3FPUA

The crystallographic structure of the complex between evasin-1 and ccl3
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
100
structure length
100
Chain Sequence
b'EDDEDYGDLGGCPFLVAENKTGYPTIVACKQDCNGTTETAPNGTRCFSIGDEGLRRMTANLPYDCPLGQCSNGDCIPKETYEVCYRRNWRDKKNHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Evasin-1
publication title Structural basis of chemokine sequestration by a tick chemokine binding protein: the crystal structure of the complex between Evasin-1 and CCL3
pubmed doi rcsb
source organism Rhipicephalus sanguineus
molecule tags Immune system
total genus 19
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2009-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.50 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3fpuA01
3FPRA 3FPUA 3FPTA
chains in the Genus database with same CATH superfamily
1QDNA 5C1BA 5FTLA 2JV2A 2Q19X 3QQ8A 5EQJB 2GFAA 2QQSA 4KLNA 1I9GA 5EPPA 4KODA 2MM0A 5CCBA 3ZJVA 2Q1DX 3FPRA 2PWYA 1O54A 3ZGZA 2LW6A 5C18A 3HU1A 5DYGA 5FTMA 3ZJTA 4KDLA 3LHDA 4RV0A 4KDIA 5D6XA 3HU3A 1WLFA 1S3SA 2Q18X 2YUJA 2Q1AX 1E32A 3QWZA 5D6WA 3QC8A 4AQ7A 5FTKA 1CZ5A 1CR5A 2YVLA 2GF7A 2QQRA 3TIWA 5DYIA 4UC4A 3ZJUA 4ARIA 3MB5A 5FTNA 4CQNA 2Q1CX 2PJHB 2XDPA 5FTJA 5CD1A 4KO8A 3LGAA 4FIBA 2B25A 1CZ4A 3CF2A 3FPUA 1R7RA 3QQ7A 5B6CA 3BQBA 4ARCA 3HU2A 5GLFA 4AS1A 5D6YA 5CCXA 2KY9A 1ZC1A 1QCSA 2MM2A 5ERGB 3FPTA
chains in the Genus database with same CATH topology
1QDNA 5C1BA 5FTLA 2JV2A 2Q19X 3QQ8A 5EQJB 2GFAA 2QQSA 4KLNA 1I9GA 5EPPA 4KODA 2MM0A 5CCBA 3ZJVA 2Q1DX 3FPRA 2PWYA 1O54A 3ZGZA 2LW6A 5C18A 3HU1A 5DYGA 5FTMA 3ZJTA 4KDLA 3LHDA 4RV0A 4KDIA 5D6XA 3HU3A 1WLFA 1S3SA 2Q18X 2YUJA 2Q1AX 1E32A 3QWZA 5D6WA 3QC8A 4AQ7A 5FTKA 1CZ5A 1CR5A 2YVLA 2GF7A 2QQRA 3TIWA 5DYIA 4UC4A 3ZJUA 4ARIA 3MB5A 5FTNA 4CQNA 2Q1CX 2PJHB 2XDPA 5FTJA 5CD1A 4KO8A 3LGAA 4FIBA 2B25A 1CZ4A 3CF2A 3FPUA 1R7RA 3QQ7A 5B6CA 3BQBA 4ARCA 3HU2A 5GLFA 4AS1A 5D6YA 5CCXA 2KY9A 1ZC1A 1QCSA 2MM2A 5ERGB 3FPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FPR A;  3FPU A;  3FPT A; 
#chains in the Genus database with same CATH topology
 1QDN A;  5C1B A;  5FTL A;  2JV2 A;  2Q19 X;  3QQ8 A;  5EQJ B;  2GFA A;  2QQS A;  4KLN A;  1I9G A;  5EPP A;  4KOD A;  2MM0 A;  5CCB A;  3ZJV A;  2Q1D X;  3FPR A;  2PWY A;  1O54 A;  3ZGZ A;  2LW6 A;  5C18 A;  3HU1 A;  5DYG A;  5FTM A;  3ZJT A;  4KDL A;  3LHD A;  4RV0 A;  4KDI A;  5D6X A;  3HU3 A;  1WLF A;  1S3S A;  2Q18 X;  2YUJ A;  2Q1A X;  1E32 A;  3QWZ A;  5D6W A;  3QC8 A;  4AQ7 A;  5FTK A;  1CZ5 A;  1CR5 A;  2YVL A;  2GF7 A;  2QQR A;  3TIW A;  5DYI A;  4UC4 A;  3ZJU A;  4ARI A;  3MB5 A;  5FTN A;  4CQN A;  2Q1C X;  2PJH B;  2XDP A;  5FTJ A;  5CD1 A;  4KO8 A;  3LGA A;  4FIB A;  2B25 A;  1CZ4 A;  3CF2 A;  3FPU A;  1R7R A;  3QQ7 A;  5B6C A;  3BQB A;  4ARC A;  3HU2 A;  5GLF A;  4AS1 A;  5D6Y A;  5CCX A;  2KY9 A;  1ZC1 A;  1QCS A;  2MM2 A;  5ERG B;  3FPT A; 
#chains in the Genus database with same CATH homology
 1QDN A;  5C1B A;  5FTL A;  2JV2 A;  2Q19 X;  3QQ8 A;  5EQJ B;  2GFA A;  2QQS A;  4KLN A;  1I9G A;  5EPP A;  4KOD A;  2MM0 A;  5CCB A;  3ZJV A;  2Q1D X;  3FPR A;  2PWY A;  1O54 A;  3ZGZ A;  2LW6 A;  5C18 A;  3HU1 A;  5DYG A;  5FTM A;  3ZJT A;  4KDL A;  3LHD A;  4RV0 A;  4KDI A;  5D6X A;  3HU3 A;  1WLF A;  1S3S A;  2Q18 X;  2YUJ A;  2Q1A X;  1E32 A;  3QWZ A;  5D6W A;  3QC8 A;  4AQ7 A;  5FTK A;  1CZ5 A;  1CR5 A;  2YVL A;  2GF7 A;  2QQR A;  3TIW A;  5DYI A;  4UC4 A;  3ZJU A;  4ARI A;  3MB5 A;  5FTN A;  4CQN A;  2Q1C X;  2PJH B;  2XDP A;  5FTJ A;  5CD1 A;  4KO8 A;  3LGA A;  4FIB A;  2B25 A;  1CZ4 A;  3CF2 A;  3FPU A;  1R7R A;  3QQ7 A;  5B6C A;  3BQB A;  4ARC A;  3HU2 A;  5GLF A;  4AS1 A;  5D6Y A;  5CCX A;  2KY9 A;  1ZC1 A;  1QCS A;  2MM2 A;  5ERG B;  3FPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...