3FPUA

The crystallographic structure of the complex between evasin-1 and ccl3
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
100
structure length
100
Chain Sequence
EDDEDYGDLGGCPFLVAENKTGYPTIVACKQDCNGTTETAPNGTRCFSIGDEGLRRMTANLPYDCPLGQCSNGDCIPKETYEVCYRRNWRDKKNHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of chemokine sequestration by a tick chemokine binding protein: the crystal structure of the complex between Evasin-1 and CCL3
pubmed doi rcsb
source organism Rhipicephalus sanguineus
molecule tags Immune system
molecule keywords Evasin-1
total genus 19
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2009-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.50 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3fpuA01
3FPTA 3FPRA 3FPUA
chains in the Genus database with same CATH superfamily
2Q18X 5FTMA 3BQBA 1E32A 2MM0A 4AS1A 2MM2A 2QQRA 2Q19X 3ZJUA 4AQ7A 5DYIA 1CZ5A 3ZJVA 4CQNA 4KDLA 4KDIA 1WLFA 1CZ4A 3QQ7A 4ARCA 2LW6A 4UC4A 2B25A 3MB5A 5FTKA 2Q1CX 3ZJTA 5FTLA 5ERGB 2YVLA 2GF7A 3FPUA 5C18A 2JV2A 1S3SA 4KODA 2KY9A 3FPRA 3LGAA 3FPTA 3HU1A 4KO8A 3HU3A 3TIWA 3QWZA 1O54A 2YUJA 4FIBA 5B6CA 4ARIA 2PJHB 2GFAA 5D6YA 2Q1AX 1CR5A 3ZGZA 5CCBA 5FTJA 2Q1DX 5GLFA 2PWYA 1R7RA 5EQJB 5FTNA 5EPPA 1QDNA 2QQSA 3HU2A 5D6XA 1ZC1A 5CCXA 2XDPA 3CF2A 1QCSA 5C1BA 4KLNA 4RV0A 3QC8A 3QQ8A 5CD1A 5DYGA 1I9GA 5D6WA 3LHDA
chains in the Genus database with same CATH topology
2Q18X 5FTMA 3BQBA 1E32A 2MM0A 4AS1A 2MM2A 2QQRA 2Q19X 3ZJUA 4AQ7A 5DYIA 1CZ5A 3ZJVA 4CQNA 4KDLA 4KDIA 1WLFA 1CZ4A 3QQ7A 4ARCA 2LW6A 4UC4A 2B25A 3MB5A 5FTKA 2Q1CX 3ZJTA 5FTLA 5ERGB 2YVLA 2GF7A 3FPUA 5C18A 2JV2A 1S3SA 4KODA 2KY9A 3FPRA 3LGAA 3FPTA 3HU1A 4KO8A 3HU3A 3TIWA 3QWZA 1O54A 2YUJA 4FIBA 5B6CA 4ARIA 2PJHB 2GFAA 5D6YA 2Q1AX 1CR5A 3ZGZA 5CCBA 5FTJA 2Q1DX 5GLFA 2PWYA 1R7RA 5EQJB 5FTNA 5EPPA 1QDNA 2QQSA 3HU2A 5D6XA 1ZC1A 5CCXA 2XDPA 3CF2A 1QCSA 5C1BA 4KLNA 4RV0A 3QC8A 3QQ8A 5CD1A 5DYGA 1I9GA 5D6WA 3LHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FPT A;  3FPR A;  3FPU A; 
#chains in the Genus database with same CATH topology
 2Q18 X;  5FTM A;  3BQB A;  1E32 A;  2MM0 A;  4AS1 A;  2MM2 A;  2QQR A;  2Q19 X;  3ZJU A;  4AQ7 A;  5DYI A;  1CZ5 A;  3ZJV A;  4CQN A;  4KDL A;  4KDI A;  1WLF A;  1CZ4 A;  3QQ7 A;  4ARC A;  2LW6 A;  4UC4 A;  2B25 A;  3MB5 A;  5FTK A;  2Q1C X;  3ZJT A;  5FTL A;  5ERG B;  2YVL A;  2GF7 A;  3FPU A;  5C18 A;  2JV2 A;  1S3S A;  4KOD A;  2KY9 A;  3FPR A;  3LGA A;  3FPT A;  3HU1 A;  4KO8 A;  3HU3 A;  3TIW A;  3QWZ A;  1O54 A;  2YUJ A;  4FIB A;  5B6C A;  4ARI A;  2PJH B;  2GFA A;  5D6Y A;  2Q1A X;  1CR5 A;  3ZGZ A;  5CCB A;  5FTJ A;  2Q1D X;  5GLF A;  2PWY A;  1R7R A;  5EQJ B;  5FTN A;  5EPP A;  1QDN A;  2QQS A;  3HU2 A;  5D6X A;  1ZC1 A;  5CCX A;  2XDP A;  3CF2 A;  1QCS A;  5C1B A;  4KLN A;  4RV0 A;  3QC8 A;  3QQ8 A;  5CD1 A;  5DYG A;  1I9G A;  5D6W A;  3LHD A; 
#chains in the Genus database with same CATH homology
 2Q18 X;  5FTM A;  3BQB A;  1E32 A;  2MM0 A;  4AS1 A;  2MM2 A;  2QQR A;  2Q19 X;  3ZJU A;  4AQ7 A;  5DYI A;  1CZ5 A;  3ZJV A;  4CQN A;  4KDL A;  4KDI A;  1WLF A;  1CZ4 A;  3QQ7 A;  4ARC A;  2LW6 A;  4UC4 A;  2B25 A;  3MB5 A;  5FTK A;  2Q1C X;  3ZJT A;  5FTL A;  5ERG B;  2YVL A;  2GF7 A;  3FPU A;  5C18 A;  2JV2 A;  1S3S A;  4KOD A;  2KY9 A;  3FPR A;  3LGA A;  3FPT A;  3HU1 A;  4KO8 A;  3HU3 A;  3TIW A;  3QWZ A;  1O54 A;  2YUJ A;  4FIB A;  5B6C A;  4ARI A;  2PJH B;  2GFA A;  5D6Y A;  2Q1A X;  1CR5 A;  3ZGZ A;  5CCB A;  5FTJ A;  2Q1D X;  5GLF A;  2PWY A;  1R7R A;  5EQJ B;  5FTN A;  5EPP A;  1QDN A;  2QQS A;  3HU2 A;  5D6X A;  1ZC1 A;  5CCX A;  2XDP A;  3CF2 A;  1QCS A;  5C1B A;  4KLN A;  4RV0 A;  3QC8 A;  3QQ8 A;  5CD1 A;  5DYG A;  1I9G A;  5D6W A;  3LHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...