3FPKA

Crystal structure of ferredoxin-nadp reductase from salmonella typhimurium
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
247
structure length
247
Chain Sequence
ADWVTGKVTKVQNWTDALFSLTVHAPINPFTAGQFTKLGLEIDGERVQRAYSYVNAPDNPNLEFYLVTVPQGKLSPRLAALKPGDEVQVVSDASGFFVLDEVPDCETLWMLATGTAIGPYLSILQYGQDVARFKNLVLVHAARFAADLSYLPLMLELQQRYEGKLRIQTVVSRENVPGSLTGRVPALIENGELEKAVGLPMDKETSHVMLCGNPQMVRDTQQLLKETRQMTKHLRRRPGHMTAEHYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Ferredoxin-NADP Reductase from Salmonella typhimurium
rcsb
source organism Salmonella typhimurium
molecule tags Flavoprotein, oxidoreductase
molecule keywords Ferredoxin-NADP reductase
total genus 69
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2009-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3fpkA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3fpkA02
5EMNA 2EIXA 1IJFA 4M1KA 3I56B 1ZM2A 4G5GA 3FJOA 1R5NA 1BX0A 4FN5A 3CC4B 1W2BB 3AVXA 1YJNB 4N3NA 1F20A 1J9ZA 1JJ2B 4FWTA 4ACAA 1Q81D 1YJ9B 4Q7JB 1FNCA 4HE5A 4UAJA 1FRNA 1JNYA 2VNHA 3OJXA 2QEXB 4M2LA 1QFJA 4LBVA 4ZGQB 1QVGB 3OZUA 3VMFA 3CC2B 1UMKA 4G1VA 1IB0A 4IW3B 1QH0A 3ZBTA 1G7TA 1KD1D 4AC9A 2VZLA 3P27A 4B43A 2PIAA 4RD6A 4YAFA 3WNDA 2RC6A 1XE1A 2RC5A 3ZZ0A 3CRZA 2HMAA 2BGIA 1FRQA 1BX1A 2DEUA 4LBWA 2NPFA 3CCMB 4M53A 3CCRB 3E1YE 5THXA 2YWFA 3W2EA 4Y9UA 1N0VC 1W35A 4RD1A 1ZM4A 2OTLB 1NDHA 5TY0A 1QGAA 3CCQB 1KK3A 3P26A 5HXBA 4G1BA 3CCSB 1N0UA 2BSAA 3LYUA 1AMOA 3U6BA 1VQOB 3AVWA 3QFRA 4PC7A 2R6HA 2QTZA 2QN6A 4H9GA 4YAWA 4PC1A 1S0UA 3AVTA 2BPOA 1VQ6B 4ZCMA 3A1FA 4PC2A 3MHPA 2E1RA 4P3YA 1AIPA 1JA0A 4ACBA 1N8RD 3CCUB 1CNFA 1YI2B 2C77A 1A8PA 3B82A 2XNJA 2CRVA 1VQ5B 2XNCA 1QGYA 3U2QA 3AVUA 1GAWA 2BMWA 2QDXA 4AF6A 4HE6A 5KSWB 3CC7B 3W2HA 1KJZA 1E62A 2EFGA 1BQEA 1BJKA 3OZVA 1G7SA 1VQNB 4P6VF 1E64A 4YAOA 3W5VA 3QFSA 4Y7CA 1EFUA 1Q82D 3J81k 3CMAB 4FK8A 1KK0A 4TMWA 2BM1A 4M4SA 1ZM3A 1YITB 4DQLA 1U2RA 2BF4A 4MYTA 3ZBUA 1JA1A 3G4SB 3VO2A 1K8AD 2VYQA 1QUFA 3CW2A 4B4DA 4C0SA 1KK1A 4RD0A 4YALA 1GJRA 2XEXA 4F7DA 3ZZTA 2QTLA 1EP1B 1VQMB 3ES9A 4Y9RA 3G6EB 4RD3A 3CXCB 1WDTA 1FNMA 2DY1A 1EFCA 2B5OA 3ZZUA 3G71B 1DG1G 3W2GA 2BN4A 2OK7A 5H59A 1YHQB 1B23P 2B7CA 1KTVA 5H5JA 1DDGA 1EXMA 5TR9A 2B7BA 3E20A 4ZCIA 1EP3B 1TLLA 3U6KA 4TMTA 3QE2A 2X3UA 4TN1A 4TMZA 4ZGNB 1QUEA 1OB2A 1NJID 3CB4A 1KK2A 1ELOA 1EP2B 3CD6B 3OW2B 3MCAA 3I55B 1VQLB 2GQFA 4TMXA 4QHYA 2DERA 1M90D 4U9UA 1XB2A 2AHOA 4N3GA 2BM0A 3WBJA 4B48A 3QFCA 3AGQA 2VNKA 1VQ8B 1QGZA 3CCLB 3W5UA 2OK8A 1DDIA 4NBSA 2HCJB 2YWEA 1D8TA 2C78A 4WQMA 3VNVA 1CNEA 1YIJB 4ZV4A 4LBZA 1GO2A 1TUIA 3WXMA 1OGIA 2QA4B 3CPWB 3WYAA 4B47A 3B78A 1B2RA 4PC6A 1OB5A 1TTTA 3JQPA 3QFTA 2DETA 3B8HA 1CQXA 1SKQA 1F60A 5GV8A 1FNDA 3LVBA 1G7RA 1KRHA 4K1XA 2QMUA 4J0QA 5GV7A 4B3XA 1VQ7B 1VQ9B 1ZUNB 4RJLA 4RD2A 3WBKA 4B44A 1FNBA 2BGJA 1W34A 1Q7YD 1W87A 1D2EA 1I7PA 2ZITA 3AVYA 1QVFB 4YAUA 4C43A 3V76A 4RCZA 4TMVA 4MYUA 1K9MD 1JB9A 1KQSB 3OJWA 1GVHA 1K73D 1H42A 2GPJA 3W2FA 1GAQA 3LRXA 1EFTA 4R71A 3AGPA 3JQQA 2PMDA 4DQKA 1ZM9A 1QX4A 4AF7A 3SJZA 4RD4A 1VQPB 3PENA 4BPRA 4RCYA 3W5HA 1FDRA 1KC8D 4PC3A 3W2IA 3ZC3A 2FX3A 2VNIA 1D1NA 4QFMA 1DARA 2D74A 3CCEB 4NCNA 5FA6A 4PGOA 1M1KD 5DSZA 2BV3A 3MMPA 2HDNB 1OGJA 3WNCA 2VNJA 2CNDA 4YHBA 2J7KA 2OTJB 3WNBA 1E63A 2YWGA 1QFZA 3FPKA 5TV2A 1SM4A 1GR1A 2YWHA 3WY9A 1VQ4B 3OZWA 1HA3A 1G7CA 5AN9A 5JBQA 4ZCLA 3I1FA 1QFYA 4LC0A 1EWYA 3CMEB 3LO8A 4M0LA 1TVCA 3VO1A 3CCVB 2PLFA 4EH1A 3QSYA 1S72B 3AVVA 1Q86D 3VNUA 4LBYA 3JQRA 1IJEA 1H85A 2BVNA 1QG0A 1YJWB 1R5OA 2DCUA 1VQKB 1R5BA 3CCJB
chains in the Genus database with same CATH superfamily
1H23A 1ZNZA 2BJHA 3K2IA 4M1KA 2HA3A 1AZTA 2DXIA 3R6DA 2NU7A 2YJ3A 5CB0A 1QHXA 1SR8A 4WRRA 3BF8A 3UCXA 5IRCD 4AWAA 2W6QA 2X42A 2WAOA 4L08A 1IXZA 3HKCB 3TX6A 3CA8A 2JN9A 2QIPA 1QJCA 4J16C 5TEVA 4M8IA 3KAPA 2QUKA 3TPZA 5CYFA 4EPVA 3HXQA 1DWUA 1JEJA 5LBIA 4KRGA 3UQZA 3EVNA 3JWEA 3Q4GA 3H4VA 1Q81D 1O0SA 2FSHA 5KW9A 4L9RA 4QOSA 5EY5B 3R0IA 2YC4C 1KTIA 3L92A 1J8QA 5BSWA 2F62A 2QE6A 3IH5A 2WMNB 4JCCA 5SZIA 3FPHA 3EIHA 1QH8A 1WB4A 2B36A 3E70C 4IKOA 5JQGA 3T52A 3A3YA 3I2FA 1QO7A 5BN3B 4ND2A 4DY6A 4Q6BA 3GVPA 1QFJA 2K7ZA 4KTTE 2AKYA 4RDKA 1NPYA 4KQ1A 3SLRA 4RSMA 2BJVA 3VMFA 4HF7A 4D97A 3IJPA 1KXZA 2GCGA 1F0PA 3OEHD 4IUCS 2IHTA 3CONA 3GRYA 1YK1A 1X7WB 2GKGA 2NNWB 3R6TA 1YTUA 1J99A 2QD3A 3UHOA 3RE1A 1EFLA 4ZI7A 3KB6A 4ECEA 1J06A 2OXFA 2XDWA 3H9EO 3QU5A 3LQKA 3PUWA 4MUXA 3BMCA 3MGCA 2KS6A 1JG2A 4Y2GA 4DT1B 2VZLA 1CBUA 1M1XB 1P29A 3BICA 3GUHA 4U63A 4GP7A 1SKBA 2AVDA 2OG2A 1AD2A 5JYBA 1K98A 4RGVA 4MCAA 4IV5A 5LQCA 2XX3A 4ARIA 5IF3A 3ZZ0A 1RWKA 2B37A 4Q1DA 4GPD1 1WD5A 2DPXA 4Q3AA 2YV1A 3ENNA 1UPBA 4JUFA 1VI5A 1GFSA 3H18A 3Q40A 4GZ6A 5I7VA 3JZMA 3WQRA 5KYVA 1DIHA 4AT1A 2V3CC 1H4SA 3MJSA 2AZTA 3JYNA 3CCRB 2F1MA 4LHSA 3ZE8A 3IR7A 3G1TA 3RUCA 1RADA 5THXA 3LLUA 1SCJA 3EX7C 3EC1A 4PGMA 1UBMS 1YE3A 2XVMA 2H4FA 1TQ6A 3BKWA 5GY7A 3RUFA 3PQ5A 3AHFA 3IXQA 4PFJA 3SHWA 2K2WA 4BQIA 4J49A 5DU2A 3NU1A 5D84A 4AZTA 3ON5A 2OTLB 4IHJA 3LUCA 4HD8A 3QOWA 4RENA 1NDHA 1W6UA 4CGYA 1G41A 1GPDG 1Y8QA 2ZWPA 1Z08A 3F6EX 3TZ6A 4RFLA 4GL4A 4Q18A 5J2TA 4X00A 5FR1A 2OFOA 4OHUA 2C58A 5EWLB 5KX5B 4PF1A 4S3MA 5JZOA 1RLTA 1TO6A 4CEIB 3M3PA 1ONSA 2VDQB 1ZI8A 2P0YA 1GN8A 1XZDA 4FXOA 1WD7A 2Z1NA 3F7OA 5FNZA 3BX1A 1ZH4A 1AKTA 1U7DA 3FUWA 3L5OA 3SGLA 4KWCA 4NV0A 4PC7A 2Q07A 3IQHX 4MUYA 1UOEA 3WTCA 4W8GA 1XMXA 1BPLA 1TT5A 5B64A 3GDHA 1R4MA 1VA4A 4DQDA 3ZD6A 1D0VA 3BM5A 3VPAA 1NL3A 4F7WA 5E0KB 1BNCA 3LBNA 4B5KA 1FFBA 2YS7A 1YVEI 2GJKA 2SNIE 3K0BA 5F1OA 2ZB4A 1C7JA 1RI5A 4XX1A 5FAXA 4B81A 4JUBA 1WW2A 5I7RA 5LJIA 3LE8A 1M2OB 5BSVA 5DF1A 3QWBA 2ZAMA 1N9KA 1RRVA 3DOJA 2BFPA 2W6JA 2P67A 1YUNA 4E70A 4LUCA 3UAWA 3NE5B 3H84A 4LY3A 4OHMA 4X7RA 4DWWA 2WUWE 3S8YA 2NU6B 3CCUB 3KKEA 1YU9A 3A05A 2JLSA 3EG5A 1TUBB 3UT6A 2C77A 4R51A 3G5MA 2HU7A 2EWWA 4I14A 5JJCA 3FZYA 1XX6A 3QVMA 3GLHA 4KXUA 1KAMA 4FB5A 3NHAA 4B3JA 3AWDA 1RHRA 4D0GA 2YVKA 3SC6A 1MXHA 4N65A 2Q3EA 1VKZA 2D06A 2BELA 3ONVA 3A32A 4IZIA 4R2WA 1MB3A 3ZHSA 4F9GA 4K9PA 2HZ7A 3H4IA 4LZNA 2WF7A 1OHHD 3Q7SA 2MR5A 3N2YA 1PJ3A 3SJAA 3BC1A 3DPUA 3SR3A 4YRLA 1JMKC 3ZYZA 1CUBA 1H0SA 2F7SA 4JASB 4X6UA 4YP0A 1QK4A 4FOSA 4M7WA 4HNHA 3SHQA 4BOYA 4QSHA 5BXYA 3CUSA 3KOMA 4A5SA 4AVZA 1NBWB 2XQKA 5IK2A 3K16A 3TLAA 2C61A 5J2TB 2J59A 1EU1A 2X0IA 3H94A 3C7AA 4MUGA 4AX4A 2JCXA 1SQSA 2Z5GA 1TU3A 3IEKA 3A26A 4GX2A 3WX0A 3U40A 4C4OA 4LJYA 2FE4A 5E1OA 3WIDA 3D7NA 4KOAA 1D1TA 1Z06A 3UBMA 4L15A 1M6VB 1XROA 4X1YB 1JDTA 3IP9A 2TMYA 1N3IA 4JXXA 5DYGA 3RYIA 2QMZA 4BLTA 3R3XA 4I55B 5J2UF 1Y1SA 1QUFA 3Q88A 1ZD3A 3ISTA 4U2BA 4CT5A 2JCVA 3BRWA 2JLUA 4WZTA 4CJXA 1KK1A 3ZLBA 1U81A 3E58A 1VFPA 5ECWA 1B0UA 1JU3A 3OEYA 4FKZA 4GICA 3EXHB 4R84A 1KDZA 4YV0A 1FVXA 2PKQO 4EHBA 4ZHQF 5B1DA 1GGFA 1MAWA 1MNAA 3QTTA 4GVPA 3MTIA 4Z49A 1P3DA 4D9IA 1RPJA 3QFFA 3PFHA 1QKIA 1A27A 4TV9A 1Y7IA 3FZNA 3PQ7A 2QNRA 3CLUD 4LGCA 4RETA 4JBXA 1RLIA 1Z62A 4HMOA 5FH9A 2XA1A 1UOQA 4KC0A 1SZPA 3WLPA 4E5YA 2AT1A 4MVJD 4Z8XA 1X92A 3OCZA 3V1LA 1PN3A 1G8KA 4PGAA 2PXCA 1YHQB 1R88A 2IHJA 3AMVA 3O93A 4BEJA 1KTVA 4LISA 4WXMA 3X2EA 2PGXA 1JXMA 1L4FA 4M55A 3T3DA 4AG5A 5K8IA 2JFVA 1JE1A 3TWOA 1DWQA 2EBFX 2PH7A 3P9KA 3C5HA 3UA4A 5E0OA 2Q46A 4OQPA 4N18A 1A5TA 2UUCB 4O1IA 1WSVA 5KDOA 4UVDA 4RTMA 3ZGOA 3WGQA 3CVUA 3CT6A 1OX5A 6Q21A 1T2AA 2WM3A 3NXKA 1EFDN 3O21A 3PNMA 4GKAA 4Z54A 3CYFA 3DZJA 2HK8A 4PGGA 3FW1A 1KZLA 4JI1B 1Q7RA 4Z86A 4ZMBA 3GNLA 4INZA 1RACA 1VMIA 2VJPA 1U8CB 1YB2A 1YL6A 3ZGLA 2AN1A 3FTNA 3NHPA 1L7VC 2XRYA 3BMQB 3H8JA 2FOLA 3DDUA 4XD7D 5CT5A 3ICQB 1LSUA 2NO1A 1GNVA 1CY0A 3CD6B 2HNKA 3BXHA 4LJAA 1IN7A 4PZYA 1RKQA 5F4JA 3NBAA 3GUVA 1CR0A 4GXNA 2PBRA 1EA5A 2PMBA 4PFKA 3FVRA 3PYMA 2Y71A 1Z2NX 2A78A 1UBRS 2IP2A 2PGOA 3ONFA 1T10A 3TLXA 1GTZA 4QOHA 1R0ZA 4RTJA 1L7AA 1X74A 1RZRD 2NUAA 1EAMA 1DFGA 5DCLA 5A4DA 3RRNA 4FJ2A 1U63A 2J9ZB 5TT1A 3L0IB 4B0OA 4ZOQI 5FLXA 3PITA 2OY0A 2OM6A 1CYEA 4URXR 2BFFA 3FI9A 1GT6A 1G38A 4BFYA 3GZNA 2NZWA 4QQNA 3TRJA 5JRZA 4LDPA 3A27A 3UUGA 3MT0A 2QVZX 2YMPA 1PJBA 2LGJA 2O2EA 3JD4A 4LRWA 4XRRA 1IC6A 4Z8YA 1X15A 1JG6A 1CKEA 4RDCA 1G5QA 4FE4A 2BEWA 4KMRA 4DM3A 4BO9A 2REXB 1S2MA 2J9YB 4M1EA 3UXHA 4MRMA 1DCMA 1NUAA 1JDSA 2XUPA 2ZYGA 3D6VA 5I7AA 3KSBC 1LZKA 3O4IA 4JMLA 4LY9A 1CZLA 1E9DA 4NXNB 2GJAA 5EP3A 1NVWQ 2GZRA 2VDJA 3VX4A 4AFNA 3ONNA 2ZIGA 3GVIA 5K3CA 5M2QA 1UWCA 3T1YB 2H3EA 1NVXQ 1X1CA 2WHPA 3VPDA 1TUIA 4HAUA 3N58A 1F8GA 2JHGA 1REQA 1LSJA 4W7SA 4RA9A 3TG2A 4AS1A 3HL0A 2XSZD 3SZLA 2FG5A 3GFPA 1XAIA 2PUAA 1Q1NA 3D81A 4PC6A 4I1UA 1JU4A 3O4JA 1O95A 3JQDA 2NTEA 1A98A 1A9XA 1USIA 4QPZA 3ABQB 1JR2A 5JS2A 1OAAA 4HTFA 1DEAA 4IQ8A 3M49A 3WGKA 2PR7A 4B46A 3IA2A 3QX8A 3ZDDA 2AG6A 1SKQA 1VP9A 2ASEA 1EE2A 1ZMRA 2QSZA 3DHYA 1X94A 2DR0A 3FUTA 1VOTA 2QT0A 2JGFA 4P4TA 2AWOA 2E21A 1KRHA 2GZDA 1V1MA 4LEIA 1P18A 1STOA 4YAGA 1Q14A 1Q7CA 2WILA 3FBGA 3DMNA 4MA0A 5B58C 3RTGA 3TMYA 1RCTE 4LYHA 2KPOA 4R05A 1VC2A 3DTNA 3CF2A 4EY4A 1XDSA 1H9CA 1IG3A 2C95A 5BVGB 1QG2A 1N4AA 1EKXA 3P8ZA 4BVLA 1QGUA 2NUAB 1ULAA 3Q8KA 1E3WB 4LHWA 4P82A 3D3EA 3D7LA 1HYHA 5PNTA 2ECQA 1Q0LA 1N3LA 1Y3DE 3CJTA 3ZY3A 1O57A 3BH7A 3GZNB 2ACEA 2RIRA 4IIXA 4L75A 4YN3A 4BMXA 1W5EA 3L40A 3W9YA 1XNQB 2EYQA 1XRSB 3FJ1A 2BEKA 4PBRA 1SZCA 4TMVA 3A6PC 3CLTD 2GDJA 4TT8A 2XOXA 3KPVA 4MHSA 1A2OA 2Y1EA 2EFYA 5ILQA 2I6UA 4YJFA 2BKVA 4RAQA 2B1IA 4KIUA 3PUJA 1M83A 4GOLD 3WOVA 4L78A 1H42A 1Z63A 1VE6A 2A9KA 2MMCA 3UK0A 1K6JA 3UH0A 2I91A 3F4KA 3SHFA 4A0RA 1GY8A 4W5NA 4KMOA 3RHZA 3FMPB 4KE7A 3B13B 1K7FB 4JLBA 4R8KA 3AYZB 4OHCA 1VA5A 3RJZA 5FFMA 4K9KA 1EEXB 5FPYA 3SJBA 3EZ9A 3T9FA 1WZIA 1XF9A 1A9XB 2O52A 2X8AA 1QR6A 4K0RA 1G64A 2EZTA 4LW8A 3EE6A 3K0FA 2CNBA 2N9UA 4Q19A 5JNTA 3HKDB 2DWUA 3TLGB 4D4KA 3H97A 3N2LA 1B1CA 2J41A 1UJCA 4OQXA 4Z3KA 4K87A 1JBQA 4MJ3A 1OZHA 5KOYA 2Q8QA 1L1RA 3FOEC 3A1VA 5DT2A 4JLNA 4RTQA 3A4MA 1ZQ1A 3V4SA 2XODA 5CIYA 2BKEA 4N54A 4YUZA 4OHZA 3RS4A 1RQRA 4CZ2A 2MSNA 3E9ZA 3HYRA 4ZALA 4MW5A 1KMQA 1XE3A 4CG3A 2D74A 5DS0A 4EF4A 1S2NA 5DSZA 2GXUA 2RKWA 1RYZA 2ZZEA 1CJMA 1PQUA 3BXPA 4QUDA 4TYQA 5FPPA 1D5CA 4YO7A 4ZJZA 4A1FA 1PJSA 4H15A 4ZQGA 4R41A 5L9AA 3FTQA 2CNDA 1ZVKA 5CYGA 1RYDA 1Z17A 3UWSA 4A5OA 5KIAA 4PZPA 1QB8A 5K09A 3HGTA 1ZISA 1SAYA 4ZAXA 3W9BA 1EB8A 1L4GA 3W5IA 4UZSA 3M6FA 1W36B 4C4PA 2ZUTA 5LUAA 3IMCA 3LX5A 2FTKE 5AVRA 3H7IA 3U4DA 2Z30A 1U8XX 3QWIA 3G2IA 1PL8A 4PHHA 1HH4A 2Q41A 3I9OA 1B00A 1YC2A 3E4CA 2QF7A 1T8SA 3ESYA 3MJVA 5LC1A 1LLQA 2BFEA 1Q57A 2JIQA 1ID1A 1PV1A 1KI3A 4PAMA 4KKVA 3JZIA 2JIPA 3FE2A 4O6VA 1BFDA 4R98A 4WVLA 3KYDA 3W5SA 4PN7A 1ORDA 3A6LA 1J0DA 1II8A 3C0KA 3D3WA 1VJGA 1U9IA 2NYRA 4OOEA 4M1MA 3ZLVA 5HHTA 4TVKA 3OEED 3TE7A 5LMNB 4Q5IA 2X5XA 3UN1A 1IBMB 2R5NA 3R6WA 2ZJFA 4FGSA 4OJMX 3X1DA 2YUTA 5G40A 3GAZA 2J3LA 1OX4A 1M67A 3HKDA 3TLGA 4EFLA 2XE7A 2YHSA 3I2KA 1OH6A 4KIWA 4YRZA 3T41A 4D8UA 1HT1E 1XTUA 1I30A 4KO4S 3B9BA 2YMMA 1A1SA 2Z2IA 4LZZA 3I76A 4F06A 2PXAA 3VSAA 4D43A 2ZT5A 2FEMA 2H7YA 1QVZA 4L9SA 3C87A 1MU0A 3EMBA 4TWJA 4UXJA 3VC2A 3P2MA 4DQXA 4QSMA 2CLFB 2ZRKA 4J2OA 2ZDHA 4LI3X 3RUPA 1J39A 4IUYA 3ZLJA 2VCEA 4LOAA 4MX8A 3QEAZ 4LF4B 3DYBA 2OVBA 3BDVA 1D9ZA 4FR0A 2Z4SA 4UHHA 4EF5A 2XUQA 4ZYXA 2V8OA 3DAHA 2C20A 3FD8A 1KH3A 3B1XA 2RGXA 5BV7A 2JGJA 5KTSA 3AB8A 2JIDA 4NK4A 3VDNB 4BNUA 1KETA 4YRJA 4PCVA 4CMBA 3NAGA 3DO6A 2GBGA 1VXRA 5JSHA 1XMPA 4OQFA 3BIWA 1GUFA 1Z2OX 1ZJ6A 1NI5A 2A9FA 3A1WA 2CVOA 3AJDA 5AW3A 1NWCA 1X70A 2DP4E 2QJWA 3FHJA 2C1ZA 1YRBA 4ZEXA 1SB9A 2P9ZA 3JY6A 3DDOA 4G89A 4IOKA 3R9IA 1XMSA 1V2HE 3C4QA 4PNZA 4ID3A 5KYUA 1MAHA 5CB4A 4GU5A 5EVJA 4O4LB 4KO1S 1CNMA 1WCV1 5TARA 5IYZB 1B0AA 1Y33E 1IQRA 2JEZA 3E9NA 3LLVA 5JW6A 3FN4A 4KQIA 2ORED 4YJ2F 3U61B 3NWPA 5CDHA 2E82A 2M6RA 2DBVO 2HHLA 1F06A 1N6NA 3LOQA 3VJKA 8GPBA 5KNDD 3SS7X 4Y2JA 2PRKA 3D0OA 4IYRA 5K4AA 5TJ9A 2H0AA 4TYMA 4I4CA 4XPZA 4CLRA 2ATIA 4RHTA 4HOYA 5ALJA 4E5KA 2IEBA 1SBZA 2EKPA 3A4IA 5ARDA 5AVVA 5JNWA 1Z07A 1XEAA 2XCIA 1CE8A 2WTMA 2IZ0A 3QE4A 4KQMA 4UOEA 1UT6A 4FX2A 1II0A 2GCEA 3G85A 5FHRA 1PD0A 1E3XA 2IEIA 3FR8A 4RD6A 3CX3A 2UUAB 4DNQA 4TV8A 5T4EA 2C84A 2IYUA 2WJWA 2GMWA 1TC2A 3RVBA 4NZMA 3CNQS 3N6XA 4I50F 5IDVA 4CTJA 2C4HA 2IXEA 2WIFA 1ZH8A 2GD2A 3NALA 3JSAA 4XR6A 4EB6A 1FVFA 1GWNA 5AHXA 3SD7A 4DIDA 1NNEA 2OHJA 3PP8A 3VBCA 4E4TA 2CV1A 2NPFA 1L6RA 1LFAA 1K3UB 5A05A 3ROEA 2JLYA 2ZJ0A 1RRFA 1KO8A 2QL9A 4M1QA 3QLVC 3R5HA 4DF3A 4EGQA 4B9AA 1HX7A 3Q10A 3GPDG 4YUYA 4ZEOA 3JVIA 4NATA 1WZ2A 1DT3A 3A3NA 4NS1A 5ELLA 3FUVA 2I76A 3PUMA 5JI3E 2G9QA 3R8FA 4BL5A 5C37A 3LQYA 3L6RA 2R87A 3WLIA 4D0LB 3R09A 1YRYE 4L57A 2OP0A 4L76A 1Z0SA 3AB7A 1XVVA 3HCPA 4N41A 1CY6A 2ATVA 3D7RA 1WXFA 3B6EA 5C2JB 5FQOA 4ZPXA 2ONJA 4IINA 1QV9A 1NMQA 4NYIR 5IUJC 5TY0A 1UT8A 3B9RA 1RZ3A 3HXPA 4B3DA 2FLWA 2I62A 3TRIA 3WFIA 3AEXA 3TQIA 3ZS8A 5IANA 2IOFK 4O4LA 5ICEA 1GR0A 3PC8C 3FGPA 5HA5A 5HXBA 3QKSA 4AJ1A 4UPDA 4K6GA 3PEYA 5DK6A 4BKMA 2PM8A 1P7YA 4CG0A 4H4DA 2CL0X 2RB4A 3IUEA 1PFKA 4I9GA 2CMGA 5E3JA 1CUDA 3TZCA 5HKKD 2P3OA 4ZCRA 3KDPA 1W36D 3IPAA 1KI8A 1U5BB 2ZATA 4F0JA 1JWLA 2B25A 4REQA 4LKOA 2PJUA 4JX8A 1S3GA 3K73O 5FLKA 2XMSA 3SSMA 1JEEA 4Y0VA 2AUNA 4QECA 3BT7A 4QOFA 4D26A 1K89A 3D6NB 3RTCA 1XDUA 2CSUA 1Q1ZA 4TXLA 5FA8A 4QEZA 4PC2A 4AZ3A 3HZOA 3K1TA 3Q7TA 4G6ZA 1TQDA 4M0MA 2RHJA 3AF4A 1BJTA 1KI6B 2IYAA 2NPOA 2R25B 1XCJA 4LSWA 2F43A 1GHTA 2X1VA 2DU8A 3L07A 3ND7A 2ZBGA 1X87A 2HSGA 1YI2B 2JCSA 5D5QA 1YGYA 3T1TA 4ZDIA 2H3HA 3EQ8A 3UJ7A 1UQRA 2PWAA 5F3DA 1K68A 2I2AA 1W2GA 2XWJI 2YDXA 3OOHA 1P3JA 4RQUA 4Y1GA 4QU5A 2XMGA 4DNPA 1PFYA 3PF8A 5K0TA 2AFHE 3GEEA 4DN6A 3AM1A 1NW7A 3ST7A 4WN9B 4EJSA 3RBVA 1G9XA 4QYSA 2J30A 3I8XA 2W11A 3L4SO 4YCJA 2JZOA 2QDXA 2NXNA 2A9VA 3I04M 1YZHA 3LHIA 4Z4QA 2FFHA 3FLMA 5KSWB 2WTNA 1DKUA 3BHIA 1FTSA 1E6UA 1XN4A 2Q28A 4KUHA 3ZDXB 1LSSA 3WNZA 5H81A 1QGDA 2DFTA 4OLJA 4PLWA 4ZAYA 2CNOA 4YAOA 4L50A 1L5HA 2W70A 4RTNA 1C50A 1J24A 3QYJA 4JVSB 3LDGA 4A2QA 2BT4A 5KU7A 2W9XA 4XSHA 2FXIA 4GKJB 1XPJA 2CHFA 3HDVA 1GPWB 5F52A 4QUHA 1ETHA 1YITB 1P4HA 3KXLA 1KAOA 4AKIA 2BF4A 8AT1A 3K35A 1A97A 4Y3UA 2RGRA 2D3NA 3MD9A 5CCDA 4C21A 1ZICA 5G0SA 1SELA 4UMFA 4RS4A 4JNCA 4A0SA 4B45A 4EFMA 4Y6RA 1KZ6A 3CX6A 4E09A 4OXRA 3TS1A 3ASTA 1SEPA 3SQMA 5TC4A 2BL4A 2DFVA 5KWVA 2JRCA 1FRFS 1R15A 1BU5A 3C2QA 1QMGA 3ODGA 5LDDC 4DEVA 1JXOA 2VT7A 4LZAA 3GJZA 3VTZA 4AM8A 1UD3A 1SB8A 1WXIA 4C4AA 3G8CA 4CIYA 4AZ3B 1EGQA 2QZPA 5A5DA 2IBSA 3LK6A 3NNSA 3AM5A 2VJKA 2PWZA 1MOPA 4JVMA 4N3AA 3UHJA 2FCRA 2VG8A 3H0EA 4U39A 5KYGA 3KQVA 1U99A 1Y34E 4WY5A 4ZVRA 3G71B 4ZQCB 1DG1G 1YQDA 2AFRA 3H2GA 2O59A 2I55A 2VBVA 1KYXA 5FI0B 4Q0MA 4BKQA 2B7CA 3H3FA 3S8EA 1LRLA 4N49A 4CM4A 2QMYA 3OFNA 4HUQA 4N3BA 3T9BA 5TR9A 3W5BA 2ZSDA 1GSOA 1S6YA 1ZA2A 2C0PA 4HV4A 3E20A 3R7WB 4W7HA 3E9YA 3HJNA 4P3XA 5TS3A 3TZLA 3V1TC 1PFGA 3QM1A 1EP3B 5IMBA 5CX1B 3N5KA 1NVVR 2OHIA 3R3HA 2ZREA 4YROA 1ZI9A 4RUKA 3ZCQA 2JAOA 3HBJA 4DJEC 5EYPA 5I48A 1UK8A 1AGPA 1PWYE 2OV2A 2I1VB 3D8UA 1FQJA 3BRSA 1SD5A 1J7KA 1DI0A 1WM1A 3CKKA 3DBRA 4B2IA 3FVTA 3GSIA 1GSHA 1K6EA 4OREX 2DVMA 2J5KA 2OD2A 3LVFO 4BMZA 2V6FA 1IULA 4OLFA 2B98A 4BLOA 2A84A 2FZVA 4QKQA 2IVZA 3FHLA 4HHEA 2O8EA 1ZVQA 4DZRA 5A2GA 2F1OA 4NTZA 3S1LA 3OW2B 1P91A 4XWKA 3V1KA 1KS9A 4PYLA 1MTZA 2VEDA 4IIGA 1MJ5A 4RMIA 4GLFA 1COZA 3WLRA 1R8QA 2DERA 4INJA 1FJGB 3A04A 4HVCA 1FB5A 3VKFA 5DM1A 3RSQA 2AHOA 1UC9A 4QD3A 2QUJA 1TGYA 2X15A 4YRAA 5EHIA 9GPBA 1XHFA 3F8TA 1N2HA 4LTMA 2H07A 3P96A 3W8NA 2GVZC 3DV0B 3U1BA 4YUWA 2XUZA 3RPEA 1U0HC 4PNHA 3JU3A 2VJAA 1UOOA 3EOAI 3K05A 4RGQA 3TO5A 5JEDA 1GTVA 1XELA 4GR4A 3EULA 5LLSA 3UMBA 5JXWA 5KQLA 2VNKA 2XVXA 4EGAA 4IHQA 1K2WA 4A2CA 2P65A 4L5AA 2WQZA 4LPKA 1L8LA 3MFQA 1M2JA 1Z6YA 3WI7A 1V16B 2OLJA 4V0MA 1TUGA 5GONA 2XSZA 3WMRA 2MIIA 3H2ZA 5FBHA 4YPVA 5JZMA 2Q1YA 4RPCA 3DH0A 3VR5A 2O1WA 2QKYA 1Z73A 2DJ5A 2NSDA 3KTOA 3GRAA 4HUQB 3OZRA 5CK4A 2LCQA 2IC5A 3Q6NA 5EINA 3LL7A 4D3XA 4BO1A 4CKEB 4CLOB 5B5SA 2G8NA 2P0AA 2YS6A 1GO2A 5ALTA 1L7NA 1UIMA 2F3SA 4FCWA 4GKVA 4HB0A 4K9OA 2XYHA 4W5WA 5CX1A 5J5AA 4XYLA 4V1CI 4JL8A 3LUHA 3B78A 1AQ6A 2IGTA 1JQJC 4IDDA 3OP1A 2D2EA 3BXGA 4Z2YA 1OB5A 2FJUA 5KCZA 4ME6A 4O2AB 2PL9A 4IHJF 1MO5A 1HK7A 1GPKA 4IVNA 3D7KA 2P5UA 3EZYA 4QJBA 1QU3A 4X6XA 3LC0A 1OXMA 1S8OA 4QUJA 3W05A 4CUZA 1TAGA 3U62A 5AUOB 4CMIB 4JITA 5AW2A 1U2TA 2BUAA 4EW1A 3EXEA 1ULSA 1MJNA 3A7EA 1KXJA 3L02A 1MB0A 2AV6A 2PSJA 3V4OA 2CMFA 2C3PA 4E2WA 2PY6A 4ND3A 1OJLA 2Q1TA 5BR4A 1EH5A 4K0KB 5M3BA 5EAIA 4TX1A 1P72A 3NP7A 5A71A 4IDEA 4ILEA 4RX1A 2C96A 3NV9A 4DR2B 2Q9CA 1IUOA 4EY3A 1E7YA 5BSUA 3CN9A 2QENA 3OWXA 3ZXIA 3H99A 5AXCA 5FV4A 5IZCC 3QKRB 4B6GA 2PRIA 1FNBA 1AA9A 3C16C 4S24A 4U5XA 3WQHA 5ITSA 1D2EA 1TCUA 1KVTA 3CZ9A 3PUXA 4XL9A 1LZLA 3EYAA 1OLXA 2JC3A 3L0CA 4RADA 1EDEA 3DL4A 4IH1A 4CV0A 1DV1A 3M2PA 2WJHA 4R1UA 4UJ5A 4WPGA 3IAHA 5EKTA 3U3ZA 2OV4A 2Y76A 1V8BA 2OESA 4ISBA 5BR1A 5J43A 5ALSA 4PIMA 5KTTA 5ES4B 1QFSA 4AYWA 4AXXA 1GNLA 2C92A 1VSVA 3IUYA 3C8UA 3PUNA 3P4YA 3DAYA 3WWOA 1FSPA 1RBYA 3BTVA 3SPXA 1ZBQA 3PFKA 5DI3B 3IVXA 3SNHA 1EVJA 5JNUA 5F4MA 1SZDA 1Z2DA 1C3JA 3D8HA 1TM1E 5FOWA 4C5AA 3THXB 1FX0A 3DQPA 2ZTVA 2JAUA 4BIMA 5EIWA 2QAGB 2AG8A 3E9CA 1BEZA 2ORYA 2WJJA 1ODIA 2DFDA 3CF6R 2W90A 3K8ZA 2PS0A 3ISXA 5DISB 1L7MA 2KBFA 1KOLA 3LQ6A 3DW3X 1F7UA 1UPUA 4I08A 3VO8A 5GOTA 2ZI9A 1T8TA 4XI9A 4KUGA 4BXOA 3IFSA 3JQQA 1M5TA 2NTJA 3B6MA 1IDN1 3O82A 4JLWA 1ZM9A 2Q7DA 2YN2A 4ZICA 4LNUB 1YB1A 1L5OA 5CNKA 5F77A 1RRCA 1ZSYA 3VKHA 1BFUA 1OZGA 4QATA 2QR3A 3AEYA 3BB1A 4C7OB 3TBFA 4E46A 3ZG6A 3EPHA 3Q85A 3SMVA 2RI6A 4WLEA 4RKYA 5ICGA 2VNIA 1BHO1 2X4DA 4N0MA 3X2SA 2XB6A 4ZYWA 5L40A 2C2WA 3K9NA 4MRSA 4U6SA 2HIAA 1J8DA 3CM0A 2X1HA 3UV7A 3H3XA 4EARA 3DO5A 4YBRA 1DARA 3JD1A 5JSZB 3ZCXA 5I4BA 4OLAA 3ZW8A 3E8XA 3QV2A 4X7DA 3KZXA 1D0SA 1X7DA 2B6NA 2F59A 1N0HA 4X97A 3RKUA 2GTIA 2O2CA 3JQEA 4WESA 1TAUA 3RFXA 3T7KA 3KDAA 1OXBB 1DG3A 3TBHA 1E6WA 1HG0A 3KVRA 4LDQA 4PEVA 3BWBA 1XCMA 2IPAB 4Z4UA 1JHDA 4M9ZA 5KVAA 1PQYA 1YDMA 3UF0A 2VTBA 4LRUA 5ES3A 2HREA 4JJ8A 3FPKA 4IXWA 5JDIA 2ISSD 1AGNA 2GEBA 2DQ4A 3I4CA 3BRWD 1DOZA 5DH9A 5D5PA 5IM4F 3B9QA 2A2ZA 3G7UA 5DYWA 3ZCRA 1SUCA 4XUCA 3L4BC 5A4JA 1MX3A 4Z4HA 3MB5A 2AMVA 3H6HA 1W9HA 4L4XA 4TRNA 1PT8A 3AFGA 4G97A 4WKPA 4F11A 4L0DA 3OMLA 3P2EA 3NLLA 5CPFA 1G7CA 2C2OA 3SYLA 4Y2TA 5CM9C 4P86A 3GAFA 4ZCLA 4XJTA 2V55B 1PK9A 2QAGA 2IS6A 3I1FA 1I5OA 2E6UX 2WVAA 3W6PA 4Y2SA 4JYBA 5B1IA 3T7AA 3GLIE 1XLUA 1LS1A 3B1ZA 4FBLA 8ADHA 4D98A 4M0LA 3CP2A 3T1NA 4CV2A 1E2QA 3N7UA 1PEDA 5G0TA 4MI9A 5LDGA 2QXTA 3M6XA 3BJRA 3OLQA 4CFSA 2I8LA 3ILHA 4FHGA 5K05A 5AJTA 2R9VA 2QLLA 4YQFA 4QVAA 5JMTA 4U7JA 2VYFA 4R9NA 5ER6A 3RFTA 4NOJA 3O4VA 4HQNA 2C4NA 1L5SA 1WDLA 4JJEA 1OH7A 1TM5E 2QLJA 1Z0KA 3JQRA 4Z4YA 1Y80A 2D8AA 3EVCA 3FRHA 4HQ0A 2ZR8A 3UJ9A 1M6HA 4C7OA 1X1QA 4JYCA 4LX0A 3SBXA 1Z33A 2DMRA 5F7XA 4X65B 2ZXUA 3I5YA 1X1TA 4FEAA 4KXVA 2D1SA 2QXUA 4BMNA 4ZOAA 3TSOA 3SJUA 5LZ7A 2G67A 4ZAVA 3TLYA 1C1HA 1VQKB 1UC4B 3GGOA 4P12A 1WDWB 3LT4A 4K9RA 1W29A 1KC1A 4L07A 4WNIA 2Z4RA 5EZYF 3TQQA 5CFNA 4LHYA 4XUGB 2RK6A 2I2WA 3FNQA 1YDEA 5LIRA 2QX8A 1ZLYA 3MJTA 5HM8A 3PUZA 4HRXA 4LYJA 1FMFA 2R8PA 2ZU6A 4IP0A 4EENA 2OSBA 2VPPA 1M34B 4LSMA 4MMYB 4WFKA 3EIWA 5IJAA 3R74A 1WG8A 5KPDA 3WDKA 3ZNPA 5DOVA 4BX3A 4G0YA 4WECA 3ZIDA 2XE4A 1GP2A 3I3OA 4ACAA 1DEXA 1HDEA 2HCFA 2C99A 4LC1A 4LECA 3HCCA 1KJ9A 3AHDA 3MK31 4YRGA 3KE9A 2QUZA 2E89A 2ZYTX 2VHVA 4P36A 1SBCA 5C53B 1FNCA 3ESQA 1HUQA 4RY0A 2ID9A 1JBKA 5HS6A 2FH5B 1DQZA 5JANA 1W36C 4HE5A 1I3MA 3DKKA 4MQUA 2XJ9A 2VSXA 3RR2A 5D86A 4LJ9A 2FMTA 1E2MA 1VE7A 1WY7A 4EI9A 4GVLA 4Q39A 5EFZA 4UFNA 4YYEA 4AULA 4RJJA 3KLOA 3FCOA 1ILEA 1X39A 2GLXA 2G0TA 1SU7A 3CKYA 4OTZA 1KWKA 1BCSB 1QH1A 3KXIA 4BUZA 1EAYA 1RM3A 4GR5A 5F1YA 1P17A 3H2JA 3OQPA 1Y42X 3I1JA 2V5AA 2WNIA 5CA0F 4EJ2A 2GN6A 4NQZA 1IIBA 3H2HA 2PDAA 4FVTA 3VMMA 1LBQA 1T5OA 5EP1A 1UZNA 1U3WA 3HFSA 4IEEA 2Z5FA 2HGSA 1R27A 3C3JA 3P2OA 1WF3A 1GUDA 1EGMB 1OWMA 1SUPA 1E60A 3E22B 2OQVA 4DLKA 2HSZA 1LI7A 3EVZA 2Q49A 3G3EA 4DSAA 5BV0A 1M75A 3QGMA 4EB3A 3HA2A 3B7WA 1LPNA 4WGGA 3ORHA 4LFAB 1QP0A 3C3DA 2E5WA 1G5IA 4B6FA 4GUDA 1Z82A 1SCDA 1LDNA 4LG1A 1KP9A 3DEIA 4EJSC 4BMOB 4D02A 3MAGA 1WLYA 1OPRA 2V8BA 4WLOA 1LVGA 4Q9JA 4P6YA 5AKKA 1RWXA 2DEUA 4LBWA 3D4BA 1W46A 4QYTA 1Q3KA 5I45A 3AEQB 3C43A 3O3CA 4GGPA 1SQ0A 5LQDA 2FMUA 2P3LA 2DOGA 1M2FA 1D7AA 1ENOA 1NVTA 5LB2A 2FG7C 3HDYA 3WQZA 4FDLA 1SXJB 2O0MA 1TOAA 4ETNA 1NI4A 3NVKI 4A91A 1H0RA 3C1TA 3PE3A 2V7WA 5JMPA 3H1AA 5FUWA 2Q5OA 4KRYA 5BQPA 1D4FA 2ZI6A 1PR0A 2C7QA 3A10A 3LHKA 4GKBA 2RB5A 4WFIA 2DR2A 2A0WA 3U3RA 1I33A 1JXQA 2HMVA 1Z3IX 3LCCA 3ZV5A 3K6RA 3AZPA 4OHRA 3BUSA 1E77A 1F2VA 2HFJA 4BWYA 4N0PA 1RYEA 1T3ZA 4W1SA 5FRDA 3PXAA 5J4VA 4Z4GA 3IDOA 2OENG 3QBDA 2RDMA 2J09A 2VWPA 4OHFA 2W2LA 4M8KA 2XYGA 4YMWA 3IDQA 3M34A 4DBZA 4HWKA 4IQ0A 5JAPA 4KE6A 3UA3A 3LYUA 4DRYA 1Q1EA 1AQLA 3SYRA 1VQOB 2PEZA 1YJAA 2O5VA 3HDJA 4KRFA 3CUYA 3HBMA 2HPVA 3DAFA 3OIFA 5DCWA 4Q7LA 3PC8A 1HMYA 1CF9A 2QN6A 2FZWA 2QU8A 4MVJF 1E1RA 3HI6A 1JL3A 1UXKA 2HA6A 1CW2B 3CZMA 4C6SA 4OJKA 4E5NA 2NVWA 5K9ZA 1QZ3A 1KI4A 3D0RA 5KQPA 1XTIA 4N9WA 2WB4A 4BRUA 2ZQ5A 5EG5A 4HXYA 1JFSA 5DGTA 5IUKC 3DEJA 1NUHA 4FOLA 3MYYA 1PKXA 2AG5A 2LXNA 2ZUUA 1G3MA 3H9QA 5EIBC 3UAZA 1K9VF 3VUFA 4QJ5A 3WIUA 2IXBA 4FFNA 4CVNA 5DEIA 4RTLA 3RRJA 4P3YA 2R11A 3HPQA 3E84A 4BP9A 1G21E 4ZQHA 1KEEA 1QE3A 2H4ZA 1QSGA 4ACBA 3AETB 1T9GR 3IQEA 4I9FA 3KJGA 3B3JA 3ZHUA 5IXSA 1M73E 1DIRA 1N8NA 4I81A 1CVIA 3PQ8A 4E0BA 3DLCA 5LP1A 1DQYA 2REQB 3QLVA 3LY5A 4FWIB 4OHBA 5DHRA 3GJ3A 1NRJB 2VF4X 4KN8A 4MWOA 3P5SA 4XXHA 1JMVA 1XC7A 2CNNA 1JB1A 2E87A 4XN3A 1WKVA 3COSA 2ZR7A 3HVHA 5JS8A 1Z34A 2G1UA 4K28A 2WZDA 5AI9A 1B76A 1V0JA 2GBFA 2EAUA 5C8ZA 3V32A 5B1HA 3EPPA 2JFHA 3ESZA 3CC7B 1EX9A 3R6GA 5CD9A 1JU9A 3WDLA 2X9GA 2B69A 2ON6A 3OZVA 1ZCJA 1OLSA 2EGHA 2IYLD 4NENB 5FWXA 1C3XA 3QFSA 1X1RA 2IOFA 3ENQA 1WTHD 3B5IA 3C85A 2UYOA 1P77A 4CIXA 4X62B 5DZSA 1DUIA 3O4HA 4H17A 3ADDA 1KJQA 2P6NA 2AR0A 1QB7A 1FLNA 2GTHA 4AIIA 4BV3A 1QH8B 1FW8A 3ND5A 5BO5A 3PNBA 4Q4JB 2Z8YM 1EUQA 1EWTA 3BXZA 1V9CA 1EZ4A 1SIOA 3ROQA 1ZGGA 1X3LA 4JP8A 4ESEA 3GFSA 1ZJ5A 4RULA 1QANA 1C1DB 2ZAYA 3COVA 4MYRA 3KKZA 2ADOA 2WY2D 5LL6P 3G2PA 1YCDA 5BSYA 5A9TA 1J90A 1PJ4A 4ON9A 2GHRA 2DWCA 1P2GA 3CISA 4BZQA 4E15A 3BQNB 4ENVA 3ZR4B 1M2HA 1QHFA 2Y1XA 3KFLA 5A4MS 4XIFA 3LY9A 3AFNA 2C0QA 3KC2A 4G8JA 4Q9LA 1K86A 1VPEA 1F4LA 4B7AA 5ISMA 3WHKA 2C7GA 5G2OA 3KR0A 2VQFB 3OJEA 4GQBA 4KX3A 2VDWB 1FP6A 2GF0A 4RA6B 2VF2A 3TGPA 3UPUA 5HJ2A 1WY5A 3VNSA 3HRIA 3M1IA 4X8IA 4O4LF 1DC3A 2J0EA 3U31A 5G1NA 1U5AA 1A8HA 1PDVA 1YXMA 2CXUA 1CJTC 3E7DA 2H8GA 2XH8A 3BL8A 4H16A 4X60A 1KVSA 1ONBA 2I99A 3TKYA 1UM8A 1EM8B 4HXFB 4OH1A 3N2GB 4H4EA 4WBNA 4OH7A 2D3LA 4YCAA 1E3DA 3CE6A 3UAVA 5A0TA 1G60A 2WI8A 5B12A 1EXNA 5C5IA 3NPMA 4EKIA 5CG1A 3ICEA 4ZCIA 2ERYA 4R9UC 2B5VA 3U80A 3N0VA 1MZPA 5DJ5A 4YT8A 2C9CA 4GI1A 3HI4A 4LWZA 4QNMA 2ZTSA 3BMXA 3EAGA 4KQEA 2CE2X 2PX8A 1XJ0A 5JD6A 1FFHA 5FXMA 4KFRA 2PTHA 3WGVA 2FEAA 2IPLA 3TGWA 3EY9A 2CCGA 1EUCB 1FU7A 3T3OA 1NQOA 2GWHA 3P9NA 2UYQA 3OQMA 4IFEA 3ZVLA 1ACJA 1YVRA 4Q4JA 1NBMA 3HEMA 2PZFA 1AC5A 2DPLA 2Y1KA 4UUBA 4AK9A 4DDKA 5CVTA 3EPJA 4E22A 3W8FA 2B8WA 2CVZA 3FWHA 5C3MA 2W42A 3CC8A 2IUEA 3E7FA 1XFOA 3H86A 1PS0A 1Y4UA 1XLTA 3OE1A 2CF5A 4M7PA 3CRQA 1NF9A 3CESA 3C6QA 3LUBA 2G40A 5LXTA 1S9DA 1DLJA 3PR3A 4N3GA 4GGOA 3TG8A 2UUBB 2SBTA 4MGHA 1GZ6A 1B8OA 1U4OA 1CUFA 5EIOA 1Z26A 3BSWA 1LLUA 2PMWB 4LMPA 3HXOA 3A3BA 3ZQJA 3AUYA 3INRA 4Q7MB 3WBJA 4B48A 4RDIA 3WV4A 1DBQA 3T5BA 4MR8B 3CRRA 5WRFA 3OZBA 5C0OE 2CMHA 4FEGA 5F4ZA 2ZDQA 4FCCA 3Q38A 4K46A 3EXFA 1W4BA 2C29D 4UU1A 1JG3A 1M0TA 5DSXA 2W8ZA 4K6HA 1ZSVA 2FMIA 2P6UA 2GI4A 3ND6A 2PMFA 3BWVA 1L5ZA 3WGGA 3ORFA 1O95D 3M70A 1U7UA 1M6EX 1HOXA 1K08A 2IYSA 2P9TA 3F46A 5BSGA 5JJ5A 1GPAA 2EX1A 2BUBA 3LNNA 3C8DA 3X1WA 4KODA 4A1OA 4ALNA 1N7JA 3GARA 2DF8A 1BA3A 2ECKA 2X2FA 4J90A 4WCFA 4ANFA 1PL0A 3V8BA 1GKKA 3ZDQA 3ESXA 1LRKA 2YXLA 3L93A 4RM0A 1PL6A 2ONYA 3KQUA 3U4QA 2I7VA 4HAZA 4NICA 5JMWA 2A5GA 2VJQA 1YWGO 5DP2A 4CXMA 1K27A 5EZQA 2ZZKA 4QGSA 2IYYA 2XT6A 1SFRA 3WL5A 4OI4A 2FY8A 2PO7A 2KI5A 3QX3A 2NO5A 3FPEA 5JI2E 3PUKA 2ZE8A 5DHFA 4DAOA 1MH1A 2HLHA 2PPVA 5B1SA 3NYRA 4DLYA 3LQ2A 2AZ4A 3GB9A 1V8OA 2PGAA 2QD4A 2A9OA 4I1VA 2I3ZA 3TNDA 1ZJWA 1NG9A 3RG2A 5ECDA 1L3CA 1WVGA 1VPLA 2VJBA 5DX8A 4DUGA 2FPRA 3OO0A 1VCOA 2HT6A 2BFMA 4Q66C 4UCXA 1U0LA 2RK3A 1DAIA 2XZOA 2QBYA 1KJYA 1G4AE 2ZUEA 4YJGB 1IY8A 4MS4A 4YAIA 4U7HA 2FEKA 3FYCA 2RHHA 2HDWA 3IP8A 1ETUA 3PD7A 4FSDA 5CB4F 2IBTA 2AEEA 4PHCA 1SKYE 2UYCA 3FF1A 2H5EA 3WBKA 3D6UA 3I2HA 4F6RA 1Z5VA 3C7TA 5HIAA 2JI7A 1N6RA 3DZIA 4L8FA 3LUKA 4BLQA 2WK1A 2QVXX 3BH6A 1U11A 4WKCA 4MWEA 2J9XB 2G72A 2IL1A 2XTMA 2HJWA 4RK6A 4C43A 1S2IA 3EQZA 3K1AA 1J56A 4MR8A 3VPGA 3WAKA 2Q0XA 1U8YA 1YR3A 1KQSB 1L2TA 1D09A 2XUAA 4Q7KA 2O2ZA 1GU0A 4I7EA 3CB2A 4D4JA 3RUEA 4CF7A 4F9TA 4L5YA 4QPCA 1Z88A 4UJ3A 4OB7A 3RU2A 4YCSA 1BWSA 5J35A 3VBEA 3TZBA 1N2GA 1KPIA 3WNVA 1BDMA 1VKRA 1WO8A 2GK3A 1N5OX 3AF0A 3HABA 4KAXA 3L05A 5SICE 1P1FA 2Y6VA 3NKVA 4BWVA 4EMUA 1QM5A 3PA6A 2ZANA 2AJLI 4QPNA 3HR4A 2Z6QA 4L0MA 2O0KA 5CA0B 3ENKA 4BBAA 3OT4A 2CBXA 3MS4A 4CQNA 1T9BA 2PFKA 2A5FA 3UYKA 3LCVB 1KS2A 3AL2A 4TTJA 4AW9A 1RC1A 4HNAA 3EBOA 3GDFA 3IA7A 1F4PA 4JR2A 4H2DA 2HSDA 3KT8A 4TROA 2WE7A 3WJ1A 4A23A 3A8JA 5I4IA 2PMDA 4DRZA 3EZGA 1CUSA 2IEZA 4PG8A 4P31A 5A4FS 2B1QA 3H2IA 1BS1A 4Z7JA 3I39X 3UT5B 3KRTA 1PR6A 3LUFA 5DN9A 3UEOA 1L8QA 3SJZA 3CR8A 4PLTA 4TKVA 4JH0A 2OYRA 1LW6E 4RD4A 4FNOA 3S40A 1FS6A 2VHQA 3DV9A 4BNGA 3IVCA 5CFPA 2IIPA 2ZTHA 2FX2A 4L8YA 4BO4A 3BIOA 4YJDA 1OTXA 2HF7A 5IFKA 1KPHA 3KO8A 3P0IA 2GH1A 1ZK0A 2PZBA 4R8LA 4X6LA 3EUAA 2YXNA 4BAZA 4MS4B 2GJ8A 5IJ0A 1NBAA 2B2XA 4P32A 2I6FA 1QLWA 3LNCA 3GLIB 4IWNA 1K2VN 4LWPA 3E82A 5EWMB 3DR5A 4NHOA 4KWIA 4BNNA 4PCUA 3W7AA 1YJBA 1GTJ1 1GDTA 4JQZA 5IEJA 3ZGZA 3W4IA 5AW4A 1C3EA 2NSYA 2I4TA 2JAXA 3QVOA 2DGDA 4Z0TA 1U9JA 1AHHA 1LJ8A 1IOVA 2OHXA 3WP0A 4EYQA 1POXA 4WNAB 4JCOA 4TYWA 1FXUA 1RFLA 4CM5A 1IUKA 2FUG6 3JWHA 4N5HX 1VXOA 3DNPA 3M4YA 2AI3A 4D74A 2QUHA 1U98A 2SCUA 1DO2A 1RZVA 1YHZA 3ICCA 3LFTA 4YPFA 4A0FA 2CC2A 4DA8A 1ZEJA 4KE8A 4WX2B 4Z0HO 4BKOA 2DQYA 2P91A 4Q3NA 4MCHA 3W4KA 5J1SB 3V42A 2Q0SA 1NU6A 1LPBB 1U3GA 1NE2A 4TV8F 4E2ZA 2GPYA 4K9MA 2CL6X 4S1TA 3CVYA 4M49A 3IEXA 4PSDA 1SVSA 1E7MA 2JGDB 4WA7A 1PFQA 1HT0A 4XR4A 5FCDA 2MCFA 2OQRA 1ZIDA 4DW8A 4MUJA 4QEDA 1PT5A 2OAGA 1JYEA 2GVDC 2QR2A 1TJ4A 2PSSA 3CLRD 4EB8A 2PX4A 3E0XA 4ZYTA 1B4DA 4XDYA 3Q7QA 1WPGA 4C04A 1R0KA 2RAFA 1YO6A 3ROKA 4A26A 3AYXB 3P0JA 3OSUA 2IUYA 3IAM1 3SEQA 1BMFD 5IT4A 3UFXB 2OD9A 4L7QA 1EBBA 3INYA 1HNNA 5FFNA 1J0XO 3D4NA 4E31A 2O6LA 4J0KA 1L1FA 4F93B 2CF4A 3MD0A 4Q1BA 5CVDA 4JI0B 1E7SA 3R0XA 2CD9A 4I4TA 1KR2A 3IT1A 4AMBA 1Y8ZA 4GZ3A 4WJKB 2P4SA 3IOMA 2EFHB 3AEKA 5GADl 3MN1A 1C29B 2F4NA 1E5VA 2P9QA 3PR1A 4LXGA 3ZWNA 2B9VA 3C8MA 1EINA 3TIIA 3AM3A 3ASQA 2GA8A 5IWCA 2DCUA 1PU2A 4YRIA 8ATCA 3JX9A 3KXDA 4ENPA 2DE0X 2V31A 5LMZA 5LMCA 1OA1A 5LWQA 4KN9S 1UDRA 1DB3A 1FYDA 5BQXA 2FWIA 2R0QC 4P4SA 5FV7A 1WDKA 3DWGA 2PKXA 3PA8A 5FPQA 3DZCA 4X84A 4WGFA 2HSEA 4KWHA 4RHCA 4KGVA 3FGNA 3LYHA 1WVMA 2DHRA 4KR9A 3L7KA 4TLDA 3UENA 4AJEA 1E7QA 1E43A 4QYIB 1JEOA 4M8NE 1OYVA 4WUTA 5KDLA 1J21A 2R1VB 2RH4A 4BB9A 2GZ3A 4QQ8A 1A9SA 2B78A 2VS1A 4B76A 1R6BX 3BJZA 3WMEA 3A11A 2SCUB 4ARZA 2XF8A 4HGYA 1OBFO 4YONB 3M5DA 4FWTA 5KYYA 2R8RA 2F9LA 1TM7E 2IU6A 5CTJA 3DBHA 3DVQX 2Q3DA 1UXIA 4NPHA 2AXQA 7REQB 3TTUA 4MS3A 3RVMA 5MGBA 3F7TA 3HJRA 4EUKA 4HDRB 1WW8A 1YA8A 4P53A 5DTEA 3RD5A 1W5TA 3M5WA 3BXEA 3M1LA 3MS7A 4YIHA 2VI5A 5ALDA 3MTGA 3HNRA 1SC1A 3JRNA 1PGPA 2VNHA 1TZJA 2EKDA 4IAOA 4MPPA 4CCYA 2PGJA 4FMPA 4URFA 3T56B 1YZUA 5CA1A 1LPPA 1JDBC 1E2FA 4DJTA 5BSEA 4MUFA 2ODEA 3RS5A 5CITA 4B6QA 3EWAA 2CZQA 1PJ2A 2BWJA 1W0KA 2VP4A 1GZ7A 2P6PA 3CMCO 3F98A 4YEDA 2IHVA 3FGZA 4MHOA 2P68A 4IF4A 2KQUA 5JXGA 1QNFA 3K0FB 2HMTA 3RG8A 1WWKA 3HLKA 3AOGA 3PUYA 1OFHA 4WSOA 5JXJA 2EHJA 5J2UB 1Q50A 2YWJA 1OB0A 1OV6A 1RFGE 2H54A 5J4KA 4Q3BA 1OGYA 4N82A 1KP3A 1L3BA 5J5CA 3R7LA 1D6SA 4YPOA 1A8UA 1TO2E 3PPYA 3D43A 3QNMA 5IP5A 4L7VA 2GCOA 1I6LA 4RMJA 5TVGA 3MTEA 3F6PA 5A5FA 1BMQA 1XZLA 1W19A 1ZLXA 3RCBA 3GLQA 1MO3A 3QOFA 4MW2A 2JK0A 4KUEA 3WL8A 4OHKA 4EA8A 3ZV3A 3CT4A 3WHLA 5K51A 1JS1X 1YUMA 3TLBA 4A3SA 2KSQA 4IIEA 1T2FA 5CLQA 2ZU0C 1QRAA 2O6HA 4OYLA 2YWFA 2VR1A 4LQDA 4BECA 9LDBA 4R8SA 5H3HA 3DZ8A 4ARBA 3SOPA 2IY7A 4D80A 1Y7TA 4XM2A 1N0VC 3OTQA 1ZINA 2VXBA 3ZJTA 2QU7A 1RTTA 3HWWA 2Q3BA 2XY4A 5I5EA 4NCIA 2BLNA 4OOSA 1JVSA 1Q3HA 3ANSA 3OICA 2IFTA 2QSUA 1Y5RA 4F2DA 4XVRA 2I54A 4FDTA 1TXGA 2O8CB 5IKEA 4FJ0A 1KK3A 4P7BA 3MB8A 4IGIA 4QFBA 1W0JD 3RJ5A 3UWOA 4M0FA 4FW9A 4XKVA 1HI9A 3A4NA 4IMRA 1QOQB 5DW0A 1U0RA 2O2JA 1AKMA 3F90A 5ICCA 2MR6A 1XJQA 3OJFA 4ZGGA 3D4IA 3LXUX 5IKMA 3MT7A 1IXYA 1SUDA 1Q11A 5F2OA 3KU1A 3MRSA 1PZHA 1XVIA 5CA1F 5C52B 5KJCA 2RAPA 3K2EA 2NVBA 3BGIA 5F7ZA 3RC7A 3RTEA 2R8YA 4M1ZA 3WK7A 2CBZA 2C88A 2YYSA 4HGZA 5IZCA 2YV5A 1VMAA 4JGGA 1NONA 1NUUA 5JBIA 5C7LO 4CM3A 3I52A 2O7QA 3UWDA 2I1LA 1GNPA 3NHKA 5J2UA 5DWQA 2HU2A 1JGTA 1PGJA 2XOEA 3F7MA 2BPOA 1C0LA 2WSYB 2PLAA 5E7QA 4E2XA 1M2KA 4ZCMA 2C8LA 2HF2A 4ERNA 1TM4E 3GGCA 3K5IA 4I0WB 1ISGA 1QX3A 3L9WA 1U28C 3SLGA 3UOAB 1W9XA 4FFOA 1AIPA 1WW3A 2RHOA 2BFAA 2WAMA 4N5IX 4ZCPA 1R9NA 4JJ7A 5AVYA 3X43A 2WWYA 2XDYA 4RVDA 3VHRA 4G1FA 1FUKA 4LXTA 3E3AA 1PZNA 4G26A 8LDHA 1L8XA 1QFXA 4H08A 2YIDA 1ID8A 3PGLA 5K8CA 1L7BA 1VQ5B 1QGED 4DTIA 1QGYA 3AXTA 5E4YA 4ABTA 2BGGA 3D2CA 4F2GA 5J1TB 2OC4A 4KGDA 3GLSA 4FMDB 3UGQA 3IP7A 4CFYA 1XNGA 4Q1FA 1BRMA 2B3DA 3LUGA 3MQ4A 4F92B 4Z9BA 3KJFA 4BU0A 3LWBA 3FKSD 5IJ9A 2GFHA 3P9QA 4HPXB 1E62A 2QZSA 1L5LA 3ESRA 5FTKA 4F2WA 1JLLB 5FEUA 3BHJA 1VQNB 1HL3A 4D3DA 1YIDA 1NYQA 3V4RA 3RFVA 1KSFX 3OPQA 3V34A 1U9CA 4OHVA 3RVDA 4JIMA 2A9JA 4BNVA 2PH3A 2YRWA 4Q12A 4WLFA 4P1ZA 5DWDA 1ORIA 4W5OA 3LTNC 1JRLA 4DMLA 1RYNA 5LNK1 2P40A 1EK5A 5I7HA 4MICA 3KEQA 2X4LA 3C3BA 1EQ2A 5CB4B 3THWB 4X54A 4X7EA 2CXPA 2IYPA 3R5FA 2FPGA 1JPUA 1RAFA 1A5BB 3WOHA 5D3MA 4YWJA 5BXQC 3ZHTA 3A1DA 1NR5A 1DKLA 5KWSA 3ABOB 4IM7A 2QM7A 3LHFA 4KK3A 3OM0A 3SC2B 4IUDS 3W7BA 4QLAA 4RABA 4OI1A 2O8BB 4MROA 2ATXA 2IZ1A 4RQTA 1W47A 5EMMA 3VKUA 1T15A 4Z4RA 3U37A 5JAOA 3A6FA 3B3QA 4RIIA 4WK4B 3AJ8A 3H9BA 5HP4A 3WQSB 1VQMB 3BYZA 3OX2A 1V8DA 4OCZA 4Y2VA 5A4IS 1U0OC 3E1SA 2C4WA 3UB3A 3P5BA 4UBJA 2XW6A 1JHAA 1TUEA 5FBLB 3CXCB 5NLLA 4JDUA 1A72A 1PUIA 4NZPA 3R5XA 5BSMA 1GZ3A 4ZRNA 2M6SA 4DIEA 4OQ4A 4J16A 1XZAA 2ZKLA 1X9HA 3AQIA 4G0VA 2XLBA 5EP4A 5TQ0B 4LJ4A 2V65A 4YJ3F 4YRBA 1W76A 3A8IA 1NN0A 4TL9A 5A6SB 2G4LA 3WJ2A 3OZDA 4PTYA 3GEMA 3MXTA 1PNQA 3TQRA 2AFHA 2FPPB 2H2FA 4DE5A 4P5DA 4P3PA 4OHOA 4DMFA 2JPDA 2XLCA 2NVUB 2OZVA 1ZUIA 4E5VA 4B4VA 4IZOA 1UKVY 5IJ9B 2X1MA 2XUOA 4HEA1 4NYMR 1E92A 2NQ2C 3HADA 1ZC4A 4AUMA 4EO7A 5FWAA 2M1XA 4OJQA 4L3WA 1LVHA 1GQYA 3W6OA 1RAAA 2R84A 1TCVA 4YT2A 1X2EA 1QGOA 4DG8A 3WYNA 3BZUA 1LC0A 3LM8A 4LYGA 3F73A 2VTKA 3RC8A 2V9ZA 3BC9A 1A9RA 2BKLA 1YASA 2ZP1A 4DK0A 1WULS 1XCOA 1USVA 2OCKA 5TXGA 4DR3B 1H05A 2FWRA 1MAVA 1CUAA 3HY4A 2FPGB 4ZTUB 1XCPA 1GKYA 2VJLA 3LCJA 1XU7A 3HS3A 4M8SA 4OJTA 5E95A 2OOKA 3T9EA 3NGMA 5BSHA 5GJWC 2QTAA 3EVAA 3T7IA 1NQUA 1ZR2A 5EE0A 1JTFA 1NM5A 2PS9A 4G37A 4F4CA 4YQZA 5BWNA 1NQWA 1BGVA 2OVFA 4CKBA 1EFHA 4UU8A 1Z8DA 4NF2A 3QXJA 4IJMA 2OM2A 4OJYA 2XYVA 2R8EA 1WNFA 2CL7X 5FULA 4I9NA 3HPRA 2BY4A 3I45A 2PS3A 1C81A 4FILA 3ER9A 4BWGA 3AT1A 4JUIA 2HJ9A 1VQ8B 1UAGA 1CIJA 2JS7A 3EEYA 3M83A 1DX9A 2XWBF 5E9WA 3W5UA 3TOSA 2LPMA 3NTRA 1B42A 4FZ3A 4J0HA 1BEUB 2HA0A 2VH1A 1GAXA 2FDRA 3TYXA 3AR4A 1X86B 5HIIA 4B3BA 1RBQA 1CY2A 4TS4A 2GRAA 3CF0A 4C4TA 3IILA 3GRUA 3L8MA 1HDRA 3UMSA 5LP6B 4HSGA 3GN1A 4ITRC 5M7EA 1OGIA 2WSIA 2VJMB 1C4OA 1L3IA 2ZXFA 4HDAA 4XDHA 3CLKA 3ITKA 5KU1A 4UZUA 1FPMA 4N7MA 3D8BA 4TSRA 3FWKA 4BLWA 1H2ZA 2IIVA 3ZU2A 4MKZA 1WZUA 3K9LA 2HCTA 3NOXA 1G21A 1XYYA 4BFXA 3WB2A 4OQLA 1MFZA 1DELA 3AKEA 3MTDA 4P54A 3ZTYA 5HUQA 3RRBA 2DIEA 3P7MA 3FUUA 5IYNA 4ZWNA 1GL7A 1KNXA 4OQDA 4E1VA 2R3SA 3FFBA 1M5UA 3L04A 4BV9A 3MWDA 1UDAA 2JFXA 2C7VA 4YRNA 1WBJB 3D9QX 3N70A 1OW3B 3ZQUA 3CLSC 2P1RA 4XOPA 1KQPA 1NJ1A 3BWDD 3CZCA 1P0PA 2M98A 4MK4A 3CIOA 2YBDA 3R3YA 1YJCA 2RBEA 4HN4B 4PG5A 4WINA 2XYQA 1B16A 5G4KB 3ZDEA 5KVVA 2JJQA 2QZJA 4B3XA 4G5HA 4ZVTA 5EJ5A 2XCRB 1JKJB 3LBAA 3A4YA 3QLJA 5NULA 3WG9A 4ARCA 1EZZA 2AZDA 3GFTA 3DXXA 5EIEA 1ANKA 1WUKS 4EHLA 2ZXEA 1GA1A 1U1FA 3GXOA 1NJGA 2TS1A 2I3DA 4INAA 2YCBA 4UZEA 1ECLA 1O8BA 3C7KA 5C31A 1N75A 1SCAA 5JNLA 3HM2A 1RHJA 1KO7A 4EW2A 3TW8A 2A8YA 5EVCA 1J8FA 1NHGA 5KYWB 3I34X 3RRFA 1UJ5A 4JYMA 3ADCA 4RCZA 1DJOA 1RRMA 1U2DA 4HDMA 2B82A 4MR9B 4WH0A 1L5VA 2DRIA 5KS2A 1PRYA 3CRVA 1XL1A 4BMPB 3A35A 2C5AA 1YOBA 4HB4A 4LYDA 4DV3B 2VPTA 2AC2A 4EDHA 1W5FA 1K4MA 3BEOA 3HSSA 1E9SA 2EJWA 2SECE 4LQCA 1SBTA 2WG2A 5F78A 2HQSA 2VXCA 1XRLA 2FFAA 2NQ8A 5I4KA 3KS9A 1SU8A 2ZTUA 3MVEA 3O3MB 1QIEA 1H6AA 4R1MA 4RXMA 2NO0A 1B8NA 1B0ZA 3GYBA 1JXAA 4RM2A 4Q9KA 3U4IA 4X3PA 4BO8A 4L4SA 3KKNA 3FTEA 4JEMA 2IF0A 4JR1A 5GJBA 1TKAA 1U7PA 1YZFA 2CK3D 2RH5A 1I01A 3DMPA 2QI9F 3IMKA 4HAOA 1IXKA 3QSGA 4M9QA 2I8CA 5D01A 1MV5A 1DS6A 1DVRA 6REQB 1QDEA 3W6NA 2M1ZA 1PZMA 5L7TA 1Z4QA 4TGLA 5C9ZA 1QIMA 5G1PA 5HCNA 4FGLA 3ZWXA 3ILYA 4TWRA 4IX1A 4XIJA 4Y30A 3U1VA 4RK7A 1O96A 1ODJA 5E8JA 2ZXHA 1RXWA 1OH8A 2A86A 4KMMA 3PQ2A 1PDWA 3UH1A 2NSHA 2B0JA 4YT4A 4EYKA 2NIPA 5SZKB 2BP7A 4R3NA 4CE6A 2XB4A 3TXYA 5B7GA 4JKOA 3N6RA 1FVHA 2JZCA 3NKFA 4NBUA 2D5CA 5EHNA 5KJEA 1N5IA 3NBYC 1C41A 2QMQA 3GLGA 1O4VA 4JU9A 2BUCA 2GLTA 3FTDA 1CYDA 2XB2A 2CEAA 5A6VA 4NYIQ 3ZHBA 2WWVD 4KYTA 4X7BA 2V7QD 3GMSA 5LIPA 3OZXA 4RIGA 5EC8A 1XZHA 4HH4A 4X94A 4CIVA 2WTXA 4JNKA 3RBAA 4GZMA 1GLVA 1SOMA 2A58A 5ICMA 2AYYA 1E63A 2FSUA 1ADJA 2WICA 3DV0A 3JWIA 1P2VA 2CXOA 2OB1A 2XQGA 3JYQA 1RMTA 1V1RA 3I12A 5F64A 3OUUA 2H1RA 3KCNA 2QE7D 3Q98A 4DIFA 4KFCA 3O74A 2IYRA 3V3KA 4KAAA 3NIGB 1VQ4B 5F9HA 2BR4A 4AWBA 3TIVA 1V16A 3OOSA 3UB4A 2XBUA 3QFHA 3PEWA 1ORHA 1A88A 2GB4A 2I9PA 5DASA 4AQYB 1V5GA 1Y7HA 1AS0A 1NRIA 3QBEA 4Y6QA 4DCCA 4B33A 1LWNA 4GE3A 3DSRA 4X20A 1Q17A 2DWQA 2NAFA 2WDZA 2ESRA 3INGA 4L3VA 1Y6ZA 5C3UA 3DE3X 4CLOA 3B5JA 5I47A 5A9RA 1EWYA 3Q7PA 2GZSA 1ISPA 1T8WA 2OC9A 4GLLA 4CQMB 1JJAA 5B2FA 3TL6A 1JR6A 1OROA 3V1YA 4P58A 1G0NA 2GVNA 1DJLA 1SIWA 5JDCA 4DDUA 1QKJA 2DHQA 3KYIB 2ZPUA 4P2GA 5AUQA 3VR5H 1YZYA 4ENSA 3IB6A 1G17A 2H5JA 5JADA 2G82A 3JCZA 3W5AA 2JJ1A 1AO0A 4LBYA 1C7FA 3I92A 1FFWA 4RVFA 1NMEA 3LZ6A 2Q3JA 2WDPA 4WKGA 4XCQA 1AVTA 2PKRA 3PKIA 5CEFA 2PLRA 2M6KA 1ODFA 3STWA 2WSSD 3V4PB 1WCYA 2WYIA 1MIOB 1G98A 4C88A 3BA1A 1HEYA 5DTIA 5FQNA 2R7KA 1KVRA 1M2GA 1ZCZA 1QRRA 1ZD5A 1NSTA 2DSTA 3KV1A 5C18A 1I7NA 1TZBA 1SXJD 4V2IA 1GUYA 4NZ9A 3WSWA 2WQ6A 2ZIXA 4ND7A 1GA6A 4UAGA 1E7RA 2FRDA 5ICFA 3DTVB 3SKVA 3TSWA 4D9HA 4RMHA 4EQZA 4EUEA 1T4DA 2Q3LA 5DLDA 4WKNA 1GCGA 1ZXLA 4FYIA 4OKNA 4OHYA 1UBTS 2O57A 4DJJA 1SOUA 2D6FA 1BTOA 3KSUA 2NP7A 1CS4C 1F4VA 1C7EA 2FMFA 3JASB 2IIBA 1V7CA 4JVNA 1KH1A 1ZD2P 1E3EA 1U9IC 2VK8A 4NP6A 5BUSA 4J2TA 2WNSA 4WOJA 3MMNA 3WYBA 4BFCA 4DC9A 5KNDH 4EZIA 2H63A 4G85A 3IIKA 1T4GA 4HNVA 2JLAA 2EKQA 2VCYA 4GBED 1RI4A 5AJHA 5J5VA 1SCBA 3EPLA 1SKMA 1NDQA 2Z6AA 2QVGA 3KKLA 2C4KA 1P39A 3EDRA 2DTDA 5A7HA 3NONA 3UVEA 2ZE7A 3ETCA 5DI3A 4HJRA 2QPLA 4QOJA 3DUFA 4X05A 1ZH6A 1Y4DE 3B53X 2ZYUX 3M2TA 2I67A 4HZUB 2Y0PA 2YBEA 1CUWA 3UATA 1LX7A 4B0PA 3OLWA 3GLRA 4GM4A 3C1OA 4N5LA 4Q4AA 5TGZA 1ZIPA 1OFVA 2Q7XA 2WWRA 3FMVA 4XWYA 1RKUA 3MPUA 3I2YX 1IZ9A 1WHSB 5L4SA 4BXOB 3CVWA 2XUFA 3FUXA 1N2OA 2RJNA 2R2GA 3UNXA 5FUQA 3CNOA 1G291 2MSDB 4M87A 2XKBA 4CT4B 4LNUA 2DH6A 1Z0IA 2WABA 4LRQA 5IDYA 3T8YA 1XZQA 3DG9A 1QK3A 3WIOA 4B6SA 5G0UA 4B43A 2Y2UA 4HL6A 2WAYA 3MUNA 3B1JA 5AOVA 2CFSA 1IBRA 5DO9A 4NECA 2O2XA 2XKAA 4W5RA 3BWYA 5FHQA 3EB9A 2F2TA 4HLUA 1SD2A 5CH5A 3AEUA 1FRQA 2BGMA 3AUAA 3EZNA 4DR1B 4ZQFA 5MFPA 3TRFA 3N0WA 4D6PA 3H1BA 3Q1KA 1IDOA 1WEHA 2R48A 1ZOPA 2A1TS 4J4BA 3MELA 3CINA 1BN7A 2N1BA 1XQXA 2JAWA 3H5WA 4WESB 1U3DA 3TFQA 1RKBA 2NSJA 2VKQA 3MCUA 1SUIA 4KXLA 4TOIA 2VJDA 2XGSA 5CLIA 5EPOA 1JHMA 3V4LA 1C5KA 5JS6A 3RYCA 1FXSA 4DHWA 2C9YA 1BOFA 1AKEA 3OX1A 4K03A 4R3UC 4ZQBA 2QRVB 3SN6A 3OT5A 4KXQA 1LPOA 4BN5A 3PX2A 4EHNA 2A0XA 4MYSA 5EEHA 3ZI0A 3DAGA 2IF2A 2EDCA 4AZWA 1W8DA 3G79A 4O59O 3RC2A 2J6BA 3GG2A 4PFSA 1ISMA 4BX2A 5B57C 3ET4A 4OK5A 3WMWA 5IULC 1AG9A 3DNFA 2YOHA 3JVEA 5CBPA 1ZC3A 3BDAA 1C7ZA 4KBFA 1F5NA 4A8JB 1QCYA 1C3LA 2Q5LA 2EBWA 3U6BA 3W8DA 1RLUA 1NUSA 2POQX 2OGUA 1JG4A 2FSVA 3G6KA 3U7RA 3PXDA 1UD2A 1WCXA 2ZUFA 1X6VA 3S81A 2FW1A 1NT4A 5AUPB 2FLVA 1WPRA 4I1OA 4YFYA 3I58A 1FNSA 3K9CA 3S55A 2ORWA 4HBGA 3QF4B 4G01B 4EG5A 1SNYA 3AJEA 2V7VA 1TZMA 2V9CA 3WLNA 2P6RA 3KJXA 2OV3A 4EUNA 5J4LA 1ZGZA 3A36A 1GN9A 1Q77A 1M7GA 1D2GA 2XF2A 2FSPA 3Q15C 1Q1QA 1JYFA 1QS0A 1NNSA 5CT8A 2OPHA 4W63A 5KKCA 4RANA 1M9NA 2XECA 3LG2A 1UODA 5H70A 5IDWA 3FKSA 1TTQB 4OM8A 1UD6A 4G0XA 4U2FA 1BH2A 1Q7GA 4E2YA 1L7RA 4FONA 3UICA 3WS7A 4GI7A 1O95C 1IU9A 1DJQA 4GXQA 4TKUB 2EC5A 4DYHA 1RIIA 1GFZA 3ONYA 3QW4B 3TSYA 1XOIA 1E32A 1JSZA 3C3EA 2BMWA 4FT4A 1OWPA 3KOUA 4MARA 4YMVA 3UBTA 3G88A 2JAPA 2VYVA 3IQZA 1ZGHA 4DDHA 3BNWA 2I7DA 3E5RA 3I5AA 2TMGA 1BJKA 1XDDA 4ZDWA 1RHKA 2WM2A 3GHYA 1QVVA 1EX7A 3GFRA 2ZRHA 3PC3A 3UJNA 3ZDCA 1WOYA 3OJ0A 1W44A 3T4XA 1THTA 4O4HB 3WJ7A 2FRDC 2A1IA 4UUNA 4C7MA 4JEHA 1E5XA 2BHLA 1O6ZA 3CMAB 3TZKA 4N6GA 4QDOA 2CXQA 4UHDA 1SKYB 4E12A 2RD2A 1ZIYA 4RMGA 4ONEA 4Q9IA 1UT5A 2IBMA 1G3RA 3AY6A 1ECPA 2ZAGA 4IDNA 4B3IA 3ZVKA 1DRJA 3FPSA 3QMWA 3U44A 2VYQA 1E0DA 2GYYA 2WLSA 3T9CA 3MFYA 5IASA 1FU4A 5EQFA 1N2CB 4PYNA 2XXAB 3AU8A 5AMXA 4JLKA 3QF4A 4WK0B 3ECSA 2PA3A 1OFIA 5IJXA 3ZZTA 1JFTA 4YMHA 2YWXA 1CEQA 1KKUA 1EP1B 3I73A 3NAQA 4R1QA 1W8IA 3ES9A 1I6MA 3E1GA 1BGXT 3UWMA 1AUPA 4L28A 1NF2A 2H1WA 2VDRB 4NRDA 4RD3A 1WDTA 3M81A 3QELA 3KQKA 4ZU6X 4BEWA 3FETA 3THSA 4QPJC 2WR8A 1E2GA 1T2CA 4ZI7F 4F6CA 1M1UA 4P3KA 3EGVA 4GOXA 3RASA 1P75A 3PQCA 1OZFA 1PW5A 4KLNA 2PUJA 3Q8LA 2ZQYA 4F8EA 4DILA 1SU4A 4LHXA 2PZJA 1OXVA 1XLVA 1VI6A 1DDGA 3AFHA 4OPSA 1I2BA 3HB1A 5DHUA 3S5UA 4DMHA 3F9RA 5AVJA 2NU7B 1K0FA 2FVXA 2I2CA 3RANA 4P4GA 1X8JA 3VH4A 4D9NA 1JDBB 4RH3A 5ALQA 3JALB 1QHIA 3ZWVA 5LN1A 1YS7A 2DQZA 2I4RA 2ZUSA 2CEKA 3MS2A 4PO3X 2PR2A 4K6FA 1NI4B 4V0ME 2B20A 2GAJA 4QJ3A 4Z1MD 4L8WB 5C1IA 3AIIA 5IN4A 3IPCA 1CX9B 3NO4A 4DCVA 4EW6A 4DR5B 4O8ZA 1DCKA 1HE5A 2B1RA 3FUCA 3ILSA 1CB0A 4NBKA 3D2AA 2BGKA 4C0QC 3L1UA 1Z45A 4DADA 2B4AA 4ES6A 4G5QA 2Q27A 2H11A 3E61A 4S1NA 1NSFA 4FKMA 3DP7A 3U3KA 2IWHA 4L6CA 2XVZA 3P0EA 2YJNA 1GCOA 1G8YA 1T6XA 5ELXA 3ZWDA 4C22A 5KDDA 1ORWA 4FNMA 4CRWB 4TLAA 1UFVA 4F6LA 3JQFA 4V39A 1PGNA 4ZN6A 2W2VA 3FSEA 5BQOA 1MRSA 1Y1RA 2X41A 1N2CA 1U3UA 5IH7A 2QD2A 1KZGB 1T2UA 2XUGA 3EAQA 3TIGA 3B1VA 3KX2A 4LJLA 4MZXA 1VYTA 3GFGA 4RQAA 3H8SA 4YUVA 1U0BB 1H6CA 3FDXA 1EG2A 4J43A 2WBLC 3PFWO 1T0PA 4KQHA 4IVRA 1O0BA 5LZ2A 6PFKA 4CMCA 5A0FA 3PX7A 4BUCA 2FX5A 2ZOSA 2OCXA 3KM0A 4L51A 4XJVA 1BA2A 2YJ5A 2OMEA 4DVGA 4KREA 1I0LA 1ZNXA 3GX1A 1XP8A 3BMCB 3HUTA 1DCTA 5FTJA 3KKMA 4HGRA 4EATA 3LWZA 5KC8A 1CQIB 4GDFA 1AMNA 2Q6OA 1UBNA 1C3OA 3KJHA 3C6YA 4PYJA 1MO6A 2X6RA 5E1BA 4Z53A 2H1CA 4QO7A 3RSOA 5FWNA 3LTEA 4PZZA 1ORVA 5K0CA 4F91B 1LX6A 1MB9A 2R2AA 3UHFA 3TTVA 5HKBA 2HCJB 1I4EB 5CU7A 1NFRA 3EY4A 3QK7A 1OSNA 3OT1B 1J2JA 5FBZA 1SXPA 2HBZA 1SC9A 2H4XA 4UDXX 1X7XB 3K2BA 3SXPA 5JROA 3MCZA 3U5TA 4N5DA 1D4OA 1KYIA 1UDBA 1XKQA 1MR3F 3B5EA 1P6QA 1MG0A 3V4VB 5L4NA 2FG6C 3ZV4A 5KVQA 4DLNA 2BEUB 2X4IA 4GYJA 4Y2HA 1IM8A 1R0SA 4BQPA 2O8FA 1T6BY 3JQPA 3CWQA 4LOKA 3DCYA 5AVKA 5CAEA 3F2IA 2O1XA 5GQSA 1GRQA 1M0SA 3FMOB 5FWXB 5DRYA 1IM2A 3L8DA 1P2DA 3Q39A 2F6RA 4KNYA 2P75A 4UQLA 5K0GA 1SPXA 1MKYA 1PVVA 1X7YA 3E2MA 5FOUA 1ZJZA 3FVQA 3VV2A 2QTVA 2JW5A 2B34A 2RG7A 3LVBA 2YH2A 2V7EA 1X7GA 1CQJA 4WDRA 1Y1LA 5K6AA 2FP3A 3ZHYA 3BH4A 2UDPA 1Z18A 3PC7A 3CIFA 2WHEA 1NQXA 4YRSA 3R5SA 4I5FA 4NH4A 4OXQA 2DPMA 1AMUA 5LLTA 3ZGYA 1NOJA 4MPDA 4IMPA 3O8QA 5HF5A 3TCNA 4BKRA 1PR1A 4RK4A 2CLCX 4D46A 1EUZA 2NUTB 4US0R 3AKCA 1C1DA 5GGYA 1H9AA 1DFHA 4QUBA 2OZKA 4ZKDA 1ODKA 3GH1A 2BGJA 3JU4A 2JLQA 1SXHA 2EX0A 3IT2A 3NHLA 4P81A 1EMDA 3QQPA 3OQOA 4NJMA 3IVMA 821PA 1G5HA 2XWPA 2B35A 4OXXA 5HYVA 1A5SB 1NAHA 2ZS9A 1NW4A 1T1GA 2VT2A 2Y4NA 4KB5A 1U1EA 4MI6A 5A5EA 4JMPA 3IULA 1C3OB 3FI0A 3OZFA 1TCCA 3MZ0A 2A7XA 1GVHA 1P5RA 3EQ7A 2C4UA 3OF2A 3ZVNA 5F51A 2X5KO 3HCFA 3QHQA 2QX6A 1Z4LA 3BTSA 4D5GA 1GYQA 4J3JA 3W1WA 4TV9F 4AJ9A 4LDZA 4WXHA 1GYPA 2OHHA 3OT1A 4QREA 3UMCA 2IYTA 2XNDA 1LTHR 2UYHA 3IUBA 2CNKA 3LQEA 2ZYHA 5K3FB 2PYZA 3V7UA 2FMXA 3BD7A 3QUQA 1SY7A 4J9VA 4Y6LA 1W4CA 1FXWF 1USKA 3C6ZA 1M0EA 3IKMB 2PQ0A 3HMQA 1IN6A 1FMTA 2PN1A 3PVZA 2GM5A 3UJ8A 2D8MA 3P9PA 3R3ZA 4BEBA 1R9MA 3SQLA 3RH0A 3DFIA 4LWQA 4MWBA 2PU7A 1X7YB 1TO1E 4P5PA 1NM5C 4C0HA 1XRJA 1NBIA 1XFDA 3EIOA 1B8VA 1VMKA 3TRHA 2H59A 1AKQA 2E85A 2NO9A 3I4LA 1V71A 1D03A 4EKEA 2ZTNA 2W00A 3EG9A 3GD7A 2WG0A 4JBNA 4QT0A 1GPLA 1XHLA 2ZRPA 5LM3A 5IM4A 2IDMA 4MUBA 2ZYWX 3BGSA 3F97A 3KEMA 2BFDB 2ZCJA 5MDHA 1DOAA 5EJ9A 1JLMA 3MWEB 2QX7A 4JC0A 3U26A 3MRXA 4ODIA 2IPOA 4MV0A 4YCLA 4PPQA 3EZ6A 3IEMA 4B6OA 5B4UA 1DE0A 2FJPA 3FXAA 3IERA 3GEHA 2OPBA 4OOVA 3FLAA 3KOZA 4Q03A 3GUCA 5ALRA 5DGCA 4AVYA 3C74A 1YA6