3FPKA

Crystal structure of ferredoxin-nadp reductase from salmonella typhimurium
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
247
structure length
247
Chain Sequence
b'ADWVTGKVTKVQNWTDALFSLTVHAPINPFTAGQFTKLGLEIDGERVQRAYSYVNAPDNPNLEFYLVTVPQGKLSPRLAALKPGDEVQVVSDASGFFVLDEVPDCETLWMLATGTAIGPYLSILQYGQDVARFKNLVLVHAARFAADLSYLPLMLELQQRYEGKLRIQTVVSRENVPGSLTGRVPALIENGELEKAVGLPMDKETSHVMLCGNPQMVRDTQQLLKETRQMTKHLRRRPGHMTAEHYW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-NADP reductase
publication title Crystal Structure of Ferredoxin-NADP Reductase from Salmonella typhimurium
rcsb
source organism Salmonella typhimurium
molecule tags Flavoprotein, oxidoreductase
total genus 69
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2009-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3fpkA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3fpkA02
3OJWA 1YJWB 1D2EA 2DCUA 3CCQB 1E62A 4TN1A 1VQKB 2B7BA 4ZCLA 1VQOB 3B78A 1FNMA 4PC3A 1KK3A 1ZUNB 3CCRB 1EFUA 4RD0A 3VO1A 3OZVA 3CXCB 1ZM2A 2QA4B 1QVFB 1YJ9B 3MCAA 3CCMB 1QGAA 1TVCA 4ZCMA 4LC0A 2X3UA 4G5GA 2HDNB 3CCLB 1VQMB 3G4SB 4TMXA 3ZBTA 3CB4A 3AGPA 4YALA 3AVWA 1Q86D 1K8AD 1EXMA 2RC6A 4RD6A 1E64A 2BSAA 3W5VA 2OTLB 3OJXA 3B8HA 1TLLA 1JNYA 1F20A 4RCYA 4U9UA 1KJZA 3ZBUA 2VYQA 2E1RA 1G7TA 4QFMA 1KD1D 2VNHA 1DDGA 1IB0A 2QN6A 2QMUA 4M0LA 3LO8A 3W2EA 2YWHA 4UAJA 3AVVA 1Q7YD 1JA0A 1VQ4B 3ZZ0A 4G1BA 1S0UA 4B4DA 3W2IA 2RC5A 1FNDA 1N0VC 1HA3A 4J0QA 1YI2B 2PIAA 3CCUB 1E63A 5GV8A 3FJOA 4AF6A 2HCJB 2QDXA 4BPRA 3SJZA 4AC9A 1G7CA 2C77A 1ELOA 2BM1A 5TR9A 3W5UA 1Q81D 1GO2A 1ZM4A 3W5HA 3FPKA 4G1VA 3CMEB 3G6EB 4B47A 2J7KA 3ZZUA 4WQMA 3W2FA 1G7SA 2DERA 2YWFA 1H42A 4IW3B 4PC2A 4M53A 3JQRA 4H9GA 1YITB 1AIPA 1KK2A 3CW2A 5EMNA 2BF4A 2EIXA 2C78A 1QX4A 1S72B 2PMDA 3I56B 1EFTA 1NDHA 2CNDA 3W2GA 3WXMA 3WBKA 3CCVB 2BGIA 3QFTA 3AVXA 4YAWA 4M1KA 5HXBA 1TTTA 3J81k 3MHPA 1R5BA 3U6BA 3CC2B 4Y9RA 4HE6A 1JJ2B 5JBQA 2HMAA 1FNBA 4RD3A 1EP1B 4TMVA 4RD2A 4PC1A 2XEXA 4TMZA 1W35A 1M90D 3JQPA 1WDTA 4NBSA 1ZM3A 3LYUA 1NJID 1XB2A 2BPOA 1DG1G 4RD1A 3U2QA 2GPJA 4DQLA 1OB2A 2B5OA 5THXA 4B43A 1KRHA 4M4SA 1M1KD 1ZM9A 2YWGA 4QHYA 3OZWA 4P6VF 2BV3A 5AN9A 3OZUA 1CNEA 1KTVA 3JQQA 2VNIA 1Q82D 3AVYA 1VQ5B 1BX1A 1DDIA 3G71B 1GR1A 2BN4A 3WNDA 2D74A 4F7DA 4LBZA 1CNFA 3WY9A 3CCEB 4EH1A 3P27A 3VNUA 1TUIA 2R6HA 3U6KA 4MYUA 1YIJB 4HE5A 5FA6A 5GV7A 1QH0A 1QFYA 4FWTA 1K73D 3VNVA 5DSZA 3ES9A 4LBVA 3ZC3A 3CC7B 1EP3B 3QSYA 3QFRA 3WNCA 1SM4A 3P26A 1CQXA 2DY1A 3E20A 1H85A 4ACBA 3OW2B 3W2HA 4DQKA 1VQ7B 1B2RA 1OGIA 5H59A 1KC8D 4RJLA 3WNBA 3CCJB 4LBWA 4ZGQB 2BM0A 2EFGA 1QGYA 1GAQA 4AF7A 1BJKA 1QUEA 3CD6B 1EWYA 2BGJA 3E1YE 4RCZA 4YAOA 4R71A 1D1NA 3WBJA 1GJRA 2YWEA 3CRZA 1QVGB 1KK1A 4C43A 4N3GA 4K1XA 1XE1A 1QGZA 1A8PA 1F60A 1N0UA 4PC6A 4RD4A 4TMTA 2XNCA 1QG0A 1I7PA 4C0SA 4PGOA 1IJEA 2OK7A 4B48A 3I55B 3B82A 5H5JA 4NCNA 3WYAA 2QTLA 1FDRA 2AHOA 4M2LA 3LVBA 2GQFA 2ZITA 1JA1A 1FRQA 1QUFA 1N8RD 4ACAA 4Y7CA 1B23P 3AVTA 2XNJA 1SKQA 1VQ8B 2DETA 3LRXA 2CRVA 4FN5A 4P3YA 1W87A 1G7RA 4PC7A 4YHBA 1KQSB 3QE2A 4TMWA 1VQPB 1VQNB 1VQLB 1R5OA 4YAUA 1R5NA 1EFCA 4LBYA 3AGQA 4ZCIA 3AVUA 1FRNA 3QFSA 4B3XA 4ZGNB 2OTJB 1BQEA 3MMPA 2DEUA 1GVHA 1YJNB 1VQ6B 3CMAB 5TV2A 3CC4B 1YHQB 3VO2A 4Q7JB 4FK8A 4ZV4A 1GAWA 1FNCA 3ZZTA 2PLFA 1KK0A 4B44A 1IJFA 3I1FA 3PENA 2VZLA 3CPWB 3QFCA 1BX0A 1DARA 2QEXB 2BMWA 1EP2B 1QFZA 2OK8A 2NPFA 1OB5A 3A1FA 5TY0A 1K9MD 1QFJA 3VMFA 1J9ZA 2BVNA 2QTZA 3CCSB 1W34A 1UMKA 2B7CA 2VNKA 3V76A 4N3NA 4Y9UA 1JB9A 4YAFA 2FX3A 1AMOA 4MYTA 1D8TA 2VNJA 5KSWB 1OGJA 1VQ9B 1W2BB 1U2RA
chains in the Genus database with same CATH superfamily
2YJ6A 3JQBC 3RVKA 3LX4A 1LTKA 1USWA 3FZGA 5TMBA 2ZSDA 4L75A 2ZZFA 3LTEA 4KBFA 2XT9A 4ENRA 1QIGA 2FW7A 2IXFA 3SBEA 3B3FA 3DDSA 1JH9A 1YZUA 2EJBA 1L9KA 3KUCA 5CD9A 2G77B 1Z4LA 1IQPA 2IOQA 3C7AA 1VQOB 1SBIA 3OCUA 4H7PA 4XLFA 4MYSA 4P80A 5JAHA 4ZJZA 4E07A 4YRIA 3FPSA 3C7TA 3TB4A 2QLJA 4YY3B 2LCIA 1E9EA 5EJ6A 5KIAA 2OV3A 3QX9A 5DNWA 3OX3A 1EFRA 3EEFA 3LBIA 4OXIA 4BX0A 1UKCA 2XV1A 3BCSA 4NR0A 3T95A 3T1HB 1SHLA 1TXGA 4XUDA 3RFCA 1QAMA 1EGAA 2V7PA 2VA9A 1L7QA 4ER3A 1SUSA 4II2A 1W1IA 1Z0UA 2BDUA 4CETA 3JATB 1G5HA 1T3GA 1WB4A 4MX8A 1ZBDA 1ZN8A 4NMHA 4R1QA 4CG3A 4GBED 3REQA 3ED1A 3QF7A 5KYXA 4DMKA 4BKRA 9MHTA 1AS2A 3LVRE 3FOFC 1XDBA 1FYEA 1RKVA 4K3UA 4X85A 3A4YA 2FFJA 3ZBTA 4HVTA 1SZPA 1MEJA 1TVEA 2FSPA 4DDTA 4F4CA 5KOHA 1ZGGA 1HNNA 2OV8A 2ZJ5A 3N8NA 4S12A 2RHGB 4H7DA 3QEBZ 4CE6A 4L0DA 1Q86D 2AVNA 3E3OA 5LNK1 2RC6A 2AE2A 2XVAA 1VE3A 2YWDA 3LXRA 4J94A 4PGAA 4LJ6A 3SYTA 3QSGA 5JD4A 5A9SB 3OJXA 2P3MA 2P6UA 4R81A 4RGQA 4KYUA 5A0FA 5J2UF 2BMDA 4UUPA 5L45A 4UBLA 4TUYA 4ARBA 4C4ZA 2I99A 2GAOA 1UBGA 1V0EA 3GJ4A 4RCYA 1PJ5A 1EWVA 3NDIA 1C9NA 1SG9A 1P6QA 2J0SA 3IOEA 2XITA 1M72A 3VAAA 4O59O 1KD1D 2GCGA 3FCYA 1V4VA 1FX0A 1MH9A 2WFLA 5HF5A 1PGNA 4JI6B 2EKDA 3UFXB 2QMUA 3LQKA 3DQZA 4WNIA 5EINA 1B8PA 4M46A 4TS4A 3C41J 5TNXA 3IDQA 4LV5B 2APJA 5JH7B 3ME5A 1TAGA 4D0NA 1I6WA 1O5OA 4YJHA 5AKIA 5H16A 4QT0A 4JYCA 1ID8A 2V7XA 2RBEA 3W0LB 3M9WA 3HKEA 1S6YA 2MYPA 3R7DA 4Q16A 4IZ6A 1L6RA 1X0XA 2CFTA 3EA5A 3FDZA 4HS9A 1GV1A 3GP3A 1DIGA 2W93A 3AYXB 4KWTA 1NJFA 1PS9A 4GBGA 2IHVA 1XF9A 1DZIA 1E66A 2BD0A 2ENWA 3BIFA 2F67A 1TCVA 1W85B 1OASA 1VYHA 2H6EA 2W6CX 7MHTA 4HN4B 5AHRA 1CRZA 1S2OA 5FI1B 2GXAA 4IJKA 4JX9A 2V59A 2IKQA 4NBVA 4RGYA 4EO9A 4G5XA 4DM4A 4UZSA 2AUTA 3ITNA 3LWBA 2CZQA 2E1PA 4GPEA 3FDXA 2IJGX 3QF4A 5DPMA 3PWKA 3RW9A 3AHFA 3H8JA 5HXAA 2HFJA 4V1CB 1B2LA 4AJJA 2QPLA 4HQRA 3DP7A 4LQLA 3FYSA 2JD2A 4L5YA 3MOSA 2VDJA 1D3AA 4DJJA 3H6HA 3N5CA 4GD3Q 4F6RB 2BM1A 1RS0A 2OGZA 3N2EA 1Z12A 1CDDA 3EFOA 1U8AA 1SVMA 4ZQIA 3BHMA 1KC1A 5TGZA 2JGJA 4ZZ1A 4LOJA 4B3MB 6PFKA 2VS1A 2ZATA 4KAXA 1D4AA 1ZKMA 2QA5A 3FZNA 4GRAA 1U4NA 3NDPA 4JFAA 4PQEA 3ADCA 5EWLB 3HKBA 2ZXUA 1UOEA 2ERYA 2JD1A 3TECE 2DFPA 5KYYB 4G1EB 3RODA 2OZLB 4PYOA 1H42A 4W5TA 3LC2O 5I9MA 1WY7A 3E3MA 4XGRA 2GJRA 4ZV7A 4EMTA 3LUGA 1Q1QA 1KPGA 1Y4DE 3I76A 3OOSA 1RXWA 1XRNA 4GXQA 1J39A 1BMFD 4LY9A 5CGZA 1SFRA 1OYVA 2R60A 3ZHUA 1ZVQA 1V3TA 4UFOA 4B74A 4M9XA 1IM2A 3KD2A 1R8XA 4FI3F 2D0OB 1AZLA 1J2YA 4NNOA 2Z2ZA 3P4UA 3U7JA 1GUAA 2IF2A 2E82A 3FDIA 3JPWA 4HYYA 3D6FA 5JWOA 3E7XA 3MW8A 4Z0NA 2BI7A 1IATA 1G8AA 4ZOLF 1T8YA 4C6HA 1M2KA 1D6JA 3U3DA 1ZEJA 3OTIA 2V4MA 1HF3A 1W5SA 1SO8A 4CMCA 1SMKA 3JW8A 2YS6A 1Q3KA 2BTOA 3F8TA 5EFOA 3SOZA 2ECKA 5BW5A 3OA0A 3EF0A 3RRJA 4ZOAA 1UBLS 2VSFA 3PYMA 1SAYA 5K3AA 1L8LA 4P98A 1RI3A 1HC7A 3E53A 3JVDA 2HLPA 1W35A 3ZG6A 3ZIAD 4D8VA 1H4SA 4GXTA 4RL4A 2VA8A 4TMKA 1QKJA 3HJHA 1HFKA 3N6VA 3RUEA 1USKA 1CJVC 4DCMA 4W5OA 2FMHA 3UK2A 1XB2A 4I5EA 1ZWLA 4P92A 2FGKA 2IVZA 3IVXA 1UKEA 3MG9A 3MXTA 3PUYA 3HJUA 1OTHA 3VYSB 5AW2A 5G1NA 3KFVA 4GT1A 5JG7A 1GN9A 2GCPA 2VDNB 1O95A 3ILYA 3C24A 5K7SA 1MN6A 1ZBQA 1ZXXA 2JBAB 4I50B 4JCOA 2NXCA 3WO1A 4HNAB 1EVLA 5DM0A 2GZMA 3AR4A 3UXMA 3ERCA 1GNRA 3FTPA 3O8NA 4IEIA 4IDGA 1Z7GA 3DBRA 3INNA 3W4KA 2UYYA 3K71B 1DJLA 4EEZA 1NRIA 2CLKB 3CKLA 1ZM9A 1UBKS 3OFJA 4QQFA 3JR7A 4ARCA 3OIVA 2C03A 2ADMA 1Y4ZA 4PBSA 2IS4A 3K1YA 5KQSA 4QFDA 1K5DA 4BZPA 5IJXA 1Z8NA 4HFNA 2G72A 3QPBA 4XGNA 2ZXEA 5ES4B 4RK5A 3S1AB 5IWAB 3B1JA 1W94A 4XD7D 4HZIA 5FKJA 4RANA 2OV1A 2P5YA 4GGPA 1SU6A 3DCIA 5C2JB 3DKVA 3LQ2A 1AKNA 4PIPA 3T5MA 5I8PA 2AFIE 3U7HB 3P2OA 5KVSA 4NBKA 4RX1A 1RQRA 3KL2A 5CH3A 3R6GA 3Q98A 2QR5A 3DBHB 4KYVA 3ZV7A 1IHUA 1G59A 1U65A 4BMSA 2CXUA 1JKJB 1SBYA 5FWXB 1R8YA 4DMRA 3WNDA 2BP7B 4LRSB 1XDGA 1VBMA 1NXOA 2X1MA 4NJMB 3PQ8A 4F2DA 1JL3A 2J4DA 2PY6A 3NDRA 4J49A 3ROGA 3WL8A 4BQIA 5JPDA 4GX0A 5FYDA 4ZO8A 2CYAA 3G9XA 4R16A 1ADYA 4DR1B 4NATA 2CEKA 4E2YA 3CKMA 3UW1A 5HYVA 4X54A 3GD7A 3F6RA 5AJWA 2ZOSA 3HKDB 1YRHA 1XCMA 1FUEA 4MUXA 2ZS8A 2GT1A 4HAXA 3HBLA 1P0IA 1H2XA 4CNBA 3F74A 5B1YA 2Z3ZA 1K89A 4TKMA 3W9UA 1E0DA 1U7WA 3FPBA 1X6VA 2OXTA 1FIUA 1E6WA 1JHDA 4LBVA 1YI0A 2BHNA 3MSXA 4O2RA 3EPJA 4PFSA 4XIYA 3GY0A 1F2UA 2ZJOA 3W8DA 3CC7B 4YT4A 2HT1A 4TKVB 2C88A 1I30A 2VL7A 1KDTA 1WAMA 2W8BB 4JOBA 1HDRA 5FNZA 1KVUA 4ZRMA 4E08A 4W9NA 1QVZA 3TNLA 1AKWA 2D1QA 1QE5A 4HLCA 2JBHA 1ZSYA 1I36A 2DBYA 1R2QA 1KI7A 2H92A 1HURA 4B3JA 2G80A 1PV2A 3K1TA 5EI5A 1KMCA 1MAHA 4DQKA 2UZAA 5HFNA 3ZCVA 5E1BA 2ZI4A 2CMGA 5GTDA 4LJRA 3BFPA 3RJ9A 2Q6KA 2G9RA 4R5HA 4C07A 4HGPA 1KC8D 2ZR7A 4RZUA 4B0PA 2G9QA 3N7TA 4AZ0B 3WNBA 2C57A 4QTUB 4DV7B 1FU8A 2JLSA 3LPCA 3LAWA 3R3ZA 4IIVA 4M99A 5ARDA 4FI3C 5T64A 3ZQUA 3BICA 3V8NA 2LD4A 2RI0A 3A9WA 2GRAA 3V8PA 4WOKA 3IHLA 4BMXA 2BGUA 4KW7A 3LQ1A 1RVDA 4ARAA 4LHXA 2C4VA 4PR3A 3A3YA 3FNQA 5H9VA 4K40A 5ER6A 4EW2A 4N4AA 5KNDD 2VF2A 3ENWA 3TS1A 2OD2A 2AJBA 4BS9A 4JC4A 1JV2B 4RIFA 4CFZA 1WKVA 1VSTA 1HZJA 4Q9AA 2ZI7A 4LCEA 4N5IX 1RAAA 5AIBA 5G3ZA 4CN9A 2ZRMA 4IIUA 4M1MA 3S2SA 2TRSB 1YKSA 3SVLA 1OE0A 1QVGB 3TNFA 3ZR4B 5IZCA 4MR9A 3WICA 1B6RA 4AUNA 1QANA 2R6CA 5A4IS 3PGKA 2VT2A 3PQFA 4US0R 4KQCA 4N3AA 5DCLA 3KSBC 1ZJWA 2IZ7A 5IW8A 3I1YA 4XW2A 2X4GA 3OFNA 2L0XA 1UODA 3PC6A 2XDAA 4IHAA 3EAFA 1M9NA 3HO6A 3TD9A 4HDNA 1I7PA 1OI2A 2H1LA 3MCWA 2QSZA 3LC1O 2IYUA 3O31A 4TTJA 4MYRA 3QNMA 3EF1A 1ZNYA 4JSTA 1I7NA 5I7EA 4PNZA 3DZGA 2PVCA 3ZPXA 4MRRA 4Q39A 1QQAA 2YBEA 5C1OA 1V25A 4YQYA 4P8RA 1KL7A 1YQDA 2C54A 3T4EA 4HO1X 3LXMA 3EG5A 3LT2A 4JC0A 5ALNA 4W6QA 5AM2A 1TO6A 4BNGA 5CDUA 4IKPA 2YWCA 4UPVA 2PG3A 5JDIC 2CLFB 4Z4CA 5FBHA 1RLIA 4QRHA 1BXZA 4MGKR 1V48A 5JSFA 2Z83A 3A1WA 4OUDB 3OIGA 1TO1E 1WV1A 2H2WA 2XB6A 3F6YA 4PGFA 4CUZA 5FUWA 3FYUA 3BRQA 5BSEA 5L4SA 1SJ9A 2VF4X 4ZDKA 4G5FA 4IXTA 1M3SA 4CHGA 4Z4RA 3WMGA 2G5TA 4HAIA 4X95A 5EKDA 3LC0A 3D6JA 5CU7A 3GMTA 1OPXA 1REQB 5EZQA 2ZETA 1E18A 1F6BA 1DJPA 4BRZA 2QMZA 1U04A 4CIAA 2ZJ1A 2ORVA 4RLHA 1KMHB 3C3EA 1MO3A 4RIIA 1RBMA 2YZ7A 2WR8A 3V4VB 5BVGB 3ANXA 3X1WA 4GKJB 1QIHA 4J2TA 4MP3A 1B8UA 1R0ZA 2AN1A 4B3GA 2ZWVA 4D44A 1JDUA 4IICA 3LL4A 4KMMA 2JFXA 5BMVF 4TMWA 4I0WB 2VPIA 3HDGA 2GN4A 3G9UA 1B41A 2GNAA 1CJSA 2G9VA 3NIFB 1R5OA 4LSGA 2WWHA 4JJ8A 1C8VB 2RKWA 3A4TA 4ME6A 1L7RA 3R5KA 2IZ0A 4CMEC 4EUKA 1KYXA 5B1HA 3WDKA 5JYCA 2F3PA 1CUWA 2QLFA 1WTAA 3UJ9A 1Y6FA 3B8EA 1Z0DA 5B3KA 2OTJB 5FJJA 5BR4A 4NEQA 4WWHA 1Q19A 3JYPA 1VQ6B 3JU3A 2C4HA 4MZDA 1QO7A 3H18A 1GT6A 5FR1A 1DKOA 5IF9A 1E8DA 2H31A 2UAGA 3DBLB 3RIMA 3I73A 2QW0X 2ZRJA 1B14A 5G41A 5IM5A 3C3YA 4F3KA 4UTRA 3S28A 1XEWX 3NXKA 2E5WA 1K1EA 4EIWA 1ZH4A 4WV3A 1P4SA 5K5EA 4IVNA 3SLGA 2EQBA 2QRMA 1V5VA 3K0BA 3D4PA 3VPDA 1Y4SA 1ZRNA 4YP0A 3WNZA 3UJDA 1T5HX 1G6OA 3PQDA 4LX0A 3AESA 4OKSA 2HLHA 2VDWA 3OHMA 4Y30A 1OY1A 3T9EA 5IG2A 3ISJA 3FTQA 3CPWB 2H0RA 2D13A 1Z4JA 4ER6A 4QTZA 1EZ4A 1PP4A 2INGX 3BZBA 1RE0A 3MOIA 1AGRA 4KHZA 5CA0A 4BUCA 2QEXB 3BGWA 2XYVA 3T0IA 4A0QA 1ST3A 2J5BA 1AXGA 3C0KA 3R6LA 4EW6A 3SZ3A 1VSQA 3NWPA 4QUKA 3DFIA 3VU3A 1PJQA 1RWNA 2E2WA 3G1WA 4Q03A 3ZHSA 2PXHA 4FR5A 1VTKA 1CY8A 4IQ0A 2FF5A 3PTAA 3H16A 1W34A 4PG4A 3EZ9A 2PPLA 1X80A 5J23A 5DM4A 1LX6A 1NPTO 1XR3A 3IJEB 2QRZA 4UREA 2VO1A 4JLBA 1K8QA 4RVCA 4DCJA 3PHBE 4LUCA 1SIOA 2BR5A 2Y0BA 4EA7A 4MMYB 1UMBB 4P33A 3IEIA 3MT7A 3KTAA 2XB4A 3ZLJA 1R88A 3OKAA 3CH7A 1A4XA 3NIBA 5KTKA 2AXNA 1U3WA 4IIDA 1Q9SA 3M6IA 4UQLA 3OCYA 4GDFA 2JGDB 3Q87B 3LMKA 4WZBA 3TMAA 3AJEA 4ITRC 4YBRA 1XMSA 2Y27A 4U7FA 4CCAA 1YJWB 2O5VA 4CG1A 5COAA 4ZAZA 4CKEA 2W83A 3HR8A 5F98A 2I6SA 4LXGA 4AWBA 2GX6A 1PGJA 2GZ2A 4WCFA 5G53C 3GZTB 1ZR2A 2DCUA 3KFXA 5FD8A 3SKBA 1L5OA 3ORHA 4QUEA 5LYJF 1APBA 1Z2OX 1J21A 2HU8A 2IEAA 2DCMA 2PV7A 2Z2JA 1ONOA 3BD9A 3CNQS 3I5UA 3QVGA 5CVDA 3SEFA 4EHAA 3B78A 1JHQA 2GAAA 2I6UA 5DHFA 5AVKA 1JJBA 1VFNA 1ZHHA 4WN9A 1Z4MA 1WKCA 1WXXA 2IUEA 3T1OA 3A1VA 4GQIA 4PAQA 5KOIA 2Y3IA 3RAPR 3QNUA 4B8YA 5LM3A 2G06A 1BCSA 2DRIA 1EK5A 4JKYA 5BYAA 2Y92A 4BX2A 1E7QA 2LWIA 1DFHA 3I5AA 3H5WA 3LP8A 3CXUA 3SPXA 3SWWA 3BILA 3RU9A 3LWNA 1M8KA 5A5EA 2X9LA 3PZBA 4H0FA 2WIAA 1JJVA 4KI0A 4X62B 4R9RA 4LC0A 3Q3AA 1ZMTA 1VG0B 2IYZA 3CCLB 1VQMB 2GYVA 5BMVB 2GN2A 1TKBA 3I92A 1NW4A 2PU7A 2ZZKA 3TD6A 1M54A 4BUZA 3A8TA 3DE3X 4DV6B 3AEYA 1YGPA 2ORWA 3COPA 1I0ZA 1UM9B 2WI8A 5D6NA 2QE7D 6Q21A 4KXFB 5FULA 4FNOA 4QRDA 3ZK7A 3ZS9A 1JFFA 2R7MA 5DK4A 4ZVLA 4CV1A 1Z74A 2WT8A 4N6GA 1AURA 3IUBA 3I9MA 3PS9A 2YW9A 4JLUA 3T8YA 4BYMA 3LJKA 3RS2A 2H4ZA 1J8VA 4P4TA 3JQ8A 4ZVQA 2J6IA 4D9IA 3WLJA 1I10A 5L7TA 4BKPA 3NGMA 4YI3A 4YUVA 1QB7A 1TF2A 4HRAA 2XYQA 4NBRA 3EZXA 2B82A 1J4AA 1HZZC 3GW8A 5H80A 4IIJA 3L8EA 4KNWA 2GCOB 1TU3A 2YMMA 4KO2S 3TLCA 3ZXXA 4DJEC 4UM9B 5JS6A 1SBQA 5H4HA 4V0MA 5HNKA 1UADA 2OM2A 4NU6A 1WB5A 3LCVB 4MV9A 4XSHA 1ENZA 3MJ4A 5JFTA 2F48A 3OY2A 5A2GA 3TCKA 4X07A 1CUJA 3WIUA 4PZUA 4RULA 3KKMA 2R6DA 3E15A 5IAEA 1II0A 2JRLA 1AKEA 2XQJA 3CRQA 4Q21A 2X6RA 4EJSB 3KQKA 1Q7YD 1MC1A 1G8FA 1F14A 1SVIA 1W8IA 1WVIA 2D1YA 3GJRA 3HVHA 3QUQA 4H08A 4NVRA 5IEJA 2X0KA 1RIFA 3B1KA 3RYIA 4KSCA 5KNBH 2YJ5A 2BFBA 2EJWA 3MBKA 3OUTA 2WZBA 5G0SA 1Z62A 1IN1A 2ZGVA 1H1LB 3FVVA 1T9HA 2RIRA 2B35A 2AOUB 4MRNA 1H2EA 4PLFA 5HSGA 4Z7QB 1H69A 1V8BA 2ZXHA 4RHCA 3K15A 1CY0A 1N0WA 1UDAA 1ENYA 2VF7A 1E4OA 3AM3A 5JO0A 3RVJA 3FLEA 1NQAO 3GBSA 2NSDA 2QRVA 4JP1A 4IWNA 5F1YA 5IT9A 3CCCA 2D5CA 1E2JA 3RRMA 1UFRA 3H86A 1T36A 3MOGA 2X86A 3EN0A 1JH8A 3QTBA 4TS9A 2WWVD 5KZMB 1MQAA 4TN5A 5LQDA 1YVPA 1QX3A 2OQ2A 3GSIA 1LJUA 2Y76A 4JQOA 4OFZA 1MVNA 1QTQA 2X22A 2CLLB 4J1TA 5LKAA 2GETA 2QF7A 1JHPA 2ZTUA 5A3SA 3JAWB 1V3UA 5DNYB 5LYJB 1Z0AA 3L41A 2PLRA 2PT9A 3QJGA 1NBHA 1YJ5A 1PZMA 2F3SA 1GFIA 4AVZA 5IAOA 1S3SA 1SOAA 3TQOA 1TA4A 3BA6A 1E7RA 5IVDA 2IV7A 1DTWB 5AM1A 4G2TA 4UBJA 1C30B 2V9ZA 5FOWA 4GPD1 3ETDA 4GMDA 5DXJA 3W34A 1QHEA 3P0EA 3TRDA 1JXMA 1P1HA 5ALLA 1NKSA 1ORIA 2BHTA 2QLLA 3F2VA 2HU5A 4HFRA 1BWSA 1CRWG 4IDEA 4JP5A 1P6XA 4LS3A 4RXMA 3RNLA 3V42A 3QOXA 4QG3A 4ES6A 1G6HA 4XLLA 2A1IA 2QAIA 1XPUA 1OFUX 1U8YA 2ORIA 2ZRAA 2ZU0C 1MW8X 4LTMA 4AP9A 5LQKA 2UYCA 5KBYA 2BMEA 4GWLA 3WR5A 4FFWA 3N8IA 5EOVA 1S72B 2FMFA 5E9QA 3JQBA 4FS8A 3EPRA 2JASA 3K30A 3AWDA 3L5KA 1JQAA 2J32A 3LYLA 3M5PA 4EG8A 1HNZB 2C7BA 3O26A 1NR1A 3L7AA 4L8GA 4XEUA 4YP9A 2V7UA 5BQPA 3DH0A 2C2HA 5HJ5A 1YKGA 2JD0A 4FFRA 4CT4B 3I6MA 3WNVA 4JYAB 4M1KA 2YUTA 1OKKD 3CJRA 2QUJA 4TXJA 3O8LA 1DOAA 2D7JA 2ZRIA 3LP6A 1NXXA 3HYLA 3RS5A 3MHPA 1K4YA 1PO7A 4IZOA 1KSHA 1MOZA 1Q95A 2BWJA 5T3YA 1T1RA 2XQFA 5FV4A 5JAUA 3UV3A 3CF4G 1GYQA 1KDVA 3I9FA 1U90A 1FNBA 4EHHA 4XFJA 4AJNA 1QK4A 4DSTA 2DOKA 4H35A 1IHMA 2XEXA 2WA1A 4G7WA 1CUDA 3PDWA 3E7DA 4JOCA 4ZT7A 2P3SA 3RVMA 3FKSD 5H81A 4D5GA 4A6DA 3V4RA 3CVXA 1JQ5A 5EN4A 3WGOA 4IKEA 4BEBA 4LY3A 2BKVA 3CO5A 4DUZB 4X1IB 4DN6A 1ZJYA 3BOSA 4RMNA 4ON9A 1FVHA 4BGEA 1AHNA 1RR6A 3RJ5A 1VIVA 3VSEA 1VE1A 5DNAA 1G20B 4BBAA 3UFBA 1OZFA 3UJ7A 4DCVA 1WTHD 5CW2A 5J4YA 1G21B 4WNYA 4ZEWA 1HDXA 3N7UA 1IH8A 1GPLA 4M4SA 3EMKA 3LDUA 3VX4A 3W1VA 4CMIB 5CITA 1NRWA 2GJ8A 2HWWA 3C87A 2BFFA 3AM5A 3LV8A 2PGLA 4OH1A 2JK1A 1E1QD 1OVGA 4MDFA 4JJEA 2B5VA 3RK4A 3FTNA 2IBMA 1X74A 1BXRA 1G17A 2O1SA 3H1GA 3RVLA 2Q3BA 3ZTWA 3E9ZA 2PRZA 3GLVA 1PT6A 5H3CA 1RZRD 4FNMA 1Q77A 2BLLA 3R5TA 5TPZD 4ZFNA 4XA8A 1X0VA 3EZFA 4DBZA 2VNIA 1OAAA 4B7XA 1XC7A 1IG3A 3GDOA 3H5RA 4OQ4A 2PS1A 4Z5XA 5I4IA 3GPCA 1WPCA 1QSGA 4M21A 4YVFA 3P94A 1UBEA 4DJTA 5ERXA 1CRPA 2PUTA 4BBPA 2N3ZA 3DLHA 2C00A 3IVRA 4P08A 2H7VA 3GH3A 2EL9A 2GERA 2BCEA 2W2NA 4ZWNA 2CE7A 1Y1SA 2IHKA 3RROA 3TK1A 5I7RA 1H6DA 3UAYA 2PU5A 3D8UA 3T52A 3GFBA 1EQUA 3EXHB 3ETHA 2OD9A 4E3ZA 5CVJA 1RYMA 4RMGA 2V45A 3AY0A 4MIEA 1NF8A 4OMDA 3U4CA 2O7NA 4BCDA 3RYCB 2BTQB 4F4IA 3SIWA 1KI6B 1XTVA 2PT6A 5IKEA 4Z4YA 4DJAA 1Q1ZA 5IAKA 3X44A 4E5NA 1YU6A 3DE1X 1V4NA 3QXGA 1MAVA 4CKWB 3MAGA 4X6UA 1U0GA 4PEVA 5DLQC 2CN1A 3HG7A 1ZY2A 3VNUA 5IFKA 5BN4A 5K4GA 1NL3A 1T34A 1U5CA 2XXBA 3GRRA 1K3UB 2PH5A 3PDHA 1E2IA 1FTGA 1Z34A 4KGDA 2NU7A 5BV0A 2MTBA 2G9ZA 3E84A 2D0PB 4MQ4A 4NNPA 1M76A 2VHJA 3PDIA 2W5UA 2C4WA 5FQNA 3HZHA 3EXHC 5TSDA 1P5JA 4G0YA 4I81A 1TEXA 2W2KA 4DNPA 3BG5A 5CLFA 1J06A 2IPMA 3TIIA 2ZYTX 5AK3A 3BGOS 4GZ6A 2Z6AA 1E9DA 1M10A 3NV7A 3Q0IA 4ZU3A 4ASUD 2IXDA 1TZMA 5LMCA 3BK7A 2BEJA 4UHHA 3BH7A 2Q7DA 3RG8A 2YRWA 4CM4B 2VJIA 4JI0B 4FOLA 4P4GA 3E20A 3NT5A 1H85A 2N0SA 1LNSA 3QOWA 4B9AA 4LZPA 2AC4A 1HQCA 2W2QA 3KYBA 2R5WA 1NQTA 4YELA 4IEEA 1VMDA 3FHJA 2Q5EA 5AOCA 3EEIA 2OFOA 1D2NA 1ZN2A 2AFHE 3I2IA 4C4AA 2FZVA 2I1QA 5ECYA 3C4QA 3B2NA 5KJ6A 3KHTA 3T7RA 3GV0A 3FPHA 5FWNA 5LJLA 1LSUA 4JJKA 5DIFA 1EE1A 4KGXA 1MHTA 4B2IA 1OIXA 1JIJA 1JDTA 2BHSA 2GJPA 4R1MA 3Q7IA 2F7SA 2W00A 1ORDA 1KYIA 4E32A 2M6RA 1TJPB 4UQOA 1DBPA 3BRSA 1M6VA 2X4IA 2R1TB 1LW6E 3DBVO 4M7RA 4LWZA 5IABA 2QZ9A 2ODQA 2UVPB 4PZEA 1GXSA 4MWCA 3U4IA 3SQXA 3AZOA 4F6LA 2OQIA 3E18A 1ISFA 1CULC 4Q1EA 2QX7A 1Y9ZA 1AK2A 4R8SA 2MSDB 1OXBB 2QRLA 4Q3CA 1WSAA 4IJ5A 4M0KA 2XWPA 4I1SA 1TYBE 1USVA 2NZWA 3C5CA 2XPCA 3RSSA 3TM4A 1JT9A 1Z06A 2A94A 3IKTA 3M3PA 2Z6QA 3KZCA 4FHGA 4XM1A 1V8OA 3T99A 1KORA 1LRKA 4G3XA 1OBFO 1A8PA 4RHFA 3LFTA 4R54A 5HIMA 3USZA 5DBEX 3DTVB 4YRBA 1H4QA 3QKUA 2WNSA 1QG0A 2OD7A 4D45A 1C7ZA 2GO7A 3OPYI 4LWOA 5CR9A 1GKKA 2CDAA 2OZKA 1K6EA 4B09A 1GILA 3D3QA 1XFDA 3EZ2A 4HFJA 2NN3C 4LY6A 4NZMA 2J08A 4TRRA 5JAQA 3KSDO 4BCBA 3L46A 4QQKA 3OVMA 5G0WA 4DR7B 3BA1A 3QBJA 4UD2A 1ZA2A 4IS2A 4EKEA 2JJ2D 3MWYW 5JEDA 3H97A 2ZB2A 5B2EA 2FMXA 4IMPA 5ITZA 5DE3A 1RXSA 2DSTA 3BSWA 5AK0A 3TDMA 1D2MA 4BVHA 2O5EA 1J22A 2JIZD 4X84A 4N03A 1FDIA 4A03A 1W0KD 4JOQA 3COYA 1G8SA 2WOOA 1BJTA 3IPRA 1QUFA 2XUZA 3Q2KA 4N8DA 3C6QA 1MZVA 1JB1A 2WAAA 5FI0B 3GRVA 4C30A 3ZX5A 4QO8A 2JJ1A 3HAGA 1BW9A 1Q0HA 4LJAA 4L5BA 3L6DA 2ZIWB 2IHUA 3TCNA 4E31A 2JF0A 3A6PC 3OZFA 2O8EA 2ES4A 4A6EA 1QYVA 1NOIA 1JR3D 3I1JA 1S4QA 1L7DA 2OY0A 1RI2A 1ZMBA 2KJQA 1IXRC 1IBMB 3KBBA 4M37A 5FA8A 3P9SA 2CXTA 5LN1A 3BCUA 4QFCA 1XU9A 2QTVB 3V8VA 4HQOA 2XWQA 3LW7A 1N2GA 3QI2A 4LDQA 4YRKA 1WDLA 2Z3WA 5CPBA 4LOKA 3MUFA 2ZSIA 2ONZA 1VQPB 5AW8A 5CB4A 3O4GA 2B8JA 4IFBA 1BX3A 2HHJA 5FTMA 4EHLA 1P45A 3M6XA 2JI8A 4PONA 4B34A 2WYVA 1E61A 2C7RA 1OCEA 1YE8A 4P3IA 2VHWA 2FWPA 2C5EA 2CT8A 2C5FA 3GO4A 3BWYA 4G23A 3AZQA 5DNEA 3WYGA 4X7DA 4PLZA 2HSJA 4GI5A 3IOCA 3LVQE 2Q2WA 3PR2B 4FYWA 4DS3A 1WIWA 3CMAB 1S3FA 1Y3IA 2H4HA 3IQFA 3JQCA 1FFXB 5CURA 3S1AA 1ODLA 1L5QA 1FTQA 3OIYA 2CD7A 3C1UA 2OOKA 2CL0X 1GVNB 3FFTA 1IMJA 3MWEA 1XEXA 2I6QA 3DE7X 4ANFA 1P60A 1DC4A 1LQUA 3TD2A 2GPNA 1F1BA 1KVSA 1IQ0A 1JR2A 1RW4A 3DGEC 4JODA 2HSEA 3GOHA 1P4AA 3HP7A 4IDPA 5TDHA 3REFA 1XSEA 1TCUA 2O9JA 2YYYA 5AVWA 3G5AA 2JDID 4V0SA 5KYWB 2E1BA 1E1YA 2GLXA 4OQZA 3SJBA 1PJBA 4F12A 2C92A 4AKHA 4MQ6A 2H51A 1XQ6A 2ZKIA 3KDPA 3PNBA 3G02A 3NBXX 3K8OE 1V35A 2I4OA 3LLMA 2XE4A 2OCGA 1UBUS 4TLLB 4U6SA 3TDKA 1W0JA 3TZLA 4AUKA 1K6XA 1BMDA 4MVJA 4UJ5A 2HB6A 1TQDA 3HY4A 2WJVA 3TKLA 1CLUA 3EDYA 4RUKA 1G20E 4Z8YA 1ECLA 4MW0A 1VPTA 3PNKA 4Q93A 2A0KA 2QG6A 4OP3A 3OECA 4ATNA 5LR6A 1G21E 2BKUA 3K35A 3V2UA 3GU3A 1WP6A 3Q40A 5J9FA 3JALA 3D4LA 3W5IA 1UXHA 5T8KA 3R3VA 4BVBA 4BLRA 3HVUA 3LPDA 1MOSA 1WU7A 4HPWA 1AMOA 1E6CA 1G2OA 1F2TB 1WCV1 3LOQA 4GYWA 3KEQA 1U3CA 4HN9A 1JQDA 1EBUA 1OU4A 4O4IB 5TPWA 3U4AA 3LUKA 1N2BA 2I3AA 3NTQA 4OHRA 4YYZA 1TLTA 4Q1VA 1NV8A 3U4HA 3IAUA 4CTNA 4HNTA 4GR5A 3GZNA 4IPTA 5TB5A 3AB3A 4YRSA 1YR3A 4MEBA 4JSYA 5C4MA 1ZQ9A 4N7MA 1V45E 4KIJA 1WPRA 1KU6A 3U9TA 1RABA 3UTDA 3KQNA 3UMCA 3LQRA 3DA8A 4QM7A 4OHKA 2R8OA 3CFYA 4D57A 2VUSA 2O6HA 4Z4WA 1EHYA 2VJQA 4X00A 4ZCLA 1FRFS 5AW7A 4D8XA 3A1NA 3F47A 3GQBA 3W4JA 3TDNA 3Q3CA 4HVLA 2G71A 4AXXA 5BXYA 2B2XA 5FWYA 5SZJA 4ZRNA 4QOJA 4XX0A 3HDQA 5GM2A 2ATXA 2XUFA 4NYJQ 3MN1A 5BN5B 4F4FA 1VGQA 4DR5B 3RAFC 3IEPA 3I45A 1WTCA 2BSQA 4HDMB 2G09A 1E0SA 1W88B 2GYUA 4WUVA 1HTTA 1TVCA 1IK4A 4R9UC 5HUQA 5KPDA 1W5TA 3OOYA 3PUXA 3ABQB 4QBHA 3U7RA 4CM8B 4ZCTA 3GUUA 3JAKA 3R9XA 3G4SB 4OPVA 1UFKA 2P40A 3RYFA 1QKIA 4KMOA 5JI2E 3GZJA 4U7TB 1KEWA 4ALMA 5I7WA 2UYQA 2V0NA 3GLHB 3AGPA 1AB6A 1OLXB 4OB8A 1YRQA 2I2XB 3U13A 2WE8A 2XZTA 4CMHA 1A2KC 3FETA 4CV3A 4S24A 1YDEA 2X7JA 3QW4B 1K6MA 2FUKA 5AOBA 3CY6A 1Z73A 3S5UA 2IHZA 2HSGA 4DLAA 3R6DA 5DHPA 4CIDA 2OTLB 4Z54A 5JS8A 2ZWMA 1GSOA 4NFYA 3MBOA 2QRHA 1QV7A 4KR7A 2A7XA 1HFEL 5IYQA 4PXAA 1FMLA 3H5IA 1V5FA 2V7BA 4HADA 2I2CA 4PPGA 5AHWA 5HCUA 4JVLA 2XMZA 5CFPA 1NQOA 3L2OB 4YLEA 4F45A 2EFCB 1EPUA 1TQ4A 3OU2A 4QFMA 1KSGA 2YJNA 1LUAA 2H4FA 3PD7A 3FJYA 2XE6A 3COZA 4QEDA 3QVVA 2Y1CA 4L08A 4ZYYA 1ZXLA 1M2VB 2FCRA 5K3FA 4WBNF 1R6UA 5IJ9B 1NBAA 3GGGA 4JEUA 1I4LD 4EHIA 3UWOA 4QUIA 4GXNA 4B3TB 1W5AA 3OICA 1OMOA 1B7GO 3WHKA 2YWHA 3A3BA 1TVKA 4B7UA 4IRUB 4UAJA 1HE1C 3OT1B 5FCDA 1C3EA 4ND8B 4JT2A 3ELWA 4CPDA 5C8YF 5AVVA 4Q00A 3ICWA 2QY9A 1ZJ4A 3NYRA 4EGAA 3PC8C 4WKPA 2C1XA 3QRWA 1X1TA 5CVUA 3O73A 1SBCA 621PA 4QDJA 3VU1A 4YUWA 2DUWA 3DDYA 2EX1A 2HRBA 2ZBGA 4KKVA 3SQDA 2YVLA 1N2CE 1L8XA 1Z2DA 1VYVA 1Z5UA 4G0NA 4FDMA 4IS3A 2XWSA 3VKVA 2J45A 1PK9A 4J4HA 5DYIA 1MORA 4ZU1X 2VNAA 4MLPA 4QHSA 3DE6X 2YN2A 3LT5A 4L7QA 3WGMA 2C2OA 3CVWA 2ECFA 3BF8A 4WIAA 4AF6A 4X9XA 3LPNA 5AVZA 1QP4A 2V74B 1L4UA 2JIMA 2O2IA 2PAFA 3KQSA 1M7HA 3NPMA 3QKWA 4QNMA 4IUYA 5FDFA 2I4TA 1FXWA 3WGKA 1CPYA 2QGZA 1V1RA 1U2GC 3BDAA 2HDHA 5IH3A 3ZBPA 1T2DA 5FBZA 3HN6A 4MQUA 3QENA 1RHJA 3IVAA 5REQB 3WQBA 4Y6OA 2CVPA 521PA 3IAS6 4MNTA 3G6EB 1CQWA 1KYYA 2GD2A 2O23A 3M9LA 4WQMA 2GCNA 5D6OA 1LBQA 5L3ZA 4DWOA 3RC8A 1TZBA 2WFAA 4RELA 1J2RA 2HLDD 2SICE 1SVUA 1E5XA 9GPBA 2V4ZA 5K0GA 1C8KA 3LK6A 3SM9A 1JQ3A 1XFOA 1NMZA 4V0OA 3V4ZA 3EIQA 4ERNA 2FMTA 2QP9X 1QRTA 4QGHA 1ONSA 4HNGA 3ADOA 5AW4A 1YQQA 4K6OA 5K0TA 3K70C 4G0XA 2NAPA 3OW7A 1PFVA 2GM3A 2R79A 3S55A 4OHZA 3DT6A 3K4QA 3TM5A 1TPYA 1X77A 4YJ3F 2GB4A 5EMNA 2YIDA 1VJSA 1SHTX 1TYAE 2I91A 3W3AH 1D2GA 1Y1LA 3HUEA 4MRSA 4XEHA 5AM0A 1VHJA 5THQA 5EJ2A 4YXFA 2FPLA 3EC7A 2XQIA 3NEYA 3ZDCA 3K0AA 4KLRA 3IC5A 1EFTA 1SBZA 1P2FA 1TRHA 3IKLA 3KK0A 4LNHA 2BKEA 4K26A 4O1MA 4OF4A 2PBRA 3LCCA 3VHXB 3CCVB 1U4SA 2Q28A 5A1TA 1O6FA 1LI4A 1FYWA 4A7PA 1TM7E 3G1TA 1LPOA 3HP4A 1AT1A 3KX2A 2QBYB 2FXIA 1S2GA 4OQNA 1CP2A 3RC7A 3L9WA 1MXFA 2AX3A 4WK2B 4WXMA 5EIWA 2C8JA 4TQGA 1E1DA 1R0CA 1Y81A 2ZK7A 1S1CA 1ZUWA 1BGVA 2LBPA 3ASSA 1YS9A 2Q1YA 2Z2IA 3DXFA 5J59A 2VWHA 3G8CA 3CE6A 3GRFA 1CR1A 3JYQA 1DBIA 2B9VA 2P9YA 2P69A 3AHHA 1WUTA 4UM5A 2F9LA 4OBBA 4U8HA 3SZOA 4DWWA 3ZOKA 3TKYA 3KB1A 4ZCPA 4KDFA 4PGGA 3ANNA 2A9FA 2CHFA 1J20A 1GU1A 3PFFA 4RAQA 2ZJ3A 4CLHA 3WHLA 4MJ3A 1MEOA 4IQ8A 1EAYA 4XDGA 5CYFA 1TU0A 4HC4A 3DLIA 4Y6PA 3W1EA 3A10A 5CA1A 1IY2A 3BIXA 5K6AA 2EP8A 4XLHA 1FS4A 1SELA 1B15A 2NGRA 3QHQA 4JNCA 4NYIQ 5AD1A 2UDPA 2VYVA 1TL7C 4PHTA 1GSHA 2YN0A 3GRKA 3KZKA 3EF3A 3ZLBA 3DV0B 5C8YB 1CJMA 4G56A 3AI1A 3D3WB 4WKCA 2O2YA 2VATA 3IJPA 2HCRA 4W1RA 1SKUA 4NCIA 4D25A 4K2HA 1JILA 1KBOA 2DFLA 3QLUA 2XJ4A 4Q15A 4Z1MD 2VXBA 2OHHA 4IV8A 4LAFA 4X7RA 2E0IA 3R5JA 3R41A 4ARVA 2MCFA 4OX9B 3EMBA 4YDSA 1YSCA 2FFAA 1M34A 3UJHA 1E6MA 3GJ3A 3I09A 1QH8B 4R2HA 1PZXA 4D41A 5SZKB 1G42A 1R1DA 1Q7BA 4E13A 5IANA 4U7HA 1GPNA 4ZODA 3CLVA 3KE9A 3UJCA 1T24A 5DSXA 3HEBA 5C37A 4OQLA 3LLCA 5AK6A 4K9OA 2C0QA 2ZT8A 4KQGA 4NONA 3WZLA 3GRZA 4AY4A 3RVPA 1WUIS 2E21A 2PUJA 4TT3D 3CVVA 4AQ7A 1BX1A 3B6JA 4DDWA 3GB9A 3O83A 5ESRA 1S96A 3BWBA 4M7OA 4KB5A 2VH1A 2D74A 1WSRA 2WD7A 1NVFA 3T1VA 2HUNA 4LI3X 2VJJA 1S7CA 4MS3B 2DJ5A 2ZJYA 4GICA 3ABZA 4EHNA 5K8UA 2JLXA 3EXG1 3HXOA 4LBZA 4GMKA 4N5HX 1UFQA 2VKTA 2AOWA 3Q3GE 2AJTA 3WSVA 3IFSA 4BQOA 4EG6A 3BFXA 7YASA 1LVUA 2H8GA 3MWDA 1J0AA 4HR7A 3FG9A 4H1UA 5KMGB 4OIMA 4AKEA 3HN2A 2A0YA 1FFYA 3R3XA 4JLKA 1EHCA 3P97A 5AVTA 4KREA 3HR7A 4RPLA 2QQ0A 1F9EA 1YR9A 4I66A 3VVMA 1SC1A 4DCSA 1KO8A 3SBOA 2PZGA 3K9NA 3EGXB 3LUHA 4MXDA 3LUJA 5K0SA 2QRUA 3GA5A 4GSKA 3OKXA 1FP1D 4YJ3B 1BEZA 2C0CA 2DVMA 1GTSA 3NMUF 4LOLA 3NE5B 1PVDA 1RRCA 4QG7A 2I4NA 1XE3A 3DEZA 2HH9A 3ROMA 1OIWA 1RRGA 3HY6A 3H04A 5E6UB 5KSOA 5IM4F 1CZLA 1U1FA 3SCZA 2FR0A 2REBA 5EJ8A 1LX7A 3JWIA 7AT1A 2Q3HA 4KKXB 5L3VA 1ENPA 3L7CA 2IXTA 3C6YA 4XFKA 5AQ1A 5LL6P 3AZPA 2Q1TA 3E3LA 2DY1A 3GLHE 3GVHA 5IAGA 3ZQKA 1Z33A 5DP2A 4CKXA 2YV5A 4JX8A 4HX2A 4TYQA 4MR8A 2HWUA 2KB0A 1MX1A 3FCXA 1DKUA 2OLEA 3QE4A 3AP1A 3PD1A 1P2UA 1R9JA 1YZGA 2PBZA 3AJRA 3CX4A 2E4AA 2XADA 4I9HA 6ABPA 5ECGC 2XLBA 4RMIA 3TW8B 2Y0CA 3EIFA 1A4RA 4Z9BA 4YQFA 2EDCA 1CY7A 1KZ4A 4IGKA 2O5RA 4JVSB 1CR4A 5BRJA 1QGYA 1LC3A 1MV8A 4DCPA 1NUSA 1PKEA 5K8JB 3A6KA 5LZ9A 1WE2A 1KYVA 1EUDB 4MRVA 1YNOA 1ZG3A 1PEAA 1DINA 2AQKA 2G5PA 4IDHA 4NDZA 1U0FA 5B3JC 3G0IA 5L7WA 2CFSA 4INOA 4RJ2A 4KUGA 1V0JA 3YASA 4DQDA 1BE0A 2JB9A 1GNSA 3Q11A 2QL7A 4HVAA 1E6UA 2PBFA 2CE2X 4HYTA 4UUOA 1E4EA 3PKZA 4UE6A 5L6LB 3HXMA 2CUZA 3WBJA 5LD2C 1LK0A 3FZEA 4ZD6A 3QMPA 4YXWD 3RREA 3KQPA 4I8DA 3IOMA 4OKNA 4RA9B 1ODSA 4Y2TA 1GL9B 1UD8A 4II7A 3ETJA 3ONFA 3G68A 2GD6A 3LC7O 5FTNA 1X1CA 1RDFA 3HWSA 4MCJA 3OF2A 1TAHA 3AQ4A 4KXWA 1GP2A 2CB9A 3LKDA 4NPHA 2JVJA 3IJRA 4OKIA 2CC2A 4C0SA 5EQJB 1NW3A 4CQLB 1U2PA 4PGOA 2AMVA 1Z6YA 2OK7A 3HQ4O 1UD2A 3QYPA 1W47A 1AHIA 3ASZA 4IILA 4YUYA 2VZ0A 3OF5A 1VRWA 1RKBA 1GV0A 2O4UX 2PR2A 4FS3A 5H3LA 4DLPA 4EL5A 4AMZA 3IDZA 3P9RA 5FQOA 2FA9A 5DWVA 1CRLA 3UWDA 4BEVA 1PF7E 2RI1A 4TKLA 5DBIA 5IHXA 2EDAA 3G88A 3QOYA 4IYJA 4OHXA 3CMMA 3SC4A 4DWJA 1W36B 2IBSA 1HBJA 1PLLA 3L7LA 3HCPA 5K3OA 2NU6A 2Q4TA 1KY4A 4AQDA 4BRWA 3MM4A 2VSQA 1TADA 1EXNA 1MDFA 3F1LA 4I19A 2UZIR 2ENUA 3A35A 1E4VA 1PFQA 2OKCA 3VSCA 4DUGD 1VSVA 4JHLA 2PSFA 5NULA 1CCWA 3A1SA 4FGUA 3M8KA 2VQDA 2BJHA 3U1VA 4WJLA 3GLUA 1VQ8B 1VL1A 2VOJA 3A1EA 1RP7A 4YONB 2WWFA 3B2EA 4P3YA 4IFIA 3FROA 3E9EA 3V3TA 4KZPA 4PC7A 3D6HA 1W36C 2PH7A 2A5DA 2RI6A 8ADHA 3RNOA 2FR8C 5IT5A 3DS8A 4ZYWA 1J0DA 5BYKA 3H8VA 4ZQFA 3TN7A 2ODWA 5GIOE 1NBME 4QV2A 1FU7A 3ELBA 3JQDA 4EYEA 3FZYA 4MKIA 1V6CA 2HBQA 2R8PA 4YAUA 1C8BA 5FUYA 1DAHA 4UCFA 4Q4HA 1XCBA 4PS0A 4RHEA 5HF8A 5JCJA 3CUEF 2IODA 4OGLA 4EPRA 2TS1A 2M5SA 1O87A 4XFDA 1NFRA 1ULBA 1JEDA 4HTFA 2QTBA 4LZAA 1W1WA 2XDQA 3R6TA 4GPTA 3G0HA 4HDKB 2FQYA 1BQEA 2BEWA 3EUEA 2D6FA 2QVBA 3FBWA 3OP4A 1EUYA 3F3KA 4MQFB 3F90A 1PJCA 2IA5A 5J2TA 1T5TA 5L6MB 3THYB 1OWMA 1PJ3A 1Q22A 3RUAA 1L5NA 4OYLA 2ET6A 2ZUFA 2Q4BA 4BKQA 1UPCA 3HJAA 2WIFA 1OXMA 4F96A 1Q1AA 1KJYA 2IE8A 4JEMA 3F78A 2E3JA 4PXYA 4MLDA 5EIAA 1E2PA 1AN9A 3C1AA 3G89A 5DKFA 1IXSB 1ZZGA 2FPSA 1FUYB 3N8KA 1NT4A 3BMQB 3KCQA 2ZS9A 5KVAA 3BF7A 4QX6A 5K0FA 2FSVC 3FKJA 3I6QA 1G291 2X5KO 4HB2A 2FOLA 2QHXA 4JBLA 3EVAA 3H05A 5K03A 1NY6A 3AEZA 3X3HA 5FPYA 2V7QA 1OWNA 4MKXA 4ODIA 1RC0A 5TY0A 4ADSG 4GI2A 2WSSD 1ACMA 5B53A 3KJIA 1X7YA 3O21A 3V1TC 4F0JA 1JBEA 2W6IA 4LIPD 4IDAA 2MHCA 2QTAA 4TT8A 2HRCA 1W581 2WNIA 3DAOA 3JQAA 4KE7A 4UDXX 4POAA 5EE5B 3ET4A 3ASQA 1BVHA 9LDTA 3WLOA 4H3HB 5ARCA 3TR5A 2TSYB 2XJ9A 4PHFA 2VK8A 3R8XA 2HKIA 3IAM1 4AMBA 3WGNA 5DN6D 3UC5A 1LS1A 4K6KA 2QI9F 5JSKA 4CV2A 4ZEMA 1AK1A 3E9YA 3LDFA 4FYXA 2BFCB 2C2YA 4TRMA 3I9V6 4M9UA 2A5GA 3HS3A 4R8MA 4W7SA 2F43A 2B25A 1JEAA 3BTOA 1Y5NA 3I9LA 3KXDA 3WGJA 1PFYA 4JB2A 4OL0A 1RWQA 4MW2A 4Z86A 5BYBA 2NPIA 4CEIA 2V58A 3L8GA 1QH9A 4K8OA 5FHQA 3TI7A 3AOEA 2XZDA 5U4XA 2IP4A 2PCLA 3IP9A 3RJZA 5IDQA 5JSHA 1B0UA 2QJOA 5F7XA 1IK6A 5IXSA 1BROA 3IAAA 5KWSA 1RCFA 3N07A 2Z2XA 2VPWA 4IDNA 1P7ZA 3UH1A 4DCCA 4TVBA 3G49A 2DSNA 2JNWA 2YZKA 5JVDB 3KKOA 1U1GA 3EWAA 3CUVA 4X92A 5ALMA 1PT8A 5C80A 4OYYA 3MCAA 4Q18A 4LVCA 4Y6QA 1NLUA 3RKUA 3N74A 1PS0A 1CU1A 5EJ9A 4M1OA 2EZUA 2EHJA 2QTMA 4FMDF 4OGWA 4PZYA 1U31A 3M34A 2OBNA 4JEIA 1SC4A 2G0NA 3K94A 1ISSA 3NUQA 2IT1A 4PX9A 4GOLD 1VLJA 3I6BA 4RVFA 4UW9A 4XJTA 3QKSB 3SR4A 3V46A 3WFZA 2Z1NA 5GM1A 4MTCA 4ENWA 1L1RA 1OFVA 1O0CA 3W2TA 1RHKA 2GPBA 4DADA 4YJFA 4D81A 1KARA 2AZ4A 2PGJA 3B6KA 1N3BA 1IULA 2FFRA 2IUSA 3SNKA 3ZW8A 4GXRA 4FM9A 3GT0A 5JNRA 1WSDA 2Q07A 2XVXA 4FSHA 4HQ6A 4RH1A 3VR2D 5CJ2A 2BSAA 1YJBA 2XRFA 5HKKA 3ZJYA 1FLVA 3L93A 3CRVA 2GD1O 4NYIR 1P2SA 1KVTA 3R7AA 3DJFA 2WQ7A 1XYYA 4GHWA 4BQNA 2C5AA 5H0IA 2AG6A 4COKA 4UASA 4YT2A 5AI9A 4BKOA 2OB2A 2PLWA 1RI1A 1OOEA 2BFAA 4HD8A 4JQZA 3ZU2A 4ZHQA 2HTEA 3GDHA 2E1RA 3JASA 1I6MA 4M8KA 4WN3A 1MMFB 3EHEA 2LCQA 1JKFA 3CHYA 4CQJA 3KVYA 3NM5A 5JBNA 4KTVE 5L7YA 2QV7A 4A0SA 1ETUA 3N2IA 2NZXA 4L5AA 5E0OA 2WKQA 1E7WA 3PT5A 3EUWA 3P5BA 4MVJP 2ADFA 5F2OA 2QAGB 2P41A 2IPOA 5J40A 2R5FA 3BTVA 3G9QA 3R0ZA 3BEDA 1ESNA 1R27A 4B0OA 5K3EA 1Y33E 4H7FA 4H77A 4KIFA 3RADC 2D3NA 1R0LA 3AJAA 1Y3FE 1JA0A 4DMLA 1CY6A 1EGQA 1PR6A 3NYWA 3L4BA 4G1BA 5HF6A 2YXEA 2HUPA 4F9GA 2RAVA 2G7ZA 3D3NA 3LNCA 4JH0A 2QTVA 4KYIB 3WRYA 4COOA 4BQEA 4EI2A 2OCLA 4OHMA 1G5TA 3QNWA 5DU2A 4OHBA 3IBSA 2WB2A 4HKTA 4X7CA 3ND6A 2CV1A 2G17A 1GUYA 1FNSA 3EAQA 4L2IA 4GFDA 5HR5A 3G7SA 1N1EA 1ZFNA 2FPKA 2HK6A 4HAUA 3N7AA 4R68A 5COBA 1NKVA 2DBVO 5TT0A 3T3DA 2IP2A 2VIIA 4JROA 1I24A 5KINB 1IRXA 1PT7A 4MIYA 2NO6A 4F97A 2XBMA 3ORFA 3PYLA 4ZYVA 2NVBA 5G2OA 3WXBA 4PWZA 3D02A 2PX6A 3AF2A 2GEUA 1IN8A 2ODBA 3QYAA 3Q8XB 4RDLA 2B8EA 1YQUA 3D64A 1KAGA 2IELA 5JR3A 2I87A 4A2CA 1JJAA 4YMTA 2XH8A 1NIPA 4MS4A 3SC2B 3KOYA 2WPDA 2PFSA 3OEEA 3IDFA 1Z7BA 2CJPA 5CYPA 4MMXB 1J56A 2A88A 4QLBA 4M1TA 2IK8A 4DBLC 4OHWA 4U6NA 5TQ2A 4IOJA 3IEMA 3KYDA 3H8SA 2OZVA 4WKBA 2HJSA 1YS6A 3DDOA 4LVUA 3D8NA 1M5RA 1EUCA 1UQUA 2HJVA 3BQMB 1ESEA 1ZK2A 1RYDA 1QHIA 5KCZA 1EVJA 2YHIB 5BV7A 2HY7A 4N5NA 3H1TA 4BWGA 4WTOA 1Z0JA 3TE6A 4C05A 3HADA 2FQQA 5B1DA 1JS1X 2ZWAA 4NI5A 4QOSA 5C53B 3VFDA 4JDPA 2ZSBA 1E58A 3F67A 3R8CA 5J3OA 5L3SA 2QORA 1YF3A 3MMNA 5A02A 2D1SA 2W2LD 5LMNB 1J0XO 2PZLA 4TL6A 3RIGA 4EUFA 5L40A 3DCYA 1AQNA 1GNTA 2GBCA 2YOFA 3C15C 1YBAA 3L82B 1DEXA 1X1DA 4MO9A 1KZ7B 4XMYA 3TRKA 5FADA 3U62A 1CVLA 1W25A 4P82A 2EG9A 3EQ8A 1OFHA 1JEQA 2RH4A 1XJQA 2EYUA 3AY3A 2GEJA 3OLXA 4N0DA 4DA9A 2C9CA 1TEZA 2CCKA 1OZHA 2YHSA 4PPNA 5TJ9A 2RGWA 3EZLA 3A8KA 1HDOA 3DAPA 3KQWA 2R6ZA 2XY4A 2JKVA 3HCNA 4RV4A 1GCAA 3EEYA 3TLYA 2P6PA 2WWWA 4FGJA 4IAOA 1AC5A 1CZOA 3VYRB 2X8JA 1P1RA 5LWQA 4NMXB 4Y18A 5CLGA 1PWZA 2G08A 5J5VA 2Q9BA 2VH2A 1N5KA 2ZVDA 3E1KA 3EY9A 2XHEA 1A71A 3P9CA 3G2OA 4K28A 4OCZA 2CJFA 5EP3A 2AZDA 4IJQA 3R3WA 3RSLA 1MNAA 4A0HA 3COJA 2VPYA 4B76A 3ML1A 3S2ZA 3U81A 1SPXA 3QFHA 1RAIA 5LA6F 2EGHA 3LX5A 1P4GA 3PR3A 2DH6A 2RK6A 4EGQA 3MCZA 4PBTA 3KNZA 5LFAA 3KSMA 2IYWA 2LZJA 5CFOA 2C2BA 2Q2VA 3L0YA 3QXCA 4MO2A 5E3JA 3WL4A 1JPVA 1GEGA 4P4UA 1DCFA 3NO4A 1N8TA 4Q34A 4QPPA 1GA1A 4KQ6A 3U2QA 4KZKA 4QQNA 2NVUB 1ESDA 1SKBA 5B64A 1DBVO 2C8KA 3L49A 2JIDA 1VPWA 1JDJA 3JD4A 1ISMA 1W0CA 4IHJA 5B6PA 8AT1A 5HZGA 3OKCA 3LP5A 3FOEC 4BFLA 5C4GB 3IVMA 4OXKA 4Q9HA 3EVCA 4CU5A 5JYDA 2VT7A 1O8CA 3LGAA 3ZQJA 1NY5A 1SUIA 1WB9A 1PHPA 4ZOEA 4ZOBA 1IZZA 4UPEA 2XOKA 2P91A 1DRJA 1E9SA 3ZXUB 3I42A 3DL0A 1N7IA 3VV3A 1CUIA 4D43A 2QM3A 1GPUA 2OYSA 3W6PA 4TLEA 1E2KA 5KX5F 7REQB 3JTMA 1FX1A 2VJOA 5ILOA 2I66A 3RGGA 1FFBA 4R84A 5BOSB 2O1EA 4N7BA 5ED4A 3K2IA 2A9PA 2O8DA 2GA8A 1F2VA 3VO8A 3JARB 3L1HA 3G71B 1FFCA 2BN4A 3E8XA 3O4HA 2IITA 5H3HA 5KEIA 2NUBA 3REOA 2YWBA 3DEIA 1EAMA 1VP9A 3EVDA 2YW2A 2G67A 2QWXA 3LBFA 4XTCS 5JNTA 2P5UA 4C3VA 5CDSA 4XPIB 1BLIA 1O4WA 4EJ0A 2FWRA 1STOA 1SUCA 4S35A 4LMAA 3DDUA 5DNUA 1TO2E 3B1XA 3UHJA 5DULA 3QU5A 1NPYA 1RJEA 3QVLA 2VOEA 2Y1EA 4J0CA 3UAWA 3OJEA 4HUQA 3EGVA 3B89A 5DNVA 2Q6OA 2WUVA 3CUKA 3EDMA 1BFKA 3RVNA 3UJ3X 1VLOA 1JAYA 2ZSEA 3SJCA 3CE9A 3H87A 4FEEA 2AZTA 2HMYB 1H94A 4X97A 1JHMA 3RQSA 1Z2PX 1X7WA 2IQIA 2IYVA 2NXNA 3CXRA 4E6PA 1Q3HA 5BW6B 1FJXA 3AFNA 3USCS 16PKA 1Q7GA 1YRAA 3H2HA 4G09A 1Y1PA 13PKA 1R37A 2AYZA 3R0JA 1NQVA 4JP3A 1U2GA 1XUOA 2VPPA 5HE8A 1RYFA 2RJNA 3LIPA 4W8HA 1T6NA 5LDDC 2LTAA 1SUFA 1TAUA 2GJSA 2NUTA 3IP7A 3R9IA 1NU6A 1R6XA 4KLCA 4BLSA 3EPKA 1QORA 2HF8A 3H11A 2DTEA 1QIFA 4RQUA 4FYVA 1GNLA 4C29A 3WS7A 2Q3EA 1U0RA 3OZEA 1U28A 4UVIA 5JSQA 4BMZA 2E6UX 2QUAA 4RESA 4PQFA 2VUIB 3QG5A 3CCJB 4NAHA 4FR0A 5DHTA 1K7CA 2FN3A 3BRWA 4ZI7A 2DHDA 3RWMB 5KOJA 5IMBA 3QA3E 1HT1E 4LTNA 5F1OA 2BJVA 1SZDA 2Q1UA 4PYQA 1Y7TA 4M7PA 5TE9A 3O8DA 3RG2A 3GMSA 1GNQA 2J33A 5IDYA 2VN8A 3SC6A 1OV6A 4XVRA 2BHRA 1MRZA 4D3FA 4RXUA 2H9YA 2NU8B 3SXUA 3FD8A 1GZ4A 4UTOA 4HSGA 2HPVA 1DCMA 5KSYA 1V3QE 3K9HA 1HFJA 2ERCA 1D2RA 3NW9A 5LA6B 3IELA 1TT5B 2P3QA 2WBLC 3LRPA 1P2DA 3SF0A 3ZLTA 2BGJA 1UP4A 1FE8A 1GQYA 1KETA 1R64A 2V54A 3BKXA 3PX3A 2IYEA 4DILA 2RBGA 1XEFA 1I7LA 2JH9A 3PPVA 4V39A 1LH0A 4XN0A 3UJBA 1U7OA 3IUJA 4TYWA 1RD4A 1SUDA 5JSZA 4B46A 1RACA 2OA0A 4K1XA 1SU4A 5KJ1A 4EO4A 2UVQA 3F7MA 4O6VA 4DB4A 4XRGA 4FKBA 2OXEA 1JSXA 1H0RA 4Q4AA 4DC9A 5DTEA 1LW7A 4Y0NA 2PKCA 3NJ8A 4AJIA 3ORRA 1FZQA 2H1CA 4Z0TA 1RZUA 4LXTA 4DVGA 4GS5A 1NF2A 2O0HA 3GMIA 3FUUA 4A16A 1XMIA 2Q4RA 3I39X 4KLNA 2I7DA 4OLAA 1NMSA 2R8RA 3C3AA 1DWOA 2V4DA 2PK3A 4I9GA 1M2WA 2R66A 5EIEA 1MTOA 1QVWA 2GUWA 3VH4A 3ZCTA 1AUOA 4DBLE 1D6NA 3H2GA 2GBLC 4YH1A 2W70A 3WFIA 4RY0A 4BIIA 3GJQA 3O1LA 4QPCA 1I5EA 4BFXA 3GLFA 4ENQA 4LHWA 4XB6B 5GZ3A 1HEIA 2EBHX 3DOEA 2ID7A 5LIPA 3PVSA 3N3AC 1R8JA 4RTMA 4AN4A 1BYUA 1KEZA 2QP3A 4Y7CA 1SB9A 1W5EA 2NO0A 3DO5A 3KS9A 3KOZA 2GPWA 3CR8A 3CZCA 1VLVA 4HZGA 4P32A 4TRJA 2H0QA 3GCXA 4FT2A 4LXYA 3TLGA 2DETA 3RK1A 3S1LA 3D2BA 3FMPB 3MQ4A 3V1LA 4NENB 5HHTA 3H1FA 2J0UB 2ZBUA 3P0HA 4EFLA 2QZJA 2LDBA 2A3NA 1L4GA 3MUNA 1EM6A 1OV4A 5AKZA 4HNUA 4CKZA 4EMSA 1M33A 2FK8A 2VDRB 3DZCA 3QOFA 4UAUA 4DAEA 5IJ0B 1H1DA 2EJCA 4IZIA 3TB6A 2ZXIA 4H60A 2CF4A 5E9AA 1AV7A 3ROXA 2QUKA 1NB0A 2BM9A 4A5SA 2O1XA 2FGJA 3AUYA 1I4EB 5A4DA 3STHA 5JDCC 2NU9A 2OZEA 4RWEA 1X1RA 4ZQEA 2O06A 5BQ3A 3K0FA 4ZO7A 3MHTA 3U80A 1SHUX 1I1OA 1O77A 1U5BA 2GKSA 3EDRA 1G19A 3VKWA 3DMYA 3DOCA 2ZROA 3GNLA 1TTPB 2PX8A 5BUZA 2Z08A 1E9VA 3W5SA 3L8CA 1YJNB 1T3TA 2CNKA 2GJ4A 2HWXA 4P2NA 4FSXA 4LEIA 4GKAA 2FP4B 3CIFA 5JNWA 3GVLA 1TZCA 4JJ7A 1GKUB 2P0YA 1E2UA 1H2ZA 4KXLA 4ZARA 3CONA 1EB9A 4M83A 2GD0A 2UXDB 2IZ6A 3GC6A 5EHQA 3U1BA 5A7FA 1FZTA 1UBHS 3L07A 4HTAA 4LYHA 4MKRA 2P6MA 4CZ2A 1G3UA 2QMYA 2FPPB 4MROA 1XMOB 1XO1A 4BVGA 2HXGA 2UYHA 3ZZTA 1HDZA 3UG7A 1FJGB 2FKNA 3TBHA 3VNQA 2FX5A 3BXXA 2QE6A 3F4BA 4PO3X 1SHZA 1E3JA 1P77A 1M1NB 1R0BA 1EM8B 2FLVA 3F97A 1J7KA 1XZJA 4OYHA 5AJUA 1XWWA 1KTIA 1YD7A 1TIPA 2OAGA 4LG1A 2C58A 5HA5A 2WSYB 3HJCA 4FTWA 2YICA 4MS3A 2HW8A 3CZQA 3Q2OA 3VNRA 4ZZ2A 3TG8A 1M8GA 4EPVA 3NRBA 3RRXA 4F21A 3ZGZA 3UB3A 2JVKA 3KSZO 4LMPA 5GZ6A 2C04A 3H4TA 1S89A 3AINA 4Z2AA 4KVGA 1A9TA 2QVLA 4FFSA 3PJFA 1YHNA 2P79A 3VHRA 4E0FA 1E2LA 3CW8X 2OILA 3EGWA 5FNVB 2J3QA 2VF5X 4I3HA 3LE8A 1J9ZA 3A9UA 5DLDA 1NUHA 1RQLA 4ZTUB 5L4NA 2HJ9A 1NW8A 1DX4A 4AYWA 1DC5A 3EZNA 1W44A 3CG4A 3HHPA 4R3NA 3WX0A 4ZCRA 2XR1A 3WLTA 3WRXC 1A27A 2F3TA 1QXSA 4LMBA 3EQ7A 3VGJA 1SC3A 1MLDA 4FBGA 4FDAA 2FB9A 1JU4A 4B2YA 1X94A 1X8JA 1RRVA 4WNAB 3WGLA 4EFMA 1ODKA 1J0BA 2OORC 2X3FA 1L7XA 2ZRKA 2QNIA 3E3NA 4OXYA 1QGUB 5CX4A 5JQGF 1OLSA 3D0KA 1VRVA 1BWRA 3I2FA 1C1DB 5IKXA 4IGAA 4OGFA 3CQ9A 3DC7A 2WA2A 3RO7A 1OGJA 1O57A 1OB0A 3O4IA 1WULS 1TK9A 4WACA 1W2HA 4U63A 3Q10A 2AFIA 3NGXA 4MUHA 2A9JA 3BYZA 4WZZA 2F00A 2YQZA 4E51A 1FTSA 2W2MA 1XDZA 3TLJA 2BCJQ 4W7HA 4B2LA 1A0OA 1JEYA 1NATA 1M1UA 1SPBS 4HDAA 1ARZA 2Z5LA 1AGXA 1HLGA 4R83A 4ABTA 2DPYA 3EIOA 4TSFA 4UU8A 1B16A 2FSGA 3VYUB 4BNIA 5GMOA 1T0UA 3PHIA 1UAAA 2RE8A 1C3LA 1UJMA 1Y8CA 1UEXC 1WSBA 4WWVA 4M89A 4IKOA 4EVQA 2VUHB 2HMVA 3KUXA 3M5CA 3NHBA 3AW9A 3OM1A 4JYMA 5DCWA 1D0SA 1Y98A 1YIOA 2CNNA 2OKGA 4EVRA 2YVUA 3PLRA 3ED5A 5G4KB 3FUVA 3WB2A 3D6NB 3I5XA 3C6KA 4M0FA 5J4VA 4Q82A 4YRNA 3VR4D 5LP6B 2CNWD 1C4KA 3MNFA 2NXWA 4X06A 3Q5DA 4Q37A 1E2FA 2ODEA 4JENA 1XQBA 2PKRA 1PSWA 1I1QB 1Z82A 1CV2A 1JDPA 4GI1A 6REQB 4LE0A 1BMFA 3AW8A 2N9UA 2WJAA 2QD3A 4DE5A 1Z37A 1OPRA 1Z5NA 4C2UA 5LQCA 1L4NA 4MUMA 1J5PA 4CM1A 1FC0A 1UBCA 1GPWB 2JC3A 1WUHS 2ONKA 5HW0A 4YCNA 1VL6A 3A28A 4HWSA 2GRUA 4BMDA 4WLVA 4NYMR 4M22A 5LP6C 1ZUD1 5HOEA 1ONBA 1DAPA 4S0XA 2OYRA 2PD3A 2CKMA 1DNPA 5KJFA 5AVRA 4Z53A 3AI7A 3B8HA 1L5HA 5CH8A 2RGAA 4TV9F 5HIJA 3NHLA 1WPXA 1AK9A 4BN5A 1RXYA 2CYCA 3E9DA 3FB1A 1WD7A 3HUUA 3PEUA 4H1VA 4KMSA 4PBRA 3P32A 4QFBA 4URVR 2EFJA 4U9UA 4QM6A 1Q7RA 2AS0A 5KWVA 4FYIA 5CT4A 2P2NA 4Y2RA 2C59A 3CCBA 2B7LA 1YIAA 4JGBA 1M6NA 2KM1A 5ILGA 3HCAA 5JZMA 1WCYA 3DF7A 1E96A 3MLAA 3RARA 1U1CA 5BV1A 5JHHB 4YRFA 4LNUA 5E9JA 2RK4A 1YMVA 1NUTA 3ZIAA 3O8CA 1YB2A 4H27A 5CM9C 3I34X 1KJ8A 4REQB 4DA7A 2VKQA 4YLGA 3VDXA 3W3ZB 3D6UA 1XTSA 1K8ZB 2FVYA 3BQJA 3FGZA 3EULA 2HWKA 4MQLA 1O96A 3PSAA 3TAXA 4J6EA 3TW4A 4Q3EA 5JRZA 4DLXA 2LKDA 4B6SA 1C41A 3DHYA 3UZUA 4PAAA 2B37A 4U1RA 2DF8A 3M6AA 4I1VA 4QPJC 4AS1A 1X7XB 1N7HA 1HQYE 4UXJA 1P2BA 2QB5A 3Q88A 2JN9A 2DQYA 4JI3B 2R62A 4UXIA 2DULA 3AV0B 1W48A 3U4GA 4ALJA 3I28A 1BS1A 1OLOA 3TG2A 1EVIA 1UJCA 2NSLA 2ODPA 1RFGE 3Q3HA 1WHSA 1X1BA 4KWEA 5CB8A 1UWLA 4P54A 4KR0A 4H7EA 5EZYF 4BPRA 1DC8A 4WCDA 3ZYCA 1Q14A 2HU7A 2Q7OE 2ZWPA 1BJRE 1UK8A 4H1HA 4XB1A 4XARA 3AVPA 4JC8A 1T8WA 4PHCA 4W82A 4H15A 2J0QA 4ROSA 5EHXA 3RGWS 5KWJA 4EUSA 3FWHA 4YRCA 3JQ6A 3N2LA 4H17A 3GEIA 4YT5A 1CS0A 3W06A 4LGCA 2PQ6A 3PUHA 3VPXA 4B47A 4OJKA 3THRA 2A0WA 2ZAOA 3H3JA 3WK7A 5HQJA 4Z51A 3FCEA 3PNQA 3LUDA 3JD3A 2FG6C 1P9NA 3BJZA 3G9ZA 4BRSA 1HVXA 4N18A 4AAYA 4EENA 5LU8A 5EIXA 1CUHA 2VPZA 2R751 3ZD6A 4NZPA 4HAYA 5ALIA 3U44B 1UXJA 3ICPA 1U0NA 1NJ6A 1BA3A 1OJLA 3ZCPA 1VXRA 3TQRA 4LYDA 4EKGA 2W98A 5CBPB 3JZAA 1UXIA 3TQCA 2DPLA 1Z5VA 2WSMA 2YL2A 1J8MF 1TNDA 3LF2A 1Q57A 2WWTA 1Z35A 4WASA 4RTKA 2I7XA 3I2JA 3CW2A 1UZNA 1V1MA 3TNYA 3F5FA 3ON5A 2IEGA 4XDYA 5EUMA 3X1MA 5D87A 4J4BA 1XTTA 2JFHA 2I67A 3BVPA 1MT0A 1TC1A 2RH8A 3A6FA 1MR3F 3HNPA 3OTHA 2NT3A 4B85A 5AM3A 1K97A 1YFKA 2ZTSA 3IQZA 4R2MA 5HZBA 5DN9A 4ZOQI 3D5QA 2J9FB 4XIJA 2BONA 2EXXA 4RFSB 5DYNA 4QA9A 4ZAYA 2HDWA 3QFTA 2OL4A 5IYZA 3ZNQA 5ADUS 4RE5A 4BNDB 1XA4A 2Z2YA 1X92A 4NPAA 4TTPA 3VOTA 4LF5B 4RMJA 3UMSA 2R96A 5HXBA 3CNLA 3DMDA 4HQLA 3WISA 4M1ZA 5AJXA 2XYGA 2AHRA 2ZRLA 2ATCA 2PT5A 4OQQA 4BO3A 1PFGA 3GXBA 2ZRGA 3DFZA 3RYHB 2QMHA 2ZREA 4RDHA 1XVLA 3WWOA 5CDYA 3GPLA 1LFDB 4D8YA 2FUG6 2GBIA 4HY3A 3UB4A 1PL7A 4MDHA 1L5SA 4PN7A 2J3EA 3TLZA 3L3BA 4MV4A 1TYZA 5AI0A 1CEQA 1ZI8A 2VRWA 2GPYA 2WJPA 3K05A 4HFMA 4PYJA 5K4HA 1Y1KE 2O3UA 4OOXA 1LDEA 4MVCA 5J58A 4L57A 3BZUA 1CJKC 2O7QA 2OQRA 4YGYA 1WDTA 2W4IA 1YRLA 4YFVA 4NBSA 1XI2A 2DKFA 1OAOC 4U7PB 2Q8PA 3IIMA 5FPSA 4Q01A 2VQ6A 3P20A 1TCBA 3B3GA 2VJLA 4J1QA 4AJOA 3UGJA 1L5YA 3E22B 2X2FA 3OPYA 1EUQA 1OSNA 4Q1FA 3OC0A 5KNDA 3FMIA 3W77A 4LF9B 3QWIA 2CXPA 3N39C 4UARA 4YJ2F 3TIXB 2M98A 4B43A 1O1YA 1QHYA 5K05A 2XTNA 3FSEA 4JB8A 2PA3A 4H7IA 2JA2A 3G13A 1XK6A 2AYXA 2FHSA 4TTRA 4HRXA 2I7VA 4FHDA 3EVBA 3EAGA 3OLQA 5B1IA 3C3PA 1LLFA 4UNNA 2D59A 1GZHB 1O3YA 1US8A 2H2FA 3WZMA 1C29B 4WA7A 1MQSA 5TLSA 3J7TA 3RC9A 4OU4A 3JWPA 1HNXB 4LECA 2I29A 2AQHA 4CLRA 5KDDA 3D7SA 2H59A 4L3OA 1SH7A 2V7VA 3M3DA 1BKYA 1Q7TA 4V03A 1MIOA 4EPTA 1RMYA 4NL4H 3WQQA 2WP0A 2ZL6A 4LC1A 2X8KA 1BXGA 4BWFB 2FRDC 3GOQA 3W8RA 5H8WA 1V6SA 4KPUA 3ZH2A 3I3SR 5C4IA 2P4EA 3KKEA 1BWQA 3SFVA 3GLGB 2ZTMA 4HLUC 4TLCA 2AD5A 3A4MA 5D00A 1N5IA 3NRJA 5JBIA 5EVCA 3SKYA 1QRDA 3JQGB 2W43A 1XWFA 3PHGA 5KYVA 3RM3A 1A5AB 4K6GA 4GNRA 2WKSA 5CDFE 4E5KA 2X2PA 4Z4UA 4GPBA 4MRAA 2GO1A 1KXZA 1XRMA 1ZI9A 3AJ9A 3PQCA 4GOXA 1LFAA 4IXWA 4YRLA 1M2OA 2J4FA 3HXQA 4N49A 4WRRA 1NP7A 3UCXA 2Q6IA 5BSUA 4W5QA 2QRQA 3C7CB 5C8XA 3A7DA 3FYHA 3L84A 3IQIX 1HYEA 3IPCA 1L1EA 3R75A 3IKVA 4LJ9A 3L0CA 1KJWA 4DHWA 4XWYA 1MENA 1LDMA 3R0VA 4AQYB 4QUAA 1IWPB 2X4DA 3UK7A 5FA6A 2VBCA 1TD1A 1YAJA 1Y7IA 3WGGA 2RGGA 3ADPA 3Q6MA 4JP8A 6YASA 1QH0A 1R9MA 4KTTE 4NARA 2WKPA 3M6VA 2O2HA 4Q7MB 5K01A 4FWTA 1UJ6A 4FYKA 4QXMA 5FLXA 4BNZA 1J09A 4OP7A 2ZDQA 3NHJA 2JHAA 1T2NA 5FA5A 4Y6RA 5JZ9A 2JHPA 3GMDA 2JW5A 4KQJA 5CX1A 3QSYA 4E7OA 1X1EA 3DULA 2C9OA 4GYYA 1OZGA 4ER0A 1PTJC 1GY8A 4K9KA 2QG9A 1P18A 1C5KA 1QIDA 2JAOA 4HCJA 2TECE 1JTVA 3NOXA 2F9FA 2Q5HA 3GJZA 4Y6SA 5BVHB 2YJ4A 5E1OA 1Z63A 2ZUEA 5AKKA 3KKZA 4X64B 4ZOLA 5ELLA 4ZREA 5T57A 1E3ZA 1J33A 2Y1XA 1RXIA 2PX5A 4FFLA 3B1WA 1G9TA 1QZUA 3GUCA 3L04A 3QEMA 4GSYA 4K0KB 1IHDA 4CCYA 1E9CA 3RRYA 3F96A 5I5GA 3MTIA 3P8ZA 5JZOA 5I9LA 1HR0B 1GZVA 1OREA 2XGGA 4ID3A 1S2NA 5FOSA 4NPCA 2IPLA 4DUPA 4B3BA 3AB8A 4QU5A 5AKYA 5EJMA 3EFEA 4Z7JA 2G82A 3K8QA 1EWYA 1ZK4A 4RS4A 2Y9MB 3IP8A 4JQSA 1KBZA 4TKZA 3ZWPA 1YRBA 4QQ8A 1I7SB 1JPNA 4X7BA 3AERB 4LXHA 4LZLA 3UBMA 1FFSA 2R4UA 4F3RA 1AF4A 1ZM7A 4S1OA 4BNUA 3KJQA 3S8EA 2CGEA 3CRZA 4YJ2B 1TKCA 1SVNA 3MILA 4S2UA 4RDIA 3UMRA 2Z8XA 2M32A 3L77A 3RHZA 5IDXA 2PZMA 5TT1A 4JP2A 2YQ4A 4BE4A 4KKUA 4BVKA 3S2EA 4C2TA 2F3QA 4WJZA 1TJYA 1D2CA 2PXCA 3KEOA 1N6PA 1ULHA 2C5GA 5I8ZA 3UXEA 1TM1E 1WM1A 4DC1A 5KKCA 5KTNA 1JZQA 1HL7A 2EGGA 2H29A 4I5GA 4CMKA 4EPYA 4KQHA 5BQ5A 5F12A 1PK8A 3B3JA 1V37A 1W4AA 4JA0A 1O5TA 3CMCO 3QKTA 4RZIA 5E1DA 1YJ8A 3ZE9A 2A1UB 3RTAA 3NASA 4C1BA 5H5JA 1T13A 4NCNA 5A88A 3F4KA 4OQDA 5HM6A 5M2QA 1TW2A 2AQ8A 2F1JA 1B76A 3NVAA 5J1TB 2GCIA 4WZEA 2IZZA 4BYGA 5FTLA 3SK0A 2G40A 3T4UA 3BQNB 2O7RA 4IOMA 4WZ6A 4WX2B 1SD2A 1YS2X 4D96A 2TMGA 3PDCA 1FRQA 4FEYA 3FYDA 3TRJA 4Z9FA 4HEA1 4EECA 5BR8B 1DJMA 4BL5A 4RJKA 1N8RD 5K0BA 2BRUC 3DSRA 3OMXA 3ND5A 3JVIA 5D3KA 3SX4A 1CHDA 3IA2A 1BN6A 1HQKA 1N0HA 1K3FA 4AMVA 1UPTA 4IH1A 4QXRA 4R69A 3JYNA 2CRVA 4RKFA 2VAMA 5A6VA 3N28A 3BULA 3DM5A 1MH1A 4HH1A 3U7QA 1W5BA 1QQ5A 4YV0A 4CEJA 2WZDA 2WU1A 3PI6A 5TX7A 5L8VA 2EJUA 4NU0A 1OXUA 1SVSA 2R00C 1V8PA 2SBTA 3C45A 3VRHA 3THWB 3TZBA 1QQBA 1FMFA 3OTOB 4JJAA 1E9FA 4R3UC 3ZDEA 4PZPA 3ETEA 3T4XA 4IF6A 5BUCA 5JS7A 4N6OA 3SE7A 4RTRA 1NXSA 4IO1A 3TFQA 2A14A 4BKUA 3I5YA 5EMKA 3RC2A 3FWPA 4W5RA 1H3NA 2ZJ7A 3CZAA 2HPHA 5K3BA 1WXEA 3G2PA 4JZKA 4TTQA 3ZOZA 2WAMA 2XOEA 3IUQA 5SYNA 4DNOA 4LBYA 4K1LA 5GINE 2FN7A 2E48A 4HDRA 3TH5A 5IYPA 2WF9A 2FW8A 1HT3A 1VG1A 1VKRA 4JSRA 2Z6BD 1BU8A 1Y0RA 1W0JD 7GPBA 1GTMA 5BURA