1GILA 3N0XA 3WLQA 4HH3C 4OHBA 3OLXA 3WMEA 4CCYB 2VZLA 2YQ4A 3LHFA 3FNQA 4MUNA 4TMXA 3GFOA 3LBNA 4BQEA 3F5QA 3FZQA 1LF0A 3CWCA 3E48A 1FUUA 4DLRA 5JCZA 3TFQA 1QTQA 5HYVA 5D3QA 1YOBA 2FWRA 1NUUA 2XT0A 2C4MA 3GCZA 2F55A 1XJWA 4KQ6A 2PS1A 2I67A 3OCXA 1Z6GA 3FA2A 3IR6A 4FZ5A 3G5LA 1V3VA 4GT1A 4X84A<