3FPUA

The crystallographic structure of the complex between evasin-1 and ccl3
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
100
structure length
100
Chain Sequence
EDDEDYGDLGGCPFLVAENKTGYPTIVACKQDCNGTTETAPNGTRCFSIGDEGLRRMTANLPYDCPLGQCSNGDCIPKETYEVCYRRNWRDKKNHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of chemokine sequestration by a tick chemokine binding protein: the crystal structure of the complex between Evasin-1 and CCL3
pubmed doi rcsb
source organism Rhipicephalus sanguineus
molecule tags Immune system
molecule keywords Evasin-1
total genus 19
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2009-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.50 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3fpuA01
3FPUA 3FPTA 3FPRA
chains in the Genus database with same CATH superfamily
3QQ8A 4RV0A 2YVLA 3HU2A 3ZGZA 4KDIA 3QWZA 5B6CA 1WLFA 2GF7A 3QC8A 1QCSA 2Q18X 4FIBA 2B25A 3LGAA 5FTNA 2YUJA 5FTMA 3HU1A 3HU3A 1R7RA 5EQJB 5ERGB 3FPTA 4ARCA 5CD1A 4KLNA 3BQBA 2MM0A 5FTKA 5EPPA 1CZ5A 2QQRA 4KO8A 5CCBA 3QQ7A 5GLFA 5C18A 3FPUA 1CR5A 2JV2A 2Q1DX 5D6YA 4KODA 2Q19X 3FPRA 4AQ7A 2PJHB 2KY9A 3TIWA 5CCXA 3MB5A 4KDLA 2LW6A 4ARIA 5C1BA 2Q1AX 1O54A 5DYGA 3ZJVA 3CF2A 1E32A 4AS1A 1ZC1A 5FTJA 2Q1CX 3ZJTA 5D6WA 1I9GA 2PWYA 4CQNA 4UC4A 1QDNA 1CZ4A 2QQSA 2XDPA 5D6XA 2MM2A 3ZJUA 5DYIA 2GFAA 5FTLA 3LHDA 1S3SA
chains in the Genus database with same CATH topology
3QQ8A 4RV0A 2YVLA 3HU2A 3ZGZA 4KDIA 3QWZA 5B6CA 1WLFA 2GF7A 3QC8A 1QCSA 2Q18X 4FIBA 2B25A 3LGAA 5FTNA 2YUJA 5FTMA 3HU1A 3HU3A 1R7RA 5EQJB 5ERGB 3FPTA 4ARCA 5CD1A 4KLNA 3BQBA 2MM0A 5FTKA 5EPPA 1CZ5A 2QQRA 4KO8A 5CCBA 3QQ7A 5GLFA 5C18A 3FPUA 1CR5A 2JV2A 2Q1DX 5D6YA 4KODA 2Q19X 3FPRA 4AQ7A 2PJHB 2KY9A 3TIWA 5CCXA 3MB5A 4KDLA 2LW6A 4ARIA 5C1BA 2Q1AX 1O54A 5DYGA 3ZJVA 3CF2A 1E32A 4AS1A 1ZC1A 5FTJA 2Q1CX 3ZJTA 5D6WA 1I9GA 2PWYA 4CQNA 4UC4A 1QDNA 1CZ4A 2QQSA 2XDPA 5D6XA 2MM2A 3ZJUA 5DYIA 2GFAA 5FTLA 3LHDA 1S3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FPU A;  3FPT A;  3FPR A; 
#chains in the Genus database with same CATH topology
 3QQ8 A;  4RV0 A;  2YVL A;  3HU2 A;  3ZGZ A;  4KDI A;  3QWZ A;  5B6C A;  1WLF A;  2GF7 A;  3QC8 A;  1QCS A;  2Q18 X;  4FIB A;  2B25 A;  3LGA A;  5FTN A;  2YUJ A;  5FTM A;  3HU1 A;  3HU3 A;  1R7R A;  5EQJ B;  5ERG B;  3FPT A;  4ARC A;  5CD1 A;  4KLN A;  3BQB A;  2MM0 A;  5FTK A;  5EPP A;  1CZ5 A;  2QQR A;  4KO8 A;  5CCB A;  3QQ7 A;  5GLF A;  5C18 A;  3FPU A;  1CR5 A;  2JV2 A;  2Q1D X;  5D6Y A;  4KOD A;  2Q19 X;  3FPR A;  4AQ7 A;  2PJH B;  2KY9 A;  3TIW A;  5CCX A;  3MB5 A;  4KDL A;  2LW6 A;  4ARI A;  5C1B A;  2Q1A X;  1O54 A;  5DYG A;  3ZJV A;  3CF2 A;  1E32 A;  4AS1 A;  1ZC1 A;  5FTJ A;  2Q1C X;  3ZJT A;  5D6W A;  1I9G A;  2PWY A;  4CQN A;  4UC4 A;  1QDN A;  1CZ4 A;  2QQS A;  2XDP A;  5D6X A;  2MM2 A;  3ZJU A;  5DYI A;  2GFA A;  5FTL A;  3LHD A;  1S3S A; 
#chains in the Genus database with same CATH homology
 3QQ8 A;  4RV0 A;  2YVL A;  3HU2 A;  3ZGZ A;  4KDI A;  3QWZ A;  5B6C A;  1WLF A;  2GF7 A;  3QC8 A;  1QCS A;  2Q18 X;  4FIB A;  2B25 A;  3LGA A;  5FTN A;  2YUJ A;  5FTM A;  3HU1 A;  3HU3 A;  1R7R A;  5EQJ B;  5ERG B;  3FPT A;  4ARC A;  5CD1 A;  4KLN A;  3BQB A;  2MM0 A;  5FTK A;  5EPP A;  1CZ5 A;  2QQR A;  4KO8 A;  5CCB A;  3QQ7 A;  5GLF A;  5C18 A;  3FPU A;  1CR5 A;  2JV2 A;  2Q1D X;  5D6Y A;  4KOD A;  2Q19 X;  3FPR A;  4AQ7 A;  2PJH B;  2KY9 A;  3TIW A;  5CCX A;  3MB5 A;  4KDL A;  2LW6 A;  4ARI A;  5C1B A;  2Q1A X;  1O54 A;  5DYG A;  3ZJV A;  3CF2 A;  1E32 A;  4AS1 A;  1ZC1 A;  5FTJ A;  2Q1C X;  3ZJT A;  5D6W A;  1I9G A;  2PWY A;  4CQN A;  4UC4 A;  1QDN A;  1CZ4 A;  2QQS A;  2XDP A;  5D6X A;  2MM2 A;  3ZJU A;  5DYI A;  2GFA A;  5FTL A;  3LHD A;  1S3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...