3FPRA

Crystal structure of evasin-1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
85
structure length
85
Chain Sequence
GDLGGCPFLVAENKTGYPTIVACKQDCNGTTETAPNGTRCFSIGDEGLRRMTANLPYDCPLGQCSNGDCIPKETYEVCYRRNWRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of chemokine sequestration by a tick chemokine binding protein: the crystal structure of the complex between Evasin-1 and CCL3
pubmed doi rcsb
source organism Rhipicephalus sanguineus
molecule tags Immune system
molecule keywords Evasin-1
total genus 15
structure length 85
sequence length 85
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.50 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3fprA00
3FPTA 3FPRA 3FPUA
chains in the Genus database with same CATH superfamily
5CCBA 2JV2A 2B25A 3CF2A 5EPPA 3ZJVA 4AQ7A 3HU3A 5FTKA 3FPUA 2Q18X 5C18A 2QQRA 3LGAA 2XDPA 2LW6A 5FTJA 5FTMA 2PWYA 4RV0A 1QCSA 1S3SA 5FTLA 1CZ5A 2GF7A 5ERGB 5EQJB 5DYIA 3LHDA 4KDIA 3FPTA 3FPRA 3QC8A 2Q1CX 2PJHB 5FTNA 2MM2A 2MM0A 1ZC1A 4FIBA 1QDNA 2YUJA 3ZGZA 4UC4A 4KLNA 2Q19X 1I9GA 4KO8A 4ARCA 3BQBA 4ARIA 4CQNA 1CZ4A 5B6CA 4AS1A 1E32A 4KODA 5CD1A 5D6YA 5DYGA 3HU1A 2KY9A 2YVLA 5GLFA 3ZJTA 2Q1DX 1WLFA 3QWZA 2Q1AX 3HU2A 3QQ8A 5C1BA 4KDLA 1O54A 2QQSA 3MB5A 1R7RA 2GFAA 5D6WA 1CR5A 3QQ7A 5D6XA 3TIWA 5CCXA 3ZJUA
chains in the Genus database with same CATH topology
5CCBA 2JV2A 2B25A 3CF2A 5EPPA 3ZJVA 4AQ7A 3HU3A 5FTKA 3FPUA 2Q18X 5C18A 2QQRA 3LGAA 2XDPA 2LW6A 5FTJA 5FTMA 2PWYA 4RV0A 1QCSA 1S3SA 5FTLA 1CZ5A 2GF7A 5ERGB 5EQJB 5DYIA 3LHDA 4KDIA 3FPTA 3FPRA 3QC8A 2Q1CX 2PJHB 5FTNA 2MM2A 2MM0A 1ZC1A 4FIBA 1QDNA 2YUJA 3ZGZA 4UC4A 4KLNA 2Q19X 1I9GA 4KO8A 4ARCA 3BQBA 4ARIA 4CQNA 1CZ4A 5B6CA 4AS1A 1E32A 4KODA 5CD1A 5D6YA 5DYGA 3HU1A 2KY9A 2YVLA 5GLFA 3ZJTA 2Q1DX 1WLFA 3QWZA 2Q1AX 3HU2A 3QQ8A 5C1BA 4KDLA 1O54A 2QQSA 3MB5A 1R7RA 2GFAA 5D6WA 1CR5A 3QQ7A 5D6XA 3TIWA 5CCXA 3ZJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FPT A;  3FPR A;  3FPU A; 
#chains in the Genus database with same CATH topology
 5CCB A;  2JV2 A;  2B25 A;  3CF2 A;  5EPP A;  3ZJV A;  4AQ7 A;  3HU3 A;  5FTK A;  3FPU A;  2Q18 X;  5C18 A;  2QQR A;  3LGA A;  2XDP A;  2LW6 A;  5FTJ A;  5FTM A;  2PWY A;  4RV0 A;  1QCS A;  1S3S A;  5FTL A;  1CZ5 A;  2GF7 A;  5ERG B;  5EQJ B;  5DYI A;  3LHD A;  4KDI A;  3FPT A;  3FPR A;  3QC8 A;  2Q1C X;  2PJH B;  5FTN A;  2MM2 A;  2MM0 A;  1ZC1 A;  4FIB A;  1QDN A;  2YUJ A;  3ZGZ A;  4UC4 A;  4KLN A;  2Q19 X;  1I9G A;  4KO8 A;  4ARC A;  3BQB A;  4ARI A;  4CQN A;  1CZ4 A;  5B6C A;  4AS1 A;  1E32 A;  4KOD A;  5CD1 A;  5D6Y A;  5DYG A;  3HU1 A;  2KY9 A;  2YVL A;  5GLF A;  3ZJT A;  2Q1D X;  1WLF A;  3QWZ A;  2Q1A X;  3HU2 A;  3QQ8 A;  5C1B A;  4KDL A;  1O54 A;  2QQS A;  3MB5 A;  1R7R A;  2GFA A;  5D6W A;  1CR5 A;  3QQ7 A;  5D6X A;  3TIW A;  5CCX A;  3ZJU A; 
#chains in the Genus database with same CATH homology
 5CCB A;  2JV2 A;  2B25 A;  3CF2 A;  5EPP A;  3ZJV A;  4AQ7 A;  3HU3 A;  5FTK A;  3FPU A;  2Q18 X;  5C18 A;  2QQR A;  3LGA A;  2XDP A;  2LW6 A;  5FTJ A;  5FTM A;  2PWY A;  4RV0 A;  1QCS A;  1S3S A;  5FTL A;  1CZ5 A;  2GF7 A;  5ERG B;  5EQJ B;  5DYI A;  3LHD A;  4KDI A;  3FPT A;  3FPR A;  3QC8 A;  2Q1C X;  2PJH B;  5FTN A;  2MM2 A;  2MM0 A;  1ZC1 A;  4FIB A;  1QDN A;  2YUJ A;  3ZGZ A;  4UC4 A;  4KLN A;  2Q19 X;  1I9G A;  4KO8 A;  4ARC A;  3BQB A;  4ARI A;  4CQN A;  1CZ4 A;  5B6C A;  4AS1 A;  1E32 A;  4KOD A;  5CD1 A;  5D6Y A;  5DYG A;  3HU1 A;  2KY9 A;  2YVL A;  5GLF A;  3ZJT A;  2Q1D X;  1WLF A;  3QWZ A;  2Q1A X;  3HU2 A;  3QQ8 A;  5C1B A;  4KDL A;  1O54 A;  2QQS A;  3MB5 A;  1R7R A;  2GFA A;  5D6W A;  1CR5 A;  3QQ7 A;  5D6X A;  3TIW A;  5CCX A;  3ZJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...