3FPUA

The crystallographic structure of the complex between evasin-1 and ccl3
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
100
structure length
100
Chain Sequence
EDDEDYGDLGGCPFLVAENKTGYPTIVACKQDCNGTTETAPNGTRCFSIGDEGLRRMTANLPYDCPLGQCSNGDCIPKETYEVCYRRNWRDKKNHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Evasin-1
publication title Structural basis of chemokine sequestration by a tick chemokine binding protein: the crystal structure of the complex between Evasin-1 and CCL3
pubmed doi rcsb
source organism Rhipicephalus sanguineus
molecule tags Immune system
total genus 19
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2009-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.50 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3fpuA01
3FPUA 3FPTA 3FPRA
chains in the Genus database with same CATH superfamily
5FTMA 3QC8A 3MB5A 2Q1AX 1QDNA 4RV0A 5D6WA 5FTLA 3ZJTA 5FTKA 3CF2A 3QQ7A 4FIBA 1ZC1A 5C18A 4KODA 1S3SA 3LGAA 1E32A 5D6XA 4CQNA 5DYIA 5CCBA 5DYGA 2Q18X 2GF7A 3QWZA 1CR5A 3ZJUA 1O54A 3FPUA 3FPTA 2QQSA 4KDLA 5FTJA 2MM0A 4AQ7A 5FTNA 2B25A 1CZ4A 3HU2A 3FPRA 2Q1DX 4UC4A 1CZ5A 3HU3A 3ZJVA 2MM2A 5EQJB 5ERGB 5GLFA 5B6CA 2GFAA 5D6YA 2Q1CX 5EPPA 5CD1A 3QQ8A 2Q19X 4KO8A 5CCXA 4ARIA 5C1BA 2LW6A 2KY9A 3TIWA 3BQBA 1I9GA 2YVLA 2XDPA 2JV2A 1QCSA 1WLFA 4KLNA 2YUJA 4KDIA 3LHDA 3ZGZA 3HU1A 1R7RA 4AS1A 2PWYA 2QQRA 4ARCA 2PJHB
chains in the Genus database with same CATH topology
5FTMA 3QC8A 3MB5A 2Q1AX 1QDNA 4RV0A 5D6WA 5FTLA 3ZJTA 5FTKA 3CF2A 3QQ7A 4FIBA 1ZC1A 5C18A 4KODA 1S3SA 3LGAA 1E32A 5D6XA 4CQNA 5DYIA 5CCBA 5DYGA 2Q18X 2GF7A 3QWZA 1CR5A 3ZJUA 1O54A 3FPUA 3FPTA 2QQSA 4KDLA 5FTJA 2MM0A 4AQ7A 5FTNA 2B25A 1CZ4A 3HU2A 3FPRA 2Q1DX 4UC4A 1CZ5A 3HU3A 3ZJVA 2MM2A 5EQJB 5ERGB 5GLFA 5B6CA 2GFAA 5D6YA 2Q1CX 5EPPA 5CD1A 3QQ8A 2Q19X 4KO8A 5CCXA 4ARIA 5C1BA 2LW6A 2KY9A 3TIWA 3BQBA 1I9GA 2YVLA 2XDPA 2JV2A 1QCSA 1WLFA 4KLNA 2YUJA 4KDIA 3LHDA 3ZGZA 3HU1A 1R7RA 4AS1A 2PWYA 2QQRA 4ARCA 2PJHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FPU A;  3FPT A;  3FPR A; 
#chains in the Genus database with same CATH topology
 5FTM A;  3QC8 A;  3MB5 A;  2Q1A X;  1QDN A;  4RV0 A;  5D6W A;  5FTL A;  3ZJT A;  5FTK A;  3CF2 A;  3QQ7 A;  4FIB A;  1ZC1 A;  5C18 A;  4KOD A;  1S3S A;  3LGA A;  1E32 A;  5D6X A;  4CQN A;  5DYI A;  5CCB A;  5DYG A;  2Q18 X;  2GF7 A;  3QWZ A;  1CR5 A;  3ZJU A;  1O54 A;  3FPU A;  3FPT A;  2QQS A;  4KDL A;  5FTJ A;  2MM0 A;  4AQ7 A;  5FTN A;  2B25 A;  1CZ4 A;  3HU2 A;  3FPR A;  2Q1D X;  4UC4 A;  1CZ5 A;  3HU3 A;  3ZJV A;  2MM2 A;  5EQJ B;  5ERG B;  5GLF A;  5B6C A;  2GFA A;  5D6Y A;  2Q1C X;  5EPP A;  5CD1 A;  3QQ8 A;  2Q19 X;  4KO8 A;  5CCX A;  4ARI A;  5C1B A;  2LW6 A;  2KY9 A;  3TIW A;  3BQB A;  1I9G A;  2YVL A;  2XDP A;  2JV2 A;  1QCS A;  1WLF A;  4KLN A;  2YUJ A;  4KDI A;  3LHD A;  3ZGZ A;  3HU1 A;  1R7R A;  4AS1 A;  2PWY A;  2QQR A;  4ARC A;  2PJH B; 
#chains in the Genus database with same CATH homology
 5FTM A;  3QC8 A;  3MB5 A;  2Q1A X;  1QDN A;  4RV0 A;  5D6W A;  5FTL A;  3ZJT A;  5FTK A;  3CF2 A;  3QQ7 A;  4FIB A;  1ZC1 A;  5C18 A;  4KOD A;  1S3S A;  3LGA A;  1E32 A;  5D6X A;  4CQN A;  5DYI A;  5CCB A;  5DYG A;  2Q18 X;  2GF7 A;  3QWZ A;  1CR5 A;  3ZJU A;  1O54 A;  3FPU A;  3FPT A;  2QQS A;  4KDL A;  5FTJ A;  2MM0 A;  4AQ7 A;  5FTN A;  2B25 A;  1CZ4 A;  3HU2 A;  3FPR A;  2Q1D X;  4UC4 A;  1CZ5 A;  3HU3 A;  3ZJV A;  2MM2 A;  5EQJ B;  5ERG B;  5GLF A;  5B6C A;  2GFA A;  5D6Y A;  2Q1C X;  5EPP A;  5CD1 A;  3QQ8 A;  2Q19 X;  4KO8 A;  5CCX A;  4ARI A;  5C1B A;  2LW6 A;  2KY9 A;  3TIW A;  3BQB A;  1I9G A;  2YVL A;  2XDP A;  2JV2 A;  1QCS A;  1WLF A;  4KLN A;  2YUJ A;  4KDI A;  3LHD A;  3ZGZ A;  3HU1 A;  1R7R A;  4AS1 A;  2PWY A;  2QQR A;  4ARC A;  2PJH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...