3FPUB

The crystallographic structure of the complex between evasin-1 and ccl3
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
66
structure length
66
Chain Sequence
b'SLAADTPTTCCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of chemokine sequestration by a tick chemokine binding protein: the crystal structure of the complex between Evasin-1 and CCL3
pubmed doi rcsb
molecule keywords Evasin-1
source organism Rhipicephalus sanguineus
molecule tags Immune system
total genus 15
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fpuB00
1CA5A 4ZK9B 5EPJA 4HEDA 4ZAIA 1IKMA 1IKLA 5EPKA 2NYZD 2B2WC 3F2UA 1LV9A 1BO0A 1X3PA 2FHTA 2JP1A 3HP3A 5CMDA 1RJTA 4QUFA 1GUWA 4HSVA 1SSOA 2KECA 1CM9A 5CBEE 2DY7A 1ESRA 2FMMA 2KEEA 2KOLA 5E4XA 4IUVA 4IUUA 1NCVA 2MGSA 3P7JA 4XT1B 4HAEA 4NW2A 1B4OA 1PLFA 1U4RA 2MJ8A 1ICWA 1PFBA 2L9HA 1KNAA 3Q6SA 1HA6A 4RWSC 4R8IA 1QNKA 3DEPA 4XT3B 5EKIA 1HFNA 1O80A 2FJ2A 4IUTA 1WTRA 2RSOA 3MWYW 1HUMA 1WTWA 1EL0A 4IUPA 2B2YC 1WTPA 2B2TC 3TN2A 1EIGA 4ZKBB 3KBXA 1XX8A 3DM1A 1ILQA 5EPLA 5E4WC 2HDMA 4X3KA 2Q8RE 3I90A 2N88A 2Q8TA 2SDFA 1J8IA 5DNFA 1PDQA 1HHVA 3I91A 1WTVA 1EQTA 2K28A 1G2SA 4IURA 1WTXA 1MGSA 4CJ1B 1DZ1A 1ILPA 3MTSA 3UI2A 1G6ZA 1F9QA 2B2WA 4IUQA 2K1BA 5CBAE 1MSGA 3IL8A 5CORA 1B50A 2B2VC 2KEDA 2EPBA 4XDXA 1WD1A 1RODA 1RHPA 5T1IA 3FPUB 4CJ0B 1WTQA 5D65A 1NR2A 1DOKA 1PFMA 2X69A 1WTOA 1JICA 1EOTA 1RTOA 1ZXTA 2HCIA 2HCCA 1ML0D 2FINB 2L1BA 3QO2A 2X6LA 4HCSA 1DONA 2KVMA 2B2VA 1MSHA 1SAPA 1S4ZA 2R3ZA 2X6GA 3GV3A 1O7ZA 1QE6A 4RA8A 1O7YA 1F9SA 3SVMA 5EJWA 2RVLA 1G2TA 2KUMA 2B2YA 4RAUC 2B2UC 2B2TA 4MHEA 4ZLTF 2N55A 1Q3LA 4X3TA 2CVRA 4X3UA 3I3CA 1BNZA 1KNEA 1XYIA 3G7LA 1CA6A 4R9WA 1AZPA 2BDNA 3ONAB 1JE4A 1F9PA 1C8CA 2IL8A 2MPMA 4OIKA 1B3AA 2B2UA 2J7ZA 1B2TA 1DOLA 1IL8A 1HFGA 2L12A 1WVLA 1HRJA 2M2LA 1M8AA 3I8ZA 2HUGA 1SDFA 3R93A 1X32A 3GV6A 1B53A 1X3QA 2DY8A 2RSNA 4MN3A 1F9RA 4ZKCB 2JYOA 2EOTA 1WD0A 3TZDA 1VMCA 2D9UA 1HUNA 1AZQA 1EIHA 2NZ1D 4U68A 2MP1A 2FFKB 5EQ0A 2EE1A 1PFNA 1A15A 5T1GA 2K04A 2K01A 2VXWA 1NR4A 2L11A 4LMQD 5D14A 4O42A 3IFDA 4OIJA 1TVXA 3LWEA 1U4MA 1AP0A 2HDLA 2K05A 4QUCA 2H1EA 1BBXC 1E0BA 2NWGA 2RA4A 1DOMA 4DN4M 1RTNA 3KUPA 1NAPA 1U4PA 3H91A 2L4NA 4UAIA 1G91A 3FDTA 5JJZA 4X3SA 5AFWA 1U4LA 4CJ2C 1MI2A 3DEOA 3D6WA 1J9OA 2XIWA 3N52A 1QG7A 1BF4A 1VMPA 5COYA 1F2LA 2K03A
chains in the Genus database with same CATH superfamily
4KK7A 5EPJA 3STBC 4ZAIA 4NB3A 1LV9A 3J7YW 1RJTA 4A3JH 3CCEA 4LUVA 1HNWL 2FMMA 1VQMA 1HA6A 2L9HA 4WORA 3F8TA 3OYYA 3L0OA 3OHXC 1KC8C 4JI3L 1K8OA 1KQSA 1BBWA 2K52A 1UAPA 2ID0A 3G6JB 4GOPC 3I4MB 2Z0SA 2B29A 1H9JA 1JOOA 2LS01 1NE3A 1LT5D 2IT1A 3CMEA 3GTOH 2Q8TA 4UP9A 4TVAB 2GN5A 3S2HH 1LUZA 5J3BA 5IP7H 4JI6L 2EQSA 4IPDA 3M4OH 2PZWA 1FR3A 4CJ1B 3A5ZB 4DV4Q 3TREA 4ZUJA 3PUXA 4LUZA 2AQ2B 4X64Q 2QF7A 1A62A 4NKLA 4DR6L 1N36L 3GTLB 3DUZA 4C3JH 4V0BA 4CJ0B 4RGMA 3SK4A 1TWCH 1E22A 4XQJA 3T16A 2C35B 4QB4A 4JI5Q 3J81i 1F9SA 3I4NB 4P72A 3CC4A 2A6ED 5M5WH 4GKJQ 1HNXQ 4DV0Q 2ICIA 1N33L 4DF7A 2MNAA 1C8CA 1WJJA 5ELEA 1IBMQ 4FF1A 4L5RC 1A2UA 1KAWA 4A3FB 3SXHA 3KLRA 1TS3A 3R93A 3CC2A 1XMQQ 1EQQA 1QJOA 1AE3A 5IE8A 3HOVG 4IOAA 2BA0A 1VMCA 1Q7YC 1AZQA 1CSPA 4JI0Q 1PZID 2VB3X 2HHHL 5FK9C 2EE1A 1J5EL 2K04A 5LMNW 1A0IA 4OIJA 4RGNA 3NP8A 4A3LG 3CAMA 2NWGA 1J6QA 4L5SA 1I4PA 3R2IA 1I4GA 2K6AA 1B7YB 4JV5L 4JBKA 1YNXA 2LXKA 4QF4A 3TP8A 2AUJD 1LT4D 3DMUA 3U50C 1CQFA 3J80L 3A8KE 4A76A 1GUWA 1KDBA 2BOSA 2MGSA 3GQBA 1XJVA 2JA7G 3PUWA 1Q90A 3EN2A 1I50H 3MEFA 4R4OA 4DV6L 2D5DA 5I9PA 3PIO3 1YITA 1PHJA 1SJED 1A3VA 4ZKBB 1E1OA 3KBXA 3H3VH 4PG3A 3VYTA 1ILQA 1HZAA 2B39A 2Y0SE 1MIUA 3D4WA 2PQEA 2HQEA 1PDQA 4L5QA 5HGTA 1CQVA 4DV5Q 1DZ1A 1G6ZA 2WINB 3PMFA 1GHJA 3AQQA 3D4RA 1VCIA 2A68C 2NTSA 2F0LA 1WTQA 3CP0A 3VR3A 5C0XI 5JEAG 5JAVA 2JA5H 1XNRL 4GOPB 1HNWQ 1LTAD 4X6AH 5J22A 1DONA 4JBWA 1QUQB 3GV3A 1QVGA 4K2LA 1VQOA 2AUKA 4JI3Q 1PH7A 1EWHA 1PV4A 4PMCA 1TY0A 1F2ZA 2V4DA 3FKIG 1FD7D 2J7ZA 4JC0A 1VQJA 1YBYA 4OGQC 3KLSA 3TS2A 1WI5A 3VA7A 2O4XA 4JI6Q 3P75A 5C3EG 2IHEA 3Q22A 1PFSA 3PUVA 1STAA 4PZ8A 2NZ1D 3M9BA 4DR6Q 1JT8A 2CW0D 1QB5D 1N36Q 1EQRA 3IFDA 1VQ7A 1Y1WB 5KNBA 2R7ZB 2K05A 2PQAA 2A6HD 4BY1B 5C3XA 5FJ8H 3J81L 2R92H 3IKJA 2Y0SB 1STGA 4J15A 1N32L 2XSCA 4GZYC 3I72A 3CC7A 3HOXH 1AN8A 4GKKL 4NXNL 2YTVA 1N33Q 2UUAL 3PO3H 3F2UA 1UE5A 1UUPA 1GUNA 1SYGA 1ICFB 4PNYA 2IW3A 4HR7B 1G291 3KBGA 1SE3A 1QCBD 1TS4A 4JI2L 3OMCA 4A3BH 2DJGC 4FYDA 2HHHQ 2OTLA 2FJ2A 3NUCA 4R8NA 4U673 3CCRA 4GNXC 1J5EQ 1LM0A 5IT9E 3JAME 1NMFA 2M9VA 5EPLA 3K0YA 3STBD 3M4PA 3S1NH 3IRBA 2OQKA 2HQLA 5I2XA 3ER0A 4DR5L 1D6EC 3MXNA 1NMGA 2XRQD 5M9OA 4G7ZC 4CDCC 5I6WA 4JV5Q 2B2WA 1MJEA 1BXTA 4A3MG 1Y69U 2PNHA 1K73C 1TWFB 3RR5A 5DLQE 1TWAH 2F0HA 3VR5A 5BN5A 4BWGB 3QO2A 1EOTA 1L0XB 1FJGL 1HPCA 4QY7A 4UPAA 1O7ZA 4DR7L 3H15A 1DYQA 1BR9A 3S24A 2R7DA 4MHEA 2H4OA 4UDUC 1HH2P 2BDOA 5FO9B 4YHHL 1B44D 4DV6Q 5C4JH 1WYDA 4OL7A 2Z4HA 2HIVA 1B2TA 2A19A 1Q81C 2SEBD 3S2DH 3U4VA 4A3KG 1EYGA 2WB1G 4DV7L 4IJLA 1BOSA 1X3QA 2F3IA 2XGTA 3SK5A 1BDOA 1GO3E 3QOJA 2NVQH 4BY7B 3W1BA 4K5WA 1KAAA 1PTOH 2VXWA 2EXZA 1WCMH 3NXWA 3PO2G 3SE0A 3GO5A 1LTTD 2G5DA 3S15B 5ELDA 3LWEA 5M3MB 4DV3L 4QUCA 1IW7D 3TRZA 1K0SA 3I7FA 3RMHA 3JAMi 2D62A 2KQ3A 3L7ZC 1NAPA 1YI2A 1XNRQ 2ALYB 2JA8G 3BVMA 4X3SA 4CJ2C 1PH8A 1Q8KA 3K59A 4H13C 4KJNA 2XIWA 4OO1H 1SMXA 3CPFA 1VQ4A 2WFWA 2K03A 3NTHA 4N9PA 4MNOA 1X3PA 2FHTA 1CKNB 1Y8OB 1CZGA 3MFGA 5EGTA 4HSVA 4BBSB 2IPKD 4HJ5A 2UUBL 3H94A 2HD3A 4OONA 3DEPA 1UE7A 4LF8L 4DKAC 1KRSA 4DAMA 2XRSD 5C4XH 4IPHA 2BE5C 3RZOH 2B2TC 3DLLA 3S14H 4C2MH 4P71A 1S3OA 2Q8RE 3I90A 2RHQB 3FMCA 3VA5A 2OTJA 3NE5B 2PNRC 1ET9A 1EQTA 2VS1A 3NK9A 1G2SA 4IURA 1N32Q 2EYFA 4A3DB 5C44H 4K14A 2EYMA 2MO0A 1VDZA 2XTIA 4GKKQ 3AFPA 4OWTB 4A3GG 4NXNQ 2EY1A 4K2KA 2YU9B 5C0XG 2UUAQ 1CKOA 4LJZC 2N78A 3PIPA 3KFUA 1RTOA 3CF5A 1ML0D 2RF4A 4LK1C 3A5UA 4GNXB 2L5TA 3SEBA 4QQBX 1IHZA 4RA8A 2Z9HA 3S1QB 4FF2A 4JI2Q 1W2BA 4XIGS 3K5NA 3NQIA 4B3ML 5BR8L 5IYDH 4AIMA 3P20A 4FXKC 3KF8B 1MKHA 3CQZH 1B3AA 2LSSA 1IYVA 1MJCA 2VQEL 1VQBA 1DJRD 1G51A 1MBYA 3Q8DA 2EJGC 2VQFL 2F0JA 4DR5Q 2JA6H 1LTID 1LTRD 3D0FA 1YHBA 2ENBA 2K33A 1OXUA 4LF4L 4P2CB 1VQHA 4A3JG 2B3GA 3BJUA 1STHA 3K80C 3D3RA 2SNSA 3EQLC 1YJWA 2GA4B 4DN4M 5IGDA 1ZYRD 1U4PA 1FJGQ 3C46A 4H7BA 1SE4A 1UE1A 5GQOA 4CKEA 4DR7Q 2F0SA 4QJFA 4K5VA 4AYBG 4HMIA 2NVXB 1X3EA 4YHHQ 5JOBA 4HJ9A 1GHKA 3E9HA 5IP7G 3NBHA 2PW5A 1STNA 3GDEA 5IIFA 4IUUA 2E5LL 3P7JA 4XT1B 4DV7Q 1SMYC 3CCQA 3T1HL 4A3FH 1HZBA 4C3JG 1S5FD 1TIID 1PRTC 1YEZA 1O80A 2A74C 2OEOA 2WAQG 1HUMA 4QL5A 4Q0FA 5IT9L 3JAML 5CV4A 1TY2A 4DK0A 4DV3Q 1XX8A 4TKOB 4BBRH 3HOVB 4MTKA 2OWOA 2ASBA 3F2CA 3NBHB 3DWQA 4MIUA 1SROA 2Z1CA 2WIIB 3EFXD 3HG9A 2N8NA 4WRDA 1MGSA 1HTPA 1Y1VH 1F77A 3L9AX 5FO7B 1ILPA 3MXGA 1H9SB 1I6HB 3DHQA 1MSGA 3PUZA 4ZQ3A 1STYA 1O7IA 2N3SA 2O5JC 3WWVA 1LTBD 1D1IA 1V43A 5ELFA 3LNNA 3J7A5 2UUBQ 4CDDC 3ICEA 1RL2A 3HZXA 2B2YA 3GTGB 4LF8Q 1TR5A 3VR2A 3H6MA 2CVRA 1BNZA 3I3CA 4OX9L 2PZTA 4GN4B 4KHZA 2K5VA 1L1OA 2KCTA 3TDQA 1SJHD 3M3YB 3M4QA 4RMFA 1UE6A 2CH4A 1LT6D 2K5DA 1RD9D 1SEBD 2SOBA 4P74A 2E2IB 1A8VA 2Z6KC 4X65L 3UDFA 4U68A 4NXML 2F1MA 1S5BD 3SHLA 4XQNA 5EQ0A 1A3TA 1ET6A 5C5LA 2VNUD 5J39A 5GROA 5IGFA 1PH3A 4KN7C 4G7OC 4YY3L 3HOYH 1CHQD 3MEHA 2A6HC 2Q2TA 1I4XA 5AJ3L 4LNQA 5C3WA 5JJKA 5IGGA 3D6WA 5M3FH 2J4XA 3AMUA 2EYPA 4B3MQ 5BR8Q 4RCNA 2C9OA 1LACA 5ELBA 3HP3A 4CDEC 2VQEQ 3GTPH 5CBEE 5FO8B 2KEEA 2E2DC 4XQQA 2VQFQ 4XXEA 1YZ6A 3NPPA 4A93H 1X9NA 1T9HA 4IFDI 5EKIA 2L15A 4AH6A 3FKIB 2AQ3B 3T56B 4LF4Q 2JA5G 4NMZA 3BU2A 3NENA 4YIJA 1JJ2A 3HOZH 4X3KA 4TQUS 3DWAA 5C3EB 1ESFA 1SYFA 2N88A 3A7AB 1T5XD 3S17B 1K0RA 1ZEQX 2F0TA 3F2DA 3MTSA 4O2DA 3AU7A 4IPCA 2PZUA 2BE5D 3FPUB 3PIP3 5D65A 1DOKA 1N34L 1PRTB 2NVYB 2KVMA 2E5LQ 5FLMH 1TT2A 1PYBA 1QE6A 3O13A 3Q0AA 3T1HQ 1OXVA 2WB1E 3GD7A 1NBWA 2LXJA 1UEBA 2IHFA 2KCMA 2KBNA 2JJQA 1TWGB 5FJ8G 4IFDJ 3ND9A 2R92G 2L55A 1TXYA 3BDOA 1HRJA 5CV7A 3FRPB 2HUGA 1PRTF 2TMPA 3HRZC 2NN6H 3D31A 2ZJQA 3HOXG 1QVFA 1PTOD 3TZDA 3A54A 4YCWA 3QJYA 3PO3G 3W3AA 1S5ED 4P73A 2RKSA 2L11A 3D8GA 3HOUB 2F4IA 2Z6KA 5IGCA 4PZ6A 1V1PB 3CRLC 1IW7C 1RTNA 1FGUA 1B3QA 2L4NA 1TWFH 4A3BG 1O7LA 4PMBA 1V1QA 4B9XA 1CFMA 4A3MB 5KEEA 1M4VA 1AE2A 5JPNC 2OT2A 1KLUD 1D5MC 4QMGA 2I0QA 4JYAL 4KV6A 4OX9Q 4ZK9B 1YHAA 5JPMC 1GXDC 3I4LA 1IKMA 5CGKA 1BO0A 2E2HB 1PA6A 1JJCB 1NNXA 2DY7A 2OQ0A 1R9TB 3ITPA 2MJ8A 3KLSX 2JA9A 2NVTH 1H95A 3UE0A 1GJXA 2LKVA 1NUCA 1R4QB 4X65Q 4NXMQ 4RH6A 1P16A 4HIOA 3MWYW 1EL0A 1HCZA 2WB1B 5I6YA 1VQDA 3UDGA 5E4WC 2BH2A 2OF1A 4BY7H 5LL6S 4YY3Q 4HIDA 5K36H 1GUOA 3QB3A 3HKSA 1CTMA 2SDFA 3RZDB 5CV5A 1XNQL 5IGBA 5AJ3Q 1XXGA 1HHVA 3E3XA 1TKWB 3PO2B 5NUCA 1SMYD 1SFOH 4HCEA 1YJNA 4OELB 1D5XC 3CKIB 1Z47A 1PRTD 2JA8B 2KEDA 5T1IA 1VQFA 3GP7A 1EYDA 4HSPA 1SXTA 2X69A 1ZXTA 4YWMA 3CCMA 4PZ7A 2A1AA 1BQQT 2QILA 4LF7L 4GOPA 1S40A 1WCMG 2F52A 1QUQA 2UXBL 2EDGA 1JE5A 3G7LA 4R9WA 3S1RB 4C3IH 4K0KL 4XTCS 2EJFC 2E2JB 3HOWH 3J80c 2MFIA 1HTLD 2MO1A 2DNCA 1SDFA 3OIPA 4CDFC 4F87A 5LMUL 3IAYA 4OO1G 3SK6A 2DY8A 4FXDA 2YTYA 1F9RA 2AHOB 1KD1C 1CT1D 4A3IH 1IBKL 3K7UC 2GVAA 1AH9A 1CUKA 1ENCA 1KDCA 5I2YA 2PI2E 1U4MA 1ENFA 2FMCA 2HDLA 4AYBE 4G7HC 4WFN3 1N34Q 2YU9H 2QCPX 4C3HH 1I3QH 3GTKB 1ZYRC 2I5MX 4E6IA 5C4XG 3L3OC 1R4PB 4V190 1K83H 1VQ6A 3GTQH 2A69D 4ULLA 3V96A 1LYLA 4EQPA 2I5HA 4Z9CB 4EGVA 3K7AB 1VQIA 2WAQE 3TP5A 4RGTA 1VQGA 1CM9A 5E4XA 2PO4A 3K6OA 3H09A 5C44G 2Q2HA 1PLFA 1U4RA 3TP7A 3T1YL 1Z9FA 4YCUA 4UP8A 2F03A 1II3A 4MTNA 1JOKA 4YCVA 1X3FA 3H3VC 2KJXA 5IWAL 4A3EH 1EIGA 5IYCH 3GTMB 2E8GA 4Q5VA 3F2BA 5IOCA 4J6HA 1LTGD 5I4DA 1BBUA 2K5QA 4JI4L 2F0MA 2B63H 4A3JB 3HS0C 1EQVA 5IYDG 1PH9A 3G4SA 1Q86C 4LFBL 3TMEA 1RKNA 2D0OA 5A2QE 4JYAQ 4XYQA 1XWEA 2K1BA 3AEVA 1OXTA 2JA6G 2G9DA 3OMGA 2NN6I 4LAAA 3M7NA 3R2TA 4AYBB 3J81c 2E75C 5M5XB 4HN7A 5HGQA 5LL6X 2AWOA 3GTOB 4R4TA 2SNMA 2LY7A 4ZLTF 3S2HB 1Q3LA 4X3UA 3A0JA 3M4OB 2EVBA 5KNDA 1S72A 1BUVT 1KL9A 2AMCB 3HFZB 1KABA 2I07B 2KCNA 5G3LD 1M8AA 4C3JB 4G57A 1XNQQ 4Y7NH 1U5KA 5ELCA 5C4HA 2WAQB 5I9OA 5D3DA 4MZ9A 2ZXRA 3ND8A 5J1ZA 1HQMC 3R8BA 3BVGA 1B9MA 2EXDA 2EY5A 1NR4A 3CCLA 4POGA 3GTJH 2H1EA 1W6JA 1E0BA 2ZXPA 5GAEC 2RA4A 3BG3A 1GUSA 3CCSA 4A3FG 5FLXE 4KD4A 5EKLA 1Z7TA 1XPOA 1EY4A 4LF7Q 1RDPD 1I94L 4GLXA 4IUNA 2UXBQ 1SYDA 3H0GH 1TU2B 4JOIC 1FNWA 4BBRG 2RQXA 3PQIA 1A3UA 2K5NA 4K0KQ 4S3SA 1SSOA 1SE8A 4ME5A 3K81C 5LMUQ 1CK1A 1CKNA 1Y1VG 3HEJA 2H5XA 3OWEB 3S1MH 2QW7A 1IBKQ 4YWKA 5D3IB 2Q8IB 2DNEA 4C56C 5KIXA 3C3LA 1SNCA 2IJ0A 5DNFA 2R93H 1TWHH 4RFBA 4IJHA 3KJPA 1EWIA 1YJ9A 1ASZA 1EWCA 1CZWA 4B3SL 3IFTA 4K6LA 1PH2A 2VUMH 2CWAA 2QDBA 4B3TL 4DK1A 1OXXK 5CBAE 4OWXB 1I50B 2B2VC 3S16B 2B8GA 2F4VL 1E3PA 4IN3A 1H9RA 3X3NA 4JI8Q 1WTOA 2F0NA 4FF3A 4HCSA 1FNUA 2X6GA 4HMJA 3WOFA 3T1YQ 1O7YA 1BKBA 5EJWA 4GNXA 2RVLA 1JJGA 1VQAA 1PH6A 2N55A 5CR3A 3E6ZX 4GS3A 4YWLA 1DXMA 3RD4A 3HOYG 3D4DA 5IWAQ 2BDNA 3ONAB 3BDLA 1JE4A 4FP5D 1DM0B 4IFDH 3MHBA 5CC4A 1WFQA 2L12A 3OWFA 3KF8A 5M3FG 3A56A 4L6TB 4M1UB 1EY8A 2RSNA 4JI4Q 4EX5A 4LFBQ 1KHIA 1EIHA 1YVCA 1BCPC 1PTOC 5TSSA 1YNND 1EOVA 1QZHA 3VR6A 4APVA 4JI1L 5D14A 4GN3B 3EIVA 3NTIA 1QOHA 1JMCA 2PPBC 1YIJA 4UAIA 2Q2IA 4A93G 2IWHA 3K0XA 4HIMA 1MI2A 3I4MH 3DEOA 2ZJPA 4DR2L 4NPSA 2JYOA 5FOBB 2UUCL 3HOZG 3CRKC 1LT3D 4A3CH 3U4ZA 2YTXA 2K5HA 3EBEA 1X54A 4RGOS 3DM3A 2KCCA 2AQ1B 2JQOA 1PFBA 4L63B 3PSIA 3GTLH 2Y0SG 1SNDA 1HFNA 4IUTA 2JK8A 4DNIA 2D0PA 3RNUA 1TS2A 2JSOA 3HOXB 5FLMG 4H0LC 1W6KA 4H44C 4K6DA 3I4NH 1EY0A 1J8IA 3HOUH 3NBIA 5F2DA 3PO3B 2RHSB 4FXGC 3C1FA 1I94Q 4LUOA 5KYLA 1RCVD 3ERSX 3CPWA 3A74A 4IUQA 1M90C 4BXXH 2CH4W 3TP6A 4DAYB 1WD1A 4JW0A 1EYCA 1H9SA 1C9OA 1ASYA 5JJIA 2NN6G 1SLJA 4I7ZC 1PFMA 3SGIA 1DCZA 3AFQA 2B2VA 1MSHA 1S4ZA 1IBLL 1VQKA 1F2YA 2R3ZA 3B6YA 4N8FA 2EY2A 5IYBH 3K5LA 5KNCA 2ZM6L 1HXYD 3SVMA 2E2HH 3S1NB 2A8VA 2QEXA 2EYLA 5EBCA 2B2UC 2B2TA 1H9MA 2VW9A 2MHVA 3LGJA 1HA5A 1D7QA 3FPPA 3I55A 3KK7A 3NWTA 4NP5A 1CHPD 3V2TA 3G71A 1OXSC 3W2DA 1RIPA 4FNFA 4ZKCB 2D9UA 1EIFA 4B3SQ 1Z6HA 2UXCL 3J80E 4CGYB 4B3TQ 1C0AA 2K50A 1A6XA 2PW7A 5IT9c 3QG1A 4KMUC 3JAMc 2F4VQ 3PF4A 1Q12A 2Z6BA 1K3RA 4KY7A 3NQTA 1G8ZD 5FLXL 5C4JB 1T5EA 2EYJA 3FDTA 2JA7B 3WOEA 1XTCD 3S2DB 4O0AA 2NBFA 5KYIA 4HJ7A 3N52A 1FYCA 5COYA 3ZYYX 4ABNA 4BY7G 3JC66 5K36G 2A69C 5ELOA 3N6RA 1TQOA 3CHBD 4HEDA 1D5ZC 5KRUA 4KKUA 2NVQB 2JP1A 4QUFA 1BCPB 1PTOB 2QGQA 1WCMB 1HJPA 3Q23A 3NTKA 4IUVA 5EBDA 1NCVA 4KY6A 4HAEA 1ICWA 5C4ZA 4R8IA 2F0PA 1QNKA 5CYUA 1KRTA 4EQ5A 2CHBD 2LFNA 4DUZL 4JI1Q 3KF6B 1JWUD 3EJIA 5BN4A 3PUYA 4JCVE 3SDZA 1GD7A 3U9OA 3BZKA 1BCPF 1PTOF 3PF5A 1PH5A 4EQOA 4I7AA 3U58A 2EJMA 2WKCA 4C3IG 4DR2Q 1AFPA 3HOWG 2UUCQ 1HR0L 3T4AC 3OPOA 1G6PA 1RODA 5C4XB 4OWWB 2R6GA 5A35A 1A2TA 1VQ5A 3RZOB 2HCCA 1O78A 1XPUA 1VF5C 4A3IG 4EVOA 3S14B 3K7AH 3NELA 3VDYA 4C2MB 2K7VA 3G6EA 1EIYB 1K8MA 3TQYA 4RAUC 1Y1WH 1K8GA 1C4QA 2R7ZH 2RDGA 2WV6D 3MA2B 5IODA 3NWSA 2HT1A 4BY1H 4EQNA 1I4HA 1LABA 5JVG3 1CA6A 4LF9L 1D2BA 5C44B 2JE6I 3J81E 4C3HG 4IOCA 2ZT9C 2B2UA 3T51B 1PYWD 3F1ZA 4RG1A 2MUYA 5EAYA 1L0WA 1B70B 2HIXA 5E7NA 2E76C 4R4IA 2Q2UA 3C1EA 1VQCA 2MP1A 2FFKB 1CI3M 2K01A 1EYAA 1C48A 3CU7A 4B3RL 2XWBB 2JEAI 3FHWA 5JJZA 4DNTB 3HGBA 1V1PA 3CQZB 1IBLQ 3KDFB 1N9WA 5C6AA 2ZM6Q 1GM5A 1IYUA 4A3EG 1E2VA 3M7GA 1FNVA 4KHPQ 1GKHA 3K8AA 2JA6B 5IYCG 5M5XH 1F2LA 5M5YB 1BCPD 1E2WA 1YNJD 3OIQA 1EZ6A 3A7LA 1EEID 4G4KA 1OO9B 5IP9H 3X3MA 4B08A 5ISRA 2CQOA 2B63G 4CBVA 3CCUA 1F2MA 2KOLA 4XYOA 2CQAA 3UE1A 2K75A 1K28A 2VZAA 2QKIC 4RWSC 1X3GA 3A8JE 3NEMA 4J1MA 3E5SA 2RCNA 2UXCQ 1WTRA 2RSOA 2O5IC 4WJWA 1BVSA 1FGBD 2K4KA 1WTPA 4WJ4A 1LLRD 1SYBA 3I73A 4DR1L 2A73B 1EY5A 3DM1A 3M4YA 1L2FA 4HIKA 5IY0A 3RLFA 4OEMB 5H1SE 1WTVA 4QIWE 2K28A 3CXCA 2F0IA 4CKBA 2K5WA 2UXDL 3C2PA 1VS0A 4DR3L 4KKSA 1F9QA 2PMZE 2P5ZX 4LF6L 3QWNA 1GOZA 1RHPA 3NSWA 4R4CA 1NJIC 4BS9A 4PQXA 4DAVA 1XTDA 1K9MC 1E7ZA 4JG2A 4M8AA 4A3KB 1VQLA 2UU9L 2BCOA 1JOQA 4BBRB 1Q82C 2RDHA 3CW2C 3S15H 4AQYL 5M3MH 3DXJC 4RCOA 4X3TA 1JR0D 1WTHA 4L5TA 4UP7A 3PGZA 4DUZQ 2ZTDA 1GUTA 4HJ8A 1Y1VB 1EFWA 1IL8A 1P8LA 2M2LA 4BA2I 3PV0A 1V1OA 4ZRZA 2M00A 3H0GG 4MN3A 1EFID 3J81j 2AKWB 2J0TD 1DD2A 1A15A 2F0QA 1E2ZA 1HR0Q 4PV1C 1YNNC 2V1CC 4BBSH 3HKZG 3ERQA 1E24A 5C5MA 5LHY1 3KYHC 3G48A 2EIFA 3U9SA 3S16H 1VQPA 5AFWA 4DA2A 4LW1A 2F0DA 5DM63 4GLAC 1FVIA 1J9OA 1QG7A 2YV5A 4ME3A 2IY5B 4QIWB 3AB9A 2PCFB 2KHJA 5FKAC 1GUGA 2VL6A 4LF9Q 1IKLA 2CCZA 2NYZD 2R93G 3QIAA 2B2WC 2PMZB 1SE2A 1ESRA 4A3DH 2VUMG 2DJFC 3BVZA 3DWPA 1KNAA 3HOYB 3K58A 1IL2A 4JI7L 1QVCA 3UDIA 1SNOA 4A3GB 3OOCA 4LFAL 5ELNA 5M3FB 2ATWA 3TN2A 4N9TA 5G3LF 2YYZA 1NY4A 4C1NK 4B3RQ 4IALA 2R61A 3RN2A 3MVVA 3S1QH 1Y14B 1ZKOA 2WACA 4PMWA 3I91A 5GADC 4JI8L 3GTPB 4DNRB 1VQ9A 4RHRA 1PXUA 3UI2A 4IFDG 1HZ9A 2JEBI 1DGSA 2WP8J 2DUDA 1X56A 1CSQA 4A93B 4JBMA 1UNSA 3EA6A 2Z4IA 5HY6A 2X6LA 4DV2L 2IX3A 4QGUA 1SAPA 4ZCKA 1PYSB 3HOZB 2PI2A 3V05A 2AWNA 2GVBA 3P1HA 1HQRD 2ICEC 1SRUA 2VY3A 2ZTCA 5EKKA 3J7AV 4IZ8A 4JPBW 1EU3A 4DK3C 3LX0A 4DXFA 4DR1Q 1JWMD 3NHHA 1IZ6A 1AW7A 1DOLA 3R3OA 5C0XJ 5E3FA 4P75A 4IQZA 4ALPA 3I4MG 3I8ZA 5JVH3 3CCVA 1X32A 1SYEA 2NVXH 3GV6A 2EY6A 2EOTA 4N8X1 3SK8A 4A3CG 2UXDQ 4DR3Q 3K57A 2PQAB 4X66L 1H9KA 3BZCA 3OW2A 1PZJD 4LF6Q 1HZCA 3BZDB 3QR8A 2A5HA 4FDBA 1PVOA 3KOJA 1DOMA 3KUPA 4KI0A 2UU9Q 1G91A 3T13A 1KLGD 1U4LA 2Z8LA 4HJAA 2G9HD 3M85A 4DR4L 3BDCA 5CV8A 4AQYQ 1WOCA 2RCFA 3HOVH 1TWCB 4FVMA 4DAPA 3I4NG 3URYA 2ZTEA 3HOUG 4FO2A 1LTLA 3T53B 3MAQA 1L0YB 2NZHA 2KECA 1WTXA 2VB2X 5M5WB 4A3LH 1SR3A 1I6HH 2NB0A 1STEA 4BXXG 2EYHA 4XT3B 1X55A 1QWYA 5DAUA 3MXPA 4Y52H 3TEHB 5KGUA 3ULPA 4DGZA 4JK1C 3CD6A 1N8RC 3I2ZA 5IYBG 4POFA 3MXNB 4X62L 3GTGH 4KLKA 2C5CA 1JCKB 4DV1L 2WKDA 2JA7H 2QA4A 1X6OA 1JC7A 3M3YH 4K8JA 3W5OA 2NVTB 2F0UA 3VR4A 4XDXA 3MXUA 2F0GA 2IX1A 1I4RA 3RLOA 1STBA 1B1ZA 1NR2A 4JVZA 2E2IH 1M1KC 1X65A 4CHTB 4DXGA 1EUJA 1QZGA 2O2LD 2R7FA 4JI7Q 1I6VC 1LTSD 2NTTA 2JN4A 2XWJB 4K5XA 1HR0W 4H02A 4TRDA 1KNEA 3KLWA 4LFAQ 1LO5D 1AZPA 1EY7A 1A63A 4BA1I 1SFOB 5LMNL 3VYRA 1VQNA 4ZUIA 5IGEA 4JBJA 1UWVA 4OXPA 4F7XA 1VQEA 1JQYD 3RN5A 2XVSA 4ID6A 5JEAH 1KXLA 1HUNA 3H3VI 1U9RA 1MHWC 4L8JA 2L0CA 4LMQD 4NDXA 4RKBA 3UDXA 4FF4A 3EVQA 1I4QA 4IPGA 1QILA 1SNMA 1JB3A 3OSOA 2K32A 5GAGC 1Y8PB 4C3IB 2FXQA 2CWPA 4R4QA 4DV2Q 3FKIH 2OCEA 1TS5A 4DUYL 3HOWB 1S5CD 3LWUA 2F0VA 1VMPA 3I4OA 4KHVA 4DFAA 3OTOL 1CA5A 2JA5B 5C3EH 3W1GA 3KJOA 4A3IB 1YNJC 2MQHA 1HNZL 5CMDA 4GLVB 1NTGA 3OW7A 3S17H 1U0LA 1S5DD 2OXPA 3A8IE 5JJLA 1MD2D 3Q6SA 5CV6A 4ZYSA 1ONLA 3VYSA 3CMAA 1JORA 3MZ5A 4C3HB 1JB7A 1I3QB 2EZVA 4I65A 4X66Q 1WTWA 1K83B 4O1NA 2B2YC 2ZXOA 3A55A 2NVYH 3EROA 3GTQB 2IX0A 2BH8A 4KN4C 2HDMA 3MC0B 2NUCA 2EYOA 4ILWA 3BYTB 1L1OC 2QEJC 1Y1WG 2R7ZG 4BY1G 4JOIA 2A6EC 1KIXA 1RF2D 4DR4Q 1TWGH 1PH4A 2XN9C 4LF5L 1CKMA 2A68D 4ODGA 3FVQA 5CORA 4LFCL 3VYUA 1B50A 2R92B 3E0EA 1XMOL 1VQ8A 1VF7A 4B9WA 1UEAB 5M5YH 4IO9A 1FL0A 3K5OA 4DAYA 2HCIA 1EEFD 2LMCB 4A3EB 1SNQA 2FINB 1KTKA 3D6CA 2XNAC 3BS1A 1KDAA 4KJOA 1Q1EA 2KUMA 3RLNA 2QDLA 2B63B 1NSNS 1XYIA 1IYJB 4RKLA 3CCJA 4CKCA 1Q8IA 2B8FA 1F9PA 5A2QL 4OIKA 4R1JA 4A3MH 5BN3A 4X62Q 4F8MA 3I56A 3HKZE 3E9IA 4A3BB 2KHIA 2F0FA 1B53A 4DV1Q 4F88A 1WD0A 3SR1A 4KKTA 3ZJYC 5HURA 5IP9G 1PFNA 5T1GA 2TSSA 1TVXA 4KHPL 1R9TH 1BBXC 2I46A 3L2PA 1SNPA 2PYKA 3WDNA 2RDFA 1EU4A 4A3KH 4DV4L 1BF4A 4Y7NB 1TWAB 1I5FA 1EY6A 4X64L 3MFYA 3TZUA 4QCLA 1JWSD 2K14A 2D2CC 2CFMA 1V8QA 5EPKA 5LMNQ 3RZDH 3FP9A 3TSSA 4A75A 5L37A 3PO2H 1K3BC 3GTJB 1QNUA 4GN5A 1W3SA 4JI5L 4NW2A 1B4OA 1EY9A 1AEXA 2JA8H 5K5PA 4GKJL 3J7ZC 1HNXL 4J8QA 3PIOA 4DV0L 1E1TA 4IUPA 1Q46A 3PCOB 4HTHA 3H0GB 3K5MA 1IBML 4OHJA 2F3VA 2KHSA 3KF6A 1SBBB 1IXRA 2KA7A 1Y8NB 5M3MG 1XMQL 4DUYQ 1K8AC 5E1FA 4C1NI 5DEHA 3S1RH 3HKZB 4LWCA 4JI0L 2E2JH 3OTOQ 3S1MB 4A4IA 1EZ8A 3IL8A 1PMRA 4KTAA 2EPBA 1D1KA 2F0EA 4TSSA 2JXMB 3E0JA 5DM73 1HNZQ 3AYHB 1B9NA 3QOLA 1JICA 2L1BA 4UY8C 4OO1I 2DN8A 5FLXc 1C7YA 2RBMA 2F3WA 3ULLA 5GAHC 3BYYB 1OTCA 1G2TA 3TS0A 4BBSG 2R93B 1TWHB 4WJ3M 2CW0C 4RHSA 1L1OB 1B8AA 3S9WA 4UHVA 1SYCA 2VUMB 5CV9A 2IL8A 2MPMA 2E74C 3GTKH 2F0KA 2F0WA 4DU9A 4A3GH 1HFGA 2CKZB 1ENAA 1WVLA 2KENA 3J80i 4DPGA 4KD3A 5C0XH 4K8IA 3I70A 3J7AF 4KY5A 1YHQA 1GVPA 4DK6C 1PH1A 2I5LX 4LF5Q 1XPRA 4LFCQ 2F0OA 4O42A 1AP0A 4A3DG 2NZOA 3FEWX 1XMOQ 1Q1BA 1SN8A 3TBIB 1PZKD 2DGYA 3H91A 2N49A 3ULJA 3Q24A 2ZJRA 2BA1A 1V9PA 1D8LA 4DV5L 3KDFA 2ES2A 5JEAJ 3RUZA 3GTMH
chains in the Genus database with same CATH topology
4KK7A 5EPJA 4ZAIA 1LV9A 3J7YW 1RJTA 2FMMA 1HA6A 2L9HA 4WORA 3OHXC 1K8OA 1UAPA 2ID0A 3G6JB 3I4MB 1H9JA 1JOOA 2LS01 1LT5D 2IT1A 2Q8TA 2PZWA 1FR3A 4CJ1B 4ZUJA 3PUXA 2AQ2B 2QF7A 4NKLA 3GTLB 3DUZA 4V0BA 4CJ0B 4RGMA 3SK4A 4XQJA 3T16A 4QB4A 1F9SA 3I4NB 2A6ED 2ICIA 4DF7A 1C8CA 5ELEA 4FF1A 1A2UA 4A3FB 3SXHA 3KLRA 1TS3A 3R93A 1QJOA 2BA0A 1VMCA 1AZQA 1PZID 2VB3X 5FK9C 2EE1A 2K04A 4OIJA 4RGNA 3NP8A 2NWGA 1I4PA 3R2IA 1I4GA 2K6AA 4QF4A 3TP8A 2AUJD 1LT4D 3DMUA 1CQFA 3J80L 3A8KE 1GUWA 1KDBA 2BOSA 2MGSA 3GQBA 3PUWA 1Q90A 2D5DA 5I9PA 3PIO3 1SJED 1A3VA 4ZKBB 3KBXA 3VYTA 1ILQA 2B39A 3D4WA 2PQEA 2HQEA 1PDQA 5HGTA 1CQVA 1DZ1A 1G6ZA 2WINB 3PMFA 1GHJA 3D4RA 1VCIA 2A68C 2NTSA 2F0LA 1WTQA 3VR3A 5C0XI 5JEAG 5JAVA 1LTAD 5J22A 1DONA 4JBWA 3GV3A 4K2LA 2AUKA 1EWHA 4PMCA 1TY0A 1F2ZA 2V4DA 1FD7D 2J7ZA 4OGQC 3KLSA 3VA7A 2O4XA 3P75A 3Q22A 3PUVA 1STAA 2NZ1D 2CW0D 1QB5D 3IFDA 1Y1WB 5KNBA 2R7ZB 2K05A 2A6HD 4BY1B 5C3XA 3J81L 3IKJA 2Y0SB 1STGA 2XSCA 4GZYC 3I72A 1AN8A 3F2UA 1UUPA 1GUNA 1SYGA 4PNYA 2IW3A 4HR7B 1G291 3KBGA 1SE3A 1QCBD 1TS4A 3OMCA 4FYDA 2FJ2A 3NUCA 4R8NA 4U673 5IT9E 3JAME 2M9VA 5EPLA 3K0YA 5I2XA 1D6EC 3MXNA 2XRQD 5M9OA 4G7ZC 5I6WA 2B2WA 1BXTA 1Y69U 1TWFB 5BN5A 3VR5A 2F0HA 4BWGB 3QO2A 1EOTA 1L0XB 1HPCA 1O7ZA 1DYQA 1BR9A 4MHEA 2H4OA 4UDUC 5FO9B 2BDOA 1B44D 4OL7A 2Z4HA 1B2TA 2SEBD 1BOSA 1X3QA 3SK5A 1BDOA 3QOJA 4BY7B 4K5WA 1KAAA 1PTOH 2EXZA 2VXWA 3NXWA 3SE0A 3GO5A 1LTTD 3S15B 5ELDA 3LWEA 5M3MB 4QUCA 1IW7D 3RMHA 2D62A 2KQ3A 3L7ZC 1NAPA 3BVMA 4X3SA 4CJ2C 3K59A 4H13C 4KJNA 2XIWA 4OO1H 2K03A 3NTHA 4N9PA 1X3PA 2FHTA 1Y8OB 1CZGA 3MFGA 5EGTA 4HSVA 4BBSB 2IPKD 3H94A 3DEPA 2XRSD 2BE5C 2B2TC 2Q8RE 3I90A 3FMCA 3VA5A 3NE5B 2PNRC 1ET9A 1EQTA 3NK9A 1G2SA 4IURA 2EYFA 4A3DB 4K14A 2EYMA 1VDZA 2EY1A 4K2KA 2YU9B 5C0XG 4LJZC 1RTOA 1ML0D 4LK1C 2L5TA 3SEBA 1IHZA 4RA8A 3S1QB 4FF2A 4XIGS 3K5NA 3NQIA 3P20A 4FXKC 1B3AA 1IYVA 1DJRD 1MBYA 2EJGC 2F0JA 1LTID 1LTRD 2ENBA 2K33A 1OXUA 4P2CB 1STHA 3D3RA 2SNSA 3EQLC 2GA4B 4DN4M 5IGDA 1ZYRD 1U4PA 3C46A 4H7BA 1SE4A 4CKEA 2F0SA 4K5VA 2NVXB 4HMIA 5JOBA 1GHKA 3NBHA 2PW5A 1STNA 5IIFA 4IUUA 3P7JA 4XT1B 1SMYC 4C3JG 1S5FD 1TIID 1PRTC 2A74C 1O80A 2OEOA 1HUMA 4Q0FA 5IT9L 3JAML 5CV4A 1TY2A 4DK0A 1XX8A 4TKOB 3HOVB 4MIUA 3DWQA 2Z1CA 2WIIB 3EFXD 3HG9A 4WRDA 1MGSA 1HTPA 3L9AX 1F77A 5FO7B 1ILPA 3MXGA 1H9SB 1I6HB 3DHQA 1MSGA 3PUZA 4ZQ3A 1STYA 2O5JC 1LTBD 1D1IA 1V43A 5ELFA 3LNNA 3GTGB 3HZXA 2B2YA 1TR5A 3VR2A 3H6MA 2CVRA 1BNZA 3I3CA 2PZTA 4KHZA 3TDQA 1SJHD 3M3YB 1LT6D 2K5DA 1RD9D 1SEBD 2SOBA 2E2IB 4U68A 2F1MA 1S5BD 3SHLA 4XQNA 5EQ0A 1A3TA 1ET6A 5C5LA 2VNUD 5J39A 5IGFA 4KN7C 4G7OC 1CHQD 3MEHA 2A6HC 1I4XA 5C3WA 5IGGA 3D6WA 2J4XA 3AMUA 2EYPA 4RCNA 2C9OA 1LACA 5ELBA 3HP3A 5CBEE 5FO8B 2KEEA 2E2DC 4XQQA 4XXEA 3NPPA 4IFDI 5EKIA 3FKIB 2AQ3B 3T56B 4NMZA 4YIJA 4X3KA 4TQUS 3DWAA 5C3EB 1ESFA 1SYFA 2N88A 3A7AB 1T5XD 3S17B 1ZEQX 2F0TA 3MTSA 3AU7A 2PZUA 2BE5D 3FPUB 3PIP3 5D65A 1DOKA 1PRTB 2NVYB 2KVMA 1TT2A 1QE6A 3O13A 3Q0AA 1OXVA 3GD7A 4IFDJ 1TWGB 3ND9A 2L55A 3BDOA 1HRJA 5CV7A 3FRPB 2HUGA 1PRTF 2TMPA 3HRZC 2NN6H 3D31A 1PTOD 3TZDA 3A54A 3QJYA 3W3AA 1S5ED 2RKSA 2L11A 3D8GA 3HOUB 2F4IA 5IGCA 1V1PB 3CRLC 1IW7C 1RTNA 2L4NA 1O7LA 4PMBA 4B9XA 1CFMA 4A3MB 5KEEA 1M4VA 5JPNC 2OT2A 1KLUD 1D5MC 4QMGA 4KV6A 4ZK9B 5JPMC 1GXDC 3I4LA 1IKMA 5CGKA 1BO0A 2E2HB 2DY7A 1R9TB 3ITPA 2MJ8A 3KLSX 1GJXA 2LKVA 1NUCA 1R4QB 4RH6A 3MWYW 1EL0A 1HCZA 2WB1B 5I6YA 5E4WC 2OF1A 5LL6S 5K36H 1GUOA 3QB3A 1CTMA 2SDFA 3RZDB 5CV5A 5IGBA 1XXGA 1HHVA 1TKWB 3PO2B 5NUCA 1SMYD 4HCEA 1D5XC 3CKIB 1Z47A 1PRTD 2JA8B 2KEDA 5T1IA 3GP7A 1EYDA 4HSPA 1SXTA 2X69A 1ZXTA 2QILA 1BQQT 2EDGA 3G7LA 4R9WA 3S1RB 4XTCS 2EJFC 2E2JB 1HTLD 2DNCA 1SDFA 3OIPA 4OO1G 4F87A 3IAYA 3SK6A 2DY8A 4FXDA 1F9RA 1CT1D 1ENCA 1KDCA 5I2YA 1U4MA 1ENFA 2FMCA 2HDLA 4G7HC 4WFN3 2QCPX 3GTKB 1ZYRC 4E6IA 3L3OC 1R4PB 4V190 2A69D 4ULLA 3V96A 4EQPA 4Z9CB 4EGVA 3K7AB 3TP5A 4RGTA 1CM9A 5E4XA 2PO4A 3K6OA 3H09A 1PLFA 1U4RA 3TP7A 2F03A 1II3A 1JOKA 3H3VC 2KJXA 1EIGA 3GTMB 4Q5VA 5IOCA 4J6HA 1LTGD 5I4DA 2K5QA 2F0MA 4A3JB 3HS0C 1EQVA 3TMEA 1RKNA 5A2QE 4XYQA 1XWEA 2K1BA 1OXTA 2G9DA 3OMGA 2NN6I 4LAAA 3M7NA 3R2TA 4AYBB 2E75C 5M5XB 4HN7A 5LL6X 2AWOA 3GTOB 2SNMA 2LY7A 4ZLTF 3S2HB 1Q3LA 4X3UA 3M4OB 2EVBA 5KNDA 1BUVT 1KABA 2I07B 2KCNA 5G3LD 1M8AA 4C3JB 4G57A 5ELCA 5C4HA 2WAQB 5I9OA 5D3DA 2ZXRA 3ND8A 5J1ZA 1HQMC 3R8BA 3BVGA 1B9MA 2EY5A 1NR4A 2H1EA 1W6JA 1E0BA 2ZXPA 2RA4A 3BG3A 1GUSA 5FLXE 4KD4A 5EKLA 1Z7TA 1EY4A 1RDPD 4IUNA 1SYDA 1TU2B 1FNWA 2RQXA 1A3UA 4S3SA 1SSOA 4ME5A 1CK1A 3HEJA 3OWEB 2Q8IB 5D3IB 2DNEA 4C56C 5KIXA 3C3LA 1SNCA 2IJ0A 5DNFA 4RFBA 1EWCA 1CZWA 3IFTA 4K6LA 2QDBA 4DK1A 1OXXK 5CBAE 1I50B 2B2VC 3S16B 2B8GA 4IN3A 1H9RA 3X3NA 1WTOA 2F0NA 4FF3A 4HCSA 1FNUA 2X6GA 4HMJA 3WOFA 1O7YA 5EJWA 2RVLA 2N55A 5CR3A 3E6ZX 1DXMA 3RD4A 3D4DA 2BDNA 3ONAB 3BDLA 1JE4A 4FP5D 1DM0B 4IFDH 3MHBA 5CC4A 2L12A 3OWFA 3KF8A 3A56A 4L6TB 4M1UB 1EY8A 2RSNA 1EIHA 1BCPC 1PTOC 5TSSA 1YNND 3VR6A 5D14A 3NTIA 1QOHA 2PPBC 4UAIA 2IWHA 1MI2A 3DEOA 2JYOA 5FOBB 3CRKC 1LT3D 4RGOS 2KCCA 2AQ1B 1PFBA 4L63B 1SNDA 1HFNA 4IUTA 1TS2A 2JSOA 3HOXB 4H0LC 1W6KA 4H44C 4K6DA 1EY0A 1J8IA 3NBIA 5F2DA 3PO3B 4FXGC 3C1FA 5KYLA 1RCVD 4IUQA 3TP6A 1WD1A 1EYCA 1H9SA 2NN6G 4I7ZC 1PFMA 1DCZA 2B2VA 1MSHA 1S4ZA 1F2YA 2R3ZA 3K5LA 2EY2A 5KNCA 3S1NB 1HXYD 3SVMA 2EYLA 5EBCA 2B2UC 2B2TA 1H9MA 2MHVA 1HA5A 3FPPA 3KK7A 3NWTA 4NP5A 1CHPD 3V2TA 1OXSC 3W2DA 4FNFA 4ZKCB 2D9UA 1Z6HA 3J80E 4CGYB 1A6XA 2PW7A 3QG1A 4KMUC 1Q12A 4KY7A 3NQTA 1G8ZD 5FLXL 5C4JB 1T5EA 2EYJA 3FDTA 2JA7B 3WOEA 1XTCD 3S2DB 2NBFA 5KYIA 3N52A 1FYCA 5COYA 3ZYYX 4ABNA 5K36G 2A69C 3N6RA 1TQOA 3CHBD 4HEDA 1D5ZC 5KRUA 4KKUA 2NVQB 2JP1A 4QUFA 1BCPB 1PTOB 1WCMB 3Q23A 3NTKA 4IUVA 5EBDA 1NCVA 4KY6A 4HAEA 1ICWA 5C4ZA 4R8IA 2F0PA 1QNKA 5CYUA 2CHBD 2LFNA 1JWUD 3EJIA 5BN4A 3PUYA 3SDZA 3U9OA 1BCPF 1PTOF 4EQOA 2EJMA 2WKCA 4C3IG 1AFPA 3T4AC 3OPOA 1RODA 5C4XB 2R6GA 5A35A 1A2TA 3RZOB 2HCCA 1O78A 1VF5C 4EVOA 3S14B 4C2MB 2K7VA 1K8MA 4RAUC 1C4QA 2RDGA 2WV6D 3MA2B 5IODA 3NWSA 4EQNA 1I4HA 1LABA 5JVG3 1CA6A 1D2BA 5C44B 2JE6I 3J81E 4C3HG 2ZT9C 2B2UA 3T51B 1PYWD 2MUYA 2E76C 3C1EA 2MP1A 2FFKB 1CI3M 2K01A 1EYAA 1C48A 3CU7A 2XWBB 2JEAI 5JJZA 4DNTB 3HGBA 1V1PA 3CQZB 5C6AA 1IYUA 1E2VA 3M7GA 1FNVA 2JA6B 5M5YB 1F2LA 1BCPD 1E2WA 1YNJD 3OIQA 1EZ6A 3A7LA 1EEID 4G4KA 1OO9B 3X3MA 4B08A 5ISRA 4CBVA 1F2MA 2KOLA 4XYOA 2CQAA 2QKIC 4RWSC 3A8JE 4J1MA 3E5SA 1WTRA 2RSOA 2O5IC 4WJWA 1FGBD 1WTPA 1LLRD 1SYBA 3I73A 2A73B 1EY5A 3DM1A 3M4YA 3RLFA 1WTVA 2K28A 2F0IA 4CKBA 2K5WA 3C2PA 4KKSA 1F9QA 3QWNA 1GOZA 1RHPA 3NSWA 4BS9A 4PQXA 4DAVA 4A3KB 4M8AA 2BCOA 1JOQA 4BBRB 2RDHA 3DXJC 4RCOA 4X3TA 1JR0D 1GUTA 1Y1VB 1IL8A 2M2LA 4BA2I 3PV0A 1V1OA 4ZRZA 2M00A 4MN3A 1EFID 2J0TD 1DD2A 1A15A 2F0QA 1E2ZA 4PV1C 1YNNC 3ERQA 5C5MA 5LHY1 3U9SA 5AFWA 4DA2A 2F0DA 5DM63 1J9OA 1QG7A 4QIWB 3AB9A 2PCFB 5FKAC 1GUGA 1IKLA 2NYZD 3QIAA 2B2WC 2PMZB 1SE2A 1ESRA 3BVZA 3DWPA 1KNAA 3HOYB 3K58A 1SNOA 4A3GB 3OOCA 5M3FB 3TN2A 4N9TA 5G3LF 2YYZA 4C1NK 4IALA 2R61A 3MVVA 1ZKOA 2WACA 4PMWA 3I91A 3GTPB 4DNRB 4RHRA 1PXUA 3UI2A 4IFDG 2JEBI 2WP8J 4A93B 1UNSA 3EA6A 2Z4IA 2X6LA 2IX3A 1SAPA 3HOZB 3V05A 2AWNA 3P1HA 1HQRD 2ICEC 3J7AV 5EKKA 4IZ8A 1EU3A 3LX0A 4DXFA 1JWMD 3NHHA 1AW7A 1DOLA 3R3OA 5C0XJ 5E3FA 4IQZA 3I8ZA 5JVH3 1X32A 1SYEA 3GV6A 2EY6A 2EOTA 3SK8A 3K57A 1H9KA 1PZJD 3BZDB 2A5HA 1DOMA 3KUPA 4KI0A 1G91A 3T13A 1KLGD 1U4LA 2Z8LA 2G9HD 3M85A 3BDCA 5CV8A 1TWCB 4FVMA 4DAPA 3URYA 4FO2A 3T53B 3MAQA 1L0YB 2KECA 1WTXA 2VB2X 5M5WB 2NB0A 1STEA 2EYHA 4XT3B 1QWYA 5DAUA 3MXPA 5KGUA 4DGZA 4JK1C 2C5CA 1JCKB 2WKDA 1JC7A 4K8JA 2NVTB 2F0UA 3VR4A 4XDXA 3MXUA 2F0GA 2IX1A 1I4RA 1STBA 1B1ZA 1NR2A 4CHTB 4DXGA 2O2LD 1I6VC 1LTSD 2NTTA 4K5XA 2XWJB 4TRDA 1KNEA 1LO5D 1AZPA 1EY7A 4BA1I 1SFOB 3VYRA 4ZUIA 5IGEA 4F7XA 1JQYD 2XVSA 4ID6A 5JEAH 1HUNA 1U9RA 4L8JA 2L0CA 4LMQD 4NDXA 4RKBA 4FF4A 3EVQA 1I4QA 1QILA 1SNMA 1JB3A 3OSOA 2K32A 1Y8PB 4C3IB 1TS5A 3HOWB 1S5CD 3LWUA 2F0VA 1VMPA 4KHVA 4DFAA 1CA5A 2JA5B 4A3IB 1YNJC 5CMDA 3OW7A 1S5DD 2OXPA 3A8IE 1MD2D 3Q6SA 5CV6A 4ZYSA 1ONLA 3VYSA 1JORA 3MZ5A 4C3HB 1I3QB 2EZVA 4I65A 1WTWA 1K83B 4O1NA 2B2YC 2ZXOA 3A55A 3EROA 3GTQB 2IX0A 4KN4C 2HDMA 2NUCA 3MC0B 2EYOA 4ILWA 3BYTB 2QEJC 2A6EC 1RF2D 2XN9C 2A68D 4ODGA 3FVQA 5CORA 3VYUA 1B50A 2R92B 1VF7A 4B9WA 1UEAB 3K5OA 4DAYA 2HCIA 1EEFD 2LMCB 4A3EB 1SNQA 2FINB 1KTKA 3D6CA 2XNAC 3BS1A 1KDAA 4KJOA 1Q1EA 2KUMA 2B63B 1NSNS 1XYIA 4RKLA 4CKCA 1Q8IA 2B8FA 1F9PA 5A2QL 4OIKA 5BN3A 4F8MA 4A3BB 2F0FA 1B53A 4F88A 1WD0A 3SR1A 4KKTA 5HURA 1PFNA 5T1GA 2TSSA 1TVXA 1BBXC 2I46A 1SNPA 2PYKA 3WDNA 2RDFA 1EU4A 1BF4A 4Y7NB 1TWAB 1EY6A 3MFYA 3TZUA 4QCLA 1JWSD 2D2CC 1V8QA 5EPKA 3TSSA 3GTJB 1QNUA 4NW2A 1B4OA 1EY9A 1AEXA 5K5PA 4J8QA 4IUPA 4HTHA 3H0GB 3K5MA 4OHJA 2F3VA 2KHSA 1SBBB 2KA7A 1Y8NB 5E1FA 4C1NI 5DEHA 3HKZB 3S1MB 1EZ8A 3IL8A 1PMRA 4KTAA 2EPBA 1D1KA 2F0EA 4TSSA 2JXMB 3E0JA 5DM73 1B9NA 3QOLA 1JICA 2L1BA 4OO1I 2DN8A 2RBMA 2F3WA 3BYYB 1G2TA 2R93B 1TWHB 2CW0C 4RHSA 3S9WA 1SYCA 2VUMB 5CV9A 2IL8A 2MPMA 2E74C 2F0KA 2F0WA 4DU9A 1HFGA 1ENAA 1WVLA 4KD3A 5C0XH 4K8IA 3I70A 3J7AF 4KY5A 2F0OA 4O42A 1AP0A 3FEWX 1Q1BA 3TBIB 1PZKD 3H91A 3Q24A 2BA1A 5JEAJ 3RUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CA5 A;  4ZK9 B;  5EPJ A;  4HED A;  4ZAI A;  1IKM A;  1IKL A;  5EPK A;  2NYZ D;  2B2W C;  3F2U A;  1LV9 A;  1BO0 A;  1X3P A;  2FHT A;  2JP1 A;  3HP3 A;  5CMD A;  1RJT A;  4QUF A;  1GUW A;  4HSV A;  1SSO A;  2KEC A;  1CM9 A;  5CBE E;  2DY7 A;  1ESR A;  2FMM A;  2KEE A;  2KOL A;  5E4X A;  4IUV A;  4IUU A;  1NCV A;  2MGS A;  3P7J A;  4XT1 B;  4HAE A;  4NW2 A;  1B4O A;  1PLF A;  1U4R A;  2MJ8 A;  1ICW A;  1PFB A;  2L9H A;  1KNA A;  3Q6S A;  1HA6 A;  4RWS C;  4R8I A;  1QNK A;  3DEP A;  4XT3 B;  5EKI A;  1HFN A;  1O80 A;  2FJ2 A;  4IUT A;  1WTR A;  2RSO A;  3MWY W;  1HUM A;  1WTW A;  1EL0 A;  4IUP A;  2B2Y C;  1WTP A;  2B2T C;  3TN2 A;  1EIG A;  4ZKB B;  3KBX A;  1XX8 A;  3DM1 A;  1ILQ A;  5EPL A;  5E4W C;  2HDM A;  4X3K A;  2Q8R E;  3I90 A;  2N88 A;  2Q8T A;  2SDF A;  1J8I A;  5DNF A;  1PDQ A;  1HHV A;  3I91 A;  1WTV A;  1EQT A;  2K28 A;  1G2S A;  4IUR A;  1WTX A;  1MGS A;  4CJ1 B;  1DZ1 A;  1ILP A;  3MTS A;  3UI2 A;  1G6Z A;  1F9Q A;  2B2W A;  4IUQ A;  2K1B A;  5CBA E;  1MSG A;  3IL8 A;  5COR A;  1B50 A;  2B2V C;  2KED A;  2EPB A;  4XDX A;  1WD1 A;  1ROD A;  1RHP A;  5T1I A;  3FPU B;  4CJ0 B;  1WTQ A;  5D65 A;  1NR2 A;  1DOK A;  1PFM A;  2X69 A;  1WTO A;  1JIC A;  1EOT A;  1RTO A;  1ZXT A;  2HCI A;  2HCC A;  1ML0 D;  2FIN B;  2L1B A;  3QO2 A;  2X6L A;  4HCS A;  1DON A;  2KVM A;  2B2V A;  1MSH A;  1SAP A;  1S4Z A;  2R3Z A;  2X6G A;  3GV3 A;  1O7Z A;  1QE6 A;  4RA8 A;  1O7Y A;  1F9S A;  3SVM A;  5EJW A;  2RVL A;  1G2T A;  2KUM A;  2B2Y A;  4RAU C;  2B2U C;  2B2T A;  4MHE A;  4ZLT F;  2N55 A;  1Q3L A;  4X3T A;  2CVR A;  4X3U A;  3I3C A;  1BNZ A;  1KNE A;  1XYI A;  3G7L A;  1CA6 A;  4R9W A;  1AZP A;  2BDN A;  3ONA B;  1JE4 A;  1F9P A;  1C8C A;  2IL8 A;  2MPM A;  4OIK A;  1B3A A;  2B2U A;  2J7Z A;  1B2T A;  1DOL A;  1IL8 A;  1HFG A;  2L12 A;  1WVL A;  1HRJ A;  2M2L A;  1M8A A;  3I8Z A;  2HUG A;  1SDF A;  3R93 A;  1X32 A;  3GV6 A;  1B53 A;  1X3Q A;  2DY8 A;  2RSN A;  4MN3 A;  1F9R A;  4ZKC B;  2JYO A;  2EOT A;  1WD0 A;  3TZD A;  1VMC A;  2D9U A;  1HUN A;  1AZQ A;  1EIH A;  2NZ1 D;  4U68 A;  2MP1 A;  2FFK B;  5EQ0 A;  2EE1 A;  1PFN A;  1A15 A;  5T1G A;  2K04 A;  2K01 A;  2VXW A;  1NR4 A;  2L11 A;  4LMQ D;  5D14 A;  4O42 A;  3IFD A;  4OIJ A;  1TVX A;  3LWE A;  1U4M A;  1AP0 A;  2HDL A;  2K05 A;  4QUC A;  2H1E A;  1BBX C;  1E0B A;  2NWG A;  2RA4 A;  1DOM A;  4DN4 M;  1RTN A;  3KUP A;  1NAP A;  1U4P A;  3H91 A;  2L4N A;  4UAI A;  1G91 A;  3FDT A;  5JJZ A;  4X3S A;  5AFW A;  1U4L A;  4CJ2 C;  1MI2 A;  3DEO A;  3D6W A;  1J9O A;  2XIW A;  3N52 A;  1QG7 A;  1BF4 A;  1VMP A;  5COY A;  1F2L A;  2K03 A; 
#chains in the Genus database with same CATH topology
 4KK7 A;  5EPJ A;  3STB C;  4ZAI A;  4NB3 A;  1LV9 A;  3J7Y W;  1RJT A;  4A3J H;  3CCE A;  4LUV A;  1HNW L;  2FMM A;  1VQM A;  1HA6 A;  2L9H A;  4WOR A;  3F8T A;  3OYY A;  3L0O A;  3OHX C;  1KC8 C;  4JI3 L;  1K8O A;  1KQS A;  1BBW A;  2K52 A;  1UAP A;  2ID0 A;  3G6J B;  4GOP C;  3I4M B;  2Z0S A;  2B29 A;  1H9J A;  1JOO A;  2LS0 1;  1NE3 A;  1LT5 D;  2IT1 A;  3CME A;  3GTO H;  2Q8T A;  4UP9 A;  4TVA B;  2GN5 A;  3S2H H;  1LUZ A;  5J3B A;  5IP7 H;  4JI6 L;  2EQS A;  4IPD A;  3M4O H;  2PZW A;  1FR3 A;  4CJ1 B;  3A5Z B;  4DV4 Q;  3TRE A;  4ZUJ A;  3PUX A;  4LUZ A;  2AQ2 B;  4X64 Q;  2QF7 A;  1A62 A;  4NKL A;  4DR6 L;  1N36 L;  3GTL B;  3DUZ A;  4C3J H;  4V0B A;  4CJ0 B;  4RGM A;  3SK4 A;  1TWC H;  1E22 A;  4XQJ A;  3T16 A;  2C35 B;  4QB4 A;  4JI5 Q;  3J81 i;  1F9S A;  3I4N B;  4P72 A;  3CC4 A;  2A6E D;  5M5W H;  4GKJ Q;  1HNX Q;  4DV0 Q;  2ICI A;  1N33 L;  4DF7 A;  2MNA A;  1C8C A;  1WJJ A;  5ELE A;  1IBM Q;  4FF1 A;  4L5R C;  1A2U A;  1KAW A;  4A3F B;  3SXH A;  3KLR A;  1TS3 A;  3R93 A;  3CC2 A;  1XMQ Q;  1EQQ A;  1QJO A;  1AE3 A;  5IE8 A;  3HOV G;  4IOA A;  2BA0 A;  1VMC A;  1Q7Y C;  1AZQ A;  1CSP A;  4JI0 Q;  1PZI D;  2VB3 X;  2HHH L;  5FK9 C;  2EE1 A;  1J5E L;  2K04 A;  5LMN W;  1A0I A;  4OIJ A;  4RGN A;  3NP8 A;  4A3L G;  3CAM A;  2NWG A;  1J6Q A;  4L5S A;  1I4P A;  3R2I A;  1I4G A;  2K6A A;  1B7Y B;  4JV5 L;  4JBK A;  1YNX A;  2LXK A;  4QF4 A;  3TP8 A;  2AUJ D;  1LT4 D;  3DMU A;  3U50 C;  1CQF A;  3J80 L;  3A8K E;  4A76 A;  1GUW A;  1KDB A;  2BOS A;  2MGS A;  3GQB A;  1XJV A;  2JA7 G;  3PUW A;  1Q90 A;  3EN2 A;  1I50 H;  3MEF A;  4R4O A;  4DV6 L;  2D5D A;  5I9P A;  3PIO 3;  1YIT A;  1PHJ A;  1SJE D;  1A3V A;  4ZKB B;  1E1O A;  3KBX A;  3H3V H;  4PG3 A;  3VYT A;  1ILQ A;  1HZA A;  2B39 A;  2Y0S E;  1MIU A;  3D4W A;  2PQE A;  2HQE A;  1PDQ A;  4L5Q A;  5HGT A;  1CQV A;  4DV5 Q;  1DZ1 A;  1G6Z A;  2WIN B;  3PMF A;  1GHJ A;  3AQQ A;  3D4R A;  1VCI A;  2A68 C;  2NTS A;  2F0L A;  1WTQ A;  3CP0 A;  3VR3 A;  5C0X I;  5JEA G;  5JAV A;  2JA5 H;  1XNR L;  4GOP B;  1HNW Q;  1LTA D;  4X6A H;  5J22 A;  1DON A;  4JBW A;  1QUQ B;  3GV3 A;  1QVG A;  4K2L A;  1VQO A;  2AUK A;  4JI3 Q;  1PH7 A;  1EWH A;  1PV4 A;  4PMC A;  1TY0 A;  1F2Z A;  2V4D A;  3FKI G;  1FD7 D;  2J7Z A;  4JC0 A;  1VQJ A;  1YBY A;  4OGQ C;  3KLS A;  3TS2 A;  1WI5 A;  3VA7 A;  2O4X A;  4JI6 Q;  3P75 A;  5C3E G;  2IHE A;  3Q22 A;  1PFS A;  3PUV A;  1STA A;  4PZ8 A;  2NZ1 D;  3M9B A;  4DR6 Q;  1JT8 A;  2CW0 D;  1QB5 D;  1N36 Q;  1EQR A;  3IFD A;  1VQ7 A;  1Y1W B;  5KNB A;  2R7Z B;  2K05 A;  2PQA A;  2A6H D;  4BY1 B;  5C3X A;  5FJ8 H;  3J81 L;  2R92 H;  3IKJ A;  2Y0S B;  1STG A;  4J15 A;  1N32 L;  2XSC A;  4GZY C;  3I72 A;  3CC7 A;  3HOX H;  1AN8 A;  4GKK L;  4NXN L;  2YTV A;  1N33 Q;  2UUA L;  3PO3 H;  3F2U A;  1UE5 A;  1UUP A;  1GUN A;  1SYG A;  1ICF B;  4PNY A;  2IW3 A;  4HR7 B;  1G29 1;  3KBG A;  1SE3 A;  1QCB D;  1TS4 A;  4JI2 L;  3OMC A;  4A3B H;  2DJG C;  4FYD A;  2HHH Q;  2OTL A;  2FJ2 A;  3NUC A;  4R8N A;  4U67 3;  3CCR A;  4GNX C;  1J5E Q;  1LM0 A;  5IT9 E;  3JAM E;  1NMF A;  2M9V A;  5EPL A;  3K0Y A;  3STB D;  3M4P A;  3S1N H;  3IRB A;  2OQK A;  2HQL A;  5I2X A;  3ER0 A;  4DR5 L;  1D6E C;  3MXN A;  1NMG A;  2XRQ D;  5M9O A;  4G7Z C;  4CDC C;  5I6W A;  4JV5 Q;  2B2W A;  1MJE A;  1BXT A;  4A3M G;  1Y69 U;  2PNH A;  1K73 C;  1TWF B;  3RR5 A;  5DLQ E;  1TWA H;  2F0H A;  3VR5 A;  5BN5 A;  4BWG B;  3QO2 A;  1EOT A;  1L0X B;  1FJG L;  1HPC A;  4QY7 A;  4UPA A;  1O7Z A;  4DR7 L;  3H15 A;  1DYQ A;  1BR9 A;  3S24 A;  2R7D A;  4MHE A;  2H4O A;  4UDU C;  1HH2 P;  2BDO A;  5FO9 B;  4YHH L;  1B44 D;  4DV6 Q;  5C4J H;  1WYD A;  4OL7 A;  2Z4H A;  2HIV A;  1B2T A;  2A19 A;  1Q81 C;  2SEB D;  3S2D H;  3U4V A;  4A3K G;  1EYG A;  2WB1 G;  4DV7 L;  4IJL A;  1BOS A;  1X3Q A;  2F3I A;  2XGT A;  3SK5 A;  1BDO A;  1GO3 E;  3QOJ A;  2NVQ H;  4BY7 B;  3W1B A;  4K5W A;  1KAA A;  1PTO H;  2VXW A;  2EXZ A;  1WCM H;  3NXW A;  3PO2 G;  3SE0 A;  3GO5 A;  1LTT D;  2G5D A;  3S15 B;  5ELD A;  3LWE A;  5M3M B;  4DV3 L;  4QUC A;  1IW7 D;  3TRZ A;  1K0S A;  3I7F A;  3RMH A;  3JAM i;  2D62 A;  2KQ3 A;  3L7Z C;  1NAP A;  1YI2 A;  1XNR Q;  2ALY B;  2JA8 G;  3BVM A;  4X3S A;  4CJ2 C;  1PH8 A;  1Q8K A;  3K59 A;  4H13 C;  4KJN A;  2XIW A;  4OO1 H;  1SMX A;  3CPF A;  1VQ4 A;  2WFW A;  2K03 A;  3NTH A;  4N9P A;  4MNO A;  1X3P A;  2FHT A;  1CKN B;  1Y8O B;  1CZG A;  3MFG A;  5EGT A;  4HSV A;  4BBS B;  2IPK D;  4HJ5 A;  2UUB L;  3H94 A;  2HD3 A;  4OON A;  3DEP A;  1UE7 A;  4LF8 L;  4DKA C;  1KRS A;  4DAM A;  2XRS D;  5C4X H;  4IPH A;  2BE5 C;  3RZO H;  2B2T C;  3DLL A;  3S14 H;  4C2M H;  4P71 A;  1S3O A;  2Q8R E;  3I90 A;  2RHQ B;  3FMC A;  3VA5 A;  2OTJ A;  3NE5 B;  2PNR C;  1ET9 A;  1EQT A;  2VS1 A;  3NK9 A;  1G2S A;  4IUR A;  1N32 Q;  2EYF A;  4A3D B;  5C44 H;  4K14 A;  2EYM A;  2MO0 A;  1VDZ A;  2XTI A;  4GKK Q;  3AFP A;  4OWT B;  4A3G G;  4NXN Q;  2EY1 A;  4K2K A;  2YU9 B;  5C0X G;  2UUA Q;  1CKO A;  4LJZ C;  2N78 A;  3PIP A;  3KFU A;  1RTO A;  3CF5 A;  1ML0 D;  2RF4 A;  4LK1 C;  3A5U A;  4GNX B;  2L5T A;  3SEB A;  4QQB X;  1IHZ A;  4RA8 A;  2Z9H A;  3S1Q B;  4FF2 A;  4JI2 Q;  1W2B A;  4XIG S;  3K5N A;  3NQI A;  4B3M L;  5BR8 L;  5IYD H;  4AIM A;  3P20 A;  4FXK C;  3KF8 B;  1MKH A;  3CQZ H;  1B3A A;  2LSS A;  1IYV A;  1MJC A;  2VQE L;  1VQB A;  1DJR D;  1G51 A;  1MBY A;  3Q8D A;  2EJG C;  2VQF L;  2F0J A;  4DR5 Q;  2JA6 H;  1LTI D;  1LTR D;  3D0F A;  1YHB A;  2ENB A;  2K33 A;  1OXU A;  4LF4 L;  4P2C B;  1VQH A;  4A3J G;  2B3G A;  3BJU A;  1STH A;  3K80 C;  3D3R A;  2SNS A;  3EQL C;  1YJW A;  2GA4 B;  4DN4 M;  5IGD A;  1ZYR D;  1U4P A;  1FJG Q;  3C46 A;  4H7B A;  1SE4 A;  1UE1 A;  5GQO A;  4CKE A;  4DR7 Q;  2F0S A;  4QJF A;  4K5V A;  4AYB G;  4HMI A;  2NVX B;  1X3E A;  4YHH Q;  5JOB A;  4HJ9 A;  1GHK A;  3E9H A;  5IP7 G;  3NBH A;  2PW5 A;  1STN A;  3GDE A;  5IIF A;  4IUU A;  2E5L L;  3P7J A;  4XT1 B;  4DV7 Q;  1SMY C;  3CCQ A;  3T1H L;  4A3F H;  1HZB A;  4C3J G;  1S5F D;  1TII D;  1PRT C;  1YEZ A;  1O80 A;  2A74 C;  2OEO A;  2WAQ G;  1HUM A;  4QL5 A;  4Q0F A;  5IT9 L;  3JAM L;  5CV4 A;  1TY2 A;  4DK0 A;  4DV3 Q;  1XX8 A;  4TKO B;  4BBR H;  3HOV B;  4MTK A;  2OWO A;  2ASB A;  3F2C A;  3NBH B;  3DWQ A;  4MIU A;  1SRO A;  2Z1C A;  2WII B;  3EFX D;  3HG9 A;  2N8N A;  4WRD A;  1MGS A;  1HTP A;  1Y1V H;  1F77 A;  3L9A X;  5FO7 B;  1ILP A;  3MXG A;  1H9S B;  1I6H B;  3DHQ A;  1MSG A;  3PUZ A;  4ZQ3 A;  1STY A;  1O7I A;  2N3S A;  2O5J C;  3WWV A;  1LTB D;  1D1I A;  1V43 A;  5ELF A;  3LNN A;  3J7A 5;  2UUB Q;  4CDD C;  3ICE A;  1RL2 A;  3HZX A;  2B2Y A;  3GTG B;  4LF8 Q;  1TR5 A;  3VR2 A;  3H6M A;  2CVR A;  1BNZ A;  3I3C A;  4OX9 L;  2PZT A;  4GN4 B;  4KHZ A;  2K5V A;  1L1O A;  2KCT A;  3TDQ A;  1SJH D;  3M3Y B;  3M4Q A;  4RMF A;  1UE6 A;  2CH4 A;  1LT6 D;  2K5D A;  1RD9 D;  1SEB D;  2SOB A;  4P74 A;  2E2I B;  1A8V A;  2Z6K C;  4X65 L;  3UDF A;  4U68 A;  4NXM L;  2F1M A;  1S5B D;  3SHL A;  4XQN A;  5EQ0 A;  1A3T A;  1ET6 A;  5C5L A;  2VNU D;  5J39 A;  5GRO A;  5IGF A;  1PH3 A;  4KN7 C;  4G7O C;  4YY3 L;  3HOY H;  1CHQ D;  3MEH A;  2A6H C;  2Q2T A;  1I4X A;  5AJ3 L;  4LNQ A;  5C3W A;  5JJK A;  5IGG A;  3D6W A;  5M3F H;  2J4X A;  3AMU A;  2EYP A;  4B3M Q;  5BR8 Q;  4RCN A;  2C9O A;  1LAC A;  5ELB A;  3HP3 A;  4CDE C;  2VQE Q;  3GTP H;  5CBE E;  5FO8 B;  2KEE A;  2E2D C;  4XQQ A;  2VQF Q;  4XXE A;  1YZ6 A;  3NPP A;  4A93 H;  1X9N A;  1T9H A;  4IFD I;  5EKI A;  2L15 A;  4AH6 A;  3FKI B;  2AQ3 B;  3T56 B;  4LF4 Q;  2JA5 G;  4NMZ A;  3BU2 A;  3NEN A;  4YIJ A;  1JJ2 A;  3HOZ H;  4X3K A;  4TQU S;  3DWA A;  5C3E B;  1ESF A;  1SYF A;  2N88 A;  3A7A B;  1T5X D;  3S17 B;  1K0R A;  1ZEQ X;  2F0T A;  3F2D A;  3MTS A;  4O2D A;  3AU7 A;  4IPC A;  2PZU A;  2BE5 D;  3FPU B;  3PIP 3;  5D65 A;  1DOK A;  1N34 L;  1PRT B;  2NVY B;  2KVM A;  2E5L Q;  5FLM H;  1TT2 A;  1PYB A;  1QE6 A;  3O13 A;  3Q0A A;  3T1H Q;  1OXV A;  2WB1 E;  3GD7 A;  1NBW A;  2LXJ A;  1UEB A;  2IHF A;  2KCM A;  2KBN A;  2JJQ A;  1TWG B;  5FJ8 G;  4IFD J;  3ND9 A;  2R92 G;  2L55 A;  1TXY A;  3BDO A;  1HRJ A;  5CV7 A;  3FRP B;  2HUG A;  1PRT F;  2TMP A;  3HRZ C;  2NN6 H;  3D31 A;  2ZJQ A;  3HOX G;  1QVF A;  1PTO D;  3TZD A;  3A54 A;  4YCW A;  3QJY A;  3PO3 G;  3W3A A;  1S5E D;  4P73 A;  2RKS A;  2L11 A;  3D8G A;  3HOU B;  2F4I A;  2Z6K A;  5IGC A;  4PZ6 A;  1V1P B;  3CRL C;  1IW7 C;  1RTN A;  1FGU A;  1B3Q A;  2L4N A;  1TWF H;  4A3B G;  1O7L A;  4PMB A;  1V1Q A;  4B9X A;  1CFM A;  4A3M B;  5KEE A;  1M4V A;  1AE2 A;  5JPN C;  2OT2 A;  1KLU D;  1D5M C;  4QMG A;  2I0Q A;  4JYA L;  4KV6 A;  4OX9 Q;  4ZK9 B;  1YHA A;  5JPM C;  1GXD C;  3I4L A;  1IKM A;  5CGK A;  1BO0 A;  2E2H B;  1PA6 A;  1JJC B;  1NNX A;  2DY7 A;  2OQ0 A;  1R9T B;  3ITP A;  2MJ8 A;  3KLS X;  2JA9 A;  2NVT H;  1H95 A;  3UE0 A;  1GJX A;  2LKV A;  1NUC A;  1R4Q B;  4X65 Q;  4NXM Q;  4RH6 A;  1P16 A;  4HIO A;  3MWY W;  1EL0 A;  1HCZ A;  2WB1 B;  5I6Y A;  1VQD A;  3UDG A;  5E4W C;  2BH2 A;  2OF1 A;  4BY7 H;  5LL6 S;  4YY3 Q;  4HID A;  5K36 H;  1GUO A;  3QB3 A;  3HKS A;  1CTM A;  2SDF A;  3RZD B;  5CV5 A;  1XNQ L;  5IGB A;  5AJ3 Q;  1XXG A;  1HHV A;  3E3X A;  1TKW B;  3PO2 B;  5NUC A;  1SMY D;  1SFO H;  4HCE A;  1YJN A;  4OEL B;  1D5X C;  3CKI B;  1Z47 A;  1PRT D;  2JA8 B;  2KED A;  5T1I A;  1VQF A;  3GP7 A;  1EYD A;  4HSP A;  1SXT A;  2X69 A;  1ZXT A;  4YWM A;  3CCM A;  4PZ7 A;  2A1A A;  1BQQ T;  2QIL A;  4LF7 L;  4GOP A;  1S40 A;  1WCM G;  2F52 A;  1QUQ A;  2UXB L;  2EDG A;  1JE5 A;  3G7L A;  4R9W A;  3S1R B;  4C3I H;  4K0K L;  4XTC S;  2EJF C;  2E2J B;  3HOW H;  3J80 c;  2MFI A;  1HTL D;  2MO1 A;  2DNC A;  1SDF A;  3OIP A;  4CDF C;  4F87 A;  5LMU L;  3IAY A;  4OO1 G;  3SK6 A;  2DY8 A;  4FXD A;  2YTY A;  1F9R A;  2AHO B;  1KD1 C;  1CT1 D;  4A3I H;  1IBK L;  3K7U C;  2GVA A;  1AH9 A;  1CUK A;  1ENC A;  1KDC A;  5I2Y A;  2PI2 E;  1U4M A;  1ENF A;  2FMC A;  2HDL A;  4AYB E;  4G7H C;  4WFN 3;  1N34 Q;  2YU9 H;  2QCP X;  4C3H H;  1I3Q H;  3GTK B;  1ZYR C;  2I5M X;  4E6I A;  5C4X G;  3L3O C;  1R4P B;  4V19 0;  1K83 H;  1VQ6 A;  3GTQ H;  2A69 D;  4ULL A;  3V96 A;  1LYL A;  4EQP A;  2I5H A;  4Z9C B;  4EGV A;  3K7A B;  1VQI A;  2WAQ E;  3TP5 A;  4RGT A;  1VQG A;  1CM9 A;  5E4X A;  2PO4 A;  3K6O A;  3H09 A;  5C44 G;  2Q2H A;  1PLF A;  1U4R A;  3TP7 A;  3T1Y L;  1Z9F A;  4YCU A;  4UP8 A;  2F03 A;  1II3 A;  4MTN A;  1JOK A;  4YCV A;  1X3F A;  3H3V C;  2KJX A;  5IWA L;  4A3E H;  1EIG A;  5IYC H;  3GTM B;  2E8G A;  4Q5V A;  3F2B A;  5IOC A;  4J6H A;  1LTG D;  5I4D A;  1BBU A;  2K5Q A;  4JI4 L;  2F0M A;  2B63 H;  4A3J B;  3HS0 C;  1EQV A;  5IYD G;  1PH9 A;  3G4S A;  1Q86 C;  4LFB L;  3TME A;  1RKN A;  2D0O A;  5A2Q E;  4JYA Q;  4XYQ A;  1XWE A;  2K1B A;  3AEV A;  1OXT A;  2JA6 G;  2G9D A;  3OMG A;  2NN6 I;  4LAA A;  3M7N A;  3R2T A;  4AYB B;  3J81 c;  2E75 C;  5M5X B;  4HN7 A;  5HGQ A;  5LL6 X;  2AWO A;  3GTO B;  4R4T A;  2SNM A;  2LY7 A;  4ZLT F;  3S2H B;  1Q3L A;  4X3U A;  3A0J A;  3M4O B;  2EVB A;  5KND A;  1S72 A;  1BUV T;  1KL9 A;  2AMC B;  3HFZ B;  1KAB A;  2I07 B;  2KCN A;  5G3L D;  1M8A A;  4C3J B;  4G57 A;  1XNQ Q;  4Y7N H;  1U5K A;  5ELC A;  5C4H A;  2WAQ B;  5I9O A;  5D3D A;  4MZ9 A;  2ZXR A;  3ND8 A;  5J1Z A;  1HQM C;  3R8B A;  3BVG A;  1B9M A;  2EXD A;  2EY5 A;  1NR4 A;  3CCL A;  4POG A;  3GTJ H;  2H1E A;  1W6J A;  1E0B A;  2ZXP A;  5GAE C;  2RA4 A;  3BG3 A;  1GUS A;  3CCS A;  4A3F G;  5FLX E;  4KD4 A;  5EKL A;  1Z7T A;  1XPO A;  1EY4 A;  4LF7 Q;  1RDP D;  1I94 L;  4GLX A;  4IUN A;  2UXB Q;  1SYD A;  3H0G H;  1TU2 B;  4JOI C;  1FNW A;  4BBR G;  2RQX A;  3PQI A;  1A3U A;  2K5N A;  4K0K Q;  4S3S A;  1SSO A;  1SE8 A;  4ME5 A;  3K81 C;  5LMU Q;  1CK1 A;  1CKN A;  1Y1V G;  3HEJ A;  2H5X A;  3OWE B;  3S1M H;  2QW7 A;  1IBK Q;  4YWK A;  5D3I B;  2Q8I B;  2DNE A;  4C56 C;  5KIX A;  3C3L A;  1SNC A;  2IJ0 A;  5DNF A;  2R93 H;  1TWH H;  4RFB A;  4IJH A;  3KJP A;  1EWI A;  1YJ9 A;  1ASZ A;  1EWC A;  1CZW A;  4B3S L;  3IFT A;  4K6L A;  1PH2 A;  2VUM H;  2CWA A;  2QDB A;  4B3T L;  4DK1 A;  1OXX K;  5CBA E;  4OWX B;  1I50 B;  2B2V C;  3S16 B;  2B8G A;  2F4V L;  1E3P A;  4IN3 A;  1H9R A;  3X3N A;  4JI8 Q;  1WTO A;  2F0N A;  4FF3 A;  4HCS A;  1FNU A;  2X6G A;  4HMJ A;  3WOF A;  3T1Y Q;  1O7Y A;  1BKB A;  5EJW A;  4GNX A;  2RVL A;  1JJG A;  1VQA A;  1PH6 A;  2N55 A;  5CR3 A;  3E6Z X;  4GS3 A;  4YWL A;  1DXM A;  3RD4 A;  3HOY G;  3D4D A;  5IWA Q;  2BDN A;  3ONA B;  3BDL A;  1JE4 A;  4FP5 D;  1DM0 B;  4IFD H;  3MHB A;  5CC4 A;  1WFQ A;  2L12 A;  3OWF A;  3KF8 A;  5M3F G;  3A56 A;  4L6T B;  4M1U B;  1EY8 A;  2RSN A;  4JI4 Q;  4EX5 A;  4LFB Q;  1KHI A;  1EIH A;  1YVC A;  1BCP C;  1PTO C;  5TSS A;  1YNN D;  1EOV A;  1QZH A;  3VR6 A;  4APV A;  4JI1 L;  5D14 A;  4GN3 B;  3EIV A;  3NTI A;  1QOH A;  1JMC A;  2PPB C;  1YIJ A;  4UAI A;  2Q2I A;  4A93 G;  2IWH A;  3K0X A;  4HIM A;  1MI2 A;  3I4M H;  3DEO A;  2ZJP A;  4DR2 L;  4NPS A;  2JYO A;  5FOB B;  2UUC L;  3HOZ G;  3CRK C;  1LT3 D;  4A3C H;  3U4Z A;  2YTX A;  2K5H A;  3EBE A;  1X54 A;  4RGO S;  3DM3 A;  2KCC A;  2AQ1 B;  2JQO A;  1PFB A;  4L63 B;  3PSI A;  3GTL H;  2Y0S G;  1SND A;  1HFN A;  4IUT A;  2JK8 A;  4DNI A;  2D0P A;  3RNU A;  1TS2 A;  2JSO A;  3HOX B;  5FLM G;  4H0L C;  1W6K A;  4H44 C;  4K6D A;  3I4N H;  1EY0 A;  1J8I A;  3HOU H;  3NBI A;  5F2D A;  3PO3 B;  2RHS B;  4FXG C;  3C1F A;  1I94 Q;  4LUO A;  5KYL A;  1RCV D;  3ERS X;  3CPW A;  3A74 A;  4IUQ A;  1M90 C;  4BXX H;  2CH4 W;  3TP6 A;  4DAY B;  1WD1 A;  4JW0 A;  1EYC A;  1H9S A;  1C9O A;  1ASY A;  5JJI A;  2NN6 G;  1SLJ A;  4I7Z C;  1PFM A;  3SGI A;  1DCZ A;  3AFQ A;  2B2V A;  1MSH A;  1S4Z A;  1IBL L;  1VQK A;  1F2Y A;  2R3Z A;  3B6Y A;  4N8F A;  2EY2 A;  5IYB H;  3K5L A;  5KNC A;  2ZM6 L;  1HXY D;  3SVM A;  2E2H H;  3S1N B;  2A8V A;  2QEX A;  2EYL A;  5EBC A;  2B2U C;  2B2T A;  1H9M A;  2VW9 A;  2MHV A;  3LGJ A;  1HA5 A;  1D7Q A;  3FPP A;  3I55 A;  3KK7 A;  3NWT A;  4NP5 A;  1CHP D;  3V2T A;  3G71 A;  1OXS C;  3W2D A;  1RIP A;  4FNF A;  4ZKC B;  2D9U A;  1EIF A;  4B3S Q;  1Z6H A;  2UXC L;  3J80 E;  4CGY B;  4B3T Q;  1C0A A;  2K50 A;  1A6X A;  2PW7 A;  5IT9 c;  3QG1 A;  4KMU C;  3JAM c;  2F4V Q;  3PF4 A;  1Q12 A;  2Z6B A;  1K3R A;  4KY7 A;  3NQT A;  1G8Z D;  5FLX L;  5C4J B;  1T5E A;  2EYJ A;  3FDT A;  2JA7 B;  3WOE A;  1XTC D;  3S2D B;  4O0A A;  2NBF A;  5KYI A;  4HJ7 A;  3N52 A;  1FYC A;  5COY A;  3ZYY X;  4ABN A;  4BY7 G;  3JC6 6;  5K36 G;  2A69 C;  5ELO A;  3N6R A;  1TQO A;  3CHB D;  4HED A;  1D5Z C;  5KRU A;  4KKU A;  2NVQ B;  2JP1 A;  4QUF A;  1BCP B;  1PTO B;  2QGQ A;  1WCM B;  1HJP A;  3Q23 A;  3NTK A;  4IUV A;  5EBD A;  1NCV A;  4KY6 A;  4HAE A;  1ICW A;  5C4Z A;  4R8I A;  2F0P A;  1QNK A;  5CYU A;  1KRT A;  4EQ5 A;  2CHB D;  2LFN A;  4DUZ L;  4JI1 Q;  3KF6 B;  1JWU D;  3EJI A;  5BN4 A;  3PUY A;  4JCV E;  3SDZ A;  1GD7 A;  3U9O A;  3BZK A;  1BCP F;  1PTO F;  3PF5 A;  1PH5 A;  4EQO A;  4I7A A;  3U58 A;  2EJM A;  2WKC A;  4C3I G;  4DR2 Q;  1AFP A;  3HOW G;  2UUC Q;  1HR0 L;  3T4A C;  3OPO A;  1G6P A;  1ROD A;  5C4X B;  4OWW B;  2R6G A;  5A35 A;  1A2T A;  1VQ5 A;  3RZO B;  2HCC A;  1O78 A;  1XPU A;  1VF5 C;  4A3I G;  4EVO A;  3S14 B;  3K7A H;  3NEL A;  3VDY A;  4C2M B;  2K7V A;  3G6E A;  1EIY B;  1K8M A;  3TQY A;  4RAU C;  1Y1W H;  1K8G A;  1C4Q A;  2R7Z H;  2RDG A;  2WV6 D;  3MA2 B;  5IOD A;  3NWS A;  2HT1 A;  4BY1 H;  4EQN A;  1I4H A;  1LAB A;  5JVG 3;  1CA6 A;  4LF9 L;  1D2B A;  5C44 B;  2JE6 I;  3J81 E;  4C3H G;  4IOC A;  2ZT9 C;  2B2U A;  3T51 B;  1PYW D;  3F1Z A;  4RG1 A;  2MUY A;  5EAY A;  1L0W A;  1B70 B;  2HIX A;  5E7N A;  2E76 C;  4R4I A;  2Q2U A;  3C1E A;  1VQC A;  2MP1 A;  2FFK B;  1CI3 M;  2K01 A;  1EYA A;  1C48 A;  3CU7 A;  4B3R L;  2XWB B;  2JEA I;  3FHW A;  5JJZ A;  4DNT B;  3HGB A;  1V1P A;  3CQZ B;  1IBL Q;  3KDF B;  1N9W A;  5C6A A;  2ZM6 Q;  1GM5 A;  1IYU A;  4A3E G;  1E2V A;  3M7G A;  1FNV A;  4KHP Q;  1GKH A;  3K8A A;  2JA6 B;  5IYC G;  5M5X H;  1F2L A;  5M5Y B;  1BCP D;  1E2W A;  1YNJ D;  3OIQ A;  1EZ6 A;  3A7L A;  1EEI D;  4G4K A;  1OO9 B;  5IP9 H;  3X3M A;  4B08 A;  5ISR A;  2CQO A;  2B63 G;  4CBV A;  3CCU A;  1F2M A;  2KOL A;  4XYO A;  2CQA A;  3UE1 A;  2K75 A;  1K28 A;  2VZA A;  2QKI C;  4RWS C;  1X3G A;  3A8J E;  3NEM A;  4J1M A;  3E5S A;  2RCN A;  2UXC Q;  1WTR A;  2RSO A;  2O5I C;  4WJW A;  1BVS A;  1FGB D;  2K4K A;  1WTP A;  4WJ4 A;  1LLR D;  1SYB A;  3I73 A;  4DR1 L;  2A73 B;  1EY5 A;  3DM1 A;  3M4Y A;  1L2F A;  4HIK A;  5IY0 A;  3RLF A;  4OEM B;  5H1S E;  1WTV A;  4QIW E;  2K28 A;  3CXC A;  2F0I A;  4CKB A;  2K5W A;  2UXD L;  3C2P A;  1VS0 A;  4DR3 L;  4KKS A;  1F9Q A;  2PMZ E;  2P5Z X;  4LF6 L;  3QWN A;  1GOZ A;  1RHP A;  3NSW A;  4R4C A;  1NJI C;  4BS9 A;  4PQX A;  4DAV A;  1XTD A;  1K9M C;  1E7Z A;  4JG2 A;  4M8A A;  4A3K B;  1VQL A;  2UU9 L;  2BCO A;  1JOQ A;  4BBR B;  1Q82 C;  2RDH A;  3CW2 C;  3S15 H;  4AQY L;  5M3M H;  3DXJ C;  4RCO A;  4X3T A;  1JR0 D;  1WTH A;  4L5T A;  4UP7 A;  3PGZ A;  4DUZ Q;  2ZTD A;  1GUT A;  4HJ8 A;  1Y1V B;  1EFW A;  1IL8 A;  1P8L A;  2M2L A;  4BA2 I;  3PV0 A;  1V1O A;  4ZRZ A;  2M00 A;  3H0G G;  4MN3 A;  1EFI D;  3J81 j;  2AKW B;  2J0T D;  1DD2 A;  1A15 A;  2F0Q A;  1E2Z A;  1HR0 Q;  4PV1 C;  1YNN C;  2V1C C;  4BBS H;  3HKZ G;  3ERQ A;  1E24 A;  5C5M A;  5LHY 1;  3KYH C;  3G48 A;  2EIF A;  3U9S A;  3S16 H;  1VQP A;  5AFW A;  4DA2 A;  4LW1 A;  2F0D A;  5DM6 3;  4GLA C;  1FVI A;  1J9O A;  1QG7 A;  2YV5 A;  4ME3 A;  2IY5 B;  4QIW B;  3AB9 A;  2PCF B;  2KHJ A;  5FKA C;  1GUG A;  2VL6 A;  4LF9 Q;  1IKL A;  2CCZ A;  2NYZ D;  2R93 G;  3QIA A;  2B2W C;  2PMZ B;  1SE2 A;  1ESR A;  4A3D H;  2VUM G;  2DJF C;  3BVZ A;  3DWP A;  1KNA A;  3HOY B;  3K58 A;  1IL2 A;  4JI7 L;  1QVC A;  3UDI A;  1SNO A;  4A3G B;  3OOC A;  4LFA L;  5ELN A;  5M3F B;  2ATW A;  3TN2 A;  4N9T A;  5G3L F;  2YYZ A;  1NY4 A;  4C1N K;  4B3R Q;  4IAL A;  2R61 A;  3RN2 A;  3MVV A;  3S1Q H;  1Y14 B;  1ZKO A;  2WAC A;  4PMW A;  3I91 A;  5GAD C;  4JI8 L;  3GTP B;  4DNR B;  1VQ9 A;  4RHR A;  1PXU A;  3UI2 A;  4IFD G;  1HZ9 A;  2JEB I;  1DGS A;  2WP8 J;  2DUD A;  1X56 A;  1CSQ A;  4A93 B;  4JBM A;  1UNS A;  3EA6 A;  2Z4I A;  5HY6 A;  2X6L A;  4DV2 L;  2IX3 A;  4QGU A;  1SAP A;  4ZCK A;  1PYS B;  3HOZ B;  2PI2 A;  3V05 A;  2AWN A;  2GVB A;  3P1H A;  1HQR D;  2ICE C;  1SRU A;  2VY3 A;  2ZTC A;  5EKK A;  3J7A V;  4IZ8 A;  4JPB W;  1EU3 A;  4DK3 C;  3LX0 A;  4DXF A;  4DR1 Q;  1JWM D;  3NHH A;  1IZ6 A;  1AW7 A;  1DOL A;  3R3O A;  5C0X J;  5E3F A;  4P75 A;  4IQZ A;  4ALP A;  3I4M G;  3I8Z A;  5JVH 3;  3CCV A;  1X32 A;  1SYE A;  2NVX H;  3GV6 A;  2EY6 A;  2EOT A;  4N8X 1;  3SK8 A;  4A3C G;  2UXD Q;  4DR3 Q;  3K57 A;  2PQA B;  4X66 L;  1H9K A;  3BZC A;  3OW2 A;  1PZJ D;  4LF6 Q;  1HZC A;  3BZD B;  3QR8 A;  2A5H A;  4FDB A;  1PVO A;  3KOJ A;  1DOM A;  3KUP A;  4KI0 A;  2UU9 Q;  1G91 A;  3T13 A;  1KLG D;  1U4L A;  2Z8L A;  4HJA A;  2G9H D;  3M85 A;  4DR4 L;  3BDC A;  5CV8 A;  4AQY Q;  1WOC A;  2RCF A;  3HOV H;  1TWC B;  4FVM A;  4DAP A;  3I4N G;  3URY A;  2ZTE A;  3HOU G;  4FO2 A;  1LTL A;  3T53 B;  3MAQ A;  1L0Y B;  2NZH A;  2KEC A;  1WTX A;  2VB2 X;  5M5W B;  4A3L H;  1SR3 A;  1I6H H;  2NB0 A;  1STE A;  4BXX G;  2EYH A;  4XT3 B;  1X55 A;  1QWY A;  5DAU A;  3MXP A;  4Y52 H;  3TEH B;  5KGU A;  3ULP A;  4DGZ A;  4JK1 C;  3CD6 A;  1N8R C;  3I2Z A;  5IYB G;  4POF A;  3MXN B;  4X62 L;  3GTG H;  4KLK A;  2C5C A;  1JCK B;  4DV1 L;  2WKD A;  2JA7 H;  2QA4 A;  1X6O A;  1JC7 A;  3M3Y H;  4K8J A;  3W5O A;  2NVT B;  2F0U A;  3VR4 A;  4XDX A;  3MXU A;  2F0G A;  2IX1 A;  1I4R A;  3RLO A;  1STB A;  1B1Z A;  1NR2 A;  4JVZ A;  2E2I H;  1M1K C;  1X65 A;  4CHT B;  4DXG A;  1EUJ A;  1QZG A;  2O2L D;  2R7F A;  4JI7 Q;  1I6V C;  1LTS D;  2NTT A;  2JN4 A;  2XWJ B;  4K5X A;  1HR0 W;  4H02 A;  4TRD A;  1KNE A;  3KLW A;  4LFA Q;  1LO5 D;  1AZP A;  1EY7 A;  1A63 A;  4BA1 I;  1SFO B;  5LMN L;  3VYR A;  1VQN A;  4ZUI A;  5IGE A;  4JBJ A;  1UWV A;  4OXP A;  4F7X A;  1VQE A;  1JQY D;  3RN5 A;  2XVS A;  4ID6 A;  5JEA H;  1KXL A;  1HUN A;  3H3V I;  1U9R A;  1MHW C;  4L8J A;  2L0C A;  4LMQ D;  4NDX A;  4RKB A;  3UDX A;  4FF4 A;  3EVQ A;  1I4Q A;  4IPG A;  1QIL A;  1SNM A;  1JB3 A;  3OSO A;  2K32 A;  5GAG C;  1Y8P B;  4C3I B;  2FXQ A;  2CWP A;  4R4Q A;  4DV2 Q;  3FKI H;  2OCE A;  1TS5 A;  4DUY L;  3HOW B;  1S5C D;  3LWU A;  2F0V A;  1VMP A;  3I4O A;  4KHV A;  4DFA A;  3OTO L;  1CA5 A;  2JA5 B;  5C3E H;  3W1G A;  3KJO A;  4A3I B;  1YNJ C;  2MQH A;  1HNZ L;  5CMD A;  4GLV B;  1NTG A;  3OW7 A;  3S17 H;  1U0L A;  1S5D D;  2OXP A;  3A8I E;  5JJL A;  1MD2 D;  3Q6S A;  5CV6 A;  4ZYS A;  1ONL A;  3VYS A;  3CMA A;  1JOR A;  3MZ5 A;  4C3H B;  1JB7 A;  1I3Q B;  2EZV A;  4I65 A;  4X66 Q;  1WTW A;  1K83 B;  4O1N A;  2B2Y C;  2ZXO A;  3A55 A;  2NVY H;  3ERO A;  3GTQ B;  2IX0 A;  2BH8 A;  4KN4 C;  2HDM A;  3MC0 B;  2NUC A;  2EYO A;  4ILW A;  3BYT B;  1L1O C;  2QEJ C;  1Y1W G;  2R7Z G;  4BY1 G;  4JOI A;  2A6E C;  1KIX A;  1RF2 D;  4DR4 Q;  1TWG H;  1PH4 A;  2XN9 C;  4LF5 L;  1CKM A;  2A68 D;  4ODG A;  3FVQ A;  5COR A;  4LFC L;  3VYU A;  1B50 A;  2R92 B;  3E0E A;  1XMO L;  1VQ8 A;  1VF7 A;  4B9W A;  1UEA B;  5M5Y H;  4IO9 A;  1FL0 A;  3K5O A;  4DAY A;  2HCI A;  1EEF D;  2LMC B;  4A3E B;  1SNQ A;  2FIN B;  1KTK A;  3D6C A;  2XNA C;  3BS1 A;  1KDA A;  4KJO A;  1Q1E A;  2KUM A;  3RLN A;  2QDL A;  2B63 B;  1NSN S;  1XYI A;  1IYJ B;  4RKL A;  3CCJ A;  4CKC A;  1Q8I A;  2B8F A;  1F9P A;  5A2Q L;  4OIK A;  4R1J A;  4A3M H;  5BN3 A;  4X62 Q;  4F8M A;  3I56 A;  3HKZ E;  3E9I A;  4A3B B;  2KHI A;  2F0F A;  1B53 A;  4DV1 Q;  4F88 A;  1WD0 A;  3SR1 A;  4KKT A;  3ZJY C;  5HUR A;  5IP9 G;  1PFN A;  5T1G A;  2TSS A;  1TVX A;  4KHP L;  1R9T H;  1BBX C;  2I46 A;  3L2P A;  1SNP A;  2PYK A;  3WDN A;  2RDF A;  1EU4 A;  4A3K H;  4DV4 L;  1BF4 A;  4Y7N B;  1TWA B;  1I5F A;  1EY6 A;  4X64 L;  3MFY A;  3TZU A;  4QCL A;  1JWS D;  2K14 A;  2D2C C;  2CFM A;  1V8Q A;  5EPK A;  5LMN Q;  3RZD H;  3FP9 A;  3TSS A;  4A75 A;  5L37 A;  3PO2 H;  1K3B C;  3GTJ B;  1QNU A;  4GN5 A;  1W3S A;  4JI5 L;  4NW2 A;  1B4O A;  1EY9 A;  1AEX A;  2JA8 H;  5K5P A;  4GKJ L;  3J7Z C;  1HNX L;  4J8Q A;  3PIO A;  4DV0 L;  1E1T A;  4IUP A;  1Q46 A;  3PCO B;  4HTH A;  3H0G B;  3K5M A;  1IBM L;  4OHJ A;  2F3V A;  2KHS A;  3KF6 A;  1SBB B;  1IXR A;  2KA7 A;  1Y8N B;  5M3M G;  1XMQ L;  4DUY Q;  1K8A C;  5E1F A;  4C1N I;  5DEH A;  3S1R H;  3HKZ B;  4LWC A;  4JI0 L;  2E2J H;  3OTO Q;  3S1M B;  4A4I A;  1EZ8 A;  3IL8 A;  1PMR A;  4KTA A;  2EPB A;  1D1K A;  2F0E A;  4TSS A;  2JXM B;  3E0J A;  5DM7 3;  1HNZ Q;  3AYH B;  1B9N A;  3QOL A;  1JIC A;  2L1B A;  4UY8 C;  4OO1 I;  2DN8 A;  5FLX c;  1C7Y A;  2RBM A;  2F3W A;  3ULL A;  5GAH C;  3BYY B;  1OTC A;  1G2T A;  3TS0 A;  4BBS G;  2R93 B;  1TWH B;  4WJ3 M;  2CW0 C;  4RHS A;  1L1O B;  1B8A A;  3S9W A;  4UHV A;  1SYC A;  2VUM B;  5CV9 A;  2IL8 A;  2MPM A;  2E74 C;  3GTK H;  2F0K A;  2F0W A;  4DU9 A;  4A3G H;  1HFG A;  2CKZ B;  1ENA A;  1WVL A;  2KEN A;  3J80 i;  4DPG A;  4KD3 A;  5C0X H;  4K8I A;  3I70 A;  3J7A F;  4KY5 A;  1YHQ A;  1GVP A;  4DK6 C;  1PH1 A;  2I5L X;  4LF5 Q;  1XPR A;  4LFC Q;  2F0O A;  4O42 A;  1AP0 A;  4A3D G;  2NZO A;  3FEW X;  1XMO Q;  1Q1B A;  1SN8 A;  3TBI B;  1PZK D;  2DGY A;  3H91 A;  2N49 A;  3ULJ A;  3Q24 A;  2ZJR A;  2BA1 A;  1V9P A;  1D8L A;  4DV5 L;  3KDF A;  2ES2 A;  5JEA J;  3RUZ A;  3GTM H; 
#chains in the Genus database with same CATH homology
 4KK7 A;  5EPJ A;  4ZAI A;  1LV9 A;  3J7Y W;  1RJT A;  2FMM A;  1HA6 A;  2L9H A;  4WOR A;  3OHX C;  1K8O A;  1UAP A;  2ID0 A;  3G6J B;  3I4M B;  1H9J A;  1JOO A;  2LS0 1;  1LT5 D;  2IT1 A;  2Q8T A;  2PZW A;  1FR3 A;  4CJ1 B;  4ZUJ A;  3PUX A;  2AQ2 B;  2QF7 A;  4NKL A;  3GTL B;  3DUZ A;  4V0B A;  4CJ0 B;  4RGM A;  3SK4 A;  4XQJ A;  3T16 A;  4QB4 A;  1F9S A;  3I4N B;  2A6E D;  2ICI A;  4DF7 A;  1C8C A;  5ELE A;  4FF1 A;  1A2U A;  4A3F B;  3SXH A;  3KLR A;  1TS3 A;  3R93 A;  1QJO A;  2BA0 A;  1VMC A;  1AZQ A;  1PZI D;  2VB3 X;  5FK9 C;  2EE1 A;  2K04 A;  4OIJ A;  4RGN A;  3NP8 A;  2NWG A;  1I4P A;  3R2I A;  1I4G A;  2K6A A;  4QF4 A;  3TP8 A;  2AUJ D;  1LT4 D;  3DMU A;  1CQF A;  3J80 L;  3A8K E;  1GUW A;  1KDB A;  2BOS A;  2MGS A;  3GQB A;  3PUW A;  1Q90 A;  2D5D A;  5I9P A;  3PIO 3;  1SJE D;  1A3V A;  4ZKB B;  3KBX A;  3VYT A;  1ILQ A;  2B39 A;  3D4W A;  2PQE A;  2HQE A;  1PDQ A;  5HGT A;  1CQV A;  1DZ1 A;  1G6Z A;  2WIN B;  3PMF A;  1GHJ A;  3D4R A;  1VCI A;  2A68 C;  2NTS A;  2F0L A;  1WTQ A;  3VR3 A;  5C0X I;  5JEA G;  5JAV A;  1LTA D;  5J22 A;  1DON A;  4JBW A;  3GV3 A;  4K2L A;  2AUK A;  1EWH A;  4PMC A;  1TY0 A;  1F2Z A;  2V4D A;  1FD7 D;  2J7Z A;  4OGQ C;  3KLS A;  3VA7 A;  2O4X A;  3P75 A;  3Q22 A;  3PUV A;  1STA A;  2NZ1 D;  2CW0 D;  1QB5 D;  3IFD A;  1Y1W B;  5KNB A;  2R7Z B;  2K05 A;  2A6H D;  4BY1 B;  5C3X A;  3J81 L;  3IKJ A;  2Y0S B;  1STG A;  2XSC A;  4GZY C;  3I72 A;  1AN8 A;  3F2U A;  1UUP A;  1GUN A;  1SYG A;  4PNY A;  2IW3 A;  4HR7 B;  1G29 1;  3KBG A;  1SE3 A;  1QCB D;  1TS4 A;  3OMC A;  4FYD A;  2FJ2 A;  3NUC A;  4R8N A;  4U67 3;  5IT9 E;  3JAM E;  2M9V A;  5EPL A;  3K0Y A;  5I2X A;  1D6E C;  3MXN A;  2XRQ D;  5M9O A;  4G7Z C;  5I6W A;  2B2W A;  1BXT A;  1Y69 U;  1TWF B;  5BN5 A;  3VR5 A;  2F0H A;  4BWG B;  3QO2 A;  1EOT A;  1L0X B;  1HPC A;  1O7Z A;  1DYQ A;  1BR9 A;  4MHE A;  2H4O A;  4UDU C;  5FO9 B;  2BDO A;  1B44 D;  4OL7 A;  2Z4H A;  1B2T A;  2SEB D;  1BOS A;  1X3Q A;  3SK5 A;  1BDO A;  3QOJ A;  4BY7 B;  4K5W A;  1KAA A;  1PTO H;  2EXZ A;  2VXW A;  3NXW A;  3SE0 A;  3GO5 A;  1LTT D;  3S15 B;  5ELD A;  3LWE A;  5M3M B;  4QUC A;  1IW7 D;  3RMH A;  2D62 A;  2KQ3 A;  3L7Z C;  1NAP A;  3BVM A;  4X3S A;  4CJ2 C;  3K59 A;  4H13 C;  4KJN A;  2XIW A;  4OO1 H;  2K03 A;  3NTH A;  4N9P A;  1X3P A;  2FHT A;  1Y8O B;  1CZG A;  3MFG A;  5EGT A;  4HSV A;  4BBS B;  2IPK D;  3H94 A;  3DEP A;  2XRS D;  2BE5 C;  2B2T C;  2Q8R E;  3I90 A;  3FMC A;  3VA5 A;  3NE5 B;  2PNR C;  1ET9 A;  1EQT A;  3NK9 A;  1G2S A;  4IUR A;  2EYF A;  4A3D B;  4K14 A;  2EYM A;  1VDZ A;  2EY1 A;  4K2K A;  2YU9 B;  5C0X G;  4LJZ C;  1RTO A;  1ML0 D;  4LK1 C;  2L5T A;  3SEB A;  1IHZ A;  4RA8 A;  3S1Q B;  4FF2 A;  4XIG S;  3K5N A;  3NQI A;  3P20 A;  4FXK C;  1B3A A;  1IYV A;  1DJR D;  1MBY A;  2EJG C;  2F0J A;  1LTI D;  1LTR D;  2ENB A;  2K33 A;  1OXU A;  4P2C B;  1STH A;  3D3R A;  2SNS A;  3EQL C;  2GA4 B;  4DN4 M;  5IGD A;  1ZYR D;  1U4P A;  3C46 A;  4H7B A;  1SE4 A;  4CKE A;  2F0S A;  4K5V A;  2NVX B;  4HMI A;  5JOB A;  1GHK A;  3NBH A;  2PW5 A;  1STN A;  5IIF A;  4IUU A;  3P7J A;  4XT1 B;  1SMY C;  4C3J G;  1S5F D;  1TII D;  1PRT C;  2A74 C;  1O80 A;  2OEO A;  1HUM A;  4Q0F A;  5IT9 L;  3JAM L;  5CV4 A;  1TY2 A;  4DK0 A;  1XX8 A;  4TKO B;  3HOV B;  4MIU A;  3DWQ A;  2Z1C A;  2WII B;  3EFX D;  3HG9 A;  4WRD A;  1MGS A;  1HTP A;  3L9A X;  1F77 A;  5FO7 B;  1ILP A;  3MXG A;  1H9S B;  1I6H B;  3DHQ A;  1MSG A;  3PUZ A;  4ZQ3 A;  1STY A;  2O5J C;  1LTB D;  1D1I A;  1V43 A;  5ELF A;  3LNN A;  3GTG B;  3HZX A;  2B2Y A;  1TR5 A;  3VR2 A;  3H6M A;  2CVR A;  1BNZ A;  3I3C A;  2PZT A;  4KHZ A;  3TDQ A;  1SJH D;  3M3Y B;  1LT6 D;  2K5D A;  1RD9 D;  1SEB D;  2SOB A;  2E2I B;  4U68 A;  2F1M A;  1S5B D;  3SHL A;  4XQN A;  5EQ0 A;  1A3T A;  1ET6 A;  5C5L A;  2VNU D;  5J39 A;  5IGF A;  4KN7 C;  4G7O C;  1CHQ D;  3MEH A;  2A6H C;  1I4X A;  5C3W A;  5IGG A;  3D6W A;  2J4X A;  3AMU A;  2EYP A;  4RCN A;  2C9O A;  1LAC A;  5ELB A;  3HP3 A;  5CBE E;  5FO8 B;  2KEE A;  2E2D C;  4XQQ A;  4XXE A;  3NPP A;  4IFD I;  5EKI A;  3FKI B;  2AQ3 B;  3T56 B;  4NMZ A;  4YIJ A;  4X3K A;  4TQU S;  3DWA A;  5C3E B;  1ESF A;  1SYF A;  2N88 A;  3A7A B;  1T5X D;  3S17 B;  1ZEQ X;  2F0T A;  3MTS A;  3AU7 A;  2PZU A;  2BE5 D;  3FPU B;  3PIP 3;  5D65 A;  1DOK A;  1PRT B;  2NVY B;  2KVM A;  1TT2 A;  1QE6 A;  3O13 A;  3Q0A A;  1OXV A;  3GD7 A;  4IFD J;  1TWG B;  3ND9 A;  2L55 A;  3BDO A;  1HRJ A;  5CV7 A;  3FRP B;  2HUG A;  1PRT F;  2TMP A;  3HRZ C;  2NN6 H;  3D31 A;  1PTO D;  3TZD A;  3A54 A;  3QJY A;  3W3A A;  1S5E D;  2RKS A;  2L11 A;  3D8G A;  3HOU B;  2F4I A;  5IGC A;  1V1P B;  3CRL C;  1IW7 C;  1RTN A;  2L4N A;  1O7L A;  4PMB A;  4B9X A;  1CFM A;  4A3M B;  5KEE A;  1M4V A;  5JPN C;  2OT2 A;  1KLU D;  1D5M C;  4QMG A;  4KV6 A;  4ZK9 B;  5JPM C;  1GXD C;  3I4L A;  1IKM A;  5CGK A;  1BO0 A;  2E2H B;  2DY7 A;  1R9T B;  3ITP A;  2MJ8 A;  3KLS X;  1GJX A;  2LKV A;  1NUC A;  1R4Q B;  4RH6 A;  3MWY W;  1EL0 A;  1HCZ A;  2WB1 B;  5I6Y A;  5E4W C;  2OF1 A;  5LL6 S;  5K36 H;  1GUO A;  3QB3 A;  1CTM A;  2SDF A;  3RZD B;  5CV5 A;  5IGB A;  1XXG A;  1HHV A;  1TKW B;  3PO2 B;  5NUC A;  1SMY D;  4HCE A;  1D5X C;  3CKI B;  1Z47 A;  1PRT D;  2JA8 B;  2KED A;  5T1I A;  3GP7 A;  1EYD A;  4HSP A;  1SXT A;  2X69 A;  1ZXT A;  2QIL A;  1BQQ T;  2EDG A;  3G7L A;  4R9W A;  3S1R B;  4XTC S;  2EJF C;  2E2J B;  1HTL D;  2DNC A;  1SDF A;  3OIP A;  4OO1 G;  4F87 A;  3IAY A;  3SK6 A;  2DY8 A;  4FXD A;  1F9R A;  1CT1 D;  1ENC A;  1KDC A;  5I2Y A;  1U4M A;  1ENF A;  2FMC A;  2HDL A;  4G7H C;  4WFN 3;  2QCP X;  3GTK B;  1ZYR C;  4E6I A;  3L3O C;  1R4P B;  4V19 0;  2A69 D;  4ULL A;  3V96 A;  4EQP A;  4Z9C B;  4EGV A;  3K7A B;  3TP5 A;  4RGT A;  1CM9 A;  5E4X A;  2PO4 A;  3K6O A;  3H09 A;  1PLF A;  1U4R A;  3TP7 A;  2F03 A;  1II3 A;  1JOK A;  3H3V C;  2KJX A;  1EIG A;  3GTM B;  4Q5V A;  5IOC A;  4J6H A;  1LTG D;  5I4D A;  2K5Q A;  2F0M A;  4A3J B;  3HS0 C;  1EQV A;  3TME A;  1RKN A;  5A2Q E;  4XYQ A;  1XWE A;  2K1B A;  1OXT A;  2G9D A;  3OMG A;  2NN6 I;  4LAA A;  3M7N A;  3R2T A;  4AYB B;  2E75 C;  5M5X B;  4HN7 A;  5LL6 X;  2AWO A;  3GTO B;  2SNM A;  2LY7 A;  4ZLT F;  3S2H B;  1Q3L A;  4X3U A;  3M4O B;  2EVB A;  5KND A;  1BUV T;  1KAB A;  2I07 B;  2KCN A;  5G3L D;  1M8A A;  4C3J B;  4G57 A;  5ELC A;  5C4H A;  2WAQ B;  5I9O A;  5D3D A;  2ZXR A;  3ND8 A;  5J1Z A;  1HQM C;  3R8B A;  3BVG A;  1B9M A;  2EY5 A;  1NR4 A;  2H1E A;  1W6J A;  1E0B A;  2ZXP A;  2RA4 A;  3BG3 A;  1GUS A;  5FLX E;  4KD4 A;  5EKL A;  1Z7T A;  1EY4 A;  1RDP D;  4IUN A;  1SYD A;  1TU2 B;  1FNW A;  2RQX A;  1A3U A;  4S3S A;  1SSO A;  4ME5 A;  1CK1 A;  3HEJ A;  3OWE B;  2Q8I B;  5D3I B;  2DNE A;  4C56 C;  5KIX A;  3C3L A;  1SNC A;  2IJ0 A;  5DNF A;  4RFB A;  1EWC A;  1CZW A;  3IFT A;  4K6L A;  2QDB A;  4DK1 A;  1OXX K;  5CBA E;  1I50 B;  2B2V C;  3S16 B;  2B8G A;  4IN3 A;  1H9R A;  3X3N A;  1WTO A;  2F0N A;  4FF3 A;  4HCS A;  1FNU A;  2X6G A;  4HMJ A;  3WOF A;  1O7Y A;  5EJW A;  2RVL A;  2N55 A;  5CR3 A;  3E6Z X;  1DXM A;  3RD4 A;  3D4D A;  2BDN A;  3ONA B;  3BDL A;  1JE4 A;  4FP5 D;  1DM0 B;  4IFD H;  3MHB A;  5CC4 A;  2L12 A;  3OWF A;  3KF8 A;  3A56 A;  4L6T B;  4M1U B;  1EY8 A;  2RSN A;  1EIH A;  1BCP C;  1PTO C;  5TSS A;  1YNN D;  3VR6 A;  5D14 A;  3NTI A;  1QOH A;  2PPB C;  4UAI A;  2IWH A;  1MI2 A;  3DEO A;  2JYO A;  5FOB B;  3CRK C;  1LT3 D;  4RGO S;  2KCC A;  2AQ1 B;  1PFB A;  4L63 B;  1SND A;  1HFN A;  4IUT A;  1TS2 A;  2JSO A;  3HOX B;  4H0L C;  1W6K A;  4H44 C;  4K6D A;  1EY0 A;  1J8I A;  3NBI A;  5F2D A;  3PO3 B;  4FXG C;  3C1F A;  5KYL A;  1RCV D;  4IUQ A;  3TP6 A;  1WD1 A;  1EYC A;  1H9S A;  2NN6 G;  4I7Z C;  1PFM A;  1DCZ A;  2B2V A;  1MSH A;  1S4Z A;  1F2Y A;  2R3Z A;  3K5L A;  2EY2 A;  5KNC A;  3S1N B;  1HXY D;  3SVM A;  2EYL A;  5EBC A;  2B2U C;  2B2T A;  1H9M A;  2MHV A;  1HA5 A;  3FPP A;  3KK7 A;  3NWT A;  4NP5 A;  1CHP D;  3V2T A;  1OXS C;  3W2D A;  4FNF A;  4ZKC B;  2D9U A;  1Z6H A;  3J80 E;  4CGY B;  1A6X A;  2PW7 A;  3QG1 A;  4KMU C;  1Q12 A;  4KY7 A;  3NQT A;  1G8Z D;  5FLX L;  5C4J B;  1T5E A;  2EYJ A;  3FDT A;  2JA7 B;  3WOE A;  1XTC D;  3S2D B;  2NBF A;  5KYI A;  3N52 A;  1FYC A;  5COY A;  3ZYY X;  4ABN A;  5K36 G;  2A69 C;  3N6R A;  1TQO A;  3CHB D;  4HED A;  1D5Z C;  5KRU A;  4KKU A;  2NVQ B;  2JP1 A;  4QUF A;  1BCP B;  1PTO B;  1WCM B;  3Q23 A;  3NTK A;  4IUV A;  5EBD A;  1NCV A;  4KY6 A;  4HAE A;  1ICW A;  5C4Z A;  4R8I A;  2F0P A;  1QNK A;  5CYU A;  2CHB D;  2LFN A;  1JWU D;  3EJI A;  5BN4 A;  3PUY A;  3SDZ A;  3U9O A;  1BCP F;  1PTO F;  4EQO A;  2EJM A;  2WKC A;  4C3I G;  1AFP A;  3T4A C;  3OPO A;  1ROD A;  5C4X B;  2R6G A;  5A35 A;  1A2T A;  3RZO B;  2HCC A;  1O78 A;  1VF5 C;  4EVO A;  3S14 B;  4C2M B;  2K7V A;  1K8M A;  4RAU C;  1C4Q A;  2RDG A;  2WV6 D;  3MA2 B;  5IOD A;  3NWS A;  4EQN A;  1I4H A;  1LAB A;  5JVG 3;  1CA6 A;  1D2B A;  5C44 B;  2JE6 I;  3J81 E;  4C3H G;  2ZT9 C;  2B2U A;  3T51 B;  1PYW D;  2MUY A;  2E76 C;  3C1E A;  2MP1 A;  2FFK B;  1CI3 M;  2K01 A;  1EYA A;  1C48 A;  3CU7 A;  2XWB B;  2JEA I;  5JJZ A;  4DNT B;  3HGB A;  1V1P A;  3CQZ B;  5C6A A;  1IYU A;  1E2V A;  3M7G A;  1FNV A;  2JA6 B;  5M5Y B;  1F2L A;  1BCP D;  1E2W A;  1YNJ D;  3OIQ A;  1EZ6 A;  3A7L A;  1EEI D;  4G4K A;  1OO9 B;  3X3M A;  4B08 A;  5ISR A;  4CBV A;  1F2M A;  2KOL A;  4XYO A;  2CQA A;  2QKI C;  4RWS C;  3A8J E;  4J1M A;  3E5S A;  1WTR A;  2RSO A;  2O5I C;  4WJW A;  1FGB D;  1WTP A;  1LLR D;  1SYB A;  3I73 A;  2A73 B;  1EY5 A;  3DM1 A;  3M4Y A;  3RLF A;  1WTV A;  2K28 A;  2F0I A;  4CKB A;  2K5W A;  3C2P A;  4KKS A;  1F9Q A;  3QWN A;  1GOZ A;  1RHP A;  3NSW A;  4BS9 A;  4PQX A;  4DAV A;  4A3K B;  4M8A A;  2BCO A;  1JOQ A;  4BBR B;  2RDH A;  3DXJ C;  4RCO A;  4X3T A;  1JR0 D;  1GUT A;  1Y1V B;  1IL8 A;  2M2L A;  4BA2 I;  3PV0 A;  1V1O A;  4ZRZ A;  2M00 A;  4MN3 A;  1EFI D;  2J0T D;  1DD2 A;  1A15 A;  2F0Q A;  1E2Z A;  4PV1 C;  1YNN C;  3ERQ A;  5C5M A;  5LHY 1;  3U9S A;  5AFW A;  4DA2 A;  2F0D A;  5DM6 3;  1J9O A;  1QG7 A;  4QIW B;  3AB9 A;  2PCF B;  5FKA C;  1GUG A;  1IKL A;  2NYZ D;  3QIA A;  2B2W C;  2PMZ B;  1SE2 A;  1ESR A;  3BVZ A;  3DWP A;  1KNA A;  3HOY B;  3K58 A;  1SNO A;  4A3G B;  3OOC A;  5M3F B;  3TN2 A;  4N9T A;  5G3L F;  2YYZ A;  4C1N K;  4IAL A;  2R61 A;  3MVV A;  1ZKO A;  2WAC A;  4PMW A;  3I91 A;  3GTP B;  4DNR B;  4RHR A;  1PXU A;  3UI2 A;  4IFD G;  2JEB I;  2WP8 J;  4A93 B;  1UNS A;  3EA6 A;  2Z4I A;  2X6L A;  2IX3 A;  1SAP A;  3HOZ B;  3V05 A;  2AWN A;  3P1H A;  1HQR D;  2ICE C;  3J7A V;  5EKK A;  4IZ8 A;  1EU3 A;  3LX0 A;  4DXF A;  1JWM D;  3NHH A;  1AW7 A;  1DOL A;  3R3O A;  5C0X J;  5E3F A;  4IQZ A;  3I8Z A;  5JVH 3;  1X32 A;  1SYE A;  3GV6 A;  2EY6 A;  2EOT A;  3SK8 A;  3K57 A;  1H9K A;  1PZJ D;  3BZD B;  2A5H A;  1DOM A;  3KUP A;  4KI0 A;  1G91 A;  3T13 A;  1KLG D;  1U4L A;  2Z8L A;  2G9H D;  3M85 A;  3BDC A;  5CV8 A;  1TWC B;  4FVM A;  4DAP A;  3URY A;  4FO2 A;  3T53 B;  3MAQ A;  1L0Y B;  2KEC A;  1WTX A;  2VB2 X;  5M5W B;  2NB0 A;  1STE A;  2EYH A;  4XT3 B;  1QWY A;  5DAU A;  3MXP A;  5KGU A;  4DGZ A;  4JK1 C;  2C5C A;  1JCK B;  2WKD A;  1JC7 A;  4K8J A;  2NVT B;  2F0U A;  3VR4 A;  4XDX A;  3MXU A;  2F0G A;  2IX1 A;  1I4R A;  1STB A;  1B1Z A;  1NR2 A;  4CHT B;  4DXG A;  2O2L D;  1I6V C;  1LTS D;  2NTT A;  4K5X A;  2XWJ B;  4TRD A;  1KNE A;  1LO5 D;  1AZP A;  1EY7 A;  4BA1 I;  1SFO B;  3VYR A;  4ZUI A;  5IGE A;  4F7X A;  1JQY D;  2XVS A;  4ID6 A;  5JEA H;  1HUN A;  1U9R A;  4L8J A;  2L0C A;  4LMQ D;  4NDX A;  4RKB A;  4FF4 A;  3EVQ A;  1I4Q A;  1QIL A;  1SNM A;  1JB3 A;  3OSO A;  2K32 A;  1Y8P B;  4C3I B;  1TS5 A;  3HOW B;  1S5C D;  3LWU A;  2F0V A;  1VMP A;  4KHV A;  4DFA A;  1CA5 A;  2JA5 B;  4A3I B;  1YNJ C;  5CMD A;  3OW7 A;  1S5D D;  2OXP A;  3A8I E;  1MD2 D;  3Q6S A;  5CV6 A;  4ZYS A;  1ONL A;  3VYS A;  1JOR A;  3MZ5 A;  4C3H B;  1I3Q B;  2EZV A;  4I65 A;  1WTW A;  1K83 B;  4O1N A;  2B2Y C;  2ZXO A;  3A55 A;  3ERO A;  3GTQ B;  2IX0 A;  4KN4 C;  2HDM A;  2NUC A;  3MC0 B;  2EYO A;  4ILW A;  3BYT B;  2QEJ C;  2A6E C;  1RF2 D;  2XN9 C;  2A68 D;  4ODG A;  3FVQ A;  5COR A;  3VYU A;  1B50 A;  2R92 B;  1VF7 A;  4B9W A;  1UEA B;  3K5O A;  4DAY A;  2HCI A;  1EEF D;  2LMC B;  4A3E B;  1SNQ A;  2FIN B;  1KTK A;  3D6C A;  2XNA C;  3BS1 A;  1KDA A;  4KJO A;  1Q1E A;  2KUM A;  2B63 B;  1NSN S;  1XYI A;  4RKL A;  4CKC A;  1Q8I A;  2B8F A;  1F9P A;  5A2Q L;  4OIK A;  5BN3 A;  4F8M A;  4A3B B;  2F0F A;  1B53 A;  4F88 A;  1WD0 A;  3SR1 A;  4KKT A;  5HUR A;  1PFN A;  5T1G A;  2TSS A;  1TVX A;  1BBX C;  2I46 A;  1SNP A;  2PYK A;  3WDN A;  2RDF A;  1EU4 A;  1BF4 A;  4Y7N B;  1TWA B;  1EY6 A;  3MFY A;  3TZU A;  4QCL A;  1JWS D;  2D2C C;  1V8Q A;  5EPK A;  3TSS A;  3GTJ B;  1QNU A;  4NW2 A;  1B4O A;  1EY9 A;  1AEX A;  5K5P A;  4J8Q A;  4IUP A;  4HTH A;  3H0G B;  3K5M A;  4OHJ A;  2F3V A;  2KHS A;  1SBB B;  2KA7 A;  1Y8N B;  5E1F A;  4C1N I;  5DEH A;  3HKZ B;  3S1M B;  1EZ8 A;  3IL8 A;  1PMR A;  4KTA A;  2EPB A;  1D1K A;  2F0E A;  4TSS A;  2JXM B;  3E0J A;  5DM7 3;  1B9N A;  3QOL A;  1JIC A;  2L1B A;  4OO1 I;  2DN8 A;  2RBM A;  2F3W A;  3BYY B;  1G2T A;  2R93 B;  1TWH B;  2CW0 C;  4RHS A;  3S9W A;  1SYC A;  2VUM B;  5CV9 A;  2IL8 A;  2MPM A;  2E74 C;  2F0K A;  2F0W A;  4DU9 A;  1HFG A;  1ENA A;  1WVL A;  4KD3 A;  5C0X H;  4K8I A;  3I70 A;  3J7A F;  4KY5 A;  2F0O A;  4O42 A;  1AP0 A;  3FEW X;  1Q1B A;  3TBI B;  1PZK D;  3H91 A;  3Q24 A;  2BA1 A;  5JEA J;  3RUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...