3FPRA

Crystal structure of evasin-1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
85
structure length
85
Chain Sequence
b'GDLGGCPFLVAENKTGYPTIVACKQDCNGTTETAPNGTRCFSIGDEGLRRMTANLPYDCPLGQCSNGDCIPKETYEVCYRRNWRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Evasin-1
publication title Structural basis of chemokine sequestration by a tick chemokine binding protein: the crystal structure of the complex between Evasin-1 and CCL3
pubmed doi rcsb
source organism Rhipicephalus sanguineus
molecule tags Immune system
total genus 15
structure length 85
sequence length 85
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.50 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3fprA00
3FPUA 3FPTA 3FPRA
chains in the Genus database with same CATH superfamily
4ARCA 2Q1AX 2GF7A 3FPRA 1CR5A 2Q18X 5D6WA 4FIBA 3MB5A 5C18A 2PWYA 5D6YA 2Q19X 1O54A 4UC4A 5C1BA 3BQBA 5EPPA 2MM2A 1QDNA 3FPTA 4KODA 2Q1CX 1QCSA 3QC8A 5CCBA 3FPUA 4KLNA 3ZGZA 3LGAA 3CF2A 1CZ5A 5B6CA 5EQJB 4KO8A 5FTKA 3HU1A 4ARIA 4AS1A 3ZJVA 2PJHB 5D6XA 3HU3A 3QQ7A 3LHDA 1CZ4A 2GFAA 1ZC1A 1S3SA 5GLFA 5CD1A 1WLFA 2Q1DX 3ZJUA 3ZJTA 2QQSA 1R7RA 4CQNA 2LW6A 5DYGA 2KY9A 2MM0A 5FTLA 2YVLA 5CCXA 1E32A 3TIWA 2YUJA 3HU2A 4KDLA 2B25A 4AQ7A 1I9GA 2QQRA 5FTMA 5DYIA 5FTJA 5FTNA 3QWZA 4RV0A 2XDPA 2JV2A 4KDIA 5ERGB 3QQ8A
chains in the Genus database with same CATH topology
4ARCA 2Q1AX 2GF7A 3FPRA 1CR5A 2Q18X 5D6WA 4FIBA 3MB5A 5C18A 2PWYA 5D6YA 2Q19X 1O54A 4UC4A 5C1BA 3BQBA 5EPPA 2MM2A 1QDNA 3FPTA 4KODA 2Q1CX 1QCSA 3QC8A 5CCBA 3FPUA 4KLNA 3ZGZA 3LGAA 3CF2A 1CZ5A 5B6CA 5EQJB 4KO8A 5FTKA 3HU1A 4ARIA 4AS1A 3ZJVA 2PJHB 5D6XA 3HU3A 3QQ7A 3LHDA 1CZ4A 2GFAA 1ZC1A 1S3SA 5GLFA 5CD1A 1WLFA 2Q1DX 3ZJUA 3ZJTA 2QQSA 1R7RA 4CQNA 2LW6A 5DYGA 2KY9A 2MM0A 5FTLA 2YVLA 5CCXA 1E32A 3TIWA 2YUJA 3HU2A 4KDLA 2B25A 4AQ7A 1I9GA 2QQRA 5FTMA 5DYIA 5FTJA 5FTNA 3QWZA 4RV0A 2XDPA 2JV2A 4KDIA 5ERGB 3QQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FPU A;  3FPT A;  3FPR A; 
#chains in the Genus database with same CATH topology
 4ARC A;  2Q1A X;  2GF7 A;  3FPR A;  1CR5 A;  2Q18 X;  5D6W A;  4FIB A;  3MB5 A;  5C18 A;  2PWY A;  5D6Y A;  2Q19 X;  1O54 A;  4UC4 A;  5C1B A;  3BQB A;  5EPP A;  2MM2 A;  1QDN A;  3FPT A;  4KOD A;  2Q1C X;  1QCS A;  3QC8 A;  5CCB A;  3FPU A;  4KLN A;  3ZGZ A;  3LGA A;  3CF2 A;  1CZ5 A;  5B6C A;  5EQJ B;  4KO8 A;  5FTK A;  3HU1 A;  4ARI A;  4AS1 A;  3ZJV A;  2PJH B;  5D6X A;  3HU3 A;  3QQ7 A;  3LHD A;  1CZ4 A;  2GFA A;  1ZC1 A;  1S3S A;  5GLF A;  5CD1 A;  1WLF A;  2Q1D X;  3ZJU A;  3ZJT A;  2QQS A;  1R7R A;  4CQN A;  2LW6 A;  5DYG A;  2KY9 A;  2MM0 A;  5FTL A;  2YVL A;  5CCX A;  1E32 A;  3TIW A;  2YUJ A;  3HU2 A;  4KDL A;  2B25 A;  4AQ7 A;  1I9G A;  2QQR A;  5FTM A;  5DYI A;  5FTJ A;  5FTN A;  3QWZ A;  4RV0 A;  2XDP A;  2JV2 A;  4KDI A;  5ERG B;  3QQ8 A; 
#chains in the Genus database with same CATH homology
 4ARC A;  2Q1A X;  2GF7 A;  3FPR A;  1CR5 A;  2Q18 X;  5D6W A;  4FIB A;  3MB5 A;  5C18 A;  2PWY A;  5D6Y A;  2Q19 X;  1O54 A;  4UC4 A;  5C1B A;  3BQB A;  5EPP A;  2MM2 A;  1QDN A;  3FPT A;  4KOD A;  2Q1C X;  1QCS A;  3QC8 A;  5CCB A;  3FPU A;  4KLN A;  3ZGZ A;  3LGA A;  3CF2 A;  1CZ5 A;  5B6C A;  5EQJ B;  4KO8 A;  5FTK A;  3HU1 A;  4ARI A;  4AS1 A;  3ZJV A;  2PJH B;  5D6X A;  3HU3 A;  3QQ7 A;  3LHD A;  1CZ4 A;  2GFA A;  1ZC1 A;  1S3S A;  5GLF A;  5CD1 A;  1WLF A;  2Q1D X;  3ZJU A;  3ZJT A;  2QQS A;  1R7R A;  4CQN A;  2LW6 A;  5DYG A;  2KY9 A;  2MM0 A;  5FTL A;  2YVL A;  5CCX A;  1E32 A;  3TIW A;  2YUJ A;  3HU2 A;  4KDL A;  2B25 A;  4AQ7 A;  1I9G A;  2QQR A;  5FTM A;  5DYI A;  5FTJ A;  5FTN A;  3QWZ A;  4RV0 A;  2XDP A;  2JV2 A;  4KDI A;  5ERG B;  3QQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...