3FPKA

Crystal structure of ferredoxin-nadp reductase from salmonella typhimurium
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
247
structure length
247
Chain Sequence
b'ADWVTGKVTKVQNWTDALFSLTVHAPINPFTAGQFTKLGLEIDGERVQRAYSYVNAPDNPNLEFYLVTVPQGKLSPRLAALKPGDEVQVVSDASGFFVLDEVPDCETLWMLATGTAIGPYLSILQYGQDVARFKNLVLVHAARFAADLSYLPLMLELQQRYEGKLRIQTVVSRENVPGSLTGRVPALIENGELEKAVGLPMDKETSHVMLCGNPQMVRDTQQLLKETRQMTKHLRRRPGHMTAEHYW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-NADP reductase
molecule tags Flavoprotein, oxidoreductase
source organism Salmonella typhimurium
publication title Crystal Structure of Ferredoxin-NADP Reductase from Salmonella typhimurium
rcsb
total genus 69
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2009-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3fpkA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3fpkA02
1OGIA 3U6KA 1KK1A 2NPFA 1CNFA 3W2EA 3WYAA 2BF4A 1QVGB 3W5VA 2DY1A 2BM1A 2RC6A 5H5JA 4Y9RA 1R5OA 4TMVA 3G71B 5KSWB 3WY9A 4YAUA 4PGOA 4N3GA 1E64A 4B3XA 1YI2B 1F60A 1EP1B 2XEXA 3FPKA 4G1BA 2CRVA 3LRXA 4TMWA 1YITB 1Q86D 3JQQA 1EWYA 4TMZA 3VMFA 4HE5A 3AVYA 3J81k 2ZITA 1Q81D 1E63A 1DDIA 4B48A 1VQLB 4HE6A 4EH1A 1AIPA 4RD3A 3CMAB 3MCAA 1GAQA 3MHPA 1OGJA 2OK7A 1KQSB 1D8TA 4UAJA 3B78A 3WNBA 2B7CA 1SKQA 1FDRA 1VQ5B 3CCLB 1VQKB 1IJFA 4ACAA 2QTLA 3W2GA 2OTJB 2AHOA 5AN9A 4AC9A 1EP3B 3U6BA 3SJZA 1H42A 1BQEA 1ZM4A 4RD2A 3VO2A 5FA6A 1KK3A 3ZZ0A 1Q7YD 2QA4B 2PLFA 2J7KA 2YWGA 4FWTA 1QFJA 1TLLA 3I56B 3OJXA 4NBSA 1W87A 1IB0A 2OK8A 2BPOA 5HXBA 2DETA 5TR9A 4M53A 1U2RA 1SM4A 3CCQB 1G7SA 4R71A 4YHBA 3I55B 2QTZA 1EFUA 5DSZA 1QUEA 2E1RA 1VQ7B 1D2EA 1F20A 4QHYA 3QFTA 3AVWA 2B7BA 1N0VC 3QFSA 4M2LA 3PENA 2VNJA 1XB2A 4M4SA 1M90D 1DDGA 4TMTA 1KC8D 1XE1A 4NCNA 1W2BB 4LBYA 1WDTA 3CCRB 1S72B 5EMNA 4B44A 3QSYA 2C78A 1BJKA 4Y9UA 1N0UA 4TN1A 1KD1D 4ZGNB 4Q7JB 5GV8A 1I7PA 3CD6B 1M1KD 3ZBTA 1CNEA 3W5UA 3ES9A 3E20A 2PIAA 3ZC3A 4PC6A 1DARA 4G1VA 1QX4A 1R5BA 3CCUB 4YALA 2BSAA 1EFCA 3OZWA 3G4SB 1JNYA 3CCJB 4IW3B 4ZCIA 3WNCA 1NDHA 1FNMA 1QVFB 1W35A 4ZCLA 1KTVA 3MMPA 4RD1A 1Q82D 4P3YA 3E1YE 2BVNA 5TY0A 4G5GA 4LBWA 2YWHA 2C77A 3ZBUA 2FX3A 1QGAA 1K73D 4U9UA 3LYUA 2GPJA 1YJNB 1UMKA 1CQXA 1JA1A 3I1FA 4PC1A 3CC7B 3FJOA 4ZV4A 1J9ZA 2VZLA 2EFGA 2QDXA 4PC3A 3CCMB 1AMOA 5JBQA 1QFYA 2HDNB 2X3UA 1S0UA 2D74A 1GO2A 4N3NA 2RC5A 2BV3A 1E62A 3WNDA 4K1XA 1K8AD 5TV2A 2VNIA 3V76A 1FNBA 4BPRA 3AVTA 1GR1A 1EFTA 4LBVA 1G7RA 4C43A 3WBKA 4FN5A 4B4DA 1KJZA 1ZM3A 1JB9A 3W2IA 1JA0A 2QN6A 3WBJA 2DERA 3WXMA 2VNKA 2BGIA 1ZM2A 5THXA 1VQ8B 4DQLA 2YWEA 1EXMA 4WQMA 1EP2B 1G7CA 3W2HA 3AGQA 2OTLB 4LC0A 3JQRA 1KRHA 2GQFA 2BM0A 4AF7A 4RCYA 3AVUA 2QEXB 1QGZA 3P26A 4P6VF 4M1KA 1VQMB 4YAOA 4PC7A 4AF6A 3CC2B 4M0LA 3CCEB 3LO8A 3P27A 3CXCB 3VO1A 1ZM9A 4YAFA 1DG1G 4PC2A 4ZCMA 3CCVB 3W2FA 4QFMA 3CMEB 3VNVA 1D1NA 2YWFA 4F7DA 1IJEA 4B43A 4J0QA 2HMAA 1ELOA 1B2RA 1VQ9B 1QFZA 4C0SA 1FNCA 4LBZA 1TVCA 4RD6A 1BX0A 2XNCA 3OJWA 4TMXA 5GV7A 4MYUA 5H59A 2QMUA 3CW2A 3OZVA 1N8RD 1W34A 1TTTA 2VYQA 3QFCA 3AVVA 1FNDA 3LVBA 1NJID 4ZGQB 1VQOB 1GAWA 1YJ9B 2B5OA 2DCUA 3U2QA 3AVXA 1OB5A 4Y7CA 3QFRA 3B82A 2BGJA 3OW2B 2R6HA 1FRQA 2XNJA 4RD0A 1OB2A 1VQ6B 1YHQB 1QGYA 3W5HA 3CCSB 1R5NA 1VQNB 4YAWA 2CNDA 3CB4A 4H9GA 4RJLA 1BX1A 1VQ4B 1JJ2B 3OZUA 1B23P 3A1FA 4B47A 4RCZA 1G7TA 2DEUA 1YIJB 1FRNA 1QH0A 2VNHA 2PMDA 3CRZA 4ACBA 3CC4B 3ZZTA 1GVHA 4FK8A 1H85A 1K9MD 1QUFA 3VNUA 2EIXA 1HA3A 2BN4A 4DQKA 1GJRA 2BMWA 1KK0A 1YJWB 2HCJB 1TUIA 3JQPA 3G6EB 1ZUNB 1KK2A 3QE2A 4RD4A 3CPWB 1A8PA 3ZZUA 3B8HA 1QG0A 4MYTA 1VQPB 3AGPA
chains in the Genus database with same CATH superfamily
5ALLA 2MU1A 3D8NA 3KLBA 1CY4A 3R6LA 1MH9A 4KL8S 2B25A 5JPDA 2FUG1 3ESAA 2YHIB 1XCMA 2W90A 4JJGA 5C37A 4PLZA 5IUNC 1F5SA 1Y9ZA 3VJRA 4LWOA 3L0YA 4GP7A 2ZIGA 3LQ4A 4U0KA 1VJTA 2WAXA 3ST7A 5A4MS 4Z4FA 1L8OA 2AHRA 3FLAA 3PX3A 4W1QA 5JIBA 5K0EA 5I4CA 4PX2A 2GVZC 3FKJA 4IG9A 1E3ZA 1QTNA 4YBRA 1G5QA 1E66A 4J76A 4L85A 1D5CA 5BR4A 2I03A 2GRJA 1V1MA 3BZUA 2RE8A 4QWMA 3LCJA 3SLDA 1IEWA 2O5CA 5H70A 3DOFA 2VXOA 1FW8A 1UXGA 4LWZA 4X1YB 3EVBA 3RF7A 5B57C 4R51A 1OF1A 1MHTA 1HYBA 2FGKA 4R6WA 4F11A 1M2HA 4GXRA 3HHEA 2WZDA 1RVV1 4K26A 5IC4A 3A6DA 5HZMA 3T38A 4PNEA 1UKYA 1LPOA 1EQ2A 1IRXA 2FEMA 1WKBA 1PJLA 4P93A 1BE8A 2EG5A 1SHLA 1FDSA 2IIVA 2RJ3A 2J30A 3LBNA 3R23A 1WWKA 1YITB 4N0QA 1U2DA 2AUNA 3NVKI 4QPDA 4NDNE 4DIFA 4UM9B 1J00A 4TRNA 1UBTS 1U2QA 3EQZA 3LUPA 2LIPA 3IDOA 3NYRA 2ROQA 3IJRA 3CP2A 3PSAA 3D0RA 5D01A 4ZI7A 1CY0A 2F9LA 2X8BA 3H5TA 4HAIA 4O8ZA 1E4EB 1SHZA 2HXSA 2P0AA 3BIWA 4BGEA 4GKJB 4MK4A 4XLEA 4XWOA 4YJGA 5ULLA 3SAJA 4MJ3A 3SK0A 3OIYA 4OB6A 2IU6A 3BJMA 1X0XA 3Q7EA 5F4MA 3ONUA 2ACVA 4ZO8A 1YCFA 3TAHA 4Z7QB 2ZUDA 1ODFA 1B43A 1KJYA 2DWQA 5FULA 1SUEA 3G2LA 1CUFA 1RHJA 3EUWA 3L1UA 5EA2A 3KYCB 5TX7A 4BO7A 2OK7A 1H05A 1LBHA 1ZCFA 1E3MA 5IC6A 2IP1A 2NUPB 5K5EA 1J2JA 2WSLA 4L8LA 2Q45A 3FPAA 2O8CB 3FXAA 4EFLA 2VYFA 4MYDA 1UKCA 2VL7A 1ORVA 4AS3A 1F1BA 3O3OB 2XTAA 2QM3A 3AHFA 4NDAA 5DXJA 4EWLA 3GB9A 3KLOA 2PVCA 2AOVA 1P62B 1HDZA 3FTNA 3N07A 4MWEA 4K6KA 1Z07A 3OZXA 2VQEB 1JHMA 1TFRA 2CJFA 7REQB 4XONA 1NVKA 2A35A 2XWPA 4P58A 4IDGA 1XZDA 3CW9A 2GO1A 3OPYA 2Z1DA 3TG8A 5G2OA 3SG0A 4CM6A 4ZYTA 1UBSB 3K9WA 2OHVA 4CL8A 2I0FA 1EA7A 3SDBA 5JY6A 5AOBA 5EUCA 3WMRA 2Q29A 3AEKA 1UEJA 1ZXLA 1CUVA 1D07A 2AMYA 2HBZA 2L82A 3ABSB 5E1OA 1HFJA 1XDBA 4EL5A 2Q5IA 4ZK6A 3OFSA 4RWZA 1I5EA 4NQZA 4MKZA 3LXRA 5IYQA 3SC6A 3DV0A 2CZGA 2HWYA 3AL2A 1XFAA 3O0TA 1GZ6A 2G71A 3W78A 1E6MA 3GN2A 4GP6A 4DCUA 1SIUA 2LZJA 3QU2A 3WK9A 1HE8B 3E58A 3I30X 2J41A 2WAYA 3NC4A 4FOSA 2PL5A 4BEVA 1Q22A 3KWLA 1KXJA 4ZOCA 5TMPA 3EY9A 1KI7A 5FJIA 4C5AA 3UUGA 4PO3X 2CLIB 3A9WA 3ADPA 4YIHA 3UT6A 1V1JA 3EC2A 4F91B 3UMMA 4GX1A 1EFHA 2VDOB 3TTVA 2BUCA 1K4KA 2NYRA 1IZ0A 2ODNA 2PRSA 2PZFA 2YXDA 4XLTA 4AZ3A 5KQRA 1K9VF 5LZ2A 5MN6A 2A88A 3A9UA 1XB2A 1YASA 1RFGE 2VR1A 2W6OA 3IJEB 4JX9A 4RPDA 1RKBA 4CMHA 4J1TA 1DX4A 2XY4A 5C35A 9LDBA 1GGEA 1JWBB 1BFDA 2XDYA 4KQEA 2DSTA 2VTDA 4P4LA 5CXXA 4B31A 3JTMA 4FFSA 3EA5A 4PFJA 3U1TA 5CNIA 3O3CA 1A8HA 1CLUA 3ZHSA 4U2KA 4WA8A 3UHJA 1V6SA 4RGBA 2HQSA 4DMGA 2EERA 5DHTA 3KZVA 3A2KA 2O0MA 4BN4A 4KQ6A 2BCGY 4LZPA 3UA3A 4LOIA 3NT4A 3CZRA 3NWOA 4FS8A 2F00A 3IVGA 5L3ZA 2WWTA 2N1MA 3I72A 2VDNB 4G24A 4F4CA 3VC1A 1CC1S 4TT3A 3U0BA 3LQRA 1NQOA 1Q1EA 5L51A 3RS8A 4LXGA 4EMBA 4C7OA 4YGXB 3DSRA 1NJGA 3IKMB 4HT3B 4IMJB 4V0OA 3IHLA 1ZHOA 2XV1A 3TIIA 4RLZA 1VSTA 2BJHA 2QD3A 3B1ZA 1DEKA 2BFCA 2X77A 3EUAA 1EAMA 2VHVA 5FTMA 3U3ZA 3SSNA 2PUAA 1OI7A 4HSEA 4OA8A 3FETA 3IR5A 4X7CA 4KGZA 4E32A 3M1YA 3DO8A 4G5HA 1W94A 4J9UE 4NESA 3ZLTA 1GWNA 1MQAA 2WK1A 2KMLA 3BREA 4LPSA 4P98A 1W4CA 4Z0NA 4ARZB 1V95A 2PIAA 4EHLA 4ZI7B 3PFGA 4H77A 1JQKA 2PKQO 1IOWA 5DTRA 1SUSA 1QX4A 4MR9A 4RZXA 2ZAGA 1PU2A 4Z4HA 2QMHA 1KDTA 3HUFA 4QUJA 1RIIA 1RJ9B 2JC3A 4ZT4A 4YALA 3HDTA 2BSAA 1X8JA 3R8XA 1EFCA 3KD2A 2C5AA 1P0CA 2ATEA 4K05A 5F64A 3G2IA 1AN9A 1ZFNA 1W44A 2ZRLA 1BNCA 3MJRA 4FFMA 4D4JA 3RANA 2XBLA 5KTYA 4Q05A 3R6GA 2IUSA 1OW3B 1RLJA 1QQ5A 2X2PA 1R6AA 3BHMA 3PVZA 3WR5A 5AOVA 2OV4A 4UU1A 3R7FA 2EARA 4XN0A 3C4VA 3GH1A 1SWVA 3MQ2A 2WFAA 3COSA 3DZIA 3SQMA 1XCBA 5LD2C 5TGTA 3KELA 4XWTA 1QOPB 2I22A 4G5RA 1PZNA 1COWA 1UBRS 4Z4CA 4E21A 1K4MA 1E58A 2OGSA 3LF1A 5F7ZA 1RWVA 4L4YA 1QX3A 3ZHRA 4RQTA 1Z63A 3PA6A 1T1RA 2CEAA 4ND4A 1DAEA 1XX6A 4AKHA 4HY3A 2RB4A 4F12A 1OXBB 4HBZA 1Y48E 3AILA 4HNHA 2A0WA 1EHYA 3B85A 1RRMA 3A6PC 1SZPA 2EKZA 1M8FA 4RM2A 1R4ZA 3I6QA 5KVCA 2G1AA 1X7YA 1ATZA 5AOAA 1NFRA 1QAMA 4QUKA 4CKWA 5GJVC 3U9LA 4DNRB 3A1EA 1LTHR 4M89A 1NSFA 4E31A 1WOSA 1NVTA 1AVTA 2IU4A 4C0AC 1M1NA 3G5UA 2PZJA 1QHXA 3C8DA 1GGFA 1GDHA 2R6GA 5FF9A 1CD5A 1EGMB 1T2FA 4D99A 1YKFA 3MJEA 4M99A 2EZUA 3EGXB 3U0VA 3QYPA 5GINE 4CQJA 2G1KA 1JQEA 5TVKA 4OP1A 1TMKA 2FPIA 3A3YA 3NATA 4N5LA 1CZNA 3AI7A 2GPBA 1DQPA 4ZRNA 2C1EA 2YZGA 2DQYA 4HAZA 5K3SA 1MIOA 1AMOA 3DOEA 2GPYA 3FKSD 3NPMA 4RANA 1UJ4A 4BMXA 4GUAA 3OHPA 4BKUA 1AF7A 2I1LA 4EECA 4E3ZA 2XSZD 4EUNA 4TKVB 5JC1A 1C9NA 4AY3A 3WJ2A 5TRDA 1KA9H 1SHUX 3RGGA 2G4LA 4M0PA 1T5TA 2ZZEA 1J42A 4CEJB 3GIWA 4FFLA 4KSCA 4TLLB 3RRYA 3ZHQA 4PG8A 1AKYA 5DBEX 3Q10A 4RH3A 2GJ9A 4B40A 5BPHA 6NULA 3LY9A 2HMVA 2ZTVA 3ZCRA 1JLMA 1LLCA 5CVCA 1NN1A 4P7KA 2A6PA 1ZLYA 1KY3A 4GBGA 4JUCA 2ZWIA 5EIBD 1B0AA 4ENPA 3RFUA 2JGAA 5LXTF 3ZWWA 1EWKA 4Z4GA 2Y3IA 3WSTA 4PRLA 2JATA 2Y71A 4AG6A 2XB4A 3KOOA 3P94A 4GHWA 4S1NA 1FDIA 5LZ8A 3RRZA 1JKJB 3RSCA 3WBKA 4EOGA 4UOZA 4LYJA 5AI9A 2H92A 1Y98A 3E3NA 4EGAA 4GU5A 4TSRA 2QP3A 3K6SB 3PVDA 2NNLD 2Z95A 4QYIB 3SJCA 1MGOA 1RPAA 4EHNA 3GA5A 1XF1A 1NRKA 1WOOA 3WQZA 2XWSA 4NI5A 4C1BA 3QP9A 4DC1A 2IEYA 1JIQA 1QJCA 4YN3A 2DERA 2LDBA 2IEZA 2OUIA 2PJZA 5FA5A 3Q3JB 2UZ3A 3G68A 4TTQA 2OD2A 2PH7A 2OQRA 2VKQA 3TXXA 2H4YA 5THXA 2IIBA 2OV1A 1KH3A 2ZANA 3FTDA 1W2HA 4ZVOA 2IU0A 1COZA 1W30A 4Q4HA 3VU9A 4AWXA 5ICCA 1BDJA 3Q8WA 4ER6A 1ID1A 3ISTA 1Z74A 1OAOC 1UJ6A 5A05A 1XEFA 1OFTA 5JCOC 3TQFA 2CL0X 3JQRA 2PTHA 3ICWA 1IQ0A 2IYVA 3THSA 3OVMA 4FCVA 4IINA 4RCYA 4M98A 2HW8A 3I83A 3OJ0A 2C96A 3PGKA 1CEYA 4XLCA 1QRRA 1FVOA 4FEGA 1SKYB 4RSGA 5E9AA 4AF6A 3IHKA 4ZAFA 3QWBA 4KOEC 4DCTA 5EJGA 3SJAA 3BT7A 2ZU6A 3AVQA 4RSMA 3Q2OA 2VCYA 4JXXA 2BHSA 5AP9A 5I9BA 5CRIA 1KF0A 4LFBB 1VHEA 2C5BA 3D64A 3WMGA 3G2HA 4QGAA 4F1KA 4X97A 1GTG1 1QHHA 3AKCA 4X8MA 3DR5A 3WL3A 3GWZA 4OBBA 4YAFA 5K6RA 4XR9A 4W99A 3P0EA 1HMPA 4Z1OA 2LXNA 4FJ1A 4R8RA 3OOCA 3CCVB 4YECA 1EU1A 2HF2A 4A9AA 4BQNA 4TVBA 3UENA 4KSBA 2YWFA 2GN9A 2PQ0A 4F7DA 1WUYA 3A1TA 4QXQA 4RPIA 5DTMA 3T56B 2XBMA 1Z4IA 2P8SA 4TSFA 3P0HA 2J3JA 4JI5B 2FEOA 1T9AA 3E22B 1QXSA 3BXGA 5ES3A 2IF2A 2OV2A 1B8OA 1JHAA 5HFAA 5C7YA 2C8JA 3FZYA 1J9EA 4D3FA 4N49A 3GAZA 2B4RO 1XNJA 4PCVA 3X2EA 1TMGE 3ZYCA 4CLDA 4CIWA 5IPFA 5JNWA 1YRWA 2CY0A 3MMZA 4FWBA 1YU9A 2QBYB 3WRXC 3ZCTA 3AI2A 1UKEA 1Y6RA 4FILA 2H5IA 1DHTA 3DVAA 1T6BY 1B14A 1WG8A 4D8TA 3IUPA 5JS6A 3GVHA 2J0UA 3ZHCA 4ARUA 3C7TA 3AR8A 3K35A 1TTTA 2BHLA 3H4MA 5CT6A 1MPTA 1FMLA 1Z5ZA 3QF4A 3LK7A 2ZATA 2GN4A 4HEQA 2XOXA 5BNFA 2AR9A 4OX9Y 4CCYA 1XG5A 4ZOBA 1ND6A 1C0LA 4HWOA 2OM6A 2ONKA 2P2YA 1US8A 1D0VA 4E3WA 4UTVA 4YQFA 1FFCA 4ZDKA 3SWWA 4JQCA 3PL1A 2O7NA 1DZ3A 3KR9A 4A0GA 1BOOA 5KDDA 2GZAA 1OB5A 2BZSA 2VRCD 2EP5A 3FRJA 5HF6A 1XXLA 3CF4A 1YT5A 5M04A 3CLRD 5AKIA 4X92A 1US8B 3LNCA 4G0OA 3AOEC 4PLPA 5LUBA 4D9HA 1MX1A 1FJGB 2V6GA 1FRQA 1OWLA 5J63A 4CLRA 3FZEA 4DLSA 1GSHA 3WYEA 4AI6A 3PUJA 3SNKA 3FVVA 4EHBA 1P3JA 3RHFA 1X1DA 5K0JA 3GPDG 4TQAA 4WN9B 2JJ8A 1GSIA 1Y37A 3BMQA 4R9SA 1I4WA 3OE1A 1K0FA 4HRAA 4KMSA 4DY6A 3HJUA 2G6BA 2QRPA 3KSDO 5LQNA 2WQZA 1XD2A 3TEJA 3A1FA 2JH8A 1S2IA 4B47A 5AHXA 2ACKA 4QG7A 4D43A 1K7EB 5AM4A 2G9UA 1PI3A 2GHRA 4NBRA 4KPEC 5G41A 3RS4A 1YIJB 4KBGA 5DE3A 2QKYA 4ACBA 4KH1A 4GX5A 4O59O 1GXSA 1I6LA 1PV2A 1QO0D 3BZBA 3TCKA 1GNTA 3EXFB 3MW8A 2GI4A 3HKCB 3NNDA 3NFYA 3IQEA 2KQUA 5AW2A 1JDSA 2PBLA 5DOZA 1WUTA 3CVYA 4P31A 2EIXA 4WESB 3H5IA 2GASA 2CD7A 3CKYA 1PNVA 4II7A 2KYRA 3K0FB 4NE9A 4JP3A 3G0BA 4DC9A 1R9NA 1I2DA 4PRKA 3TTTA 2MR5A 1SBCA 2QTMA 4YAEA 5AI4A 3G5LA 1FS5A 2JCBA 3AF4A 3JQ9C 1V8PA 1YE3A 4KACA 4XAQA 3BWDD 3RYHB 4BV8A 4DA0A 4E30A 4ZMSA 5MN4A 3H7AA 4LYHA 5E1MA 4IF4A 1BXZA 3FPCA 4Y9SA 5HK9A 4W6QA 3NIWA 5P8WA 1LPPA 1EH5A 3RYFA 1N2GA 3PFFA 4X93A 1HLFA 2E3JA 3LNTA 2CSUA 1L1QA 1I3LA 2QXYA 3MWEB 1M6YA 5BV1A 1W8DA 5HRAA 5BN5B 4X66B 4DR5B 3TZQA 4YCSA 4LYGA 1NU8A 2CEKA 4RLSA 5LQKA 3BCFA 1OA0A 2GXSA 3H94A 3DE7X 2D7DA 4A36A 1UK8A 3FSGA 1X87A 3CUTA 4DVGA 2VH2A 3QW2A 5HIAA 2C5HA 1YUBA 3EIUA 3KXLA 3GT0A 2IS4A 4JZYA 4ZQFA 4CI9A 2ZZFA 5H5JA 5AXBA 1H2HA 3PEUA 5LYJB 2PMCA 2G5TA 3GUHA 5BY2A 2GD6A 3B13B 4FFBA 4ZYWA 2QROA 1RI4A 5TQJA 3ZKWA 4JR2A 3PA8A 1IXZA 5CFZA 4RXTA 3H8VA 1KMHB 1QANA 4J0EA 1VQ1A 2H9YA 3IUSA 4YH1A 5JRDS 3BA6A 1XAIA 1I13A 2XWBF 3OM9A 3QE4A 4R8VA 4BRZA 3CEHA 3HBMA 4YNBA 4ZOLA 4QOEA 1XLUA 3W5SA 1OIVA 2P7IA 3KB2A 4C2UA 2YJGA 1YVEI 3FFBA 1L4EA 3FLEA 3HY6A 4GMGA 4YEDA 4BZZA 4C6HA 4KYVA 4IIGA 1EP1B 4FS3A 1MW9X 1DO0A 2GX6A 2MWMA 4HXGA 1ZS9A 4TPKA 4JXKA 2Z2KA 2F1HA 3ZK7A 3AY3A 3HI6A 3WLIA 1VCMA 3THRA 1FP4A 2DT8A 3RUDA 1BG6A 4MVJM 1YGPA 2QGFA 5IVIA 5JS2A 1P8AA 2HPHA 5DSTA 5F4ZA 4RTKA 4H7EA 3WHKA 3BWCA 2I2BA 1LY1A 4IICA 4MROA 4YUAA 4Z5XA 2ZI7A 1U8UA 4UNNA 1WXEA 4UCQA 2BTQB 3ZHTA 3TAUA 3LA8A 1O08A 1SD1A 1CNMA 3VV3A 3JV7A 1G4UR 4LYYA 3AIMA 3R3HA 3TQTA 2KBEA 2DKFA 1QG4A 4YCJA 4DMUB 2JGJA 3ZXSA 2DBYA 1L4UA 3CMAB 1BA3A 1T2DA 2EWVA 1S3FA 3WZ2A 1E3WB 2OQ2A 5CX1A 4C0XA 4ED9A 3U4QB 5HKLA 3DT6A 1D1PA 1CG6A 3KWMA 5ELMA 4PFSA 3HC7A 4KHPB 4D9GA 3B78A 1MB3A 1NR7A 1H93A 4FJ2A 4A4DA 3IRUA 2A59A 1B15A 2PZLA 3G6WA 4OATA 3CCLB 1S2MA 1JDZA 4XTCS 3C3XA 4EPXA 5C3MA 5BMVB 2FUCA 7ADHA 1EGHA 2HADA 3VVCA 5I9TA 3GPLA 4LI3X 4RQBA 1UAGA 1VBMA 1WPGA 5ALEA 4NU5A 3MRXA 3GLKA 1MAAA 4ZOLF 2X6XA 1XF9A 2B3DA 2UVPB 2AHOA 1E3JA 4M49A 1EM8B 4QJBA 3OX1A 3PXAA 5DM2A 1X19A 3GA0A 2ZUUA 1MFPA 3DEFA 3MB5A 2V6FA 1ZM4A 3VR6D 3AZPA 3TLAA 1NHGA 4MWGA 1INLA 1XQYA 4GYWA 2J08A 4U3JB 3LL7A 1N2HA 1X7ZA 3U09A 5DNWA 2J32A 2EFHB 1B1CA 4HDKA 4ER0A 4KSYA 3OJXA 4XSHA 1M0SA 3HMQA 2VHQA 4HQFA 4B5LA 4A0RA 4BX2A 2EFEB 1H94A 5JAUA 1N2SA 5K03A 1JU9A 1POWA 2ZE8A 1P7YA 1P7PA 4M53A 3VR5A 3K1AB 2J1LA 3AB8A 1JRLA 2DWCA 1QV9A 1O6FA 2CUZA 3DEKA 3G5AA 2QG9A 3QLVA 4F7WA 5D6OA 5A4JA 4GSKA 4DDWA 2BKXA 3DC2A 3S2SA 2XWQA 4RZSA 2XUAA 4D4GA 1RAAA 3LM8A 1JDJA 1HV8A 2E1RA 1MAUA 5F7JA 1W5EA 2IYTA 4N03A 4L9AA 3QFTA 4I9NA 1H0HA 1TJ4A 4LXHA 4OGWA 4RPKA 4UXJA 5HCNA 5I7OA 2CWDA 4WPGA 4C5CA 3D8RA 1I32A 4K9KA 5AHRA 4EIWA 4QPCA 1T1JA 3WIOA 3PNYA 3E0XA 1ADJA 1TRKA 1NRXA 2G83A 4RK1A 5CA1F 3OZBA 3U4CA 2CMGA 1JI3A 4RLHA 2DQZA 2CDAA 3LZDA 3RSOA 3E9MA 5B6JA 1ZZGA 2XTMA 1M90D 1ZH6A 2ZRMA 1JZTA 3BK7A 3I28A 3IP3A 4M87A 5C1DA 3L05A 2H0AA 3NTOA 3PWKA 4D6PA 1HE5A 2C59A 1W5SA 2QJFA 3I0MA 2G1UA 4O0MA 1V35A 3RVBA 1CZLA 1OLSA 3KDPA 2YTZA 4Z4RA 3QF4B 4X94A 3WHLA 3Q3GE 4Q6BA 5EJ8A 3AM4A 1IN5A 2B3TA 1VHJA 3EZXA 3ZGZA 4YRIA 5IZCC 2AS0A 1BCSB 2C1XA 5GAJA 1XWIA 1WPCA 2P6OA 3R5KA 3S5UA 1M33A 1S9HA 4AMZA 1FU7A 4KPUB 1KD1D 3D5QA 1S1CA 4ZGNB 2C88A 2ARKA 5G0TA 1TW3A 3COZA 4D02A 1PR5A 1G8YA 1Z25A 2GXUA 5F21A 2PX6A 4V38A 2WG1A 1YVRA 6Q21A 3DLHA 5BSVA 2BFPA 1UH5A 1WB5A 1SG6A 1G0NA 5CIQA 2NX2A 3H6HA 4TYMA 5LD2B 2ZVQX 1MEJA 2VJDA 1YLOA 4JKOA 4ENRA 5EJ4A 3I3OA 4DL9A 3UKOA 3H04A 2GKSA 1T9BA 3AX6A 4A2PA 3KKPA 3M49A 3R3XA 4UKDA 4XFDA 3QIVA 2X5XA 3ZZMA 4TL8A 4D92A 4MPPA 3HGTA 3FHTA 1DQSA 3AETB 3EE6A 4LNHA 1AK2A 2NPIA 3DDZX 4PC6A 4YDRA 5ILQA 2JCSA 4UNRA 4Y6OA 3VPAA 4EB6A 1PFWA 5DI3A 5AWFC 1WLSA 5EKUA 3WIBA 2PJRA 1YNSA 4DM7A 3GDGA 1M10A 3JQ8B 4QBKA 3DBHA 1AKQA 4BNZA 1Y1RA 2V6MA 1THMA 1RQGA 1E4VA 3JQBC 2C3UA 3AQIA 3FOCA 3N7AA 3PK0A 3FZGA 4JSYA 2IYFA 1USVA 3FDFA 4WKGA 4XM0A 4AG5A 4CMBA 1CE8B 2VP2A 3SHQA 5D6NA 1JJVA 1NXWA 1EFVA 2B8JA 3WRVA 1NDHA 4N12A 4X64B 4O4LB 4CMEA 1EWRA 3OLVA 2XB9A 4P7BA 1QVFB 4BUCA 4Y1FA 5IP5A 4YC7A 4OGFA 1XRNA 3BX1A 1GARA 2L42A 2YRXA 5A9SB 2V8BA 3ANNA 4FSDA 1MT3A 3E1YE 1T34A 1UWVA 3N86A 5J4KA 5ICSA 1JS1X 4AZVA 3A3BA 1NRIA 1RPJA 4UTNA 5E1DA 3JWIA 4GPEA 3CF6R 1YGYA 4GRAA 3IOYA 4JLVA 1A2OA 2M98A 1IHUA 3UY4A 3MBIA 4RY0A 5T3UA 3SC2B 3PB3A 4TN5A 2WP8J 2FSPA 1P17A 2O3QA 3NT5A 3CKKA 4X44A 3WYDA 4I36A 4PV7A 2X0DA 2ZI5A 4EYOA 3RYIB 3OZGA 2WV7A 3HJTA 1EDOA 2V4ZA 1JA1A 3T4UA 1FNSA 2MSCB 1KGSA 4KEAA 3ZGXA 3QI7A 4RVSA 2EQBA 4JDPA 4D41A 2J67A 3ZJ5A 1ZNYA 2UYQA 4EHIA 4OGKA 3GLGE 1GKLA 4UE3S 5DB4A 2F3UA 4MW1A 2BDEA 4CKWB 2FSUA 2XIJA 3PXBA 5E8JA 1E0SA 2D0PB 3O47A 4BFWA 2OP0A 1K89A 2LPMA 3BJRA 2AEFA 1JQ3A 1ZUWA 1SD2A 1M2GA 2YRWA 5HWSA 3EXAA 4Z7NB 1M2NA 3K6KA 2QGZA 4RL4A 1H1TA 2GK3A 1TUBA 3V32A 3CT6A 4AROA 2GMWA 2YMPA 3LPAA 4R1SA 4TX1A 3M33A 1UEXC 5IYZF 4KUGA 3S1SA 1A69A 1K8AD 1DOAA 3VYSB 4KXQA 1XR3A 3NETA 1BGXT 5HR5A 4IHJA 3WLLA 5HF9A 4RM3A 1M66A 1JAZA 3CMCO 1KKLA 2XYHA 1XYGA 1Z2CA 1SPBS 1XCLA 1FNNA 5CLJA 5K8UA 1RHRA 5L40A 4CM3A 2G17A 1G7RA 2O7RA 3DEJA 4L0DA 4W9NC 1NF3A 5DP1A 1UOOA 1BH2A 3AFHA 4PVDA 4CM8B 4IV0A 1QNLA 4RVCA 3PF9A 5HQJA 4B33A 2AWOA 3AY0A 3U3KA 1T5EA 1NUHA 4IBOA 5HJ5A 5IWCA 3FMPB 4R1QA 4J91A 1DJPA 4XCXA 5AI5A 3UCXA 4XQFA 2D59A 2QL9A 1I4OA 4BNMA 2XADA 2HRCA 1J97A 1PGNA 4KDCA 1BCRB 1VLVA 2CXPA 2VYCA 1J90A 3A1VA 3CX8A 3R7WA 2FW6A 3HCRA 1GPKA 1QHYA 4MKHA 3ZY4A 1DRUA 3FUCA 2VIIA 5EUMA 1XLWA 1AUVA 1VXRA 4X6XA 1IY9A 1NFFA 4BFXA 3QTTA 4HADA 2BGIA 3FNQA 1NN3A 2G82A 3EIEA 5AK3A 3V55A 4P1ZA 1N6IA 3FH0A 4P5PA 3TLXA 3GLVA 5CYPA 4LZNA 4DE5A 3HZRA 5C5CA 3A31A 4MWSA 3PVCA 4BWFB 1Z6TA 4K1LA 4AP5A 5JNSA 1UK9A 5KI6A 5FKJA 2NACA 1S8OA 1TIPA 4RJ2A 4ZEWA 4BFCA 1FS6A 5LXTA 3AHGA 1Q74A 3B5EA 3RLFA 3E3AA 1E3QA 3JQ7A 4E12A 4P08A 3X1DA 3LBHA 3EISA 2OZLB 2C3OA 2ZULA 2P27A 3JQEA 1KVSA 4JQZA 4LRSB 3R6KA 3ORYA 2F55A 4D3ZA 4FNAA 2WVHA 4Q3DA 3OCWA 1NUAA 3C70A 3ROGA 1YOVB 1B3RA 2P4SA 4G23A 2BHRA 1BE1A 3SX4A 4IGIA 3W9YA 2A5YB 5B5SA 2XGSA 1YQ9A 1QFSA 2HU8A 3I6ZA 2DUNA 3P9KA 3UA4A 5B1IA 3RVLA 1R15A 1DBWA 2FXIA 1T0UA 3A6HA 3OT5A 3ACBA 4IILA 4CDRA 1GYQA 4MR9B 4H4CA 4H7PA 2C2WA 2ZRDA 4DUPA 1N92A 1JG4A 4RHCA 3LGXA 3JR3A 3U7IA 4BO8A 2ORVA 4N6NA 821PA 1CE8A 1V25A 2C7GA 4ZCMA 5DNEA 2OXIA 1XRJA 5CB4F 3O4RA 4OGLA 1I4DD 1UOPA 1VYUA 3UUEA 3VNVA 3IAXA 3QWFA 4Y0VA 3NE5B 1K97A 1O4VA 1X3LA 5K6AC 2ZSBA 3OCUA 5FBZA 5IEJA 2QTCA 2M9MA 4BZPA 4UNIA 4A91A 1VPTA 1M76A 2I3BA 1YQGA 1L7PA 2PAAA 1RRFA 3EMVA 3V9AA 2NADA 1KVRA 1IHDA 4GWGA 5IDWA 5A88A 2PBRA 2OCLA 4WTOA 3PQ6A 5BSFA 3E7FA 1IM8A 1ML4A 3PC2A 3QYFA 2GYYA 4XYBA 3C48A 3W8FA 2YUTA 3Q6MA 2JFWA 1P4JA 1N8RD 4URZR 5JDCC 3RYIA 2VDMB 4B2PA 4DDVA 4E2YA 2VDQB 4BZWA 4W5QA 2UZAA 3GW8A 4LSZA 5LDHA 4AMYA 3MYYA 1LWNA 2XMZA 4X71A 4NBNA 1SXQA 3SQXA 4IX9A 2XMPA 3QFCA 4I4TB 1R4MB 5KTPA 1SKAA 5A4AA 4P0QB 1PJBA 5ALQA 2K4MA 1RRKA 1C8KA 3MJSA 2PJUA 5G1PA 4FGSA 4CR6A 3IXMA 1ESNA 3HCEA 1P18A 1GLNA 2PU7A 2CNWD 5JO0A 2KLHA 1Z6AA 2EP8A 3RQIA 4CG0A 1T2AA 2VJQA 3OP1A 3FVTA 4BMDA 4CLOB 1P4AA 2GO7A 4WBSA 4BCDA 2AE1A 5FFFA 1XTVA 3LOUA 1BDIA 2K2WA 3WO1A 3GWGA 1I8DA 3V8RA 4OJKA 2O8CA 1OLOA 4DDMA 2D5BA 2V6JA 3QV2A 1XMVA 2PKXA 4KQIA 5B3KA 2GBCA 1AHHA 3DBHB 3OCYA 2WTEA 3S0JA 4ZGBA 4P25A 3I9MA 3D1VA 3NBYC 4JBHA 4TKUB 1I30A 3EZ6A 3LFUA 1CEQA 2BFNA 1I01A 1SC4A 4FX5A 4FOOA 4I81A 3WS7A 1XU4A 4FSXA 1NZJA 2FG5A 4QDZA 1JJBA 5JSZB 1W88B 2GVNA 3IPRA 4HNSA 3N28A 1RR6A 2I1WA 1J5PA 2Y0BA 3GVXA 5G3YA 2FPWA 2CUKA 4C05A 4DLRA 4E0BA 4C89A 3GRVA 3ZLVA 1BJTA 1O5IA 2IYLD 1YQEA 2LGJA 1XBTA 2M2IA 3BUSA 2DR0A 3DBIA 5FV7A 2IS1A 4QXPA 4QQ8A 3EZNA 4BV2A 4XB2A 5IZCA 3UMVA 2GXQA 3AEKB 4LTNA 1Z15A 4W7HA 1MTOA 2P1DA 4C0LA 5C52B 4BAGA 1PHPA 4MKIA 2FDRA 5B58C 5ALDA 4E94A 4LJSA 2ZAIA 4I55B 4Y1RA 1RSZA 2XMCA 3BULA 3ZZTA 3CE9A 3ZWCA 3LV8A 1C3OB 1W4ZA 4KK3A 3E9YA 4XA8A 1NXSA 2O2ZA 3G8YA 1DIAA 4LOLA 3C6MA 3VJKA 4A82A 3E70C 3IDAA 5C5EA 1V0EA 4I9HA 2E4XA 1JG7A 3S40A 2SKCA 3PEWA 2JI6A 1I36A 2MYTA 3FA2A 1EQUA 3LC0A 1XEWX 1OBHA 1PL6A 3F5MA 1RU3A 2ASVA 3TTWA 1RXWA 1SCBA 1UKVY 2QU7A 5J4VA 3ND9A 4RUKA 1JEEA 3SHTA 3QRWA 4D4MA 3V42A 3HSSA 3IP8A 4XNFA 1UPTA 1IOLA 5B58T 4EY5A 1G42A 3CPWB 4IP0A 1DEHA 2D1RA 1JU3A 2YXBA 2IYZA 1X39A 2REXB 3DHWC 4EW1A 5JD4A 2RHCA 3IQIX 4QLOA 2QY6A 3W04A 1T4BA 4B17A 3DZCA 3L1VA 2QQEA 3MT7A 1Z0IA 4OIMA 2B5VA 3KZOA 1PVOA 3R3JA 5H81A 3ZE7A 1JKIA 1F5NA 4GECA 3T3PB 4R98A 1FJ2A 1I1OA 4FXOA 4GQIA 4O1HA 5ICGA 1EIZA 3PUXA 1JYSA 3DLCA 4PGFA 4IAOA 5FRDA 3UJ8A 1JFRA 3LCRA 3VYUB 3VZCA 4B7XA 1LFAA 3M8KA 5FOWA 1OMOA 2AR7A 4HWKA 5FI3A 1XJ0A 4CKBB 5BP7A 2R84A 4JI1B 3SKXA 2Q62A 4KIUA 4NBKA 4R1UA 2FPLA 4XMYA 5FI1B 3DBOB 4PAWA 4CF5A 4OK3A 4PG6A 2RIRA 4RDCA 2BISA 2P11A 1WX1A 3SFTA 5AMXA 1NY6A 3E2IA 3CRRA 1NVVR 4MI3A 2Y6VA 4MV5A 5EPUA 4HB2A 1Q0ZA 3THXB 3JAWB 2MSKA 3L07A 3LWDA 1T26A 2EFDB 3N0XA 1FLNA 2JEZA 2P68A 4FT2A 4Q3KA 4QDOA 4DJJA 2OB2A 4D25A 3PR3A 3M6VA 2CE2X 4G1FA 3ICCA 3NWJA 2YY5A 4BO5A 4C01A 1T3LA 5DT2A 5A4KA 3EGDB 1YRAA 3ITKA 1WZ2A 1DZIA 3AK4A 3ZHOA 2J33A 4LRYA 5EJ7A 1NC1A 3PFNA 1GT91 1LC3A 4E1VA 2K7ZA 1XDGA 3KQUA 2VZ8A 4XWYA 4JKIA 4QHTA 4RMIA 2DOGA 3GJ5A 1EM8A 1SKBA 4BO9A 4B73A 4FGJA 2OSVA 1RXUA 2DLCX 1H69A 3DGFC 2XOEA 1Q86D 5HZGA 4IHJB 4MW9A 2BBWA 1DC8A 2WIFA 4I55A 3NJ4A 4K0RA 1MJNA 1MABA 4JWTA 4PQFA 2F62A 2Y4NA 1Z4NA 3BWYA 2VJOA 3OOWA 5LIPA 1QU3A 3AVYA 1KZYC 1R8JA 3ABIA 3I92A 3JQAB 1B6TA 1XWFA 1PVVA 2LR0A 3EVEA 3Q15C 4L75A 1XYVA 4LXTA 4EKYA 1K6IA 1G3QA 3F5SA 3KJGA 2OP1A 3CA8A 3J80A 2GT1A 3GVPA 3V7AA 3T7IA 4EITA 1T8RA 2P3OA 3EVGA 3AUFA 3H16A 5HZAA 2J3LA 1GKYA 2Y9PB 3QG1A 1BOFA 3R3ZA 1D2CA 3GCDA 3WWCA 1AIPA 2NSDA 3SCZA 4Q9NA 3UOWA 1C1HA 3BAFA 2HI0A 4RHYA 5E7QA 4ZI7F 3KT0A 3DVSX 1H1LB 2VYVA 4OKIA 3A8IA 3LI2A 3ASUA 3QNUA 2J31A 5CT8A 2YN2A 4O4JF 3IKLA 3AL0C 3KOXA 1ZY2A 3DKVA 1L4LA 5BSWA 4IIYA 3H1AA 2JLRA 4TQGA 1XEWY 3HJBA 1DWOA 4DV5B 1WXFA 5CXSA 2DE0X 2EJBA 1SKQA 1ZH2A 1E7RA 1BLIA 4OHYA 2ZJAA 4RDLA 2OO5A 3ETHA 2UZIR 1CUAA 4F2HA 1SQFA 3C74A 1NULA 4ZZIA 2EZ4A 1QDLB 1IN8A 3EULA 4OBXA 5EG5A 1YS7A 2PMBA 3NP9A 1QF6A 1P0IA 1U3FA 1QBKC 1RLOA 1MOQA 2BSXA 2V7TA 1UK6A 1ADCA 4UZFA 4EJMA 4AC9A 4UVGA 3SVLA 5DM1A 2FR8C 2RGDA 2AKEA 3HY3A 4IIXA 2Q5FA 2ZAOA 1JU4A 1RBZA 3EIWA 3N2EA 3SOPA 5A5GA 5EJEA 4GNRA 4KFCA 5A9SA 1IVYA 1ZUHA 3R75A 5C1PA 4C21A 5ADWA 1O0BA 1HZJA 4CKEB 1Z34A 2PH1A 2YNMD 1AK1A 5IFKA 5E6TA 2ZZKA 5CM9C 1W87A 5L6LB 5I8PA 1OY1A 4GP9A 3E3MA 4RAQA 1N2XA 4MGZR 1RE0A 2DFKB 2V4MA 3HKCA 1H3NA 4Q00A 5E6SA 1OC2A 2B4AA 3LY5A 1SM4A 1HC7A 3AFOA 1M2OA 4HNVA 3H5LA 3QLEA 2OO7A 5JVDB 4GWKA 3H6GA 4QRIA 5ALXA 1D2EA 1CR6A 1P1FA 2QZ9A 3PRKE 4GC5A 4H4DA 4JB2A 1WMBA 1H8ED 4UHKA 3HUTA 2MSLA 1KJNA 1I8TA 2QG4A 2C4NA 1JH8A 2NSLA 1HNNA 2NAFA 2CE7A 1F2DA 2J45A 3DA8A 4YJKA 3OZSA 4DRZA 4IS2A 2R8YA 2GEVA 2FF7A 3G23A 1WB9A 4NFHA 1FFXB 4D56A 3ZU3A 2OBMA 4M4SA 4G63A 5LWQA 1KFBB 2XA9A 1DDGA 3D7NA 1EE1A 5DIFA 3V7FA 2QTHA 3OQVA 5FOVA 1Y7PA 3ZE1B 1XEAA 2GBFA 2M32A 3D81A 1SG9A 4J6EA 4OJNA 3UZUA 4EFKA 1H2ZA 4EUSA 2WKPA 5LP6F 4EKGA 2CMDA 3DBRA 4YUYA 1E2IA 1N1GA 1NJ2A 1TQDA 2ES4A 2Z43A 3GFSA 3SN6A 1UODA 1F48A 1E6EA 2WFZA 5C8ZA 1V0JA 3N3BC 5DASA 3KT3A 2EWWA 3A4TA 1ONSA 5JMWA 1VL8A 3AKZA 4F9FA 3CR3C 4BE9A 1Z33A 1Q0QA 1YJQA 1DLIA 3WB9A 5M5BA 1BXKA 3TK1A 1G60A 1UJ5A 4ZI2A 2VK4A 1RHMA 4IZIA 2ISCA 3UQZA 3U7EB 2WZCA 1VPVA 1Z45A 2RSLA 3QVUA 3OP4A 3CPXA 1T25A 3DM9B 5FLYA 5KX5F 5KC9A 3A3GA 3QPWA 5GZ1A 5JHGB 1UOQA 3OBBA 5ITZB 3ZBTA 5BXYA 3E15A 1UT5A 2GETA 2VYNA 3AOGA 4AMUA 3Q8LA 4B3MB 4OXIA 4G41A 5FBRB 5F9FA 5A6SA 4JBLA 1SVMA 2LZ0A 1A1VA 1FSFA 3EFHA 2HL6A 3LX6A 2EIHA 2YVQA 4Y2YA 1S2NA 3KJFA 2FPPB 1E79D 1K5DA 1ZCBA 1DBIA 2EKBA 2XMDA 1JMVA 3DL2A 2GM3A 3K9GA 3LX4A 2GCOB 5TPZD 4AG3A 5C7LO 4LE0A 5JMTA 1JP7A 2FEKA 1N0WA 1TM4E 3FN4A 2O8EB 2CLHB 2AMVA 2FSFA 4FHCA 1NPYA 4PNPA 1DADA 4D4KA 3CNEA 1FYWA 2PAFA 4YCMA 3MYRA 1MW8X 2J6IA 4I0WB 5IJ9B 1OUMA 4UATA 2ZXFA 3DL7A 3KSUA 1MNQA 1NG9A 3TX6A 1V6CA 3VH3A 1Y7HA 4KI0A 1DMSA 3QZUA 5IM4A 4L2IB 1H4VB 1YAHA 3IIEA 3N0WA 1WE2A 2XOKA 3DFFA 3AZQA 4LAFA 3W9UA 4D0GA 4FDTA 2CXSA 4WNAB 1E96A 1GFWA 3QUAA 3ZW8A 3FHJA 4KYUA 5FD8A 2BH2A 3M6WA 4NENB 2HFKA 1NOJA 1FYVA 4KVGA 1I0LA 4N8SA 4MKGA 3HU5A 4N3AA 4QQRA 1L7XA 4DNXA 2ZM6B 1FVHA 2L18A 2ID7A 1GZ4A 1NNEA 1A88A 4KREA 2CVHA 2WD9A 2DOKA 5K0CA 5U4XA 3EIFA 2W8BB 3MT8A 5BMVA 1WP9A 2JGLA 4LRTB 1BDMA 4Q7MB 3HXQA 1UMCA 5A3JA 4DKJA 1NSTA 3JWEA 2PLRA 4OTZA 1HEUA 4Q12A 5HOQA 3C6YA 1EDDA 2IYNA 3CIFA 3LYLA 2VO1A 3MNFA 4G5OA 4XGRA 3VA7A 4UQPA 2D0DA 2GEBA 2PZKA 4KTTE 3UJ7A 2WU3A 1U99A 2C7PA 1LDNA 1MR3F 2YV3A 1DJNA 2ZIVB 4D4HA 3GUUA 4NSNA 4ZHQF 1ZGGA 1UZLA 1YB5A 2WMDA 1AS2A 5ALJA 1ZGHA 3GOHA 4ENTA 3O74A 3M9XA 2RHBA 2W71A 3JQ6A 3PU6A 1A04A 5F2OA 1LTKA 3WYBA 5IX8A 1TZJA 1HNWB 3EBPA 1X1CA 1CFJA 1N3YA 1X7WA 1XCGB 2I2CA 4ZU6X 1U3DA 5C3UA 1ZC3A 2GDJA 5K6AA 1SOUA 3QITA 1Z7YA 3QEMB 3HGMA 3RHTA 1ORWA 2VK8A 2YZMA 5I7RA 3ZWNA 2EZ9A 4KK4A 2REBA 4NMXB 4NYIQ 3PC7A 1E0JA 2QJRA 3HVUA 3A9SA 3PDJA 3WJAA 2D13A 1D6JA 2R6FA 2JAUA 3MT0A 3CUKA 4X1IB 2LCFA 4XPIB 5IT5A 4JNKA 5LYJA 2IY9A 2RH4A 3MMSA 1GAJA 2ZYVX 5E3IA 2CBZA 1GYRA 4AWAA 2FE4A 3DJFA 3D2BA 4EI8A 3R3SA 3H83A 3RH0A 2C5FA 2PEZA 3DL0A 4HRYA 1KMHA 2BAGA 2VJMA 4MUIA 2OHJA 1MA3A 3UB2A 3WGGA 2MSEB 4Q0MA 4CDMA 1EE2A 1NMYA 3HL0A 4FUQA 2R44A 1T13A 3EY4A 2OBYA 1J39A 1UCFA 3IX7A 3N70A 4DIDA 3AIOA 2OVFA 4EY3A 5K99A 3PGXA 4A3SA 1NVMB 5EEGA 3JSXA 1TZMA 2O3JA 4YR9A 1MV8A 3NGMA 1PVDA 1SCJA 1IY0A 1YHYA 3W2HA 4NZMA 4WBNF 1SVOA 3D54D 3AGQA 2IPLA 4IJ6A 5CIYA 2R7AA 2OCBA 4YT4A 2AFHA 3VSCA 3TFWA 2OTLB 4LC0A 3L7IA 6ADHA 1DELA 3KEMA 5CGQB 5H3HA 1KRHA 2I6UA 3B20A 3OD1A 1QOZA 3LVRE 3DMRA 3G3EA 2VUUA 1SXJC 3EGVA 3QBVA 1GL6A 4BP9A 3MSCA 1E2UA 3VH2A 2JDID 1TCAA 4WKPA 2ZRJA 4CDNA 4D4LA 3KKQA 1F2TB 2W22A 1UD8A 3I61A 3AF0A 4PNHA 5K4AA 3BFXA 4EJ6A 3CWQA 4IDEA 3R5HA 1MX3A 4I6JA 4RDHA 2IF0A 5DBFA 2JCVA 1E7QA 2YWBA 4OUKX 3RKRA 1YS6A 4Q4JA 1VJGA 2VAMA 4TSKA 4WKOA 5A1JA 4CKXA 5IAOA 4GBMA 4RHFA 3FYHA 4MUGA 3SJUA 3KJZA 3UXEA 5KTSA 2VQ3A 4R0VA 2CZCA 4BVBA 5CTJA 1V8BA 3F3YA 3EOZA 4H6PA 4QO8A 3DXFA 3L4BC 5HBGA 3VNBA 2F4NA 3ZK8A 5SZIA 4YAKA 2XF8A 4Z9FA 3C3AA 4Y1EA 1NP3A 2ECOA 3FPHA 2EAUA 2M6LA 4DA4A 4JELA 3RUPA 3PLAE 2AEJA 4XIYA 3AVPA 4UQOA 3OKCA 4RF3A 4YMHA 1RWMA 2AGVA 3R41A 3IV6A 2GN1A 3HFRA 2FR8A 1GQYA 2G36A 3ISJA 4UM7A 4YROA 5DH9A 4P5EA 3GPIA 4QU5A 3CCCA 4ZWNA 4XQGA 1TYZA 5GV7A 4MYUA 3BMNB 3RFVA 1ZXBA 5BVGA 1G20B 4YMIA 3L40A 2YHAA 2HJGA 1H4TA 2H1VA 3BCRA 3KAQA 4X5OA 1IPEA 1EUCA 3ABQB 3D6VA 3I2JA 4NCJA 2Z9CA 3CX4A 2QE7D 2BKUA 2BZ1A 4FFRA 4HVLA 5EERA 2C2ZA 3AWIA 3CLTD 4WY8A 2JLUA 4F3RA 5KSPA 3MGCA 1NJID 4U9HS 4BS9A 1AGRA 3KALA 4QUZA 1KI9A 2FUG6 4WMLA 5GP1A 2VDUE 3U9TA 4B3SB 3BRWD 1VIDA 4M1SA 4LJRA 3AVXA 4Z51A 3C0KA 3LWNA 5KWVA 1J0XO 2SCUA 2VG8A 5IXYA 1KETA 1IBLB 4BGIA 3DVAB 1W6UA 4GMKA 4PCUA 3OU2A 1ZEJA 4DMLA 2XKJE 5ARCA 3OX3A 4XDYA 4RH1A 2OOSA 3F7TA 4YEJA 1XT6A 3V1NA 1GZ3A 3NC0C 3T0GA 3I4LA 4OG2A 2AKAB 1E3IA 4IXTA 1W0KA 1OASA 3WGYA 1T2CA 4GGOA 1I7SB 1VLQA 1N3BA 2X6YA 2O20A 5HIIA 3A27A 2O1XA 1C9YA 1O5OA 2IHJA 1Z4PX 3QK7A 1E2FA 4CTMA 2CNDA 3CB4A 3C87A 5AM5A 2FE1A 2YJTD 1HYEA 4RJLA 4RZ2A 1O57A 3K2EA 3HDHA 2CF6A 4ARZA 4DARA 1TCUA 5BSGA 3GVKA 3CC8A 4MVXA 1UXOA 4G6IA 1ULSA 2ZT6A 4RZHA 5TQ2A 4F8EA 1ECJA 1VHLA 2R1TA 4NAUA 1XZ8A 2OD9A 2OFPA 3NBFA 3OTGA 2QTWB 1ZEMA 4PGGA 3OZAA 4Y2PA 2MYNA 1LA2A 5L4SA 1QZUA 1HSOA 2DEUA 1VI2A 3G5MA 3UMBA 1QIFA 16PKA 1ZRNA 2QR3A 2QUKA 4HDMB 4J0CA 1PKVA 4QU9A 2QD5A 3V8PA 4AX4A 4RLFA 1TKCA 3G1UA 4FQ8A 3OJEA 4ZRMA 3R7SA 2XT9A 1YIAA 3V4ZA 3CC4B 5HUJA 3EQ6A 1KZLA 1CUWA 1CIPA 2VWQA 3A2NA 5C2JB 1FP4B 1LXCA 2L17A 3TLZA 2JEYA 4Q6WA 5FOXA 5EHXA 3MJCA 5LM3A 4ESHA 1YHZA 3SVTA 1KAQA 1RPTA 4OQ4A 2CLEB 3CLSD 4FDUA 4ZVKA 2OE2A 5EZ5A 2JGIA 4BVLA 5DVZA 1T6XA 2JBAA 4LYDA 4FFWA 3IIIA 4KQKA 1YFZA 1GU7A 1YJWB 1Q3KA 2G7ZA 4ZO9A 5EXPA 4OQZA 3HJGA 5DS0A 3HEAA 1R8QA 1SFRA 3FUUA 4H7HA 4O2AF 1U7UA 1YIDA 3KQTA 3L43A 3SJBA 5IF9A 4IQFA 1ZJYA 2ZQZA 4XIIA 2DGDA 2WYRA 2J5RA 4FCWA 4C0HA 4DQVA 3BDAA 4NJMA 4MYTA 3AG5A 521PA 3F90A 3W9BA 4IO0A 3I9JA 4N39A 5HQTA 5KOHB 2VZ9A 4R2LA 2QMEA 1THGA 2HPZA 1PSZA 1MIHA 3WFJA 4D0SA 1WR8A 1KZ4A 4RA6B 1GGJA 5E95A 4ZYZA 4LSWA 1M2WA 4NYJR 2IZ1A 2AJDA 2RC6A 1PEKE 1Q1NA 1L7EA 3B6KA 4C6RA 2FW0A 3GZNA 2ZJ3A 3CRVA 4BFZA 9ATCA 1QGUA 2RHRA 2VJPA 3B7GA 4KBYA 1G9SA 5AHKA 4AN1A 1YI8A 4HX9A 5M3BA 4YHHB 4CUKA 4WLNA 1U11A 2P90A 8OHMA 3TXYA 4RTMA 3C2QA 4DZTA 1GG8A 1M7GA 3MJDA 3SFVA 4C7BA 5JJBA 1L8XA 2PWYA 1XQVA 3J81A 3M3HA 3IGFA 3UWSA 4ZHQB 3DZKA 3H4VA 1W0KD 4TMKA 3R3UA 2XXAB 2JGMA 5JNLA 1N6HA 1E6KA 2FEPA 4ALKA 2GDZA 1YI2B 2RHGB 3P4XA 5AR1A 1OYOA 4WFJA 4JC5A 1MAHA 3EZGA 3HYRA 3FPKA 2EOAA 3GLHB 2Q1XA 3FDZB 5L8VA 3ORFA 4GOXA 3EXFA 1W9MA 2RH5A 4UREA 2BMVA 5F7OA 1BVHA 1XCPA 1G98A 2WD8A 4IIDA 3TUIC 2G76A 1V16A 3HI4A 3UAVA 3EZ7A 4EI9A 4BQSA 1B8NA 4E6PA 1DFGA 3LUGA 4AJLA 2EC5A 2O1WA 5JSKA 4G86A 4N82A 4CKBA 4KAXA 1VJCA 2AVNA 3RK1A 2AC7A 1IJBA 3Q5GA 2XRFA 4O4LF 2FMHA 1T9GS 1E2DA 4ZKEA 5U4QA 3T5GA 2Q8QA 1OKKA 1NBMA 2WJPA 3FDIA 3UJDA 3O2SB 6REQA 4HAUA 3V4LA 1G38A 1WUKS 3I1IA 1CUEA 2ZSFA 3FVRA 3KYDB 4R7ZA 4OSEA 1U3GA 5KWIA 1RZRD 1Z75A 3NIGB 5GONA 4PW0A 3QGMA 4P38A 3RYTC 4C4ZA 2IX3A 2ZT5A 1XGKA 2G70A 4I5EA 4OL9A 3JZDA 4HZUB 2VPYA 2B7LA 4UPVA 3V4SA 1TJPB 4JB3A 2DBQA 4OO3A 4YDSA 2ZIEA 4MQLA 2WVGA 5CUQA 4DXAA 4P4TA 1SQGA 3SEQA 4BQEA 3OEHA 3CLTC 4H1UA 5LVAA 1CJVC 4N3CA 4UHFA 1Y9EA 4BTEA 3O8OA 3RTEA 1W0JA 3VDNB 4LY3A 5AUPB 4I1YA 4YJ3B 2PKWA 4F0JA 4IUDS 4NMMA 4BEJA 4GOMD 4MTCA 1QQBA 3U4DA 1GQSA 1K5PA 5J5CA 3G2NA 2OENG 4B0OA 5HDBB 3UVEA 1ZLXA 3P20A 2XXBA 2YX1A 3WP1B 3SJZA 4B71A 3EZ9A 3GJXC 1A7UA 4WVLA 1ONBA 4BMSA 1U9IC 1UPCA 3DZJA 1RRPA 3B51X 3OTIA 1V11A 5CVVA 4Z9YA 2WIAA 3RUFA 3QLTA 1CY8A 3ZZ0A 2J0UB 3QVVA 3DWEX 2CXUA 1IUPA 3BK2A 5L3RA 4EX7A 5L53A 4Q1EA 1KP9A 1G17A 1D6MA 2XE4A 1XFDA 2FG7C 1EFVB 3OHSX 1Y1PA 1KI2A 4WASA 3P2MA 3IE2A 3SYMA 1DOHA 1LPSA 1YRBA 3ANLA 2WG2A 3AEYA 2EFJA 4J2OA 1I2MA 4ZN6A 4AKGA 3CISA 3KXPA 3NU1A 3ZV3A 4LECA 4CUZA 1I9GA 5TR9A 1L6RA 1YZVA 4HWRA 3BWEA 5J40A 4AJ9A 4ISBA 3MOSA 2CK3D 4FLEA 1SQ5A 3CCQB 2GUWA 4R71A 3JQ8A 3KFVA 2QTZA 4LCBA 4WXRA 1BGVA 4V0QA 4NBUA 2WWRA 4OK6A 3L79A 1RMYA 2X6RA 1IWOA 3WFZA 2W6MA 3G05A 4Q1BA 4DKXA 3DE5X 5FBWB 3NOVA 3HA7A 5EPEA 4LDRA 4KQCA 5E6SB 5E7JA 2SICE 2EXXA 4HATA 2G7MC 2Q2OA 4E09A 2HRRA 1XMXA 2ZYIA 2PS0A 2VNJA 3DTYA 3UWOA 1O87A 5JD6A 4EA9A 2VJJA 2HBRA 1SU7A 2H4ZA 2I2XB 2UUOA 2IWRA 3NIDB 3B1YA 3GEHA 1SMKA 1QNFA 3GOQA 3SHOA 1GPDG 2H1FA 3QTLA 2IZ6A 3HXKA 1Q0LA 3L04A 1TC2A 4PZAA 1XTBA 3SQOA 4URHA 3D6TB 5ALNA 1GPNA 3IXLA 1HDGO 3KVVA 5FL3A 2QEQA 2E37A 2ORYA 2TMGA 3DG9A 5F5NA 5GM1A 4ERXA 5KTTA 3VVBA 3JU4A 4GSLA 1T4GA 2YINC 3OKFA 5EXXA 5F5LA 5LBIA 4ZEOA 3T7TA 4PIMA 2A2ZA 4OD0A 4B5KA 1BJKA 4G09A 1FJXA 1E2BA 1FUIA 3B7WA 3GVIA 3ABOB 4I6EA 4W5JA 1J22A 1I51A 1SXPA 4Y2GA 1HEIA 1E9VA 1QH8B 1W5TA 2QSJA 1T9ZA 1DTEA 4BBPA 1W93A 2WFLB 3HS3A 4D45A 2CK3A 2ASEA 4BDTA 2HKIA 4E5KA 5FWXA 2R6R1 4IDBA 5AO9A 2FPKA 2ZIXA 4XL9A 4H27A 3CXRA 4KIFA 4FTWA 4J2TA 3ZE6A 2QG6A 1XKLA 1WZUA 2PS3A 3BF8A 4ARVA 4DV4B 3LQEA 3BGDA 4DCJA 2ZRFA 1SC1A 3GFVA 1LUAA 4F9EA 5HOEA 3M4JA 4LY0A 1RWWA 1A7AA 1OWOA 4UM5A 3T1OA 4J0GA 1PT5A 3L6EA 1CZOA 2BHNA 4HPJB 1J8MF 1II0A 1FYEA 4QC2A 4E03A 4LOHA 3LX5A 1HYHA 1NJFA 4NYIR 3GH3A 3TBKA 3ER8A 3JR7A 3ENVA 4YYZA 4QJ5A 5CH5A 2WM3A 3D8BA 3L8ZA 4F92B 1R5BA 3BIFA 1Q19A 3PPWA 3KFLA 2IE8A 1YDFA 5B53A 5J4YA 3ZDZB 5JD5A 2I99A 3B6EA 3E35A 1A9XA 2DP4E 4O4JB 1M9NA 2C95A 2Z3ZA 4Z0TA 3RVJA 3FTEA 4BATA 3LF2A 4CHGA 4FEEA 1T2NA 1OLXB 4WY2A 3GG9A 1WL8A 1GGHA 3OX4A 2ZSAA 5BQPA 4FVTA 4KN5A 3MMPA 3OM8A 3ZI0A 1NV8A 1KNXA 2X4GA 4N6GA 4ZDWA 1ABBA 4HX2A 5FUQA 3ZD7A 5BOSA 2H08A 3GLUA 3EEYA 3IQWA 3QOYA 3LT1A 2BC9A 5JE8A 1LH0A 3A9TA 3I9NA 4OHPA 4TV9B 1WXDA 4BQPA 2VEOA 5EHNA 1XDSA 1R37A 4YFVA 1XMOB 4FCTA 5E7MA 4JQYA 3RFXA 2EP7A 3N2GB 2VF5X 5EKXA 2XB6A 4GF5A 5L3QB 1WRBA 3R2JA 3D1LA 3KE8A 3W5JA 3MA0A 3O21A 1MAVA 3SXUB 2VQ6A 1RI2A 2HF8A 3A6KA 4C07A 5IYNA 4TZTA 5CDFE 1PF7E 2Y1GA 3MGKA 1TM3E 4CMGA 1JHOA 1FP7A 1Q1BA 3GPCA 1FFYA 1OR8A 5CIWA 4Z8YA 4LWPA 4WWHA 3VR4A 4ZV4A 1T4CB 4BX3A 2CMFA 2OO5C 4YIKA 1M0TA 2FV8A 4AFNA 721PA 2YQ4A 3BN3A 2IOYA 3S2EA 4PC3A 4BC1A 1R9MA 1KDYA 2WWYA 4PSKA 1P0QA 2I6GA 2Y1EA 2YASA 3C6KA 1VSVA 3I1JA 4MQ6A 3TW8B 1DXOA 4G0PA 3W90A 1JSXA 4R01A 2Q1WA 4MZDA 1L7AA 4RFVA 4MIYA 5JFTA 1VSUA 2YV1A 4C6TB 3B9PA 3C6ZA 4BP3A 1MB4A 2XI4A 1BMFD 4HFNA 4C7KA 4HQRA 4BRUA 3FCCA 1NMQA 2QI9F 4R54A 2CBXA 3PQ2A 2UVQA 3LTEA 1CY6A 4R8LA 4L5YA 1CQJB 5HIMA 4J3FA 2IC5A 1VCOA 3KZMA 3F0TA 2MT9A 2O2XA 4KKVA 1T36A 4MA0A 4NABA 2DLDA 4R0NA 4RLQA 2QHXA 4CWAA 5ALOA 1DC4A 1K63A 4G4JA 1GR1A 5CFQA 4YUXA 4AK9A 2AZXA 4ZOQI 4DAEA 1L5RA 2XR1A 4H7FA 4HPXB 3C8ZA 5KEIA 4F4UA 1V8ZA 4R1TA 1NP7A 3PJGA 1E98A 4FMDB 3E9DA 1E5QA 4H60A 4CUJA 1HDIA 4X05A 1OPRA 2C61A 4AJ1A 3QA3E 1M1YA 3STTA 3ZVRA 2C5EA 4DLLA 5BWMA 1V5WA 3I5UA 2NUAB 4RV9A 3EW7A 3RS2A 2G9QA 2BI4A 3W2IA 4FEYA 2BHTA 1WOPA 1J21A 5IJXA 4ZYUA 3LP6A 2AYYA 1ESCA 1IFXA 1MG0A 5CURA 1V8OA 5T57A 1A7KA 3UJPA 5C1IA 3UGJA 1Y7LA 1X38A 4J0HA 2QUIA 3B7PA 4DMFA 5LP6B 1VE3A 2YOHA 1VTKA 4QGFA 2QRUA 5LSAA 5ABPA 2C07A 3DQQA 3Q1LA 1L8AA 3IRVA 3ENKA 1B74A 1N9GB 2IBMA 2D4HA 5CP8A 3ANXA 1C8BA 5L6MB 2GERA 3BJZA 4TRJA 1MCZA 2OHOA 1W49A 1AB5A 3VR0A 3VR4D 2JVJA 5FYDA 4BL5A 2QEXB 1FQOA 4ND6A 3OTOB 5DU2A 1QGZA 1C8LA 4RKRA 4B82A 5LN1A 3BH4A 2FGJA 3LOPA 3DEAA 4H7IA 4PTZA 3CLUC 3JVEA 3NEAA 3HO8A 2I7VA 3LC2O 3CX3A 1VJ0A 2HA3A 3M6IA 4AIIA 4JENA 4YMUA 2FWBA 1KXZA 2GFIA 4PTLA 5ER9A 1FF9A 2JFPA 3LBYA 3T7RA 2W48A 4DRXA 1EFAA 3PEVA 1P0FA 3AKYA 4U5QA 4W8GA 1AXGA 1IH8A 2B9VA 2XUQA 3QVJA 2WU1A 3ZZ1A 3KOZA 1QVAA 1CUUA 1OBCA 1Z5NA 2NSHA 1IDOA 4U7JA 2QRNA 5DI3B 4A8PA 4D9BA 2FRDA 4PANA 1XWWA 3W5DA 2ZCJA 3B1KA 1N75A 2YUIA 3WB2A 3BFKA 1L4HA 3PQFA 1FQJA 3AEUB 5T7BA 3KZXA 3ZD9A 1AZTA 4XDZA 4PF1A 3AEXA 5JXHA 1QP7A 1XMQB 2WT4A 2X86A 4IRMA 1ZGJA 3R0QA 4J0JA 4ZJPA 4BNNA 5K2MA 3RV4A 1OBOA 4OBEA 5A3VA 2O54A 2UDPA 1FNCA 2MR6A 4JVLA 5CBKA 1YR3A 4GGMX 4WINA 2ZR9A 2P40A 3LT0A 4NCHA 5A2GA 2DSNA 2PMWB 3C1UA 3UT0A 1TEVA 4BNDB 1U7PA 1ZX1A 4RPGA 4EYQA 1XEXA 1KR2A 1QS0B 2A30A 2QMUA 1P7ZA 3A1WA 2NQ8A 1H65A 4HQOA 3GJ3A 4LHYA 5TPWB 3T3EA 1DIOB 3D4NA 3OIWA 4K6HA 3EPKA 3AR7A 1ZITA 3KZNA 3OLZA 4UC0A 3T0FA 2VYQA 3HB7A 1K98A 5LR6A 3T3HA 4RMHA 4YJ2B 3UT5B 5J35A 1M3SA 3DW3X 4GT1A 2AXQA 4OU5A 3N2IA 2X9QA 4N65A 5SZHB 3JRNA 4P3OA 3HXOA 5M34A 5IBQA 3TQQA 4N5MA 1M74A 3HMKA 3OPNA 2TRSB 4Z4EA 2P9QA 3GJRA 3LDGA 1SXGA 2ZBPA 2FPGB 1LLQA 3TXAA 2XWJI 4LF6B 5EMKA 3F98A 3K96A 3UGTA 2FW1A 4RV4A 3U5ZB 1QRSA 2ZETA 3N8DA 1DNPA 3IALA 3BQNB 1RKUA 2GEDA 4LVNA 1D2AA 3DB1A 3N2ZB 3T0IA 3WWEA 5FNVA 1DXYA 2P2NA 4XB6B 3BYZA 4JOCA 5EUQB 3RVQA 1TLFA 2OILA 1R3DA 4YCDA 4DDHA 4OKNA 1U0OC 5K4GA 2NUPA 1U8FO 1L7DA 3FCEA 2W8ZA 2JHFA 3PFCA 2YMLA 5EE0A 1N5LA 2PUVA 5DOVA 1E0AA 4DSTA 2AMJA 1IHXA 1U8XX 2PKQP 1PNQA 4DBZA 2Z6VA 1WCV1 3DWIA 1JAXA 3IBCA 2QPLA 3PICA 3ZQ6A 1MQ8B 1C7ZA 1ZH0A 2QP9X 2P2CA 2YW2A 2ZI9A 1VL0A 4N7BA 4NK4A 4NDZA 3PGJA 4RK0A 5LZ5A 1B23P 2CB0A 3BHIA 3IAM6 2PRYA 3EDMA 2X0EA 4FU0A 3RFFA 3SX0A 2HUNA 5CT4A 1UKBA 1B42A 2V7BA 4JIGA 3VDMA 1QYDA 2SBTA 5EIWA 4CM8A 4BKQA 1NOKA 1J07A 1JR3D 1X1BA 4CM7A 3ISXA 4JH0A 4YRNA 3MWDA 2DYIA 2H1OA 2GILA 1WXXA 2GK7A 1GD1O 1C2YA 2NQTA 2NXCA 3LLUA 3WZMA 3BQMB 4J0FA 4JL8A 1XTIA 4GRIA 3AM3A 1WY5A 1ICIA 1MC1A 5JDIA 2Q3MA 2WOOA 4P53A 1CQWA 3EARA 4YR7A 5AKEA 4BN5A 1XHEA 4TVSA 4I08A 3D31A 3ILXA 1DIRA 1FL9A 1HL7A 1IMOA 1S4QA 3KD3A 2HU7A 2X40A 3ONDA 3O75A 1JXAA 2X9LA 1J0CA 3GELA 4AJNA 3OQMA 5KHAA 2OG2A 3DFUA 1T4DA 2XT0A 3OM1A 5DX1A 3ESQA 4MIOA 2FWJA 1SBZA 4IHQA 3RYCB 3TG2A 3QUTA 4TGLA 3ZWBA 5CEFA 1XDDA 3NTXA 3H2GA 3IBGA 1CR4A 1P3Y1 2VDWA 1JDBC 3THYA 3JVVA 2DCMA 1K08A 2VWHA 2Y27A 3U17A 2EATA 4ND3A 2XQGA 4BNIA 1DRWA 2C99A 1VPWA 5DJ5A 1PR4A 1ZJZA 5A4FS 2BDTA 5KQMA 1E60A 1RTTA 3IDZA 1JJ7A 4XVRA 2AV6A 2P4UA 3P0JA 3BXFA 2QUHA 1E59A 5JVDF 3GCGA 5B1EA 1B7GO 1HI9A 1WCIA 2W6QA 2H1SA 3UFXA 2D5IA 2FB9A 2X22A 3QM1A 4N6OA 4NHEA 3UWKA 3G71B 2VPQA 1PQPA 1YB4A 2WJJA 2XA2A 1KC1A 1G9TA 1UJ2A 4QPNA 2JIOA 3ZIAD 3H2ZA 2PFGA 2B82A 3DTVB 1HH4A 1Q57A 3Q9NA 3WDMA 3O84A 4D82A 1WQ4A 4M8IA 1KDOA 1E64A 1QHHB 2WA1A 3KSMA 3PNVA 2JASA 4B9EA 4ZGGA 3EQ2A 2W6PA 1N6RA 2PN1A 1P45A 2BSQA 2FWPA 1X6VA 2ZJ1A 1DRVA 4JLAA 4NARA 4O8CA 2VA8A 4B6QA 1SURA 2PK3A 3O73A 4ECEA 2PUFA 2AQHA 1Y33E 4MR8A 5TSDA 1R0KA 2JD0A 5AJXA 4G1EB 4YUVA 3KX2A 3K8QA 3Q7PA 3VU3A 1T9GR 4X6LA 3ROZA 2IVFA 4HIZA 3L7CA 1FFBA 3DF9A 4YV0A 2R87A 3ETCA 3CTAA 1BXRB 2IPNA 5HIJA 4EP1A 5L4LA 4IGFA 1JSZA 1XCJA 3H17A 4IDAA 1W6RA 2HJHA 4GXQA 1JEOA 1G5FA 3WNVA 5KZMB 2E0IA 3CBQA 4BEBA 3L6RA 3H84A 3O9VA 2C03A 3ZV4A 1GCOA 4LHWA 2X6QA 3PYMA 1E63A 1JF8A 1JIVA 1I2ZA 1CK4A 1N2CE 5HEKA 1KYYA 3ZJUA 3Q9LA 4BWYA 3E5NA 1IEQA 1WPQA 1WULS 3T94A 2FUNB 1OX4B 3PNKA 3KR1A 3TD2A 3GGJA 1UJMA 3BGOS 3DTVD 1Y4AE 4GYJA 2NM0A 4K3VA 5KIAA 3OC6A 2JJ1D 1GAQA 1W36C 2E4YA 1NT2A 4H4EA 3NRCA 5AKYA 2GYWA 1PV4A 3HO1A 1JH9A 2I4IA 3L82B 4MUEA 4H3HB 4KH0A 3ZPXA 3SYKA 1KZHA 1JVBA 1M1YB 2BIFA 1Y9DA 1OFHA 2I2WA 2NZXA 3ZGOA 2I33A 4P6YA 1JKMA 2YJ5A 5JLAA 1J06A 5NLLA 4JEHA 4QNRA 1B8PA 1IDN1 1BHJA 3UGQA 1ACLA 2J3DA 1QZ3A 3P4UA 4NBTA 4OQDA 1XTKA 3S68A 1RYNA 5F35A 3RUEA 1E9AA 1NIPA 4AYXA 5B4TA 3QLUC 1TQ8A 2OORC 5HZHA 2PGOA 1PFVA 2CL6X 2V9PA 1P7VA 1JEYB 2CHUA 5C8YB 2CLFB 1OFIA 2DR2A 1BQEA 4J49A 5AJTA 5DX8A 1R16A 4ZVVA 1XAJA 2W6ZA 1E1QD 2X4LA 4HFRA 2FQXA 4FDAA 4IG4A 3LUFA 3UEOA 2I5PO 1KOJA 4L50A 1SC3A 1CB0A 2XE6A 2IODA 3LJKA 4EHFA 1AURA 1WZEA 3JD3A 4Y98A 4P4SA 2Q9AA 3E8MA 3TNDA 4CMAA 4JUIA 3INYA 4MUAA 5CLGA 3ZBQA 3LQ1A 3IUBA 2QNIA 3CF0A 1KEWA 1QPZA 1GXSB 1HBJA 1GUZA 3KSRA 4LWQA 4RQAA 3RBXA 3PC3A 4AB1A 4UFOA 3ICQB 5KDOA 1F8YA 1PL8A 2VTVA 4OI1A 1ZAYA 1NR1A 2NO6A 2YZ2A 3AONB 4OHVA 1GQ2A 3A9RA 5TIIA 3ADKA 4ATNA 1KSJA 1F20A 1NURA 1PQUA 2GH1A 3T5PA 3TIFA 2BFOA 2Q2WA 1Y0YA 1GNQA 1N0VC 1D04A 1N5RA 2P75A 3A4NA 3GBPA 5D1HA 2WKSA 1U28A 4FBGA 1OZ0A 1NUUA 3EF1A 1IUOA 2EJVA 5SYMA 3RROA 1QK4A 3WTCA 3SD7A 5DPMA 4Q7QA 2WT9A 2R5WA 2ZXHA 1I9CA 2C8KA 3LT5A 4HTAA 2Q0XA 1II8B 3TE7A 4ETWA 5DNAA 4NCKA 2AJTA 3N2YA 3KXDA 1PK9A 2RBGA 2XCQA 1XZBA 4V02A 2HIGA 4LBYA 3H13A 2R5NA 5ENVA 4B8YA 1NTOA 4CFSA 4MWTA 5FPKA 1EG7A 2Z5LA 4FI3F 5DX0A 4E08A 4MS4A 2FOLA 1TZCA 1CIJA 2GLTA 2E1BA 3PKZA 4JCOA 5BR8B 5EMNA 2J3EA 4WK4B 3RVKA 1KYQA 2RHHA 1Z56C 2OLJA 3BZWA 4IVNA 4LHZA 4OMDA 3DMNA 3QV1A 1JQAA 1JEJA 2KS6A 1BW9B 3CKLA 4MVJD 2Z83A 4U7TB 3AR9A 3IO3A 1RJFA 3NIFB 2WNSA 4I4IA 4IHKA 4ZV7A 2FNAA 2O3UA 1ORRA 4J7AA 4W7SA 5KYUA 4X7BA 3PE6A 4D9MA 4S1OA 2ZZGA 1GV0A 3HPRA 2D2FA 4E5DA 4DLPA 2ORIA 2P9BA 4P34A 1SPXA 2WNIA 3L8FA 4R84A 2EQAA 2QSUA 3I09A 3VC2A 1HUQA 1JSCA 1UWLA 2WT8A 3W4IA 1ZJWA 1UZAA 5KQPA 3PDWA 2BDUA 2W70A 1WZCA 4UD2A 3ZWYA 5JWRA 4DEXA 2Q3CA 1Z0ZA 5IYZB 1T35A 3JD1A 3KTFA 1C30B 1GNPA 4QJIA 1VZ2A 2VP3A 4BLQA 5CG2A 5JH7B 3H1TA 1XLVA 1H23A 2I3DA 3H87A 4WZ6A 3W7BA 4CMJA 2BFCB 1BMTA 4WKBA 5L7YA 2ZKIA 1XCOA 2OGTA 2ZYUX 3CINA 2C82A 1PLKA 2A1UB 5AHWA 4AD8A 1DBQA 1D2GA 1DXHA 4J2HA 2NP6A 1U81A 3MUEA 1SVNA 1JW9B 3COPA 1XQ6A 4P4UA 5H82A 2V5VA 2BF7A 3WIEA 4UEKA 5AVJA 2DY0A 1QIMA 3ZHVA 2F4VB 5B7PA 3MN1A 1J0BA 3VDXA 4UCWA 3PXXA 1HNZB 4IOKA 4Q02A 4IV8A 1DAOA 1FFSA 1ORIA 1S2GA 2BR5A 1U0LA 2C5GA 3I01A 4RHUA 4RIHA 5EMHA 1CVIA 1MC8A 4RL6A 1WW2A 4X61A 3G0IA 4D6XA 1N8SA 4GO1A 3GJ4A 3KTOA 1N7HA 5CM8B 4D97A 3COJA 1NZDA 3FPJA 2GZMA 5AW9A 4NH4A 4OQYA 3TL6A 4ZVMA 3MOIA 4DJFC 4CXMA 4DHWA 1EJBA 2GF2A 1DAKA 2W6NA 1C1DA 1JT9A 2ZVPX 2BONA 1VB5A 2FX3A 2FZLA 1YRHA 3ZCXA 2Y99A 2V45A 5AI6A 2JFNA 3L02A 3HDJA 5BN4B 2D06A 5HQ3A 3BRCA 4JY7A 1E2EA 3QE9Y 1IN1A 1YJNB 3WGUA 1CERA 2BL4A 3FM9A 3DHYA 4L51A 2HMWA 2ATVA 4MWBA 1U94A 4XJVA 1Z9BA 2QMOA 5CFPA 1XKTA 1MOZA 4IVPA 3Q11A 3BL6A 1AKTA 2DBZA 4KO8A 3RIYA 1J0AA 3JCZA 3ICVA 4R3NA 2YQ5A 1QP0A 1OZAA 4JB0A 3VU9B 1AQ6A 2DAPA 4B76A 4NMWA 2VF8A 4E0FA 3KPUA 4HLNA 4IXMA 3SJ7A 4XM2A 1E7YA 1T3GA 1WF6A 2J0EA 3G79A 5C4IA 3CRNA 4JLJA 2PGAA 3OA2A 4PPQA 1RYBA 3C3JA 3EIHA 3RAFC 3K8ZA 4X7FA 4G01B 3KL4A 2FHPA 2NV4A 4K81B 2Z30A 4XDGA 1FX1A 4BY9E 2AVDA 3H5VA 4IEEA 4G0UA 5A7HA 4A7PA 1IK4A 3B3AA 2NTEA 1XQWA 3MINA 3ASZA 3HDYA 4KR3A 3F3KA 4PWZA 4DANA 1LLUA 1YS4A 3O82A 2GF9A 3REGA 4DNPA 3ESRA 1O6GA 2X4DA 4IOMA 4WZZA 5B30A 3FYTA 1SHKA 1P1RA 1T1IA 2ZB2A 1H3FA 5CU7A 1C7EA 4NPCA 2XUDA 4H3SA 4LBVA 3HCBA 2Z9BA 2JI8A 4OMFG 4IDFA 3GQBA 4DSUA 4JP8A 2WTXA 4C3UA 2Y0DA 2YV2A 2Q0HA 3DZGA 4FN5A 3OF5A 1P9OA 2X42A 4LZAA 1KJZA 4YMVA 5F2KA 1LRJA 1OHHA 2ZCVA 2YIDA 3ENNA 3GFRA 2A9RA 2B2NA 4XKJA 3HG7A 1JB9A 3I8SA 4BQRA 3ESCA 1T6YA 3ROQA 2J87A 1G2PA 4QPPA 3Q3CA 1ADYA 3JPYA 3UHPA 3YASA 4RF5A 4XVCA 1NBHA 5JISA 3UHAA 5CHEA 2IFTA 3C98A 2V3WA 4E5YA 1JYFA 1FDWA 1WVIA 5D7NA 5GGXA 3S2ZA 4NY1A 4IIBA 2PL3A 1F8GA 3KKEA 1M0EA 1T9HA 2W2OA 4MVJG 2XQJA 3IOMA 3CIOA 3EGXA 5FI0B 4M60A 5AK0A 2OGZA 3EIQA 3N0RA 2I2DA 1AT1A 1T10A 5DNDA 1QHGA 4AQDA 1U6KA 2Z2JA 3TW0A 3KPJA 4MICA 4QEDA 2NSYA 4C06A 3B2EA 4R9UC 1DC3A 2P65A 2ZTUA 1NMXA 3BB1A 3KTDA 4JASB 3EQ8A 3IIKA 5HW0A 1P7WA 4IH4A 3EDYA 2L0XA 3CZCA 4Q3CA 1UD5A 1Q7TA 1LF5A 4BB0A 3CCEB 4M9SA 3UV3A 5I9LA 1LDYA 1VFPA 3SYNA 4A2WA 1HORA 3T3OA 1QLJA 2UZ1A 1PT6A 4QRDA 1R0RE 4Y2HA 2WM9B 4OU4A 3TKYA 4FHZA 2JFUA 3C4JA 4F3NA 2QVCA 4MMYB 4PLWA 4JB8A 1G6OA 1S6YA 1T8TA 3NHMA 3EXEB 5JJ5A 4RKYA 2HAEA 4NXMB 3SSMA 2HSJA 4H7DA 5JG7A 4KZKA 3A11A 4Q4AB 3SJPA 1GP2A 4COKA 3BXZA 4V0LA 5BMOA 1UBNA 2F3TA 4ML3A 5DCYA 4DIMA 4S05A 1ZVVA 2C2GA 2VPZA 1D1NA 1QP8A 3NRBA 4UW9A 1UPUA 2CV2A 1E2QA 3IEXA 3X1XA 3UM9A 3DWFA 3D6MA 5EIOA 4JLSA 5EJ6A 4GOJA 1ODLA 5ALYA 4B3RB 3JAKA 1SBIA 1J8DA 1NAHA 1NNSA 5IXJA 3ADBA 1TKBA 1Y1QA 1AA6A 4HVAA 1PQWA 1JR3A 3RAGA 4YLGA 3MPUA 3LW8A 4HTFA 1FA9A 3LGAA 1NM5C 1PT8A 4EMSA 1P77A 3LUJA 3PJDA 4C22A 1RKQA 4OXXA 5IAKA 1GZVA 1DBRA 4O2RA 3RHSA 3SYRA 1N8KA 1T24A 4MINA 3MIIA 1ST3A 3QU9A 4UAGA 1MJHA 4KU4A 4GDMA 4LZWA 4J0IA 4IMPA 4NOMA 3OZTA 1G59A 2F1OA 1IMJA 3DJYA 1UDCA 4LNUA 3IAHA 3OPYB 1CEEA 4HB0A 1YJ9B 2C31A 1DRJA 1DIBA 4K40A 1IE3A 5D84A 4EBFA 4LHXA 5GVSA 1L5SA 1NG1A 3LU1A 2IDMA 5DHAA 2F48A 1QQ7A 4KP7A 2XITA 1XVLA 1WXQA 2VT7A 2X5JO 3O8DA 3PDHA 2AEMA 1FTYA 3B6ZA 3PRYA 3A28A 3SF8A 1P81A 1JLLB 1B2LA 1N0HA 4HLQB 5L3SB 3AZOA 3BG5A 4JC0A 1N33B 3ZD6A 3KHSA 5CK5A 1OB2A 2G9VA 2VCEA 3GAFA 1Y6ZA 3LDUA 3PGVA 2ONJA 3E9RA 5J1TB 2CHQA 3O6VA 4HFJA 4N1AA 5FTJA 2CNWA 1HE4A 3T5TA 3ZNOA 3AJ8A 4C3OB 5SICE 3U3DA 4BJHB 3KUXA 3PE3A 2PUGA 2HY7A 2FQWA 3W6PA 1NUSA 5CNKA 2ZAYA 2BLNA 4XUEA 4EA8A 2FLKA