3FPKA

Crystal structure of ferredoxin-nadp reductase from salmonella typhimurium
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
247
structure length
247
Chain Sequence
ADWVTGKVTKVQNWTDALFSLTVHAPINPFTAGQFTKLGLEIDGERVQRAYSYVNAPDNPNLEFYLVTVPQGKLSPRLAALKPGDEVQVVSDASGFFVLDEVPDCETLWMLATGTAIGPYLSILQYGQDVARFKNLVLVHAARFAADLSYLPLMLELQQRYEGKLRIQTVVSRENVPGSLTGRVPALIENGELEKAVGLPMDKETSHVMLCGNPQMVRDTQQLLKETRQMTKHLRRRPGHMTAEHYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-NADP reductase
publication title Crystal Structure of Ferredoxin-NADP Reductase from Salmonella typhimurium
rcsb
source organism Salmonella typhimurium
molecule tags Flavoprotein, oxidoreductase
total genus 69
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2009-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3fpkA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3fpkA02
3FJOA 4Y7CA 3VO1A 1AMOA 3CPWB 1JB9A 1GAQA 1KK3A 4J0QA 4ACBA 3W2IA 2HMAA 1EFCA 3SJZA 3P26A 5FA6A 3CRZA 1QH0A 1S72B 1ZM9A 3VO2A 2D74A 2VZLA 3CB4A 1YHQB 4Y9RA 1FRNA 3B82A 2VNIA 1W87A 4B48A 1TUIA 4G5GA 1EWYA 1K8AD 3MMPA 2BPOA 4TMTA 2B7CA 2GQFA 1VQPB 1EP3B 3W5VA 2BM0A 1Q7YD 4YAFA 5GV7A 3I56B 4LBWA 3VNVA 1QG0A 1G7CA 4NBSA 2B5OA 2HDNB 1N0UA 2YWGA 4DQKA 5GV8A 4YALA 4RD4A 3ES9A 1JNYA 3I1FA 3ZBUA 4FWTA 1U2RA 1VQ6B 1FNDA 1GJRA 3CC7B 4AC9A 3AGPA 2HCJB 3OZUA 3QSYA 1CNEA 1TLLA 2PIAA 4BPRA 4FN5A 4U9UA 4HE6A 2YWFA 2VYQA 4RD6A 3WNBA 1CQXA 4YAWA 2BGIA 4EH1A 1EFUA 4AF7A 2GPJA 2XEXA 5HXBA 2BF4A 3LRXA 4PGOA 4C0SA 3QFTA 2B7BA 2YWHA 5AN9A 4PC1A 4B4DA 2QEXB 1OB2A 1QFZA 3CXCB 1QVGB 4RCZA 4TMXA 2QMUA 4N3GA 3U2QA 1F20A 1VQOB 1D8TA 4G1VA 3JQRA 3W2GA 1B2RA 3VNUA 4ZCIA 2RC5A 2OK8A 1BQEA 1GAWA 1VQ7B 5THXA 1QGAA 4PC6A 4PC7A 4ZGNB 1YJWB 4TN1A 3CCVB 1KQSB 3ZC3A 3ZZTA 3CW2A 1N8RD 3W5UA 4PC3A 5EMNA 1B23P 2PMDA 4F7DA 1DG1G 1G7SA 3OW2B 4QFMA 4MYTA 1GR1A 4IW3B 2E1RA 2RC6A 2CRVA 1EFTA 1ZUNB 2BM1A 1NDHA 3G6EB 1JA1A 4C43A 2QN6A 3CCRB 1KTVA 3AVUA 2EFGA 1UMKA 1KD1D 2QTLA 1VQ4B 1FDRA 1OGIA 1W35A 1W2BB 1K73D 4RCYA 3E1YE 4WQMA 4LC0A 4P3YA 3AVVA 1S0UA 3AVWA 3OZVA 4RD1A 1WDTA 1Q86D 2AHOA 3OJXA 1IJEA 3QFCA 2OK7A 4UAJA 1F60A 1KJZA 1CNFA 4B3XA 1H85A 1KC8D 2J7KA 5TV2A 2DCUA 1VQ8B 1M90D 3B8HA 4YAOA 3VMFA 3CCLB 5JBQA 1YITB 1E64A 4M2LA 3B78A 1M1KD 3CCMB 1NJID 1OGJA 1HA3A 1IB0A 3CMEB 1EXMA 3CCJB 1J9ZA 1H42A 3CCEB 1QGYA 2X3UA 1QX4A 1GVHA 2DERA 1BJKA 1ZM2A 2BVNA 1DDIA 1G7TA 3A1FA 3JQPA 2PLFA 4ACAA 1VQLB 3LO8A 3G71B 1D2EA 3I55B 4LBYA 1QFYA 1YJ9B 3W5HA 3OZWA 2QTZA 1QUEA 3CC4B 2DY1A 4RD0A 1VQMB 1KK1A 1DDGA 1BX1A 1R5BA 4TMWA 3CCSB 1W34A 4LBZA 3CMAB 4M0LA 4RJLA 4M4SA 4MYUA 4DQLA 1VQNB 1K9MD 3QFRA 1KK2A 4LBVA 3CCQB 2NPFA 1GO2A 4TMVA 3G4SB 1KK0A 1JJ2B 3CC2B 3AVYA 1G7RA 3JQQA 5DSZA 3WBKA 2XNCA 3AVTA 1AIPA 4YAUA 3AGQA 4ZGQB 1E62A 1FNMA 2DETA 1ZM3A 4ZCLA 3FPKA 1QFJA 4Q7JB 3OJWA 1VQ9B 2VNJA 1YI2B 3E20A 1FNCA 4HE5A 2BN4A 2VNHA 4FK8A 4PC2A 1QGZA 1TTTA 1FNBA 1VQKB 1SM4A 4M53A 1EP2B 4N3NA 2EIXA 1SKQA 1Q81D 4YHBA 1ZM4A 2BV3A 4RD2A 4G1BA 3WBJA 1BX0A 4K1XA 3U6KA 1ELOA 1R5OA 2QA4B 3QE2A 3WNCA 2BGJA 1FRQA 3LYUA 4M1KA 1VQ5B 4R71A 3WNDA 3W2EA 4AF6A 4ZCMA 4P6VF 2FX3A 1TVCA 4B47A 3P27A 1OB5A 2OTLB 4RD3A 3MHPA 4Y9UA 1YIJB 1I7PA 3CD6B 2XNJA 1QVFB 3J81k 2C77A 5TR9A 2DEUA 3W2FA 2C78A 4H9GA 2VNKA 3ZZUA 3AVXA 5H59A 4NCNA 1KRHA 4B43A 3MCAA 5TY0A 2BMWA 3ZZ0A 5KSWB 4ZV4A 1N0VC 5H5JA 3U6BA 1Q82D 1IJFA 2BSAA 4TMZA 1D1NA 1QUFA 3W2HA 3QFSA 1DARA 3WXMA 1XE1A 3PENA 3V76A 3ZBTA 2CNDA 2ZITA 4B44A 4QHYA 1A8PA 2OTJB 3LVBA 3WY9A 1YJNB 1JA0A 3WYAA 2R6HA 1EP1B 1XB2A 1R5NA 1E63A 3CCUB 2YWEA 2QDXA
chains in the Genus database with same CATH superfamily
1RM0A 4ZOBA 3FJOA 3EGXB 2R8ZA 2J33A 3M8KA 4QATA 3P94A 3QE3A 4X92A 1R8YA 3NGLA 3G2IA 3L05A 1A5TA 3E7XA 4XGQA 3V4VB 1I1QB 4E7OA 1NBAA 5AW2A 2JFXA 4H4CA 3PEEA 2J7PA 3EUWA 3BRSA 2GBLC 1MEEA 2Z3VA 2AOVA 2GOYA 3R0IA 4GVPA 3R8CA 3CRZA 3R7SA 3HXKA 2ZDGA 1LUAA 1DXQA 9LDTA 5L4LA 3E15A 5KWIA 4D9CA 1SPBS 4FCVA 5CD1A 4GNKA 1PJLA 3RAPR 1C0EA 1D6SA 1TF5A 1XU7A 4KBYA 4MUYA 3S2SA 3WOHA 4OLBA 1IY2A 2I2AA 1DMRA 1KDYA 3BDAA 1JHVA 3ZU6A 1FX1A 5J3JA 2WWIA 2ZWVA 3RAJA 1ZGGA 1COWA 3BK2A 3EZGA 4Q4HA 2IH4A 1OXVA 4PZCA 3BXHA 1F4PA 4HRXA 1WO8A 5C8DA 3WK4A 4FLEA 5EXPA 1EDBA 4FYYA 1Y1SA 3CZMA 3MMPA 3O8OB 1GGKA 4OO3A 3R40A 3KCQA 3U19A 3JR7A 3GK3A 2ATXA 3GDFA 3U7JA 1P0QA 4R81A 2DSTA 3HEBA 2BZGA 4D7AA 3P2IA 4IIHA 1THTA 3OLXA 5D8DA 4YAFA 1S2NA 1W49A 4AN0A 4EP1A 1HNNA 2GO1A 3HRIA 4J07A 1PV4A 2AQIA 3NNNA 1G7CA 3KSMA 2ZSHA 1KQOA 3UAOA 3W8DA 2GSDA 2Z2JA 4RV5A 1ORTA 1Z6QA 4JLJA 5I7VA 2WZDA 3BQMB 3UK2A 3OFJA 4KEAA 2OHFA 3WJ1A 3WMFA 4A73A 1RXVA 1ZNYA 3ZZNA 2ZBPA 3G17A 2IJGX 4KIWA 5LXTF 4V39A 3EPKA 3ZGOA 3BRWA 4IH1A 1IPEA 4E11A 3AKZA 3JD3A 2JVJA 2FW7A 3R2JA 1XC7A 1QTNA 1E0SA 1QYXA 3IS3A 3OU7A 3HYNA 5AVYA 1MV8A 1UDRA 1VE7A 3U3KA 3ICEA 3PCXA 221PA 2ONKA 1RM3A 1YD7A 3OZCA 3QMPA 4JSTA 3TR6A 3ZDEA 1L5VA 4BCBA 1M5RA 2OZPA 5EP3A 2V7BA 4ON9A 4CM4A 4W1PA 2UUOA 5IAEA 2BUAA 1LVGA 4HEA6 1W19A 4A92A 5HM8A 1Z4IA 4JFAA 3TQOA 3A8JA 4HQKA 3AI1A 1PZMA 1E2IA 1JL3A 1NC3A 1Q7TA 1X1TA 1XP5A 2CHFA 4JELA 4REQB 4UJ3A 2D00A 4EB6B 2FPGB 3CLTC 3KEQA 3MUOA 2O1SA 4OA8A 1W0CA 2E48A 3ML1A 2C2GA 3DEHA 4GF5A 1GZDA 5DHFA 4F12A 4MRNA 5DLPA 1L8LA 5IW8A 2G36A 3D6HA 2QP4A 2IDMA 3EA4A 1MAUA 4LOIA 5J47A 4BKQA 1CG6A 4L75A 4R84A 1O2DA 1LDBA 5HBGA 1OZAA 1XFDA 2ID4A 4TL7A 3TZQA 4ZAFA 1PU2A 2R2GA 1H0SA 3IRVA 1NJ1A 4XUGB 1NL3A 3D8NA 2V58A 3ORFA 5E1BA 1P3DA 3F0TA 4J9VA 3HWWA 4PICA 2K6GA 1S3FA 1MOZA 3MFQA 3IMFA 3K9QO 3ZE7A 3EB9A 3GLGB 4JI2B 1H65A 3I9LA 2B8WA 1XF1A 3KB1A 4G1VA 3O4IA 5A7FA 3FDZB 4HSGA 3I6IA 2P6RA 1NG9A 3DKVA 3MPOA 2XUFA 3ZVNA 2VH2A 4R69A 1RYBA 1SFRA 3EARA 1MOSA 3WJAA 4X94A 3BKXA 4M60A 4RA6B 2NO1A 1LPBB 4P22A 1T4DA 1SOUA 4RPJA 3P32A 5F4OA 5L8VA 4J4TA 5DM0A 4AICA 5L7WA 3HP7A 3JTEA 2F43B 2B6HA 2X4GA 1I3NA 1WUJS 4G5OA 4LVUA 5AW4A 2QGNA 5DI3A 2C2XA 1M2JA 5K2MA 2HJRA 5AKGA 2JCVA 4QEKA 1QMGA 3PKZA 3E3NA 1YBAA 4EVRA 4TXHA 1CLEA 1TW2A 1QR6A 3GVLA 1KJYA 2OQIA 4M54A 3M0EA 4XSGA 3WV5A 5B7NA 4KQXA 3U37A 3ZCTA 4MP8A 1HR0B 1U28C 3NVKI 4L28A 4Y6LA 1P1IA 2QAGA 1ISJA 1PNRA 4CKWA 4GZ5A 1UXHA 1I1HA 1NVKA 2ZSFA 1Y6QA 4PX5A 2AYXA 4BNXA 3TSAA 1CIJA 3I4FA 2DZDA 4AN1A 3V1UA 4O2BF 1QS0A 3R6JA 1HUQA 2OVBA 3WZLA 4D0LB 3EULA 4C5CA 2ID8A 2PRYA 5C1DA 3H17A 5DN9A 4FE3A 3R74A 2PMDA 2P77A 3SWWA 3R5TA 5LQMA 2BI7A 1L5WA 5IBPA 3T0GA 3Q1KA 2GLXA 4OQEA 5DHPA 5KYWB 5AM2A 4E5MA 2A6PA 2QY9A 4L2IB 4I6JA 4NYJR 2VPXA 2SBTA 3AOEA 3PTLA 3QM1A 4QOFA 5J4YA 5EE3A 4QD3A 1I13A 1UH5A 3FZNA 4JI8B 3GEEA 3GH1A 3SNKA 3RR2A 3FPSA 6LDHA 4TLMB 2DE0X 4LTNA 4FCCA 1AOXA 3K0CA 3EYWA 4S04A 3HY3A 4X7BA 3K5PA 2RB4A 3G82C 4MHSA 4KK3A 1KU0A 2HQBA 3PIDA 4GQAA 3UKOA 3I32A 4G0UA 1GU0A 5JDCC 3C7AA 1BMFD 3O4VA 1US8A 3AB7A 1T0PA 4TXMA 4DPMA 5JNTA 1ZXXA 1IVNA 1BGWA 1S2IA 2ZRQA 4OMDA 4P31A 2GB4A 2PZKA 4YRPA 4PABA 2FPIB 3UWOA 9MHTA 4BLQA 2P90A 3GFFA 2WSBA 4JU8A 4PZPA 1YAHA 4EG8A 4QHTA 4AI6A 1MW9X 1W30A 1ZCZA 3S81A 1G20B 2ZQZA 4F9FA 4QU0A 2B1JA 2RCYA 4Z1OA 3OZVA 3R4CA 4RX1A 3GO4A 4XA8A 3WIBA 4MUNA 4KQ2A 2DMRA 2F48A 2EARA 5HWSA 1NAIA 2EFEB 3K15A 1V4VA 2FWRA 1PEKE 4Z9AA 1DLIA 4LUCA 2UZ4A 1XPJA 2V7EA 2YW9A 3M1YA 3E1SA 4PQFA 3D8UA 3TW4A 2QBYB 2WF9A 4X7FA 4HNVA 1QHXA 4BRSA 4JP8A 3HJTA 3A1DA 3U4IA 4Z7OB 5D6NA 3ZGNA 1NMEA 1U9CA 2KPOA 3A6LA 4TX1A 1NNUA 4RVUA 1URPA 3KKPA 3Q0IA 2VQ3A 2XCRB 5L46A 3JQ7B 4WSOA 4GL2A 4ESHA 3QWIA 4HLUC 4XQFA 1JIKA 4IJWA 1A9SA 3VR2D 3CO0S 2F6RA 2NXJA 1ZD1A 2WJZB 2W00A 5EXXA 3RS5A 1QVZA 3FPCA 4ZMRA 3H16A 2OSVA 1M8KA 4P0PB 3H2IA 3E84A 1O96B 2VTKA 4TL6A 2PKXA 2GLUA 2KM1A 2XPCA 1E64A 1BKSB 2X14A 3QGMA 1PVDA 1FU4A 1T1IA 2ORVA 3CCMB 2AG8A 2X76A 3PGKA 5LMUB 3NAMA 5DDIP 2JK1A 3PQFA 2AXNA 4LMAA 2PL9A 2VDWB 3OY2A 1HT3A 4CM1A 1RLMA 1YZHA 3K2QA 4MR9B 2HUPA 2HEIA 3VR1A 3ITKA 1SHTX 3V1MA 1FJXA 1IQPA 1Z12A 2VXYA 4Q03A 3CCEB 3MILA 4XEUA 2ZJAA 2I7VA 1BJKA 3V97A 3RYFA 3CURA 1DLJA 1DCTA 3FZYA 3LY8A 4PG4A 5LUAA 2DFPA 2XMCA 3GEIA 3AOGA 1IYZA 3PHJA 3QOFA 4QBTA 3TWOA 1Q1EA 3I8SA 3CZRA 2Z56A 3SQMA 2GWHA 4Z7NB 5DB4A 4CETA 2QD3A 2HA0A 4FNGA 4E21A 1JG3A 4GM1A 2VDLB 5EMKA 5GVRA 3T0IA 4DQUA 2MYTA 1YQTA 4IDFA 3ZWPA 4GX5A 3SQDA 1RVV1 4X97A 2WTAA 3M6FA 4G67A 4E1BA 5LD2B 1TMYA 3L6CA 2VHCA 3D1LA 1D2EA 1VCOA 3CRW1 3MT7A 4MP3A 3WNZA 1K8YB 4Z0HO 3GHHA 5I9TA 4XSVA 3PHHA 4JT9A 1E9VA 4A9AA 4GMKA 2OCDA 3S2YA 2IYTA 4MVJA 4HDNA 3WYEA 4YGXB 3P9PA 4YO8A 2VZ9A 4YMWA 2GCIA 1UBKS 1GPLA 4OQQA 3WK7A 1Y1PA 2V3VA 2WSSD 3H2YA 5TSDA 4O59O 4TWIA 2Y1LA 2EG5A 3OUZA 1DAMA 4WTOA 1PDVA 2Z6QA 2GEUA 2WNHA 4LRQA 2PT5A 2WNIA 3FETA 3BIOA 2AS0A 5MGNA 3IOCA 2CCKA 4RHUA 2P65A 3G7SA 3AESA 4JLBA 1JF8A 4X7DA 3C8MA 5CVDA 1LGYA 1WVGA 4NHOA 2NP6A 1XDGA 5DNWA 3CTMA 1Q1ZA 2G4CA 1JAIA 1U0SY 4RHCA 2WAXA 8ATCA 1B7GO 2X6XA 2HGZA 2P69A 3NH9A 4KSYA 2OD7A 2PRJA 2VCEA 4KMOA 1T6ZA 3GC6A 3RIHA 3ZLVA 2IU3A 4M38A 1A88A 3T34A 4M1EA 3PYLA 3ZWXA 1FIUA 5EZQA 2DPHA 2PSFA 4CM8A 4I50F 4AZTA 4F46A 1A04A 1FXUA 1O94D 4UQOA 5ER9A 4BL5A 5EUQB 2JFQA 3HABA 1U5BA 3ZWVA 3D5EA 1UBNA 2FI1A 5DSZA 4MVJP 3AVTA 3CX7A 1FL9A 1KL7A 3MMSA 3SF8B 3PDHA 4DFDA 2PGJA 3ZX4A 2DVMA 1RI4A 4PRLA 3R3XA 4DA8A 3Q39A 1OHHA 3VNAA 2XUKA 4BVBA 1C1XA 1CFZA 2PIDA 4DEVA 3AJEA 3A05A 2LGJA 1GTSA 1XWIA 2NPOA 1W85A 2CXPA 3HKEA 5TQ2A 3HO6A 2VNJA 2YQ4A 2TMGA 2XMDA 2F7SA 5DWVA 4KPFC 2NX2A 5CBKA 4ALKA 3ZU3A 2PAFA 1D2CA 2LUOA 3PT9A 4MIKA 4X64B 2VNHA 4QUGA 1JGTA 5A4KA 3LBNA 4F85A 5IM4A 4D25A 1EM8A 4KBGA 1TTTA 1N6NA 4DA0A 3NQ41 4RLFA 2YIMA 1QO0D 4MVJE 4H6WA 2GEKA 2YVKA 3A7DA 1RAEA 1P44A 1UJCA 2AEMA 2QNBA 4JAVC 2CDRA 3T99A 2I9KA 3A9SA 5AI6A 4EJSA 4YHBA 1HZJA 2Q0QA 4YUVA 2BV3A 2AJCA 5FWXA 3RT9A 5TQ0B 4XE5A 3AERB 3F46A 3RIGA 1K0FA 3NNSA 3OHPA 1GDTA 5CHYA 2DHRA 3IBTA 2KW5A 1TVMA 1U4NA 3BPSA 1W47A 4UZFA 2YZ2A 2FETA 1VF7A 2I80A 2C9ZA 3FWPA 4P7FA 3WWCA 4RKFA 1DS6A 1ZH4A 3QVJA 4XVCA 1OC2A 3T7AA 3SLNA 3HJBA 4IHKA 5CCXA 2G04A 4QWMA 2OXFA 4R16A 5GJCA 4E5NA 3Q8WA 5HZBA 4F45A 4UOEA 5FLEX 4WLEA 3JARA 2EP7A 2Y4NA 1VSQA 3BH6A 4G23A 3WLLA 3ZXYA 3FVWA 3CN7A 2ZR9A 4Q00A 3R9XA 3KX2A 4C04A 4HPJB 3RU7A 1JEAA 3LUPA 1DAGA 1QYVA 5K3FA 3EFHA 3W0LB 2ZRHA 2W2LD 1ZSYA 3ABRB 5HTKA 2H8KA 3N76A 7ADHA 2FSHA 1NVXQ 4PNHA 3SF0A 1UT8A 1FX0B 4X00A 3B9QA 4EEXA 4EVSA 3ZDDA 4RPBA 2B98A 3G9QA 2CK3A 1SCQA 3G2QA 4DDMA 4DVGA 4UNRA 1RNLA 2XUPA 4Q15A 2B30A 4WBNA 3VR4A 2WT4A 3F7TA 5FPKA 1K88A 2NTJA 1FFAA 3KD3A 2O4CA 2BFMA 1ABFA 3PRYA 5B3AA 4TTRA 2R86A 1RI2A 2DSNA 4DBLC 3ASSA 2HN9A 5LBTA 1R6BX 1K4MA 1XBTA 2QW0X 3M1IA 2WRZA 2DH6A 3V33A 3ZR4B 2WAOA 2VXCA 3N8KA 4EPRA 1KI7A 3PL1A 4AXXA 4B6EA 3GVKA 1CS4C 2FN4A 2VTDA 1R3UA 5IXSA 3F2IA 3T12A 1NNLA 2EL7A 3KSAC 4ND7A 3ENZA 3EVNA 3QA9A 1DEKA 1T1EA 2XQFA 2CV2A 2UZ3A 3FF1A 5LR6A 4AZSA 1V3QE 1O0CA 4TUYA 1IWPB 3DZBA 4QASA 1N57A 4YMGA 3GRVA 4FOOA 2FRDA 1N2GA 2OV3A 4HDKB 2P9JA 1J8DA 1EGAA 1M1YB 3OWXA 2MHCA 1PR6A 4JGIA 2YMQA 4D9HA 5BR7A 3IPCA 1KWGA 2RAVA 2YZKA 2WPDD 1RYFA 3S55A 1MW8X 3Q7EA 1BDHA 3GVCA 5DRTA 2I6SA 3M81A 2XUAA 1N8KA 3KPJA 4MCJA 1P9LA 1V11B 4HGQA 4U7WA 5D2CA 2EZTA 1OFHA 1B0UA 1HBJA 1T9HA 2HK9A 2J32A 2Y0EA 1XHEA 3K9NA 4PTLA 1I94B 3K20A 5J4KA 4J0DA 4KREA 3IJRA 4FFBA 2KBFA 4BNMA 4KR2A 5M3BA 1Y48E 1RBZA 3V8EA 4AG5A 1DP4A 4KQJA 4BZPA 2VZ0A 4OHBA 4O2AF 2RKOA 5K3BA 4QYTA 4EY8A 4HB2A 5AJZA 1Z5UA 4AJIA 1GQYA 2JRLA 4BATA 1E5TA 4BVHA 5D3MA 4BZQA 2Q27A 2WWYA 5JZOA 2WM8A 4QQFA 1T3HA 3PJEA 1WRBA 4ZRMA 5LQDA 4NZZA 3OEED 3O9VA 5LBIA 3DL0A 2QTCA 2WAMA 4ITUA 1D4AA 1DAPA 3OX4A 1H2ZA 1XE3A 4GP6A 2DFVA 4DWOA 2JNWA 4H08A 1KI6A 2GF9A 5FPYA 4QOHA 3VJRA 5TQVA 2GJ9A 3U7GA 5EERA 5H3CA 4LJRA 2A0YA 2ONYA 3WGKA 2Q3MA 3HCEA 1T3TA 4XOIA 3PR1A 1UBSB 3FLAA 3RGGA 3HG7A 4AWAA 1F0KA 4PGAA 5C9ZA 1SB9A 5KU7A 3RIYA 1B43A 2VHZA 3BERA 1OAOA 2GVNA 1T5EA 3BFXA 2Z2YA 4BB5A 1ZQ9A 4R8MA 1WXIA 3HZOA 3EIWA 1WUIS 4JEMA 1E9BA 3PNLA 4Q3CA 4RPGA 3TR5A 3QHQA 4M88A 3HXLA 9GPBA 3W2TA 1VFNA 1IG0A 1C50A 4JEIA 3IVGA 4X6YA 4BV8A 4DV5B 5LP6A 2WYRA 2GPAA 2NT4A 3O74A 2FOLA 3TAXA 4DSAA 3RYHA 3NC0C 4IH4A 1UK6A 1S7GA 3KD2A 1CEYA 4BUCA 1EWYA 2O52A 3K9WA 4JYCA 4UMFA 3RS0A 1W5SA 2QPAA 3WZMA 1UJ5A 4HNHA 2Y3IA 4R9UC 3JATA 1GUAA 2UU9B 4XSHA 1NPTO 2GQFA 3GG9A 3L6UA 4LJKA 5EJGA 4MGYR 4O1HA 4ZANA 4CKCB 4F1KA 2CHEA 5ICSA 3IXMA 2MSDB 2EQ5A 3PJRA 2V98A 4Z9XA 4WXYB 4ZKDA 3REOA 1VG8A 2ZANA 1GPH1 4OYHA 5CX4A 5AKZA 3QXCA 1O6GA 1GNQA 4YNBA 2GEJA 5DLQC 1ZIPA 3V8MA 1CUBA 3KQVA 5GOZA 4E5UA 3Q5DA 4JEUA 1A5SB 1AN9A 4AW9A 1T4CB 5CIWA 2Q49A 1Z2DA 2GN6A 3AUKA 4Q37A 2C1EA 3ZD9A 1R2QA 1PDOA 4Y3UA 1R0ZA 5C4IA 2D06A 3OFSA 1UK8A 4HGPA 3C7CB 1F2TB 1RC1A 2GZMA 3EZ9A 3FN4A 1F51E 3O5AA 1L7EA 3EGWA 1NP7A 3T06B 4YT2A 5CFNA 1GUYA 1PJ4A 2NV0A 2O2YA 3DE3X 3H3XA 4WNYA 3RKUA 1EDOA 3UG7A 3KSDO 3CJTA 3GJXC 1GRNA 2Z8ZA 3MELA 3QWAA 2ZE6A 1T8SA 3T7RA 1RHUA 1RJDA 4JJEA 4E7PA 1FLNA 4Y2JA 1T1GA 4EFKA 5GMOA 3O8BA 5REQA 1OPRA 3LPDA 5BW6B 2OCKA 5K0CA 1HE1C 4IQ8A 2XUZA 5ARBA 3EAQA 2G0AA 1UXJA 2I4OA 1G8GA 2HCTA 2VTEA 3RU9A 1JPJA 2QUZA 3AHDA 3DR5A 3FSRA 4PGFA 3ZDRA 1W6RA 3DVAA 3B3JA 1AQ6A 4JJZA 4N7RA 5LC1A 4Z49A 3C6MA 2D3LA 5IARA 5L3ZA 4QVKA 3AF5A 2ZR8A 3S3TA 3TCKA 2X58A 2XOEA 2Q8NA 4RZ2A 3R7AA 4WK0B 2ZL6A 3VSDA 3U9TA 1DJNA 5G0VA 4C0SA 4NHEA 4DNXA 5M34A 1SU8A 3NHAA 1J2RA 2GAFA 1DJPA 3DDHA 1GGFA 1E2DA 1VE6A 2AFHB 4RGVA 4TQAA 4F11A 4ODIA 2QMEA 4DDUA 2B4AA 2WWWA 1GHTA 4UATA 3E2IA 4B35A 1Q74A 1GXSB 2XGGA 1P81A 1PL0A 3L1VA 5BYJA 1ZS9A 3U2QA 3T1NA 3OOHA 4A0QA 2AHRA 2OC4A 4TSRA 1AQIA 5FO0A 4GDMA 3SIWA 4E22A 5K9ZA 5L6LB 2NU6A 1HO3A 3A36A 3PD0A 1MNQA 2NT3A 1UT6A 2ZK7A 2OHOA 2YC2C 4RFSA 4Y9DA 1Y34E 5CNJA 3A9CA 1JIQA 3IOEA 3F3YA 2EP8A 2PUWA 2IYYA 4NAHA 3PDWA 3SEZA 3VYUB 4GI5A 5H80A 1A9XA 2XRZA 5CA1A 3T5GA 3OCWA 2BHNA 3AETA 2CKDA 3H4MA 4UAVA 2FUG6 2J5XA 2DUUA 2XYVA 3QVLA 1XCPA 1QORA 3RSQA 3S40A 1VQ7B 4EF6A 1PW5A 2BFBA 3F47A 1QGAA 5IJ0B 3BL6A 4HZIA 5E6TA 4B5KA 1XOIA 1ULAA 4HAUA 1I5EA 4O33A 4DLRA 4FXOA 5BWMA 1E3WA 2FGKA 2G1UA 2FPPA 2O2XA 1JALA 1CP2A 3R7FA 4PN3A 2DLCX 1BROA 1XJQA 1Z2CA 1J0AA 3KAPA 4H0CA 3UT6A 621PA 5JH7B 2XCIA 3AR4A 3E9RA 4Q1VA 4IMIB 4DIUA 5JBIA 3H9EO 4OK3A 3RRXA 4G84A 4IQGA 4M83A 1FFXB 4QDXA 1VTKA 2Z3WA 2QTBA 4DE5A 1R5JA 1YGYA 3QKTA 3L6DA 8AT1A 5LWHA 1F0PA 4W5NA 4CIVA 5BNZA 1TEZA 5FBVB 2O8BB 4NCAA 2CXOA 4TWRA 1NDUA 5JDIC 5KIAA 3R9WA 2A4MA 1U2DA 1WAMA 5CXQA 1ZUWA 3CS3A 1FF9A 4DIBA 4ZCSA 1BHO1 1BXGA 4TYNA 5KNCH 4HUQA 1EA5A 3MHTA 3FHLA 3GWGA 1E4VA 1YRWA 1P2SA 3OZFA 4BU0A 2C04A 1MO3A 3G8BA 1EB9A 5CLJA 2XQIA 5FNVA 1N3LA 2WDPA 2PRKA 3T95A 1GL6A 4MHTA 3NEYA 3EG9B 3E1KA 3NHKA 4U00A 5ADWA 1RCTE 2UAGA 3UKDA 3U5TA 4RHXA 4ER3A 3TI7A 5E9WA 3SKYA 4KWIA 1EUCB 2WVHA 4MXDA 1YZUA 4P4SB 4WGGA 3E5RA 3E3AA 4QJ4A 5HIIA 3USZA 1ABEA 4HX5A 3HUTA 3CEAA 2KLBA 1WPCA 2Z57A 2ZU6A 3M3PA 1TZCA 5BWOA 1HLPA 5EQTA 5EHZA 2JI9A 1K73D 3MA0A 3S27A 2XWBF 4AS2A 3W1EA 4UE3S 4E46A 2NQ8A 1V39A 4WQMA 1WB5A 5KMGA 3IEUA 3EQ7A 1KEPA 2BFDB 3ORRA 1E2PA 3FCYA 2G6TA 5H3HA 1HQKA 4P1VA 4G8BA 3KT6A 4RFLA 1ZH0A 2IHZA 1ODCA 1P2UA 3EXHC 4XD2A 2VQDA 4CCYB 3LC0A 2ZYVX 4ZDKA 2P3OA 3F71A 2BEJA 2EV9A 2FEAA 2A0XA 3KZNA 2VDOB 1OB0A 3OP4A 2P6OA 4I99A 4PSKA 4YX9A 1Y6JA 1S2GA 2YFKA 4B4VA 4DZRA 5IT5A 3TJRA 4YRAA 4NE7A 1LSUA 1XK6A 3L0PA 3DHEA 1VQ8B 1JJBA 1T0UA 4M49A 3JQFC 1DO2A 5F7XA 2ONZA 3KWFA 1HNWB 4HQ0A 1DEAA 3F7OA 4N12A 1JQAA 2VHJA 1B8PA 1AKQA 2HRZA 2Y93A 1RJ9A 3UK0A 5KQSA 1SZCA 3GLFB 3WGVA 4M2LA 3GLRA 4QXPA 4FKBA 3DTVD 5H9VA 5C46F 1QP0A 4CGZA 1QAMA 1PRYA 4Y9SA 3RVKA 2X2OA 3OZDA 2JJ2A 5GTDA 4TTSA 2R1UA 4M1MA 1OGJA 1UK7A 2GKOA 3EGEA 2RDMA 1Z4NA 3SSNA 5ENDA 4P9SA 1N6PA 3KR1A 1YJBA 3P9NA 5F35A 4OI0A 1E0JA 4RACA 5E6UB 1QKIA 5FTKA 4ZDWA 2PWAA 1C4KA 2WIAA 4CDNA 1KVQA 2VP5A 3KT8A 4M1WA 5MN5A 1H3EA 1ICIA 3OTHA 4INAA 3P0IA 1ZD8A 4ZIRB 4LXIA 1VZ3A 4XEHA 1BEZA 2BFCA 4EO7A 1IN6A 4YRSA 2FFRA 2C03A 3EF3A 4FC6A 4HQLA 2PBLA 3DVQX 4KV7A 2AYYA 3ZUPA 4RSRA 4YJKA 1T2VA 3TDKA 2DC1A 4GQNA 2HY7A 3GRAA 2G9QA 2JGKA 4JGBA 4K40A 5LA6A 2X9GA 1OI2A 4HDCA 2OOKA 3MVEA 3JD2A 5ELLA 2BEWA 3KWLA 5CDSA 2V1XA 4KMSA 3AK4A 4ITRC 1HYEA 3CT4A 3KOYA 5I3ZA 1J90A 3TDNA 1U2GA 5KNBA 2PD3A 2NO9A 4HKTA 4LOHA 4D43A 5CCDA 2LWIA 2VDPB 3QIVA 3USES 4CV1A 1KPIA 1H9AA 2GD2A 3AVPA 3D7KA 3CR7A 4NNPA 3E8SA 1L5LA 3IUMA 5LN1A 3MJEA 2W71A 4B7AA 3WB9A 4KPUA 1D4FA 3P52A 2Q2QA 4YJFB 1FOEB 1G41A 1K7FB 2PR7A 4OHCA 3HGQA 5FPSA 1CERA 1PFKA 5GZ6A 2H17A 1GEGA 1NQXA 1WDMA 1IQ0A 4HX9A 4OU5A 5L7YA 2Y1XA 1ENPA 4JODA 3RWOA 2CHGA 3WLAA 2XVXA 3G13A 2HLDA 5ELMA 1HMYA 2QX8A 1AU9A 2FQXA 4IR7A 8MHTA 2WPNA 4PG5A 1LVHA 2WTBA 4RTMA 1VYHA 2WFMA 1XDDA 2ZUCA 3OPYB 1H2WA 2R1VB 3JAWB 3A25A 2XVMA 1NLZA 4DMGA 1L4FA 3CLRC 3OTIA 4EOGA 2HGSA 4MI6A 2CWDA 2Q0SA 3VOSA 5A0VA 4N48A 1EFVA 1N3YA 3GT0A 3I01M 3N2EA 5BPFA 3ICCA 3H65A 4OP7A 4QUEA 4W7IA 3KTAB 5DOVA 4XQ9A 4JL5A 4F6RA 2XHEA 1BGXT 3R7WB 3BA1A 2V7XA 3ASTA 3PX3A 1KVUA 4Q9AA 3ZX5A 4IHQA 1JP7A 2B35A 5ALKA 5IUJC 2GN0A 4WV3A 5KDDA 5HZGA 1KORA 2HYDA 2REBA 1L7PA 3IA7A 3QHPA 2CNLA 4BDTA 1WY5A 1RWWA 5TJ9A 3SHVA 3BMNB 4JWTA 4DDHA 4E07A 1E3ZA 2H4YA 3OW7A 3HLTA 3QF4B 3X1XA 3QU7A 1E5XA 1NVFA 1PZHA 1QFJA 1W5FA 1XZIA 2QYTA 2RGCA 3CH6A 3PK0A 5KAMA 4BGVA 1VE5A 4S1VA 5CYPA 4YJ3B 1VJDA 3TBKA 4DHWA 1MN6A 4ZYTA 3N7TA 4N03A 4XX1A 1BO6A 3QXGA 1WV1A 1Z6TA 3IP7A 2GD1O 4OI2A 3WRXC 1RQLA 2Q5JA 4PG7A 4CFYA 1QGZA 4EVQA 5CR9A 4AS1A 4D9FA 2ZYSA 1IEVA 1OR8A 1SKQA 4HYTA 3U3XA 3W3AA 3Q72A 4GBGA 4Z0PA 3S28A 1AUXA 1NVBA 4GE0A 1VLJA 4KQMA 1C2YA 1J0DA 4JP1A 4TKMA 1WU7A 2H11A 4E03A 4DR7B 5B1SA 5D00A 2YJ6A 2A33A 3PWTA 2PGLA 3ESCA 1Z9BA 3IKMB 1KSJA 3HCNA 3U6KA 4YH1A 1BN7A 1EI9A 2PGDA 3L4BC 3C7DB 4LV6A 2QN7A 2R25B 2HKIA 2IHUA 1K75A 1LBQA 4WHMA 5J4HA 1ABBA 2YRXA 5BN4B 1JBEA 3DCJA 3MCVA 2NSHA 4JLNA 3WBFA 1JT2A 1PUXA 4WKGA 4I1PA 2HJVA 2V74B 4R2LA 4IFIA 5CDTA 2W90A 2Y6UA 2H2GA 4K6HA 2DUJA 4ZCMA 1U99A 5E8RA 4CF6A 2PNJA 2GQ0A 1QQ6A 3UMRA 5C5EA 2NXEA 3G2NA 2HK6A 5CM9C 2DWCA 3I58A 2E1BA 2AUNA 3PEVA 3UV3A 1E3XA 4DEXA 3U4QA 1XZMA 1D8AA 1EGMB 1Y4ZA 5BWBA 2XBLA 4OLFA 2C5SA 1H5UA 1UBGA 1N5IA 2HF9A 3ZDZB 1KMHB 4GPZA 5B4UA 1PJAA 1U6JA 3NU1A 1B8NA 4TZTA 5CGZA 3IP8A 1AHIA 3DYIA 3T38A 3HDQA 1JU4A 4G0VA 1P1KA 1E1RA 1XNJA 1ZN7A 2BEUB 2H18A 3FYSA 5CRIA 3TR0A 3ZHCA 2DULA 5LOVA 1L5ZA 2HSGA 1SVLA 2M9MA 2X5OA 1WCIA 1QYWA 4U7HA 1VRWA 2ZI7A 4U3JB 3DTNA 4Y2UA 1AV7A 4FI3C 1QK5A 3M4ZA 5LJLA 1ZPDA 5B57C 1BCRB 2YWXA 4HFMA 3LVFO 1ETUA 5JISA 1W0JD 4JROA 4KHPB 5LA6F 4GKKB 5BW8A 2ZRBA 1VPEA 2OMEA 3UJCA 3UBMA 3A6EA 3EISA 3CGWA 4LV8B 1ZN8A 4KTVE 1DC4A 1BDMA 1XZAA 3R3WA 4HEQA 1W9MA 4F92B 3DVRX 2J9GA 1Z0ZA 5B5SA 1ONSA 2ZBVA 3MG9A 1DCFA 4NOMA 2RONA 4OOEA 2I2FA 4GYKA 4QU5A 2IV2X 1M6HA 1QPBA 5H59A 4OHUA 1ZOOA 2CC2A 1OWOA 3TQTA 2XEDA 3MGGA 2OMKA 3U3ZA 2D59A 3WAKA 2VVTA 1Z22A 2HFJA 5KSWB 4PM4A 1J2UA 1U4OA 1CUEA 4Q7QA 3OKXA 4JVSB 5FL7D 4GP9A 2G1PA 1E8MA 4S12A 4GLBA 4N7BA 4RMHA 1U7UA 5K8LA 3QX3A 4GKAA 1Y3FE 1WL8A 5T6MA 2X85A 3ROFA 2R6GA 3UATA 3PEUA 3CW8X 4WECA 1C8KA 4KOEC 1CDZA 3DHNA 4P82A 1ZITA 1SWWA 4ZEXA 1U3WA 3GI1A 2XODA 4QPDA 5K7SA 1AA6A 3WA6A 4Y0NA 4MUIA 5DHTA 4TPKA 2D8AA 2GASA 1OLUB 2X8JA 3I4CA 3V4LA 2DR0A 1IMJA 1BS2A 4ZOQI 3COSA 5U9CA 3MTEA 1KAOA 2LVBA 3DBLA 4N18A 5IC5A 2WI8A 2WZNA 4H1UA 4WUVA 2WFLA 2HX1A 5JV5A 2PKQO 3OZAA 1YS2X 5KYYA 1WXFA 2OLEA 3OA0A 3QEOA 2YVLA 1BA3A 3UA3A 1ZGZA 2AEJA 4G6ZA 3K6SB 1CQWA 4TLDA 4D3ZA 5FH9A 4TWZA 3D7SA 4ZVKA 3CPSA 2ZWOA 5G02A 3L18A 2H57A 3G6KA 2DM6A 1VSVA 1YO6A 3M49A 3WWOA 2XITA 3SCZA 3VHQA 1E2QA 3KB6A 3CKLA 1LDEA 3OU6A 3OZTA 3TSZA 4E4YA 3FPJA 2NUTA 4M0EA 4R0VA 2X53S 4ZPXA 2W2PA 4G1UC 3IBCA 4IZHA 4NYIQ 4X61A 2NZ8A 3FCUB 4NU5A 4AJ4A 2PUJA 4LPSA 4DMUB 3OZSA 5COBA 4CL3A 4DC1A 4QE3A 5AKLA 1CQZA 1U9IA 1IG3A 2G0TA 2YIJA 4WWHA 3NKVA 3F2VA 2PS9A 1JMVA 3P0RA 2V0GA 3HSYA 1U2SA 1X42A 2IS2A 4RM0A 1Z5VA 1DWUA 5ILGA 4XRRA 2WWVD 2YY7A 3I9KA 1P7CA 2VSNA 2BPOA 4C0KA 4ZV9A 3DXZA 5BVGA 3KL9A 2JGDB 2W8ZA 2PS3A 3MOGA 1NN0A 3G0CA 2YZGA 4HH3C 3PE3A 3H7AA 4EG7A 1IHPA 3OE1A 4LXGA 2CDNA 2JI6A 3SIRA 2R6AA 2ZI4A 2ZIUB 5PNTA 1OX4A 1IOVA 3DAPA 5GGYA 4IRUB 3WX0A 4IF6A 1YOVB 1E2EA 1ML4A 1L1RA 1L5QA 2CLEB 3EXFA 2FSGA 4JXKA 4MWGA 1GAJA 2QIPA 4OAPA 1LWOA 2P79A 3V1LA 4C4ZA 5IZCA 4BNDB 1V9SA 2XYQA 5GY7A 3ZQKA 1M0TA 4C4PA 3PDJA 4MB2A 2X2FA 4O4HA 3TVYA 3I1FA 3TX2A 4YELA 2BE9A 3BMXA 3C87A 4RDHA 1P60A 5A9TA 4NL4H 2DGDA 2EHJA 4HBZA 4GLJA 4JUIA 4P08A 4XGIA 3OZRA 3AH8A 4Q4AA 3X1MA 3QQ5A 3OZUA 4OHMA 1I32A 1NBHA 1BE8A 4C87A 5CX1A 4H1VA 1W48A 4RTKA 2YN0A 5ITZB 5E4FA 1O54A 3C3XA 2XE6A 4C7KA 4JUCA 3D3WA 4TKUB 2IP4A 4KMMA 4EF5A 2C2ZA 4YREA 5ES4B 1QRTA 4Y2PA 4O08A 2NXWA 4TRMA 3V5NA 4EHDA 3L84A 3GGJA 5FUMA 5I4KA 2VYQA 2WG1A 2VSYA 2X4DA 4WXMA 3WGMA 2QTFA 2BAGA 1G6Q1 3IVAA 3RVRA 2BEVB 3WKDA 1GZ5A 4QU8A 2REQA 3KKEA 4ZZ2A 2QXTA 2DQYA 1ODJA 1PL8A 2OECA 2QM8A 3LUDA 3VPBA 3SR4A 2H4JA 1X87A 4QPCA 1AE1A 3DB2A 3AEUA 5TJHA 3WLJA 2B9EA 2ZROA 3DB1A 2G1AA 4IEIA 5AYVA 1ZRHA 3EAFA 3STUA 5CPFA 2OO3A 3EZ6A 3UYLA 3AHJA 4LJ5A 4IHJF 1ZLXA 3TUIC 1UWKA 2PQ6A 5AN9A 1BGVA 1ZQ1A 1RIFA 4CV3A 4B4WA 1FPQA 4PRYA 3RRMA 3TTXA 4B80A 4JI1B 1RACA 1S01A 3NC1C 3T53B 3EVCA 2I3GA 5CT9A 4JR2A 3OFKA 3WWPA 4UDNA 3PT5A 3IPYA 3WE7A 3ZW8A 1KPGA 1IEWA 1DIGA 4WCFA 1XPRA 3N2GA 4B2PA 1FVFA 3HP4A 1D8TA 3NVAA 4QG7A 5IP5A 3TTUA 3OM8A 2Q0HA 3GEPA 5JT1A 2OCLA 5FYDA 1IL0A 4Z3DA 2C5GA 2J4DA 1C0PA 4J0GA 1OILA 2ROQA 5DGCA 4XVHA 4ZCIA 2W93A 5CJPA 3VVLA 4BX0A 1VSBA 1ECLA 1YVRA 2FKAA 3ANXA 2O5EA 5FFFA 4D3XA 2HRBA 4LJSA 5FR1A 1ORIA 2O07A 3LC2O 1FU7A 3U13A 2RC5A 1IB6A 4JBIA 1F8GA 4JLUA 5K51A 4ND2A 1B0PA 2PS0A 2ZBRA 5JADA 3PC4A 3ZU5A 1VPLA 2PKEA 4RTRA 3UCXA 4MJ7A 4IXTA 1PSDA 3S1LA 5FWAA 1RYMA 5BSHA 1Y98A 3AZQA 1ECJA 3EC1A 4OH1A 4PNEA 3GCGA 1E2JA 4MW1A 1K66A 3DZJA 4F3YA 2XT0A 3OC6A 2BW0A 2VLIA 2IEGA 1DUSA 3KL2A 3NYWA 2G72A 1EUYA 2ZIXB 1FTWA 3IEVA 1NHWA 4B09A 2JIMA 5IUKC 4XB1A 1BCSB 2RI6A 1YL7A 2POCA 5IABA 1SPXA 5HQ3B 3UOGA 3EIOA 2PGIA 2HMYB 2QAJA 4CEJA 4PC3A 5EMNA 1L5RA 2COKA 2HRDA 5JVDB 2WMNB 4X20A 3OQMA 4N8DA 3ONNA 5CUQA 3OICA 3KJFA 3OOJA 1DPFA 1IN8A 4XVUA 1M34B 2QRVB 2HSJA 2HXSA 2RHDA 1NXXA 4P92A 5BUSA 2E85A 1VGVA 1BMFA 1SH7A 3R0XA 4M99A 4DR2B 3WAJA 1RKUA 3RSSA 2I8LA 2QTNA 1Z83A 4NF2A 2QP9X 3VZRA 1IZ9A 4LOJA 4G0QA 3ZIUA 4HT3B 1L6IA 3IB6A 2ZYAA 2PK3A 5L7TA 2QAGC 1NDHA 2OZEA 1WB6A 1EK2A 1X70A 4OXYA 3WLRA 1G1MA 2GK3A 2C07A 3HL0A 4WJZA 5BN3B 2QV7A 4ECAA 1UZLA 5HW0A 1AUQA 5H68A 3CF2A 2ZXHA 5EJ2A 3TN7A 2R1TA 3BG5A 3AVUA 1P4RA 3DM5A 1KEZA 2ORIA 2C4KA 3ANSA 3Q2OA 4GZ3A 4M0PA 5IDVA 5U4XA 3ILVA 4F2GA 4PSCA 4US0R 1X7YA 3EVTA 1HYHA 1DELA 1H8ED 3I52A 1XXHB 3WISA 4HUTA 5FDFA 2PO7A 4I3FA 4KPEC 1L5NA 1ZNZA 1QCYA 1W35A 5KINB 1FP1D 3NHWA 1DTWA 3R9KA 1I36A 2EZ9A 2C96A 3DO6A 2P2GA 3AOEC 3NUGA 1I3KA 1Z5PA 3L77A 2JI7A 1H0KA 2NACA 2ATVA 4GRAA 4B81A 4HXYA 2PZMA 1JFLA 3OU2A 3EYAA 1Q0LA 1WZUA 3NOQA 4JLMA 3R8FA 1K68A 3JQ8A 4DIKA 2D2IA 1Y7LA 3VR2A 2X7JA 3GPIA 1SUFA 2O19A 3K0CC 1Y42X 1FA9A 2EF0A 3RUAA 3HLKA 1G2OA 4JKIA 2M6LA 1YUNA 4K1LA 4LHEA 2P2DA 2QI9C 4D5EA 2ZULA 2PZFA 1X1BA 2ZAYA 2CXQA 1MAVA 4D46A 4V0NA 1R4MA 1DKOA 3M5WA 4RPDA 3HU3A 1UBJS 3BCSA 3DGFC 1I7LA 1T29A 5I9NA 4L9WA 1KQGA 1AMNA 3KHUA 2MWMA 3Q3VA 2ACEA 3SE7A 3JALA 4DB2A 3SLGA 4DLVA 4DNTB 1ZFNA 2Q5LA 3GXBA 2CL0X 4N0DA 4B33A 5E9JA 3LPCA 4CKXA 3VPHA 2EZ4A 5CVJA 4UMVA 3NUQA 2ZQYA 2B34A 4B4UA 1ZWLA 2X1LA 1FVXA 5I3CA 1U04A 2HIHA 1XZKA 4P4LA 3QEMB 4N8EA 5ALUA 3NHBA 4UBOA 2VT3A 1QSGA 3MQ2A 4GW3A 1WBDA 2AMFA 4FWBA 3KJNA 5KOJB 4MZDA 3THXA 1Z68A 5KYKA 1U1FA 5EY5B 1CUHA 1DHRA 1JVSA 1XDWA 3M34A 4KNYA 4OOSA 2DTXA 2IGTA 3EHDA 4LQLA 5FUBA 1GZHB 1GVHA 3HZZA 4IVQA 3ZY5A 3HXQA 2XQGA 2HH9A 3PC6A 1S1CA 1V1RA 5IYPA 2O2SA 5KTPA 3ELUA 4GSLA 2HADA 3WHLA 1OXSC 1JBKA 5A6VA 4B87A 1X0XA 4CTKA 1DQPA 3ISVA 5B37A 3TOZA 1IHUA 4BQFA 2IUTA 3DMGA 2GD6A 3VJKA 3U61B 2WSSA 1CY1A 2BD0A 3IBGA 4O4LF 3DTYA 3HFRA 3ZWOA 4HNQA 2BRUA 2EW2A 3SYNA 3TEFA 5A3RA 3DL7A 2J9ZB 5TMEA 2BR4A 3FTEA 3QV1A 3L4SO 1OX5A 5AHRA 1XTRA 2XMQA 4I1YA 2E9SA 2YV5A 1D03A 2E1PA 3OX1A 4RZQA 1LFAA 5JE8A 5DO9A 2ZREA 3PCRB 4ARCA 2PT7A 3L1HA 3F8WA 4OGKA 4TV8A 5YASA 1M1ZA 2PD4A 2HOQA 4K0RA 2EX1A 5KQRA 5L3SA 3A4LA 1LNZA 2QRJA 2WJ3A 1K8XB 1KYQA 1NATA 4FSXA 5L51A 4RIGA 1TK9A 1LLUA 1BX1A 1HGXA 2DOKA 2GDZA 1O94A 2B94A 4B82A 5CYOA 4LBZA 4KYIB 4FCTA 4OG2A 4B3CA 2O7QA 3OE5A 1W88A 3AFNA 3V00A 1X3LA 2ILTA 4WFQA 5KKAA 2AE2A 5HZKA 2QSJA 2BR5A 1JSLA 1PZEA 2PZLA 4A10A 3I2FA 4MHOA 4LBVA 2Z1NA 4ZOLA 4ZAGA 2JVKA 2IYAA 2I67A 3BL5A 3C70A 4FHFA 4LDAA 2EF1A 4BWVA 1JR6A 3BXFA 2HD4A 4JUAA 1E1CA 4J43A 3GRPA 4CF3A 1RPZA 2ZJ3A 2JBHA 4XIYA 2E18A 3L93A 4B6OA 1SKMA 2AFRA 5JRJA 1ZR2A 2HQOA 4UEKA 5TNXA 5E7IA 4C20A 4RA9A 2X5KO 2XXBA 3IAS1 2V97A 5B36A 3WBKA 2WU0A 1PQ4A 1VCHA 4ZARA 5F21A 4CKBB 2QVCA 3BY1A 4KZPA 1A4RA 2VPWA 1ZVQA 2D3NA 4CTNA 3KZKA 1MC1A 2QM3A 3H42B 1XGKA 2G09A 4FB5A 4XCQA 3S68A 3A8KA 4ZCLA 4MI3A 5JZMA 3W5DA 1OBFO 2QTWB 4X7PA 3EFOB 2VHXA 1SIUA 4D8TA 4MB6A 1G5TA 1GA4A 4FNAA 4QUJA 1SOAA 4EG4A 1O6FA 4XM2A 2VRWA 2Y67A 3I76A 5EI5A 5DSTA 4HE5A 5EVJA 5E3JA 2XYRA 5HZAA 5J58A 2N75A 2IYXA 1GCIA 1N2ZA 5FOUA 4DT1A 5I7RA 4AULA 1ZINA 4M53A 4U6NA 1SBYA 2GYUA 4H6VA 4TROA 4HNTA 2Z5GA 3BDVA 4HZUA 4ZZIA 3HO1A 5JSZA 1AT1A 5LP1A 1XELA 1YK0A 1CY6A 3K5IA 4QTZA 2QF7A 4XX0B 3LT2A 2GHQA 3N74A 5KB3A 2I71A 3M6XA 1SC4A 2IE8A 2ORYA 2W2LA 2JLAA 3KSZO 3QKRA 5ENZA 2IUSA 4EHKA 4HEJA 1YJ8A 3QLVA 1UXIA 2BGJA 1YTLA 4YJGA 4FJ1A 4MH0R 1X74A 4MVJI 5MFPA 3L6BA 1XQWA 3E58A 3BHJA 4R6WA 1R6AA 3C39A 4G4JA 3T9FA 1P39A 3GEDA 4ITVA 4OK6A 5DGXA 1HQCA 2IDZA 3CWQA 3LYHA 5E3HA 1PJ7A 3M7IA 1G59A 3BTVA 3CMCO 1N6OA 4PBRA 4RZHA 2VT7A 4TV9F 3WGQA 1HE8B 4MS4A 2C5AA 2D0IA 5IBRA 3RBAA 4G25A 4UUBA 2QZ9A 2FX3A 1TVCA 2CLLB 2XLCA 4X6UA 3EVDA 1DBPA 1GD1O 4RF3A 4RIEA 1RWQA 5AVKA 2HA3A 4ZI7A 5EGNA 1LPAB 4BQIA 5BSUA 1AGPA 1X80B 4RSHA 3W8RA 3FVRA 3C3WA 5B3JA 4ZK6A 2GD0A 2EOAA 1QVFB 3VKHA 4ZVSA 3IEKA 1EU1A 4MGIR 1NXQA 4ENVA 1VJGA 4I55B 5C8YF 3GOQA 5GQSA 1A71A 3TD9A 3GMTA 3MWEA 2DEUA 2BHRA 3VU8A 4M22A 5EEGA 3WC4A 4MYDA 4YAEA 2JHAA 2PGOA 2IQIA 3KVOA 1EFPB 4KDRA 4R0NA 3SM3A 3N75A 4IDPA 3FLEA 4DRXA 4ERNA 2IBSA 3G9ZA 1R88A 2WPDA 3IPXA 1RIIA 1W1UA 4KKVA 5FUXA 1JKJA 3DBOB 4BO1A 4HMQA 5FEMA 4XB2A 5LJIA 3W4KA 7REQA 1Z36A 3M2PA 4KXVA 2O06A 3JCZA 4QQNA 2CLDX 5IULC 3GW8A 4AKTA 1CT9A 5A3QA 2PYIA 5ED4A 1YKGA 1N5LA 2HMVA 2P30A 3AP3A 1JPNA 3PC3A 1P45A 4RJIA 1BH6A 4D42A 2RGYA 3G8AA 1BQ3A 3KQMA 1VI6A 4G5QA 3WIDA 3VO8A 4I6EA 4IKPA 2Z04A 2RAUA 5CLIA 1ZJ5A 4RQAA 1P2DA 3K0AA 4OAOA 1G9SA 2H1VA 3EWIA 4FT4A 4AG3A 3S2UA 4PY2A 3R0ZA 4BLPA 3FY4A 3KQSA 1IJFA 1YR1A 3I1YA 1H2AS 1ADJA 3EOBI 2PUBA 1XLTA 1UQTA 3JXEA 4GUAA 4W63A 3Q8LA 1P1JA 4A36A 3QBEA 4AT1A 3PUNA 1NF2A 4P26A 3OEEA 1PJTA 2ZTGA 2GRJA 2UZ1A 4K2HA 1W5AA 1CVIA 3OQIB 3SJAA 3UFBA 1SZPA 3WNQA 1QHEA 5ALSA 1PBNA 2GN8A 3IT3A 1O3YA 5BOSA 1RKXA 1XEFA 3DUFA 1JJAA 4F97A 4P7JA 2EWMA 5AO9A 4GHWA 2FJUA 4DN6A 3JZAA 4DR3B 4J2TA 2OYNA 3EMKA 3MWDA 4PR0A 1S2MA 3FH0A 2FRDC 5D5HA 5A4DA 1CXZA 4JR0A 1CEXA 2OHVA 4GWGA 4MKGA 4MQLA 1XTZA 3T7CA 4IOKA 5AOCA 3KKLA 5B4VA 3VO1A 4CIXA 3AKYA 4YLEA 3I34X 1BE6A 3DXYA 4LPKA 1C29B 4P98A 3SN6A 2OWEA 1FYEA 2BGGA 2YZNA 5B2ZA 2V6GA 3KEWA 2XRYA 3JWPA 1KDOA 3A3KA 5DHAA 1XTJA 1JLRA 3JRXA 4ZVOA 2XTMA 2P2NA 3L79A 4IEEA 7MDHA 8OHMA 5HIKA 2XTNA 2IYSA 5C0OE 3UMYA 3GBVA 2C3YA 4KAXA 2XCLA 2RHMA 3Q3IA 1GCGA 1NXPA 1K6IA 4HN4B 4I4TB 3D4OA 4TV9B 3GFSA 2C9DA 3DEAA 5HKLA 1BMQA 4EUSA 5HCNA 5JJ5A 1KAGA 2GFHA 2VNIA 4NEQA 1F1BA 5DTQA 3HB7A 1JHOA 2NO4A 3KV1A 4B48A 1CY4A 1OE0A 1BYUA 5DGHA 4YMHA 4RXUA 5D1HA 2IPNA 3UB3A 4RADA 1KXZA 3C3KA 2N47A 3FAZA 2X0EA 2ZUSA 2WG0A 4MOWA 5EIWA 3SOPA 3V4SA 4JL8A 4XDZA 3RT7A 3HCAA 2JFWA 3CXUA 2XGOA 4GPD1 2ODBA 4RH0A 2CCJA 4OQPA 2VUUA 2BHSA 4D02A 3CVXA 5B58C 3GH3A 4OUDA 4GMHA 1YDFA 3G7NA 3LC1O 2DT5A 3M4NA 4WNAB 3RSZA 4AMUA 3NUZA 2PX4A 1SCUA 1D2AA 3F6EX 1T2UA 3LBHA 3QYFA 1GKIA 1R8XA 4ICIA 2F59A 3JWGA 4L07A 5GIPE 1P1RA 4JBYA 1MTOA 1BD3A 3ZVMA 4R6XA 1JDBB 4R3WA 1DBWA 4CIYA 1M6NA 4QOIA 5LP6C 4YS6A 3TB6A 4GQBA 2VWGA 3O73A 4MQEB 4WT7A 3HB1A 1CZLA 2XTZA 3T9BA 2WF8A 4PSUA 1HL7A 1IC6A 1F5NA 4KRYA 1SBIA 2G9VA 1LLQA 1ISSA 2M1XA 4R9SA 2CMDA 4HZGA 2HCBA 3NBYC 3ER6A 1W4BA 2QYOA 3CG4A 4CEIA 2CEKA 3KZXA 2GSWA 4C14A 1OAKA 1MFPA 2JLQA 3QPAA 4QA9A 4LI3X 4BFXA 5BSXA 4DMRA 3HNOA 5SZJA 3QSYA 4UEOA 1CNEA 2GCEA 3EEFA 3K1JA 4P1ZA 4EX7A 5K0BA 2BH2A 3F96A 4P5PA 5G4KB 1NRIA 3EX7C 1P9WA 1AKMA 3KAKA 3STWA 3IILA 2FZVA 3JQGB 5IM5A 5E7MA 4DCOA 1CZUA 5DCUA 4HE6A 4R1QA 4Z4FA 4XD7D 1DCKA 2WYOA 4HYEA 1OH5A 4K9SA 4FHDA 2IOHA 4BVFA 1YL6A 1G38A 1GLNA 5HX7A 1YE5A 4W8HA 2WTXA 1QGDA 4URHA 1EEHA 5KJEA 4KCGA 2C2MA 5HE8A 2FUKA 5G40A 3K0HA 4ERXA 3DULA 4CF7A 4MWOA 3V2HA 5IDWA 3A3BA 3H8WA 1BHJA 2J0EA 1A8IA 3ZCSA 1EFDN 5C1OA 2VJBA 1QIMA 1XNQB 2RGNA 2B25A 1JB1A 4UNQA 1A0OA 1G5QA 4GP7A 4RTPA 1N5OX 1WKVA 4PGOA 3IIKA 3U3JA 3WLPA 1JVNA 3AR5A 1A9TA 3G3EA 1H94A 3PYMA 5DYIA 1N6KA 1QE5A 1F38A 1WP4A 3KK0A 1PYDA 5CB4A 4C08A 4M1OA 1U31A 1GL3A 3BMCB 4UPEA 5EWLB 3WGNA 1RTTA 2JF0A 2YJZA 2Y27A 4N3GA 2H0RA 5CIYA 1F20A 1T0HB 1N33B 5AICA 5KSPA 3ZYZA 5I9IA 3EZ2A 3DLHA 3NOXA 2AG1A 5A04A 1GTRA 2HL6A 4MB0A 4UUAA 4BO3A 1YVEI 1CUWA 2ZJ1A 1EUDB 1Q7BA 3N8NA 4TVBA 5EYPA 5H70A 1UAAA 1IBKB 1XZPA 2B78A 1NT2A 4X85A 1CEQA 2I3BA 4IXMA 2O1WA 3VNRA 4X3OA 1FMFA 1TPZA 5JSYA 4D9IA 4EGQA 4D9JA 1N0HA 2QMHA 4IZOA 4KNWA 1TMKA 3B3FA 4DUZB 2OILA 4I8DA 3KQHA 1T9GR 3CEPB 2QXUA 3ROTA 2UYHA 4E1AA 1IZZA 4EQ6A 1BQEA 2DIEA 2WM9B 4HYQA 3LWZA 4GECA 3NTLA 3HSSA 1Y89A 4RGBA 4PC7A 2XUHA 5DZSA 1U90A 4RLSA 3EFBA 2TS1A 3GP5A 1QWSA 1XVTA 3OA2A 1RXEA 4U9HS 4IX1A 4XJSA 4TN1A 4OXQA 4PG6A 3N8DA 4CFZA 2QU7A 1X2EA 3N87A 2CFTA 4HDMB 1SRQA 2Z09A 2X1VA 3DOJA 1KERA 2P5YA 4NV3A 1OZFA 1KVSA 1K9VF 4HXEB 5D51S 4UXJA 5CVEA 2XYHA 1N8RD 1N0IA 3NDJA 4GX0A 3PU6A 4N3CA 4P4TA 1DX9A 1DEXA 3EZXA 4KQKA 1DQNA 1VLHA 2HMWA 5EWJA 1SHLA 3FBTA 4F7DA 5TLSA 1BX3A 1NOIA 1KIFA 4WKBA 3ENQA 2DTEA 1E3QA 2DFTA 2A67A 4KSBA 1TLFA 3O92A 1G3IA 4H1WA 3RDPA 3L1UA 5T7BA 4TMKA 3CLUC 3R41A 1HE5A 5DJ5A 4OREX 1B8UA 3BREA 1G5HA 2SCUA 3OTOB 3G6EB 2FRVA 2HCFA 3SKXA 1MBZA 4QXQA 1JA1A 2PKWA 1GCUA 3RS9A 2WA2A 1L8OA 3A6DA 2KBEA 3TOXA 4B4OA 3AG6A 3BB1A 1GYPA 1N6LA 6REQA 2ZJ5A 3LM8A 3GGSA 3FNQA 5SICE 4ES6A 4QLBA 1N2EA 1WETA 3WDSA 1NI5A 2QZ4A 1U2DC 1YJ5A 2XUQA 3DEIA 4PBTA 4TTJA 1CWUA 3SS9X 3PXGA 1AK2A 3EIQA 4CLOB 4YQZA 3G7UA 3PUWA 4M0UA 5COQA 5KKCA 5IAJA 4FFSA 1Z6XA 3Q3EA 3KT3A 2M6RA 3COYA 1T5DX 2B7LA 2FCAA 1C0IA 2DHQA 1VXRA 1GZ3A 2ERXA 2FWIA 3RUDA 5E2IA 3T54A 2WA1A 4G0XA 2B0JA 4IEFB 4FDUA 5BP7A 4EJ2A 4RD1A 4GWLA 2Q29A 1SCAA 1NRXA 1ZJJA 2PVCA 1N77A 5AVOA 5JYEA 3N58A 1UBUS 1XTVA 4DJDC 3UUGA 2D2FA 2H29A 3QEBZ 4UPDA 2GI4A 1M9NA 3JASB 4A8TA 2RI1A 3BXZA 5KVVA 3DTVA 3DE2X 3QG1A 5DU2A 4BRUA 1Y8AA 2VHWA 1X9GA 2DRIA 3UAVA 1NW4A 3C6XA 3HMQA 4G0NA 2XT9A 1ZMRA 3FSEA 5E1OA 1UMBA 1IJBA 4QBHA 5C3UA 4RTQA 1T3LA 1QQBA 3ZCRA 5B58T 1JHZA 2TSYB 1E94E 2O2JA 3PUVA 5M5BA 3IEIA 3PI7A 1B8VA 1J25A 1PNQA 1QHIA 1W46A 5ALFA 1G19A 3UWDA 2ZUEA 2VSQA 1DWOA 3RU3A 5HHTA 5IMSA 1VKJA 3U60B 2YJNA 3BILA 4FDAA 1DKPA 5CDUA 1UMCB 1GT6A 2Q0XA 3Q6QA 2I3AA 1Y37A 5CVCA 1W9HA 1UFQA 5FBRB 4DF3A 5DT9A 3N8HA 1FLAA 4LNUA 4RMIA 4V1CI 3P0EA 3R5JA 3HJFA 1FSZA 3VTZA 4Q02A 3D3QA 3TXAA 1NBIA 1NFFA 2G06A 2SHKA 2V8BA 3FNEA 4BN4A 4FIDA 3D4IA 3O9MA 2NO6A 1SXJB 3W4JA 4LRYA 2UVPB 4FYKA 2PWBA 4RVFA 5ULLA 3LDAA 1EAYA 1G2PA 2PXAA 2GJSA 1IBSA 3AY6A 1EX6A 1ECFA 3TTYA 1GRCA 4ZEOA 2IZ1A 2GYWA 1P29A 5FPQA 3MFYA 4WK6A 1PYOA 3DDCA 1PFUA 3G71B 1VPDA 4NMLA 6AT1A 4W9NA 1PWYE 3TAHA 4ZEMA 2VQFB 1LPSA 1CVRA 1OX6A 1VLQA 4QEDA 5EJEA 4DVJA 2PU7A 2JW5A 1SD1A 3KBBA 4RK0A 2XWJI 4XOTA 3E2MA 4AJ2A 3RTAA 2QTZA 2CLKB 4Y2RA 1ZH2A 3EXEB 3WLFA 3IMCA 3EDRA 5F77A 1PR0A 2Y0CA 1KMIY 1SMKA 1U0FA 3NBAA 4GBED 4ZO4A 2YS6A 3H2JA 1JH9A 1A4IA 2OUIA 3H1TA 1N5JA 5K09A 1Y5IA 3U7RA 5JEDA 5LIPA 2G63A 2ZSKA 2HJ9A 3IESA 4TMWA 4QUIA 5AHKA 3IQEA 3RJZA 3L4JA 5JJKA 2JA1A 1DBSA 1Z8DA 3VU9B 4BVAA 1NY5A 1Z2PX 1GGEA 2JAOA 3D4BA 3H1PA 4YQEA 4R8VA 3WYBA 3ZTWA 5DNAA 4AKIA 5D86A 2C1XA 4DSNA 1IE3A 4DQLA 1MRNA 1KEVA 2JFPA 3GQBA 1AS2A 3L8GA 4RPHA 2H54A 5BR8B 2OAP1 3NT2A 4G37A 1U2GC 4XDHA 4JXXA 3L8FA 3D5QA 3FYUA 1ZI6A 1WZIA 2WHPB 1YMUA 2J9RA 5IBQA 1CK4A 3AG5A 4PWYA 3WGOA 3WQSB 5EJ7A 3A6ZA 1ZSVA 4H7DA 1HDRA 2ECPA 3OJFA 1T3ZA 3GDOA 4ZU3A 5BOVA 4UM5A 3IXLA 4YAUA 3LQFA 3RJMA 5AHWA 2IHNA 3CZ5A 1Z34A 1D07A 4JXJA 5AKHA 2ZRIA 5AXDA 5KTRA 2QVYX 1NLYA 3RBZA 2X8KA 4FLFA 3FNBA 4DGQA 1NSFA 1EGVB 3T7SA 1YKSA 2VRCD 3N2NA 4A8JA 4ZALA 1XAJA 2ZBFA 2BP7A 2P2ZA 4L15A 2I6GA 3JYQA 5BO5A 1PHRA 3IPLA 4ZHQA 2FA9A 4NJMA 1EMDA 4FK8A 1Z0JA 3DE7X 4QDKA 4OBWA 4PC2A 2VRNA 2QTHA 1N2CE 1F06A 4M0KA 1V6AA 2D62A 2JANA 1LC3A 1THMA 2YINC 1QCCA 2GJAA 4IOMA 4KGVA 2ZIAA 5CH3A 3KVVA 1KDVA 2RMKA 4FOSA 4MA4A 4Q12A 3TRHA 4EA7A 3B9BA 4G1BA 4XN0A 3G5LA 4BLUA 4OPMA 4QM7A 3JQBA 1XMOB 1WDKA 1CUAA 1AGXA 3BGIA 1P1CA 7GPBA 2O2GA 2XKBA 4U7PB 4X1IB 5KYGA 2AK2A 1K89A 3QE2A 3WNCA 2W83A 1KETA 1WE2A 4Q7LA 1WVIA 2IYWA 5JFGA 3ZJTA 1R9MA 3F9IA 4DG8A 1VQ5B 2JJ8A 1TUEA 4DCNA 2VK2A 1JU3A 1PK9A 1D2MA 5KWJA 3TGPA 3QEKA 1Z4QA 3LX4A 4TSKA 5JQWA 2BFEA 4EZBA 2Z6BD 1ORDA 1N5MA 4XW2A 1MORA 2N0SA 3QFHA 4D79A 2H2WA 4AKEA 4P4GA 2AXQA 3ETDA 1EHIA 1JG7A 3ZQJA 1SXQA 10MHA 4MRSA 3C43A 1V8PA 3RKSA 4XCVA 1W0JA 3WZ2A 3WL3A 2WWFA 3GJYA 2J1LA 2ZCUA 4ND8B 3C41J 3IQHX 4IDQA 4LFAB 2FUEA 2FZ4A 5SY4A 5HOEA 2PCLA 1ND5A 3HB4X 2R6JA 4OPOA 2H92A 1OU0A 1P9OA 4LQ4A 3H7IA 2YVUA 1FQKA 2J41A 1NP3A 2QGGA 2W6PA 4XYBA 1EFRA 4Z9BA 3I0ZA 5JXWA 3RYIB 3L5OA 2Q5QA 1D6MA 2JATA 2PJZA 5F9HA 5EA2A 4RK4A 5KTYA 2ZSDA 1S8OA 3QMMA 1FUIA 5DK4A 2W8BB 3V48A 4QVGA 5C2JB 1U81A 5J2UF 3A11A 4EL5A 4J7UA 5LDGA 2R2AA 2HI0A 4XCXA 3D7NA 5FL7A 4B31A 4H9GA 4CLXA 1AZSC 3RJTA 4BFSA 4YDQA 1X0VA 1G21B 1T26A 2PX3A 3WKBA 3SSOA 3T4PA 2O9JA 1ILWA 3I5AA 1POXA 1QZZA 3MTDA 3FCEA 3TPZA 4DKJA 1K2VN 3QNWA 1XL0A 3TTTA 1O95D 1DC5A 2R8EA 3PLAE 4MUBA 5TY0A 2RHBA 4BBZA 5JROA 2MMGA 2WU3A 3IEMA 3E3MA 2BMWA 1JEQB 5ALDA 3I61A 2W5UA 4BP8A 3LV8A 2PA3A 2NQ2C 4FDVA 1RHJA 4KO3S 1HE2A 1L9XA 1OIVA 3VYSB 3WYNA 1PT5A 2UUAB 2B1QA 4UQLA 5HK9A 4MPPA 4IBOA 4L08A 4S24A 1G8JA 4FP9A 1HE3A 2FMHA 3OE4A 4XJVA 1CP3A 3PHCA 3B60A 3EA5A 3U1BA 5JAIA 1YB5A 1YSCA 2A84A 4XKVA 1VCMA 3I37X 4H0FA 3SXJA 2OGUA 1CQJA 1ODIA 4ESOA 4UM9B 2CNDA 4NYJQ 1N34B 1M8GA 1NQ5A 4UZSA 2IY8A 4R8RA 3QA3E 3GLIA 3HDVA 5I9LA 3DKIA 2LBPA 4S0XA 4I36A 2R6HA 4G7WA 3EASA 4A1OA 1SRRA 5B7QA 4ZYVA 1HSOA 2V03A 5CEJA 1E63A 5DVZA 5CXUA 1BVUA 2GEFA 3QLUC 4RU1A 3IAM1 3V1TC 3VR6H 1VXOA 1E9RA 2CSUA 4FFNA 5HKKA 1J49A 3KYCB 3HVIA 3BC1A 2V59A 1AK1A 2J3JA 4FI3F 2ZVPX 4OHWA 1HH4A 3IUYA 4OY3A 4CKZA 2XUGA 3C3BA 5EGSA 3SLKA 2W6JD 3ZDFA 2A86A 1FP2A 2H85A 2ZE8A 3MOSA 1YE8A 2MJLA 3B1VA 4NJOA 4WDQA 4DXHA 2VAWA 4LYGA 2I4MA 4NBWA 1PV1A 4F9GA 1G63A 3IP1A 1Y6GA 1IUOA 4B76A 1NT4A 1Z7YA 3UQZA 2HMAA 2XXAA 4YJHB 5FA6A 3KC2A 3Q5EA 3RRBA 4Z4HA 1HFWA 1S72B 1BEEA 4JLWA 3AEXA 3LY9A 4RZSA 5B2EA 1R00A 1TU4A 1VHJA 2FZ5A 5AKKA 4M9CA 1VL2A 1ZYUA 5EFOA 1B2LA 2E4UA 1EVIA 3JX9A 1GZUA 1SKBA 1DG9A 3VGPA 3GJRA 3IPAA 4X0EA 4R8KA 3ZWCA 4JMQA 2ZWPA 5F4MA 1XTKA 3K35A 4UU0A 5AESA 2WD7B 3QLEA 4ZCRA 5FJJA 3E9EA 2VPYA 1UT5A 2ETXA 4ZV7A 1Q5PA 5JARA 4WOJA 5TEVA 1GPNA 4D74A 2VPPA 3GU3A 1R4ZA 4MEAA 4OAQA 4ZI5A 2YBDA 5TX7A 1NGSA 3L01A 4KQIA 4WOKA 3DM9B 2OP0A 4X07A 2YJ5A 4CNQA 1WTHD 2PLNA 4J0IA 3VISA 2BM0A 3LL7A 3WGZA 5B4TA 1SUPA 5KWEA 4UVDA 5IWAB 3I56B 5FLXA 3CTAA 3DZCA 3GLIE 2C9YA 4P12A 4WX2B 1QG0A 1D2NA 1U0EA 1ZONA 3RV4A 3A0UA 4X9XA 4B3JA 3ENNA 4C4RA 5ALQA 2RK4A 2JIPA 2AFIA 3KG2A 4D0SA 4GGMX 2YY5A 1IHXA 2EATA 3MGAA 1U9IC 3PA2A 1BFDA 4DYVA 5EJAA 3IVCA 1EHYA 1SK9A 5LKRA 1IZ0A 3CLVA 4LGVA 3PA1A 4UTVA 4PYKA 4FWTA 4FOTA 4TM8A 2Q7DA 3H3JA 1J2JA 1NG1A 1QONA 1YFZA 5HTOA 2M5SA 3W79A 4F93B 4UHHA 3LC7O 3ZHZA 1TGVA 3O21A 3LHDA 3NX4A 4JLAA 4L4UA 3ZNPA 4DIDA 2ZBGA 1KBQA 1DE0A 4O02B 1NMXA 1CC1S 2I78A 1M54A 3WK6A 5TARA 5KWVA 3SVTA 2B82A 3ODGA 4A5SA 3PITA 5CDFA 3Q6NA 2X1MA 3S29A 4FN5A 1N9GB 1TT5B 1N32B 2CWWA 3LKVA 1H4TA 1DFGA 1RKVA 1SC3A 4BNVA 3RS7A 4XQCA 4RH1A 2C7BA 4RSMA 4L7VA 1Z4OA 4B7UA 1TQ2A 3NE5B 2GUGA 3K8QA 1X9HA 3OM1A 2B3TA 5EIBD 1QFMA 4J4BA 4O4IB 2AG5A 3UWSA 4E4RA 3DFIA 2OKGA 3KUXA 4G01B 1NN3A 5LB4A 4EY4A 2XD9A 5B53A 3ZE0B 1IJKA 1H6BA 2QLFA 3QVMA 4TWAA 1MZPA 3L7KA 2XEXA 5FV4A 1H1DA 3FF4A 3L6RA 4XARA 1UQUA 3WYGA 3R6GA 4JNCA 1PSWA 4OHKA 5B6IA 1YBMA 1WXEA 1I6KA 4J0EA 4U7JA 4Z8YA 3LTEA 3WLNA 2C8KA 1WU8A 3MINB 2VJMA 1PL6A 2BIFA 3CJRA 1GG8A 4MW6A 1HLGA 3EGDA 3T7KA 4UFPA 2R85A 2X86A 5LZ8A 4F3NA 1KJ8A 1SNYA 1XKQA 2K87A 2Q2VA 5D5PA 5T41A 4KB5A 4BBPA 1GGMA 1XVAA 1TO1E 2JB9A 1T1RA 1XN1A 3BAFA 1Q1GA 1UFKA 3C5EA 3CPEA 3F6RA 1RPJA 2AFIE 2IYUA 2JZNA 1JYFA 1NBEA 3PSHA 1TKBA 4RVDA 1A1SA 4WKOA 4G0OA 4N4AA 1RQRA 4KAAA 5ICCA 1YVDA 4HS4A 1L4EA 3ICWA 3NHJA 2JAUA 4MV6A 1A9QA 2JFNA 4QDOA 3ZKWB 3MT0A 3ONEA 1G66A 1NWCA 3KWJA 4HH4A 1DO0A 3RF7A 5L3RA 4MQFA 4AZ0B 4AL4A 2JLWA 3I01A 3HDTA 3PDIA 3SQOA 3VFDA 3RAFC 1Q7EA 2PLWA 3RODA 1YDWA 2WT8A 4HY3A 4D81A 3NLLA 3O3CA 5CDFE 3N28A 4MWSA 1TRHA 4ROSA 2WU4A 3NT4A 4JD5A 1YF3A 1VHTA 2WWRA 1YK1A 1QFXA 3F1KA 4WCFC 3PG5A 4F9TA 4IO0A 4B8WA 1W5BA 3UICA 1Z33A 1P18A 5AI8A 1Z88A 3GZ4A 4RIIA 4FEEA 2F3SA 1FSGA 1FS6A 4EEZA 4F6LA 3A1TA 2Q6KA 4DV6B 2HQRA 1Q7RA 2AMYA 1M2FA 1K92A 1EWTA 1I2MA 2YHAA 3DZ8A 1KDTA 3NDIA 1C9YA 5AW9A 521PA 2E7ZA 4YRQA 3W5UA 4RY0A 1LV7A 4IUCS 4PZUA 4ER5A 1K28D 2OCBA 4NBUA 2P2LA 3SKBA 1WOOA 2C59A 3JD0A 2DCMA 1XA3A 3PTZA 1WUHS 4D4LA 2Q3HA 3OLYA 2H1SA 4QYMA 2G5CA 2GXUA 1R4NA 3NHPA 2NMVA 4MYTA 1CPYA 1JE1A 1U63A 3EBLA 3ROEA 1SB8A 1H8EA 2RC6A 4KIGA 4X24A 2E4ZA 3KNZA 4KI7A 2JFBA 3L43A 3BTSA 4XM3A 3DJFA 3AUTA 2J0UB 2NU8B 5F7ZA 3AWIA 4EBFA 1ZVKA 4XQEA 1B0AA 2O3QA 2I4NA 3ROKA 1H2BA 3P9CA 1RRPA 3I6YA 5IDQA 4KQ1A 4WLVA 3TZLA 3VBCA 1DV2A 3ASYA 5I7WA 2RARA 4DJTA 1DZ3A 2V54A 4CMBA 2PZGA 1E79D 1PP4A 3FUUA 1IBRA 1K1EA 4OATA 4QU9A 3U7QA 3V1KA 3ZHXA 4DZTA 2G88A 4RLZA 1F0YA 2OY0A 4OI1A 1OI7A 1F2DA 1YH3A 4HDRA 4FHZA 5I51A 2B36A 7YASA 1A2BA 3TM5A 2EDCA 3A37A 1LJLA 3GVHA 3W7BA 5HGJA 2PBRA 3PUKA 3VU3A 4YECA 4EQZA 4I3GA 2XMGA 4LY3A 2O8CB 4Z3OA 3SPXA 4XMYA 1B6RA 5A6SB 2FAXA 2W6NA 2QLTA 1Y7TA 2O3JA 4LRWA 3KIPA 2VP3A 1JHPA 5EIFA 3U9LA 3WJ7A 4RDCA 4FILA 1NU6A 2FXVA 2Q9CA 4JJ7A 4XUDA 3NEJA 3DAYA 3NB0A 4DJJA 1NLUA 3AONB 1VKOA 3DFUA 4GVXA 5KYUA 2EBUA 4LG1A 3T3DA 1EPUA 1PQUA 2W6ID 5IK2D 3SC3A 2DYKA 3K4PA 1GNSA 1K7CA 3PDCA 4ID3A 3ZI4A 1X77A 2IHYA 3BS4A 3SG0A 4Z8XA 5DBFA 2OFPA 1HXHA 4YPFA 1KNXA 4Q24A 2WLTA 3PUYA 1NTOA 2IYPA 5K0EA 4N5NA 5TS3A 4G4SP 4PYOA 3PXEA 3Q7QA 4ZZ1A 4B3XA 2R7NA 3PVZA 1XK7A 2WJIA 3PTAA 1NBMD 4WLOA 3W6OA 5T5QA 3ZDXB 3BCDA 2SKDA 1VG0B 3FOFC 1QK4A 2AOTB 4YP5A 5AKYA 4O6VA 4IINA 4Y6SA 2CXSA 4KFTA 3SZOA 1N8NA 3HZHA 2BEKA 3TLGA 5JATA 2KYRA 2E5FA 2B5VA 2W0MA 3W5CA 4DW8A 1ZEMA 4OX9B 1UP4A 2IYVA 2XB9A 2O8DA 1E2KA 2ON6A 4OIFA 3GLHB 4LXUA 3S7ZA 4IGIA 2R47A 2H4WA 5TPZA 1BLIA 4Q9NA 2YY6A 2ZJZA 3E23A 1FYWA 3W6PA 4N1AA 4Z3KA 2X3UA 1Z5GA 2PZBA 3T6KA 2P4SA 1O6BA 3VHXB 1U6IA 5BMVB 1G3UA 2F3UA 2CMGA 2WTMA 2HF7A 3L41A 3MTGA 2E0IA 2NO0A 2NZVG 4DAEA 2QUIA 1NXWA 4IWXA 1BRMA 3DEZA 3UJBA 4NCKA 3W77A 4CM4B 4ZICA 1QIJA 2OGSA 2QTVA 3JVIA 5K0SA 3MTBA 3CW9A 5AJTA 1FP4A 4BLSA 3WA7A 1DQYA 1P75A 2BTQA 1L7VC 3S2IA 2QI9F 4UFOA 4TL8A 2NU7B 2EFHB 3IP5A 4Z7JA 4N40A 1V1MB 1TUBB 2V31A 2BFPA 1OBVA 4ZOCA 2IKQA 1MD9A 2WM2A 2W98A 3ETEA 5ARDA 4LGMA 3VZBA 2IRWA 3ON5A 3A6PC 3I53A 5DHUA 4D9KA 4TYPA 3E22A 1E6EA 2N1BA 1DQSA 4YRRA 4CYMA 2C2BA 3VZSA 5IT0A 5DISB 2BFFB 4PZ0A 4I4LA 3OQHA 4WINA 1D7AA 3IAEA 1YS1X 1N6HA 2V4ZA 4RDIA 2BF7A 3OMXA 2FQ1A 3EIHA 2XOKD 3UW1A 1NV8A 1QDEA 5BT9A 4C9BA 3ZOZA 3VI3B 3RAEC 5J59A 1M2GA 3OAAD 2J5BA 1LS1A 5B3LA 2BRUC 3DMHA 2R84A 5T6BA 3THWB 2V55B 4GBMA 1XLWA 4JB3A 1VQNB 4MWCA 3VOBA 2HC9A 2CF5A 4EY3A 3G2PA 3RF6A 3RM3A 5JYDA 2PS1A 3Q7RA 2Q9AA 4JCCA 2VR1A 2AMVA 3DQPA 1SU4A 2ZJYA 3EOAI 4JYBA 3RW9A 1JJ2B 2BGUA 3OZXA 4EEKA 4BHTA 1XD9A 3GSIA 1R64A 4GI2A 2D0OB 3A6JA 3CEHA 3RABA 1L4BA 3OQOA 2BBTA 2BM8A 1DTSA 1N9KA 3A1CA 3ME5A 3HM9A 2XNCA 1GNRA 4Z99A 2Z95A 3VA7A 3ETNA 3EUFA 4D26A 4QPZA 4WZEA 3H4VA 2FVXA 4B34A 4NY1A 4TXJA 3K4HA 3I2KA 1NQWA 3B53X 4BZWA 4OYYA 5A5GA 1HLDA 2QD5A 4NULA 1CJVC 3GPLA 4QOGA 3ELBA 4PAQA 5TE9A 3PGXA 3IT0A 1AN0A 3H1EA 1LEHA 2IOYA 4ZVMA 4ME6A 2ISQA 3E20A 2A5YB 3ISJA 2WYVA 2QD4A 2AMJA 1E3SA 4ND6A 1KMQA 1Q22A 2VSOA 3RADC 1C1DA 4N39A 5ITVA 1HYQA 3K0KA 2BN4A 4BX8A 3E4CA 2QSYA 2OBTA 4M76B 2R8OA 2Y77A 3GPBA 3LX5A 3OPXA 2ZAMA 1LW6E 2VT2A 1L2TA 3EY9A 3R3ZA 3T5AA 2DFNA 1ISHA 1KFCB 2FZCA 3V3KA 1Z47A 3AFMA 1R0YA 3ZJYA 3ZPNA 1RXIA 1ZW6A 5K5EA 4QEZA 1QLHA 4UUMA 4N76A 5JO9A 2ICAA 2R9VA 1UKVY 2GARA 2IVZA 2YZ7A 3PUZA 4M7OA 4CM3A 2XSZD 3G5AA 3QPUA 3T5TA 1R6DA 2ERCA 2XMBA 3BGOS 3UBTA 4BY9E 3P9IA 4K26A 5AXAA 4NZPA 1TYEB 1S8FA 4HSEA 2D5IA 2WFAA 2YJ3A 2VC2B 4MVJF 3OFVA 2O54A 3LAWA 3F9CA 4UE6A 1NP6A 2RSLA 2QDKA 4FZRA 2J59A 3R6KA 2X6QA 3MD9A 1OFIA 2QRNA 1DCMA 1US8B 4TLLB 3IP3A 3T15A 1LJUA 3C7KA 2OCIA 1QO7A 1WX1A 2P6NA 3R7LA 3U48A 3AJ8A 1HTTA 3QOWA 5COAA 5A0FA 4GDFA 2GXQA 5F51A 4B47A 1LK7A 2JAQA 1EH5A 2BELA 4EW3A 3AZPA 3PFBA 1L1EA 3ONYA 4KH1A 2JLRA 3KPUA 1I4DD 5C8VA 5A89A 1F2UA 1UUFA 2W4QA 2OQ2A 4Y9UA 5LQAA 1M5UA 2ISCA 4HDSA 3VX4A 1OBOA 2HSEA 3TFOA 1LI7A 3WMRA 1XKLA 2FZGA 1NI3A 3LK6A 1KO4A 2E4VA 3P5SA 1OYOA 2HNAA 3QLVC 4CBVA 1UBLS 2Q5IA 5LWQA 4NU0A 1T5BA 3KB2A 3TL6A 3UXEA 1EWRA 1VOTA 3VO9A 2IS1A 1LQ2A 3C6BA 4W5HA 3KTFA 4ER6A 2DPYA 4BFVA 2V9PA 2QG6A 3TSWA 1XZBA 3NJ8A 3DQQA 3I0MA 4EHLA 1BRTA 4XWWA 4N5LA 3K70B 4JJ4A