3FPRA

Crystal structure of evasin-1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
85
structure length
85
Chain Sequence
GDLGGCPFLVAENKTGYPTIVACKQDCNGTTETAPNGTRCFSIGDEGLRRMTANLPYDCPLGQCSNGDCIPKETYEVCYRRNWRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Evasin-1
publication title Structural basis of chemokine sequestration by a tick chemokine binding protein: the crystal structure of the complex between Evasin-1 and CCL3
pubmed doi rcsb
source organism Rhipicephalus sanguineus
molecule tags Immune system
total genus 15
structure length 85
sequence length 85
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.50 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3fprA00
3FPRA 3FPTA 3FPUA
chains in the Genus database with same CATH superfamily
3ZJTA 3CF2A 2PWYA 2GFAA 4CQNA 5FTJA 3BQBA 5ERGB 2GF7A 5DYIA 3ZJUA 4ARIA 1QDNA 1O54A 2JV2A 5D6WA 2QQSA 3ZGZA 3QQ8A 5FTMA 5GLFA 5CD1A 2B25A 3MB5A 5FTNA 1CZ5A 4KDLA 2YVLA 2LW6A 5EQJB 5CCBA 1S3SA 4KODA 3ZJVA 1CZ4A 1I9GA 4KO8A 1R7RA 2Q1CX 2Q1AX 2PJHB 3HU3A 3QC8A 5D6XA 3QQ7A 4RV0A 4ARCA 3HU2A 4UC4A 1WLFA 2XDPA 4KDIA 3FPRA 4KLNA 2QQRA 3FPUA 3FPTA 2MM2A 3LHDA 4AS1A 2KY9A 2Q18X 1QCSA 5B6CA 3TIWA 3LGAA 5C18A 4AQ7A 5FTKA 2MM0A 3HU1A 2YUJA 2Q19X 5FTLA 1CR5A 4FIBA 5D6YA 1ZC1A 1E32A 5CCXA 5EPPA 5DYGA 2Q1DX 5C1BA 3QWZA
chains in the Genus database with same CATH topology
3ZJTA 3CF2A 2PWYA 2GFAA 4CQNA 5FTJA 3BQBA 5ERGB 2GF7A 5DYIA 3ZJUA 4ARIA 1QDNA 1O54A 2JV2A 5D6WA 2QQSA 3ZGZA 3QQ8A 5FTMA 5GLFA 5CD1A 2B25A 3MB5A 5FTNA 1CZ5A 4KDLA 2YVLA 2LW6A 5EQJB 5CCBA 1S3SA 4KODA 3ZJVA 1CZ4A 1I9GA 4KO8A 1R7RA 2Q1CX 2Q1AX 2PJHB 3HU3A 3QC8A 5D6XA 3QQ7A 4RV0A 4ARCA 3HU2A 4UC4A 1WLFA 2XDPA 4KDIA 3FPRA 4KLNA 2QQRA 3FPUA 3FPTA 2MM2A 3LHDA 4AS1A 2KY9A 2Q18X 1QCSA 5B6CA 3TIWA 3LGAA 5C18A 4AQ7A 5FTKA 2MM0A 3HU1A 2YUJA 2Q19X 5FTLA 1CR5A 4FIBA 5D6YA 1ZC1A 1E32A 5CCXA 5EPPA 5DYGA 2Q1DX 5C1BA 3QWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FPR A;  3FPT A;  3FPU A; 
#chains in the Genus database with same CATH topology
 3ZJT A;  3CF2 A;  2PWY A;  2GFA A;  4CQN A;  5FTJ A;  3BQB A;  5ERG B;  2GF7 A;  5DYI A;  3ZJU A;  4ARI A;  1QDN A;  1O54 A;  2JV2 A;  5D6W A;  2QQS A;  3ZGZ A;  3QQ8 A;  5FTM A;  5GLF A;  5CD1 A;  2B25 A;  3MB5 A;  5FTN A;  1CZ5 A;  4KDL A;  2YVL A;  2LW6 A;  5EQJ B;  5CCB A;  1S3S A;  4KOD A;  3ZJV A;  1CZ4 A;  1I9G A;  4KO8 A;  1R7R A;  2Q1C X;  2Q1A X;  2PJH B;  3HU3 A;  3QC8 A;  5D6X A;  3QQ7 A;  4RV0 A;  4ARC A;  3HU2 A;  4UC4 A;  1WLF A;  2XDP A;  4KDI A;  3FPR A;  4KLN A;  2QQR A;  3FPU A;  3FPT A;  2MM2 A;  3LHD A;  4AS1 A;  2KY9 A;  2Q18 X;  1QCS A;  5B6C A;  3TIW A;  3LGA A;  5C18 A;  4AQ7 A;  5FTK A;  2MM0 A;  3HU1 A;  2YUJ A;  2Q19 X;  5FTL A;  1CR5 A;  4FIB A;  5D6Y A;  1ZC1 A;  1E32 A;  5CCX A;  5EPP A;  5DYG A;  2Q1D X;  5C1B A;  3QWZ A; 
#chains in the Genus database with same CATH homology
 3ZJT A;  3CF2 A;  2PWY A;  2GFA A;  4CQN A;  5FTJ A;  3BQB A;  5ERG B;  2GF7 A;  5DYI A;  3ZJU A;  4ARI A;  1QDN A;  1O54 A;  2JV2 A;  5D6W A;  2QQS A;  3ZGZ A;  3QQ8 A;  5FTM A;  5GLF A;  5CD1 A;  2B25 A;  3MB5 A;  5FTN A;  1CZ5 A;  4KDL A;  2YVL A;  2LW6 A;  5EQJ B;  5CCB A;  1S3S A;  4KOD A;  3ZJV A;  1CZ4 A;  1I9G A;  4KO8 A;  1R7R A;  2Q1C X;  2Q1A X;  2PJH B;  3HU3 A;  3QC8 A;  5D6X A;  3QQ7 A;  4RV0 A;  4ARC A;  3HU2 A;  4UC4 A;  1WLF A;  2XDP A;  4KDI A;  3FPR A;  4KLN A;  2QQR A;  3FPU A;  3FPT A;  2MM2 A;  3LHD A;  4AS1 A;  2KY9 A;  2Q18 X;  1QCS A;  5B6C A;  3TIW A;  3LGA A;  5C18 A;  4AQ7 A;  5FTK A;  2MM0 A;  3HU1 A;  2YUJ A;  2Q19 X;  5FTL A;  1CR5 A;  4FIB A;  5D6Y A;  1ZC1 A;  1E32 A;  5CCX A;  5EPP A;  5DYG A;  2Q1D X;  5C1B A;  3QWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...