3FPRA

Crystal structure of evasin-1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
85
structure length
85
Chain Sequence
GDLGGCPFLVAENKTGYPTIVACKQDCNGTTETAPNGTRCFSIGDEGLRRMTANLPYDCPLGQCSNGDCIPKETYEVCYRRNWRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of chemokine sequestration by a tick chemokine binding protein: the crystal structure of the complex between Evasin-1 and CCL3
pubmed doi rcsb
source organism Rhipicephalus sanguineus
molecule tags Immune system
molecule keywords Evasin-1
total genus 15
structure length 85
sequence length 85
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.50 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3fprA00
3FPTA 3FPRA 3FPUA
chains in the Genus database with same CATH superfamily
5CCXA 3HU3A 3FPRA 3TIWA 4ARCA 1WLFA 1ZC1A 4CQNA 5GLFA 3MB5A 5B6CA 4KDIA 1R7RA 1CZ4A 2MM0A 5D6XA 2QQRA 1O54A 4AS1A 2JV2A 2Q1DX 1QDNA 1CR5A 3QWZA 2YUJA 5C18A 5FTJA 5FTNA 3FPUA 2MM2A 2Q18X 3CF2A 3BQBA 4KO8A 2LW6A 5CD1A 4AQ7A 2YVLA 2Q1AX 1QCSA 5ERGB 3LGAA 3ZJTA 5FTLA 4KLNA 5DYIA 3LHDA 4UC4A 3QC8A 2Q19X 5FTMA 2GF7A 4FIBA 5D6YA 5EQJB 2QQSA 2GFAA 5CCBA 4RV0A 5FTKA 2PWYA 3QQ8A 2PJHB 3HU2A 1S3SA 1E32A 5EPPA 3QQ7A 5DYGA 5C1BA 3HU1A 1CZ5A 2XDPA 2Q1CX 4KODA 1I9GA 2KY9A 3ZGZA 3ZJVA 5D6WA 2B25A 4KDLA 4ARIA 3FPTA 3ZJUA
chains in the Genus database with same CATH topology
5CCXA 3HU3A 3FPRA 3TIWA 4ARCA 1WLFA 1ZC1A 4CQNA 5GLFA 3MB5A 5B6CA 4KDIA 1R7RA 1CZ4A 2MM0A 5D6XA 2QQRA 1O54A 4AS1A 2JV2A 2Q1DX 1QDNA 1CR5A 3QWZA 2YUJA 5C18A 5FTJA 5FTNA 3FPUA 2MM2A 2Q18X 3CF2A 3BQBA 4KO8A 2LW6A 5CD1A 4AQ7A 2YVLA 2Q1AX 1QCSA 5ERGB 3LGAA 3ZJTA 5FTLA 4KLNA 5DYIA 3LHDA 4UC4A 3QC8A 2Q19X 5FTMA 2GF7A 4FIBA 5D6YA 5EQJB 2QQSA 2GFAA 5CCBA 4RV0A 5FTKA 2PWYA 3QQ8A 2PJHB 3HU2A 1S3SA 1E32A 5EPPA 3QQ7A 5DYGA 5C1BA 3HU1A 1CZ5A 2XDPA 2Q1CX 4KODA 1I9GA 2KY9A 3ZGZA 3ZJVA 5D6WA 2B25A 4KDLA 4ARIA 3FPTA 3ZJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FPT A;  3FPR A;  3FPU A; 
#chains in the Genus database with same CATH topology
 5CCX A;  3HU3 A;  3FPR A;  3TIW A;  4ARC A;  1WLF A;  1ZC1 A;  4CQN A;  5GLF A;  3MB5 A;  5B6C A;  4KDI A;  1R7R A;  1CZ4 A;  2MM0 A;  5D6X A;  2QQR A;  1O54 A;  4AS1 A;  2JV2 A;  2Q1D X;  1QDN A;  1CR5 A;  3QWZ A;  2YUJ A;  5C18 A;  5FTJ A;  5FTN A;  3FPU A;  2MM2 A;  2Q18 X;  3CF2 A;  3BQB A;  4KO8 A;  2LW6 A;  5CD1 A;  4AQ7 A;  2YVL A;  2Q1A X;  1QCS A;  5ERG B;  3LGA A;  3ZJT A;  5FTL A;  4KLN A;  5DYI A;  3LHD A;  4UC4 A;  3QC8 A;  2Q19 X;  5FTM A;  2GF7 A;  4FIB A;  5D6Y A;  5EQJ B;  2QQS A;  2GFA A;  5CCB A;  4RV0 A;  5FTK A;  2PWY A;  3QQ8 A;  2PJH B;  3HU2 A;  1S3S A;  1E32 A;  5EPP A;  3QQ7 A;  5DYG A;  5C1B A;  3HU1 A;  1CZ5 A;  2XDP A;  2Q1C X;  4KOD A;  1I9G A;  2KY9 A;  3ZGZ A;  3ZJV A;  5D6W A;  2B25 A;  4KDL A;  4ARI A;  3FPT A;  3ZJU A; 
#chains in the Genus database with same CATH homology
 5CCX A;  3HU3 A;  3FPR A;  3TIW A;  4ARC A;  1WLF A;  1ZC1 A;  4CQN A;  5GLF A;  3MB5 A;  5B6C A;  4KDI A;  1R7R A;  1CZ4 A;  2MM0 A;  5D6X A;  2QQR A;  1O54 A;  4AS1 A;  2JV2 A;  2Q1D X;  1QDN A;  1CR5 A;  3QWZ A;  2YUJ A;  5C18 A;  5FTJ A;  5FTN A;  3FPU A;  2MM2 A;  2Q18 X;  3CF2 A;  3BQB A;  4KO8 A;  2LW6 A;  5CD1 A;  4AQ7 A;  2YVL A;  2Q1A X;  1QCS A;  5ERG B;  3LGA A;  3ZJT A;  5FTL A;  4KLN A;  5DYI A;  3LHD A;  4UC4 A;  3QC8 A;  2Q19 X;  5FTM A;  2GF7 A;  4FIB A;  5D6Y A;  5EQJ B;  2QQS A;  2GFA A;  5CCB A;  4RV0 A;  5FTK A;  2PWY A;  3QQ8 A;  2PJH B;  3HU2 A;  1S3S A;  1E32 A;  5EPP A;  3QQ7 A;  5DYG A;  5C1B A;  3HU1 A;  1CZ5 A;  2XDP A;  2Q1C X;  4KOD A;  1I9G A;  2KY9 A;  3ZGZ A;  3ZJV A;  5D6W A;  2B25 A;  4KDL A;  4ARI A;  3FPT A;  3ZJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...