3FPUA

The crystallographic structure of the complex between evasin-1 and ccl3
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
100
structure length
100
Chain Sequence
EDDEDYGDLGGCPFLVAENKTGYPTIVACKQDCNGTTETAPNGTRCFSIGDEGLRRMTANLPYDCPLGQCSNGDCIPKETYEVCYRRNWRDKKNHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Evasin-1
publication title Structural basis of chemokine sequestration by a tick chemokine binding protein: the crystal structure of the complex between Evasin-1 and CCL3
pubmed doi rcsb
source organism Rhipicephalus sanguineus
molecule tags Immune system
total genus 19
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2009-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.50 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3fpuA01
3FPUA 3FPTA 3FPRA
chains in the Genus database with same CATH superfamily
5DYGA 3HU3A 1E32A 3TIWA 1O54A 2B25A 2PWYA 2PJHB 2YUJA 5CD1A 5B6CA 1CR5A 2QQSA 3QQ7A 5D6YA 1WLFA 2Q19X 3QQ8A 2Q1AX 3ZGZA 5CCXA 1ZC1A 3HU1A 4UC4A 3FPRA 4KDLA 5D6WA 2GF7A 4CQNA 1CZ4A 4KO8A 5D6XA 4FIBA 4ARIA 2KY9A 1R7RA 2XDPA 5EQJB 4KDIA 3CF2A 2QQRA 2Q18X 5DYIA 3QWZA 5EPPA 5CCBA 1QCSA 5ERGB 5FTJA 2MM2A 4KODA 1QDNA 3ZJTA 5GLFA 4RV0A 4KLNA 2YVLA 4AQ7A 2Q1CX 4AS1A 3LHDA 3ZJVA 2LW6A 3FPTA 2MM0A 5C18A 5FTMA 2JV2A 5FTNA 3FPUA 2Q1DX 5C1BA 3ZJUA 3LGAA 3MB5A 3HU2A 5FTLA 3BQBA 4ARCA 3QC8A 1CZ5A 1I9GA 2GFAA 1S3SA 5FTKA
chains in the Genus database with same CATH topology
5DYGA 3HU3A 1E32A 3TIWA 1O54A 2B25A 2PWYA 2PJHB 2YUJA 5CD1A 5B6CA 1CR5A 2QQSA 3QQ7A 5D6YA 1WLFA 2Q19X 3QQ8A 2Q1AX 3ZGZA 5CCXA 1ZC1A 3HU1A 4UC4A 3FPRA 4KDLA 5D6WA 2GF7A 4CQNA 1CZ4A 4KO8A 5D6XA 4FIBA 4ARIA 2KY9A 1R7RA 2XDPA 5EQJB 4KDIA 3CF2A 2QQRA 2Q18X 5DYIA 3QWZA 5EPPA 5CCBA 1QCSA 5ERGB 5FTJA 2MM2A 4KODA 1QDNA 3ZJTA 5GLFA 4RV0A 4KLNA 2YVLA 4AQ7A 2Q1CX 4AS1A 3LHDA 3ZJVA 2LW6A 3FPTA 2MM0A 5C18A 5FTMA 2JV2A 5FTNA 3FPUA 2Q1DX 5C1BA 3ZJUA 3LGAA 3MB5A 3HU2A 5FTLA 3BQBA 4ARCA 3QC8A 1CZ5A 1I9GA 2GFAA 1S3SA 5FTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FPU A;  3FPT A;  3FPR A; 
#chains in the Genus database with same CATH topology
 5DYG A;  3HU3 A;  1E32 A;  3TIW A;  1O54 A;  2B25 A;  2PWY A;  2PJH B;  2YUJ A;  5CD1 A;  5B6C A;  1CR5 A;  2QQS A;  3QQ7 A;  5D6Y A;  1WLF A;  2Q19 X;  3QQ8 A;  2Q1A X;  3ZGZ A;  5CCX A;  1ZC1 A;  3HU1 A;  4UC4 A;  3FPR A;  4KDL A;  5D6W A;  2GF7 A;  4CQN A;  1CZ4 A;  4KO8 A;  5D6X A;  4FIB A;  4ARI A;  2KY9 A;  1R7R A;  2XDP A;  5EQJ B;  4KDI A;  3CF2 A;  2QQR A;  2Q18 X;  5DYI A;  3QWZ A;  5EPP A;  5CCB A;  1QCS A;  5ERG B;  5FTJ A;  2MM2 A;  4KOD A;  1QDN A;  3ZJT A;  5GLF A;  4RV0 A;  4KLN A;  2YVL A;  4AQ7 A;  2Q1C X;  4AS1 A;  3LHD A;  3ZJV A;  2LW6 A;  3FPT A;  2MM0 A;  5C18 A;  5FTM A;  2JV2 A;  5FTN A;  3FPU A;  2Q1D X;  5C1B A;  3ZJU A;  3LGA A;  3MB5 A;  3HU2 A;  5FTL A;  3BQB A;  4ARC A;  3QC8 A;  1CZ5 A;  1I9G A;  2GFA A;  1S3S A;  5FTK A; 
#chains in the Genus database with same CATH homology
 5DYG A;  3HU3 A;  1E32 A;  3TIW A;  1O54 A;  2B25 A;  2PWY A;  2PJH B;  2YUJ A;  5CD1 A;  5B6C A;  1CR5 A;  2QQS A;  3QQ7 A;  5D6Y A;  1WLF A;  2Q19 X;  3QQ8 A;  2Q1A X;  3ZGZ A;  5CCX A;  1ZC1 A;  3HU1 A;  4UC4 A;  3FPR A;  4KDL A;  5D6W A;  2GF7 A;  4CQN A;  1CZ4 A;  4KO8 A;  5D6X A;  4FIB A;  4ARI A;  2KY9 A;  1R7R A;  2XDP A;  5EQJ B;  4KDI A;  3CF2 A;  2QQR A;  2Q18 X;  5DYI A;  3QWZ A;  5EPP A;  5CCB A;  1QCS A;  5ERG B;  5FTJ A;  2MM2 A;  4KOD A;  1QDN A;  3ZJT A;  5GLF A;  4RV0 A;  4KLN A;  2YVL A;  4AQ7 A;  2Q1C X;  4AS1 A;  3LHD A;  3ZJV A;  2LW6 A;  3FPT A;  2MM0 A;  5C18 A;  5FTM A;  2JV2 A;  5FTN A;  3FPU A;  2Q1D X;  5C1B A;  3ZJU A;  3LGA A;  3MB5 A;  3HU2 A;  5FTL A;  3BQB A;  4ARC A;  3QC8 A;  1CZ5 A;  1I9G A;  2GFA A;  1S3S A;  5FTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...