3FPUB

The crystallographic structure of the complex between evasin-1 and ccl3
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
66
structure length
66
Chain Sequence
SLAADTPTTCCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Evasin-1
publication title Structural basis of chemokine sequestration by a tick chemokine binding protein: the crystal structure of the complex between Evasin-1 and CCL3
pubmed doi rcsb
source organism Rhipicephalus sanguineus
molecule tags Immune system
total genus 15
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fpuB00
4HEDA 3SVMA 2B2VC 1WTOA 4XT3B 1TVXA 1G2SA 4CJ2C 1WD1A 1DOKA 2KECA 1G6ZA 2FJ2A 4ZKCB 1F9SA 1DONA 1WTXA 1DZ1A 3HP3A 3I91A 5EQ0A 1MSGA 1HFGA 2RSOA 4IUUA 1WTWA 3MWYW 2KUMA 5EPLA 1WD0A 1QG7A 3DEOA 4CJ1B 1U4RA 2RVLA 3N52A 1X3PA 2MGSA 3DM1A 1DOMA 1O7ZA 1AP0A 2K03A 4QUCA 2KOLA 1PFMA 1RHPA 3GV6A 1ESRA 1BNZA 3LWEA 1B53A 1QE6A 1WTVA 1QNKA 1O7YA 1CA6A 1PFBA 2M2LA 2JYOA 4IUQA 1G2TA 1MSHA 1RJTA 2FFKB 1JE4A 2FMMA 3D6WA 4HCSA 2HCIA 1F9RA 1X3QA 5D14A 2SDFA 1O80A 3IL8A 2B2WC 4QUFA 2Q8RE 1PLFA 4OIKA 1AZQA 1C8CA 2R3ZA 1CM9A 1F2LA 2B2UA 1SSOA 2B2YC 2B2TC 5E4WC 4OIJA 2IL8A 4X3UA 4IURA 2KEEA 1U4PA 2X6GA 4ZKBB 1IL8A 2HDMA 5EPKA 5E4XA 1EQTA 1E0BA 1RTOA 2HCCA 2L1BA 3FPUB 5EKIA 1SAPA 2B2VA 2N55A 1JICA 3I8ZA 2XIWA 3MTSA 4IUTA 1WVLA 3ONAB 2HUGA 1CA5A 1B2TA 1J9OA 5COYA 1BF4A 4XT1B 2MP1A 2NZ1D 4IUVA 1KNEA 5D65A 5AFWA 4DN4M 2MPMA 1F9PA 2K01A 1B4OA 4R9WA 2KVMA 3F2UA 2D9UA 3UI2A 3Q6SA 2FHTA 1J8IA 1HA6A 1HHVA 1ZXTA 2NWGA 2RSNA 1M8AA 1KNAA 4HSVA 4UAIA 3TZDA 4X3TA 3R93A 1G91A 3I90A 1HUMA 1NAPA 2DY7A 2K28A 1HRJA 1ML0D 1WTRA 2Q8TA 4CJ0B 1HUNA 1NR2A 4ZAIA 1IKLA 5T1IA 2MJ8A 2X69A 1ILPA 1VMCA 1IKMA 5CORA 3G7LA 4HAEA 4RWSC 1MI2A 3KBXA 4O42A 5CBEE 1VMPA 1PFNA 1SDFA 2HDLA 3TN2A 1EIGA 1EIHA 1EOTA 2B2YA 2H1EA 1PDQA 2EOTA 4X3KA 2L12A 2J7ZA 1XX8A 2JP1A 2KEDA 3GV3A 3I3CA 2X6LA 2L11A 2L4NA 1X32A 3FDTA 1BO0A 4XDXA 3IFDA 2BDNA 2RA4A 3KUPA 1DOLA 4U68A 5DNFA 3P7JA 1RTNA 2FINB 4MHEA 1WTQA 2CVRA 2EPBA 4NW2A 1MGSA 1U4LA 1F9QA 1U4MA 2EE1A 4RAUC 1EL0A 4ZLTF 2L9HA 5EPJA 3QO2A 1BBXC 2N88A 4MN3A 1A15A 1B3AA 2DY8A 2VXWA 5CMDA 1HFNA 2K04A 4LMQD 1ILQA 2B2WA 3H91A 1ICWA 5T1GA 4ZK9B 2K1BA 5CBAE 1GUWA 1NCVA 2B2UC 5JJZA 1S4ZA 2B2TA 4IUPA 1NR4A 4R8IA 2NYZD 4RA8A 1LV9A 1XYIA 4X3SA 1RODA 2K05A 5EJWA 1WTPA 1AZPA 1B50A 3DEPA 1Q3LA
chains in the Genus database with same CATH superfamily
4PMWA 1J5EQ 1WTOA 4H13C 2F0DA 5ELDA 4DV4Q 2FJ2A 5M9OA 3A5ZB 4BBSH 1DZ1A 1BOSA 4K2LA 2WB1G 4RGTA 3PIOA 3S1NB 1QG7A 3MXNB 5JVG3 1X3PA 1Y1WH 1SJED 4OO1H 1Y1VB 4L5QA 3S17B 3MHBA 1HCZA 3PF4A 1WTVA 1PTOF 1R4QB 1WOCA 4IUQA 1KAWA 1GUTA 1MSHA 4R4QA 2WB1B 1PTOH 1X3QA 3I4MH 1O80A 3IL8A 2E74C 5LL6S 3QWNA 1PTOD 1VQDA 4DF7A 1PH6A 5H1SE 2NN6G 1KQSA 3MXGA 4GOPC 3EFXD 1Q1BA 1CA5A 5D65A 5IP9H 4CDEC 3S9WA 1F9PA 1ET6A 4WJ4A 2FMCA 4FXDA 2JA6H 4M8AA 2EYPA 2WKDA 4LUOA 1VQCA 2PPBC 1CZWA 2NTTA 4MZ9A 1Q8IA 1SEBD 2K28A 3DUZA 3S1MH 3K6OA 4JI3L 1R9TH 2WIIB 1IKLA 2CH4A 2X69A 1HA5A 1STEA 3L0OA 4TRDA 1X3EA 4HJ7A 5EBDA 3OHXC 4JI8Q 4HIMA 2F0JA 2L0CA 3GTPH 3HOXH 1SYGA 3TSSA 1SYEA 4P73A 4A3MG 3KJPA 2VS1A 3J7ZC 4FXKC 2F0WA 4H0LC 1EL0A 2JA8H 3WDNA 2BE5C 4Q0FA 1HZ9A 3HKZG 1K0SA 1VQJA 1U0LA 3VR4A 4BBSB 3H91A 4WORA 2K1BA 1RD9D 2WACA 1HNWL 3BU2A 1B50A 1ENFA 5KYLA 3J7AF 2KENA 3DEPA 4A3FH 4QIWE 1KXLA 1G2SA 4CJ2C 4B3RL 3HKZB 2KECA 4IPCA 4LJZC 2EYJA 1PV4A 4J8QA 1L1OC 1PTOB 1OXVA 5GADC 5FJ8H 5CV4A 3I4MB 2B8GA 4N9TA 1X9NA 1YNNC 3W1GA 4DR7Q 2RHQB 3M7GA 1RIPA 4Z9CB 2JN4A 3STBC 3JAMc 2KCTA 5IT9c 2JA9A 3SK5A 4A3JG 4BY7H 2M2LA 2CWAA 2FMMA 3BYTB 4HJ5A 2HCIA 2SDFA 2A8VA 4A3KH 1DYQA 1KIXA 4L6TB 1X3FA 3AQQA 4QUFA 4QB4A 4N9PA 3JAML 1HNWQ 4AYBE 2IL8A 4H7BA 3FP9A 4BWGB 3H0GH 1EY0A 1QOHA 4EQPA 4DV3L 3C2PA 1EFID 2F0PA 1IBML 2HCCA 1HPCA 3QOLA 3TP6A 1SAPA 2N55A 4KY6A 3M4PA 1EU3A 5ISRA 3HOYH 1B2TA 4B3RQ 3S1MB 2A6EC 4A75A 1HNXL 1R9TB 4IUVA 4LUZA 2OTJA 3CRKC 2ZT9C 2OQ0A 4OXPA 4R8NA 2F1MA 2PZWA 2R7DA 2KVMA 3D4RA 3F2UA 3NTIA 2HHHL 4FYDA 1E2VA 4RHRA 1EYGA 3FVQA 4RH6A 3R93A 3GTPB 3HOXB 2XWBB 1Q90A 4C3JG 2O5JC 1PH4A 2VQFL 2K5DA 3FKIG 4EQ5A 3G7LA 5LMNW 1F2YA 1JJ2A 4UP8A 1W6KA 2JA8B 1B1ZA 3DWAA 3K81C 4LWCA 1C4QA 3I3CA 1QVCA 4DV3Q 4QJFA 1S40A 4C3JB 1IBMQ 5IYBH 1WTQA 1GUSA 4QGUA 1DJRD 2QILA 2F3WA 1JMCA 3TEHB 1Y69U 1HNXQ 3CRLC 2JA5B 4A3FB 4GZYC 1GHKA 2KQ3A 3OSOA 3BVGA 1HXYD 2K4KA 2HHHQ 1E2ZA 1T5EA 5T1GA 3L3OC 1N36L 3OWFA 4IJHA 3A8IE 1AFPA 5JEAJ 1UE6A 4RGMA 3CF5A 2OTLA 2DJGC 3GTLH 2B2VC 2VQFQ 4XQQA 2PNHA 4YWMA 4FP5D 2L55A 2ATWA 2GN5A 2BE5D 3WWVA 1PH1A 4BY7B 1N33L 5GAEC 3A7AB 2F0MA 5IGGA 2KUMA 4A3BG 4A3KB 1CFMA 1STGA 4XTCS 4A3EH 2MGSA 1HTLD 4WRDA 2WAQE 1AP0A 2Q2TA 4P72A 2DNCA 4DR6L 2WKCA 4PMCA 3OOCA 5D14A 4NB3A 4NXNL 5BN3A 4A3BB 4JI0L 4YCWA 3NQTA 5IGFA 2C5CA 3T1HL 1N36Q 3VR6A 3FHWA 3HOZH 1I4XA 1U4PA 1PYSB 2ICEC 1QVFA 1H9JA 4GOPB 3STBD 2XIWA 3U9OA 1I5FA 1KD1C 2IHFA 5ELNA 2F52A 2PW7A 3PUVA 5F2DA 5AFWA 2KHSA 1N33Q 2DJFC 4A76A 5M5YB 3FRPB 1SXTA 2KCMA 1O7LA 3HOVH 3CCRA 1M8AA 2O4XA 3K5NA 3AFQA 3I90A 3SR1A 3BS1A 1EZ6A 2EY6A 2OT2A 1STYA 3QR8A 2A6ED 2I07B 5JEAG 4N8X1 3OW2A 1VMPA 1TY2A 4NXNQ 1AH9A 4JV5L 4JI0Q 2EY1A 3K7AB 1I4RA 3VYRA 1YVCA 3KDFB 5IGCA 5GROA 1AEXA 4FXGC 3CHBD 1KC8C 1B9NA 4U68A 2RA4A 3U4ZA 1IZ6A 2ASBA 3FEWX 1U4LA 1U4MA 1UE1A 3TS2A 3GTLB 4HJAA 1CSQA 5D3IB 1UAPA 1BR9A 2F4VL 1A15A 1WCMG 1Q7YC 3TMEA 1GHJA 5E3FA 5LMUL 5JJZA 3H15A 5IGBA 4NPSA 3PO3H 4JBMA 1D5XC 2PMZB 4X3SA 4HJ9A 4A3EB 4DV7L 4ODGA 1JOQA 4HEDA 1K8OA 2XN9C 3MFYA 1KDAA 5LMNL 3GO5A 2Z6KA 4A4IA 1VQNA 1WCMB 4JV5Q 4OWXB 1L1OB 4DR5L 1TXYA 5E7NA 1GXDC 4LAAA 1N8RC 3KOJA 1E2WA 5KNDA 5CV6A 5BN4A 3HOZB 1PFMA 2B3GA 1D7QA 3GTQH 2NVXH 2R7FA 5FLXc 5J22A 2IW3A 3TP8A 4NXML 2MHVA 3UDFA 3L2PA 3QOJA 1RF2D 3VYSA 3W1BA 2F4VQ 4C3HH 1OO9B 3EVQA 3K0XA 4YIJA 1MBYA 5LMUQ 1TS3A 5FLXL 3CCSA 3I4NG 4DV7Q 2F0TA 5ELCA 4C56C 4BY1H 3S15B 2ZTEA 3QG1A 1TWAH 1QZGA 1D2BA 1Z7TA 2IX0A 5LMNQ 3EROA 3G48A 3HZXA 4IZ8A 1M90C 4KKSA 5L37A 1YHBA 2OF1A 3A54A 4DR5Q 2UXCQ 3A5UA 4R9WA 4RGNA 1B3QA 2GA4B 1SMXA 5FO7B 4LF7L 4CBVA 4DUYQ 1Q12A 3CMAA 4A3IG 1BBUA 4IO9A 5HGTA 1ILPA 1SN8A 4NMZA 2HDLA 3BVZA 3KLSX 4O0AA 5C4ZA 4Y7NB 4BS9A 4H02A 1VQ4A 2KEDA 1KDCA 5EKLA 3GD7A 2JA7H 3P7JA 1RTNA 1GM5A 2L5TA 3A8KE 4YHHL 2NB0A 3PO3B 2KA7A 1NSNS 3SEBA 1L2FA 5J3BA 3EQLC 2HQEA 4X65L 2E75C 2NVYH 4O1NA 1WJJA 1HFNA 1DD2A 1ICFB 3DM3A 4R4TA 3V96A 4LF7Q 1IHZA 1YIJA 3S14H 4P75A 3OMGA 2UU9L 3T16A 1PRTC 4KY5A 2CWPA 4TSSA 4CKEA 4QIWB 1WD1A 1GVPA 1RCVD 3J80i 1CT1D 3NK9A 4J15A 5I9OA 3GTQB 1F9SA 5C6AA 4A3GH 2KJXA 4YCUA 4JI7L 4I7ZC 2VW9A 4IUUA 4DPGA 1FGUA 4RGOS 2VY3A 3GTOH 1HTPA 3CW2C 3E0EA 2RDHA 2LXJA 3NBHB 3JAME 4HIOA 5IT9E 4YHHQ 3TS0A 4KY7A 3CD6A 4YWLA 4AYBG 1Z47A 1NUCA 1TIID 2JYOA 4BY1B 1TWAB 1QUQA 2XSCA 2E5LQ 1CZGA 2M9VA 4KN4C 1VF5C 3CP0A 2B2UA 2PQAA 3I7FA 1JORA 1X56A 1N34L 4U673 4OO1I 1BCPB 3AU7A 2L1BA 2E2HH 2UU9Q 1SMYC 3HOUH 1YZ6A 1A2TA 4F8MA 3S16H 5C3XA 2F0FA 2MP1A 4JI7Q 4IPGA 2MPMA 5EKKA 1K3RA 4J1MA 4ABNA 2A1AA 3GTMH 1WTHA 3HEJA 3OWEB 2CQOA 5CC4A 1I6HH 2F0VA 1TKWB 3L7ZC 2NZOA 1G91A 1OXXK 2N8NA 1PYWD 2JA7B 3F2DA 5IY0A 1LTBD 1SDFA 1PYBA 5K5PA 3TN2A 1NMFA 5IYDH 2CQAA 1UEAB 2J7ZA 2D2CC 4FF4A 4BXXG 1EY8A 1K83B 3CCVA 1N34Q 5C3EG 1MD2D 2YYZA 1WYDA 4GS3A 2VUMG 4L8JA 2HIVA 1LTGD 1Q86C 4JI4L 3CKIB 2AUJD 2K32A 2YTXA 5BR8L 3HOWH 4LFCL 1J5EL 2DY8A 1T5XD 3BZDB 5C3EB 4G7HC 1JCKB 1TWHH 3OMCA 1I4PA 1S4ZA 2VUMB 3G71A 3O13A 1TS4A 3VA5A 3M4QA 3GTOB 3TP7A 1EWIA 3OIPA 1PMRA 5KYIA 4QL5A 2I5HA 1VS0A 1KABA 3E9HA 1DONA 3PIP3 5EQ0A 1K8AC 1D5MC 1MSGA 4XYQA 1PRTF 5A35A 3H6MA 5JPMC 4KLKA 3SK8A 5EBCA 4I65A 3X3MA 3K80C 4OHJA 2XVSA 1C48A 2WAQB 1PRTD 4JI4Q 4FNFA 1S5FD 4IALA 4GNXA 1SLJA 5BR8Q 5KNCA 1ZKOA 2FFKB 3CCUA 4ZCKA 3S16B 1Y1VG 4ZQ3A 3KLSA 1XNQL 3RN2A 1HZAA 2B2YC 1OXTA 3UDGA 4OIJA 3P75A 3GTMB 2X6GA 1SRUA 1B9MA 3SDZA 1Y8NB 4CDCC 1LM0A 2NUCA 1EQVA 2C9OA 3MTSA 1XNRL 3ONAB 5FKAC 4PQXA 1S5DD 4ME3A 4HCEA 3D6CA 2AUKA 1D6EC 2EVBA 1Y14B 2F0NA 4KJNA 2Z1CA 2D9UA 2K5VA 3SK6A 1HJPA 4I7AA 3MXNA 1V1QA 4JI8L 4JYAL 3ND8A 4HTHA 2EJFC 3CPFA 4OELB 1I4HA 2K6AA 2PI2A 5KGUA 1SMYD 4ME5A 1TWGH 3RLOA 4QF4A 3I73A 3FPPA 3OYYA 2UUCQ 5CBEE 2J4XA 1SE8A 1CKMA 1XNQQ 4OGQC 2EOTA 5CV8A 4X3KA 2Q2IA 4EX5A 1UE5A 1I3QH 1TWCH 1TWHB 5A2QL 2M00A 3ICEA 1XNRQ 4G57A 3I2ZA 3CXCA 1A2UA 4J6HA 5I4DA 3J81L 2PQEA 4YY3Q 2SEBD 1GKHA 3S1RB 3EBEA 2IWHA 4M1UB 3CMEA 3TZUA 3SHLA 2A19A 1XPOA 2ZXOA 1ICWA 3I55A 4JYAQ 2QCPX 4R8IA 2JJQA 1WTPA 4TVAB 1PRTB 1UE7A 2Y0SB 2TSSA 4BBSG 1YJWA 1HH2P 4DR7L 3AB9A 1Z9FA 1JWUD 4JOIA 1EY7A 4RFBA 3AEVA 2LKVA 1Y1WG 4DV1L 1BVSA 1HFGA 1VQMA 1VQOA 4OO1G 5IE8A 2K33A 1SYCA 3D3RA 2HT1A 3Q23A 2NBFA 1B7YB 5FLXE 2K03A 1EIFA 3I4MG 3G6JB 4UHVA 2QDLA 3E5SA 3PQIA 4IN3A 4E6IA 3D6WA 5I6WA 3CPWA 1AE2A 1Y1WB 4KMUC 2JEAI 1C0AA 3QB3A 4X64L 1YNXA 2QF7A 3I56A 1Y8OB 3CQZH 1LT4D 4A3CH 3A55A 2HDMA 1EQTA 2D62A 1KDBA 5IP9G 2PZTA 4IUTA 2Z6KC 3L9AX 2Q2UA 4QCLA 1SYDA 1F2MA 1DCZA 2JA6G 2NZ1D 3CAMA 1LTLA 3DXJC 2LFNA 3F2CA 3UDXA 2R92H 2GVBA 1UUPA 1B4OA 4GN4B 4DV1Q 3ERSX 2ENBA 5CV5A 1PZJD 3VA7A 2V4DA 1HHVA 1ZXTA 3BDCA 2F03A 2F0HA 4HIDA 5IODA 3R2TA 1VQKA 1I3QB 1G291 2JA6B 1HZBA 5CYUA 4NDXA 4LFBL 3KBXA 2PW5A 4XQJA 4Q5VA 1PFNA 1X3GA 1JQYD 5LL6X 3HOXG 4A93H 4X64Q 5ELEA 1JWSD 2A74C 3GV3A 3MXUA 4GKJL 4LF8Q 2L11A 1YHAA 1VQ8A 3IFDA 1DOLA 2JA8G 4LW1A 3DLLA 1JB7A 1EQQA 1YJNA 2EYOA 1EYDA 3HRZC 4HMIA 3EA6A 3GTJH 3HS0C 4EVOA 1OXUA 1LACA 1LTTD 1HQRD 3QO2A 1GOZA 4N8FA 4MN3A 2VL6A 4OONA 1VQPA 4XXEA 2JA5G 4A3FG 1NCVA 1VQGA 2A5HA 2CKZB 3Q24A 4RA8A 4IQZA 1AZPA 1NJIC 2SNMA 3E9IA 1TVXA 4FF3A 4LFBQ 5FJ8G 2YV5A 3HFZB 1QILA 2QEJC 3I91A 2F0KA 1XMOQ 5G3LF 4KD3A 2MFIA 4K5XA 2F0UA 1STHA 4GKJQ 1LT5D 4GN3B 4BY7G 3M7NA 1A3UA 3CQZB 5G3LD 3PUXA 3KLWA 1A8VA 3LWEA 4A3KG 1NMGA 1B44D 3P20A 3BDLA 1JE4A 4UP9A 3MZ5A 4PV1C 3IKJA 4R1JA 4DR4L 1KLGD 3H0GG 3T53B 1W2BA 4K2KA 1G51A 4C2MH 1C8CA 2R3ZA 2R92B 1F2LA 5E4WC 4JK1C 5D3DA 4RHSA 3W2DA 4GKKL 4FVMA 3M4OH 5M5WH 3HOYG 2BH8A 2NZHA 5E4XA 3A74A 4QY7A 1EZ8A 1JICA 2UXDL 4DAYB 5J39A 4POFA 5COYA 4XT1B 5JEAH 3H0GB 4OWWB 4XIGS 2UXBL 1XTDA 2RCNA 1V1PA 1GJXA 1WI5A 1ENCA 3S1QH 5NUCA 3HOYB 4A3DH 4A93B 4C3IH 2G5DA 3CCEA 4IJLA 4HSVA 3CCQA 1OTCA 2XWJB 1EIYB 5FLMG 2A73B 4ZAIA 2R93H 1VDZA 3PUWA 4RKBA 3T51B 3ITPA 4HIKA 3KLRA 4DR4Q 2MQHA 2ZTCA 2RDGA 1EIHA 2N3SA 1DM0B 1MIUA 4PZ6A 5DM63 1TS5A 2XRQD 5IYBG 1UEBA 4JI6L 2ZM6Q 4GKKQ 2EYMA 3KUPA 2R6GA 3PCOB 1JJCB 4MHEA 5K36H 3A8JE 1CKOA 2UXDQ 1IYUA 1KTKA 4DXGA 4IOAA 2G9DA 3J80L 2K75A 1O7IA 2AHOB 1EY4A 2N88A 2Z0SA 3PV0A 1K8GA 1BBXC 2UXBQ 1CHPD 4KN7C 2K04A 2VB3X 3ERQA 3J81j 2B2WA 1RL2A 1XWEA 2JK8A 1U9RA 2I0QA 2EYHA 1QWYA 1Q3LA 1BDOA 2K14A 4L5SA 4HMJA 4TKOB 4AQYL 1XMQL 2JSOA 1W3SA 5HGQA 3T1YL 3WOEA 4A3EG 1V1OA 4DK6C 3KDFA 3M85A 4JI6Q 2IJ0A 1EY6A 2F0QA 3BZKA 2WFWA 3H3VC 1TT2A 2RDFA 2RKSA 2CHBD 3M4OB 5M5WB 5J1ZA 1XPRA 5M3FH 3PO2H 3VR3A 2Y0SE 3H3VI 3JAMi 1SYFA 3HOZG 1VQFA 2Q8RE 1MJCA 1XJVA 2I5MX 4LF5L 1I50H 2UXCL 2NTSA 1BXTA 3M4YA 3U9SA 3MAQA 4A3DB 4C3IB 1CQFA 3I8ZA 1A6XA 1CQVA 4AQYQ 3Q22A 1XMQQ 4POGA 3I70A 1VQBA 2K7VA 2KBNA 1UWVA 3PIO3 4DUYL 4TQUS 3T1YQ 2KCCA 3HOVG 1L1OA 2PYKA 4QQBX 4HN7A 5M3MH 3UDIA 2RSNA 1NBWA 4X3TA 3URYA 3R2IA 1NAPA 1M4VA 1PA6A 2IT1A 5A2QE 1O78A 2CCZA 5C0XH 3HOVB 4O42A 1EEID 1K9MC 4ZUJA 3NE5B 2B63H 1BQQT 1KRSA 3GTKH 4YCVA 4ULLA 4LF5Q 1X32A 1BO0A 1CK1A 2MO0A 3OW7A 1VQ7A 4DXFA 2FINB 1YBYA 1A3TA 1I4GA 2DNEA 2EYLA 2P5ZX 4DAVA 1ZYRC 3MXPA 1TS2A 1HQMC 3PO3G 4LMQD 2RHSB 4B3SQ 3BZCA 1LTAD 4DK3C 4DR2Q 1RODA 4JVZA 1I94L 3CCJA 2RBMA 4APVA 4BA2I 5EGTA 3AMUA 2E2IH 2RF4A 1L0XB 1SNCA 5M3FB 3ULJA 4FF2A 3DEOA 4CJ1B 4P71A 5BN5A 1G8ZD 2E2DC 4ILWA 5FOBB 4DAPA 2E5LL 4DV2L 4CKBA 4QUCA 2E76C 2KOLA 4EQNA 1B53A 1XXGA 2Z4IA 3D8GA 4C3HG 4OL7A 4IFDH 3UE1A 1IXRA 1V8QA 2Z6BA 3V05A 2XGTA 3H3VH 2NVXB 4BY1G 1TWFH 2ZXRA 2AWNA 4X3UA 5GQOA 1CTMA 2MNAA 2OQKA 1IL8A 3HG9A 3U50C 1Q1EA 2B2VA 2A69C 1I94Q 4C3HB 5GAGC 1YJ9A 4X6AH 4OX9Q 4JOIC 3VYUA 3S2HH 1Q82C 1HR0W 3BYYB 2ZJRA 1LTRD 3BG3A 4BBRH 3K8AA 4KKUA 4V190 3TREA 3M3YH 1S5CD 1K28A 1SE4A 1J8IA 1HA6A 4RMFA 4B9XA 5KRUA 3NBHA 5JJKA 2IY5B 2B63B 4CGYB 1ET9A 3GTKB 3TZDA 4DV2Q 1RKNA 2Q8TA 4X62L 3J7AV 1JB3A 3AFPA 1TQOA 5C4XH 1FJGL 5IP7H 1SE3A 3ULLA 5JJIA 1AE3A 4NP5A 1D8LA 1EOTA 2JA7G 2L12A 2JP1A 5IOCA 2L4NA 3T4AC 3VYTA 5DNFA 3KF6A 4DR3L 5IYCH 3RN5A 4NW2A 2CFMA 5C44H 3J7YW 1QNUA 4KK7A 1LYLA 2ZTDA 5EPJA 4KI0A 4EGVA 2D5DA 4A3LH 2R7ZH 1B3AA 4ZK9B 1DGSA 1CHQD 5E1FA 2B2TA 3W3AA 2K05A 3Q8DA 4DUZL 3S1NH 2NVYB 4A3GG 4X62Q 2LS01 2AQ1B 2K50A 1TY0A 1ZYRD 1FJGQ 3K7UC 2F0EA 3OIQA 3S14B 1ENAA 3HP3A 3NEMA 3KFUA 4JCVE 2BCOA 3Q0AA 4MNOA 1WD0A 5ELOA 4CKCA 2EIFA 1EFWA 4DR3Q 4A3GB 1O7ZA 4DA2A 2F0SA 3GV6A 5TSSA 1ASYA 3KF8B 3LNNA 2G9HD 1H95A 3S2HB 2DUDA 3D4WA 2WAQG 1KLUD 4OIKA 4BBRB 4B3MQ 1D1IA 5IIFA 3M3YB 4IPDA 5C4JH 4KJOA 1JWMD 5FO9B 3RZDH 5KIXA 4C1NK 4DUZQ 1SNDA 1M1KC 1TR5A 1XTCD 4LK1C 2NN6H 1V9PA 1MJEA 2I46A 5JVH3 4NKLA 3NQIA 5C4XB 2E2HB 5DAUA 3HOUB 2UUCL 2FHTA 2QDBA 5CR3A 5JPNC 2NWGA 1N32Q 4PNYA 1CKNB 1NTGA 4UAIA 1SYBA 4AIMA 4K5WA 2PZUA 3M9BA 2A69D 4FDBA 1H9SB 1FL0A 1HUNA 3E0JA 2ICIA 3MEFA 5IYDG 1VMCA 1EYCA 1I6HB 3K57A 2ID0A 3EN2A 2BA0A 2VQEL 2TMPA 2IX1A 4YY3L 1E3PA 1B8AA 1FYCA 2F3IA 3D0FA 4KTAA 1F2ZA 2R7ZB 2QW7A 2BDNA 4IUNA 2K5HA 3HOWG 1H9KA 3RD4A 4MTNA 2NVTH 1HR0L 4RAUC 4JI2L 4A3MH 3DWQA 2EXDA 4DK1A 1QZHA 1SFOH 4LF6L 4R4IA 2XNAC 2SOBA 2QEXA 2BA1A 3SK4A 4DR1Q 3HOWB 2VZAA 1NR4A 5HY6A 3J81c 1EY9A 1YHQA 1X54A 1LTID 4IPHA 2RCFA 3CCMA 4XT3B 4ZKCB 1IW7C 2K5NA 2V1CC 5I2YA 3NPPA 2VNUD 2Y0SG 1NY4A 2RSOA 4V0BA 2VQEQ 1EY5A 1EU4A 1RDPD 5IWAL 2F0IA 4JG2A 2RVLA 2EY5A 4RCOA 5IGDA 2C35B 1BUVT 4Y52H 4DV0L 4MIUA 5C4JB 3RZDB 4DFAA 1HR0Q 4XYOA 3MVVA 4JI2Q 2Q2HA 2BOSA 4K6DA 2JQOA 2N49A 4LF6Q 1S3OA 2B2WC 4A3JH 3FMCA 5GAHC 2LMCB 3QJYA 1E22A 3E6ZX 1JOOA 3I4OA 2R61A 3N6RA 3ULPA 2EJMA 1HZCA 2H5XA 2A68C 5JOBA 3I4LA 2EYFA 2BH2A 2PO4A 3CC2A 3P1HA 3U58A 1CSPA 2MO1A 5IWAQ 1D1KA 1I6VC 1D5ZC 2XRSD 5FK9C 3TP5A 4DV0Q 1HRJA 1AN8A 1LABA 1ML0D 3SGIA 4X66L 4LF8L 2K5QA 3E3XA 1A3VA 3HGBA 1Q81C 3K59A 3J7A5 2NVTB 4HR7B 4RWSC 1FR3A 1SJHD 4O2DA 4C3JH 3DMUA 1PH8A 4RKLA 1EIGA 2SNSA 4A3MB 3MA2B 3X3NA 2J0TD 3FKIH 1TWGB 2LXKA 1SFOB 2X6LA 2JA5H 4JI3Q 3MC0B 3NP8A 5CV7A 2EPBA 4DNTB 5I9PA 1BBWA 3VDYA 3RNUA 1SNPA 3G4SA 4WJWA 1TWCB 2IHEA 2AQ2B 1YNJC 2QA4A 1V43A 1QVGA 2VB2X 1ILQA 1GUWA 5CBAE 4DGZA 1NE3A 1K73C 1XMOL 3GDEA 4IUPA 2NYZD 2PNRC 5EJWA 5EAYA 1KL9A 4X66Q 2LY7A 4IOCA 2OEOA 4P74A 5IT9L 4DV5L 4LFAL 5KEEA 4A3JB 1X55A 3NSWA 1LT3D 3GP7A 1VQIA 3SE0A 1H9RA 4A3BH 1E7ZA 4FF1A 1SNOA 1BNZA 1CA6A 4YWKA 2BDOA 3BVMA 1RJTA 3LGJA 4HCSA 1IW7D 4H44C 4WFN3 4JI1L 1SBBB 3IFTA 4PZ8A 1L0WA 4DV6L 1AZQA 4A3CG 2EQSA 1PH2A 1L0YB 1OXSC 1MKHA 1K0RA 4UP7A 5EPKA 4R4CA 5EKIA 4P2CB 3MEHA 3ZJYC 5M5YH 3CCLA 4GLAC 1EWHA 1IBKL 2R92G 5FLMH 1A63A 3PGZA 2HUGA 2IPKD 3I72A 3D4DA 4DV5Q 2F3VA 2K01A 3LX0A 3PSIA 3Q6SA 4LFAQ 1ZEQX 3FKIB 3R8BA 1PH5A 3H94A 3K7AH 2ZM6L 5DLQE 4WJ3M 4A93G 4DU9A 2A68D 3B6YA 1SNQA 3K58A 4RG1A 5JAVA 4JBWA 4JI1Q 1TU2B 2B2YA 4DV6Q 3PF5A 2HQLA 3NENA 4DAMA 1XX8A 4OWTB 3EJIA 3FDTA 3PIPA 4XDXA 3J81i 2ZJQA 1IBKQ 4DAYA 1GUNA 3K5OA 1VQLA 3NHHA 2EE1A 2IX3A 2WP8J 5C0XI 1S5ED 3RZOH 1V1PB 3RMHA 1FVIA 2AWOA 2ALYB 3TDQA 5FO8B 4DK0A 3K5LA 1IYVA 2VXWA 1QB5D 1AW7A 5IGEA 3NUCA 3TQYA 1VQHA 2B2UC 3GTJB 1WCMH 3KBGA 1PFSA 1LV9A 4JBJA 3J80c 3A0JA 1SR3A 1Z6HA 3GTGH 4GN5A 5C4HA 4GOPA 1WFQA 3PUYA 1G6ZA 2F0GA 1YNND 3D31A 3W5OA 4PG3A 5C5MA 4K8IA 2KHJA 4FO2A 1YNJD 3DWPA 3JC66 4ALPA 2H4OA 3MWYW 1BCPC 5EPLA 4R4OA 1X6OA 4S3SA 3ER0A 3N52A 1PVOA 2YU9H 3DM1A 1JC7A 2PI2E 2O5IC 3MFGA 1LTSD 5C3WA 1QE6A 1O7YA 1G2TA 1VQEA 3C1FA 2WB1E 1C9OA 4L5TA 4JW0A 4PMBA 4K0KL 3WOFA 3S15H 1ASZA 1E24A 1K8MA 4UDUC 3F1ZA 2WINB 1JE5A 2B2TC 4ZRZA 4F88A 4DR6Q 1SNMA 4IURA 1B70B 1GUOA 1LO5D 2A6HC 4ZKBB 1PHJA 3NTKA 2QKIC 3H09A 2K52A 4C2MB 2NVQB 1IBLL 2JEBI 3F2BA 4LNQA 3I4NH 1K3BC 4IFDI 3T1HQ 1KNEA 4A3DG 4HJ8A 4C3IG 2Z9HA 1LT6D 5CV9A 3UI2A 2CW0C 5CGKA 3AYHB 2R93G 1VQ6A 2Z4HA 3A56A 2DY7A 4DNRB 4UY8C 3K5MA 1WTRA 4LUVA 3S2DH 1Y8PB 3EIVA 4Y7NH 3S1QB 2MJ8A 2DGYA 4A3IH 4DNIA 4K0KQ 1GUGA 3VR5A 3RZOB 3NWTA 3C3LA 1PDQA 1EUJA 5K36G 3NTHA 2R93B 2B29A 2K5WA 4JPBW 3ZYYX 3TBIB 3IAYA 1LUZA 4K5VA 1SE2A 1FNVA 2Z8LA 1JT8A 1NNXA 4B3SL 1IBLQ 2OXPA 1F9QA 2EDGA 4DR2L 4GNXC 3GTGB 1S5BD 2GVAA 1JR0D 4G7OC 2HIXA 5C0XJ 4B9WA 3CC7A 1FNUA 3J81E 2WV6D 2YTVA 4KHZA 5M5XH 1XYIA 5KNBA 1JJGA 1VQAA 4KHPL 2EJGC 2YU9B 1VCIA 3SVMA 1T9HA 3T56B 3S24A 3HKZE 3KJOA 1KHIA 1DXMA 1DOKA 3LWUA 5I2XA 5LHY1 4K14A 3G6EA 4KV6A 1WTXA 3RR5A 4RCNA 2EZVA 5JJLA 3DHQA 2OWOA 2B8FA 1U4RA 2PCFB 1PH3A 5M3FG 1I4QA 1GD7A 2OCEA 3PO2G 2ES2A 1C7YA 1ESRA 1BCPF 3NWSA 1J6QA 1F9RA 3OTOL 3I4NB 1PLFA 4OX9L 1BCPD 1CM9A 3PMFA 3KK7A 4L63B 3SXHA 4CDDC 1G6PA 3PO2B 4NXMQ 4KHPQ 3TRZA 1PH7A 1E1TA 2MUYA 3CC4A 1BF4A 3S2DB 2EY2A 5DM73 4JI5L 1I50B 1ESFA 4KKTA 4DN4M 1VQ9A 5M3MG 4A3IB 3IRBA 4IFDJ 1UNSA 3NXWA 2KHIA 1ONLA 1VQ5A 2E2JH 1HNZL 4PZ7A 2A6HD 4LF4L 1Q8KA 1PZID 1PZKD 5C0XG 4ZUIA 2E8GA 1U5KA 1XPUA 1EYAA 1S72A 4BA1I 4JC0A 4ZYSA 2NN6I 1K83H 4K8JA 5T1IA 1A0IA 1YI2A 2DN8A 4B08A 2B63G 3OPOA 5M3MB 1IKMA 1STAA 4HAEA 5CORA 1MI2A 3ND9A 5ELFA 2F4IA 3OTOQ 3BDOA 1YEZA 4K6LA 2H1EA 1BKBA 3KYHC 1KRTA 1VF7A 2AMCB 2CW0D 2CH4W 4B3TL 1E1OA 4BXXH 1EOVA 5M5XB 2YTYA 5C3EH 2JXMB 4JI5Q 4ZLTF 4G7ZC 2VUMH 1YITA 2ZJPA 1QUQB 4XQNA 1GO3E 4GLVB 1QJOA 3RUZA 5CMDA 1P16A 3QIAA 1HNZQ 2PQAB 1EQRA 2LSSA 4LF4Q 1FNWA 1JOKA 3V2TA 4X65Q 4JBKA 4CHTB 2ZXPA 1STBA 4G4KA 2UUAL 3U4VA 1IL2A 2F0OA 4EQOA 2UUBL 1W6JA 5HURA 4AYBB 5AJ3L 1WTWA 1PTOC 3KF6B 2NVQH 4B3TQ 4AH6A 3CU7A 2E2IB 1IYJB 1DOMA 4IFDG 1FGBD 4B3ML 1N9WA 4QMGA 4UPAA 2FXQA 1RHPA 3BJUA 3NBIA 2AKWB 1QNKA 1PFBA 4LF9L 2AQ3B 3GQBA 2L15A 4MTKA 2RQXA 2XTIA 1EWCA 3RLFA 2B39A 1R4PB 1Y1VH 1SSOA 1SROA 4KD4A 3S17H 2KEEA 2E2JB 4F87A 1RTOA 1E0BA 3C1EA 3FPUB 1P8LA 2EXZA 1WVLA 4BBRG 1N32L 1J9OA 1KAAA 2UUAQ 1TWFB 4CDFC 1Q46A 2UUBQ 1A62A 1CUKA 1PH9A 4L5RC 5AJ3Q 3F8TA 1II3A 1EEFD 1KNAA 2N78A 2F0LA 3T13A 5C4XG 2D0OA 1HUMA 5IP7G 3HOUG 5C5LA 2HD3A 1CI3M 1PXUA 4CJ0B 1NR2A 4LF9Q 3KF8A 4DKAC 4DV4L 4HSPA 3PUZA 2D0PA 2I5LX 4OEMB 2Q8IB 5I6YA 3UE0A 3HKSA 5ELBA 4KHVA 4ID6A 5IYCG 3NELA 1F77A 3K0YA 3RLNA 3S1RH 4GLXA 2KCNA 3A7LA 5C44G 1QCBD 2CVRA 1MGSA 1X65A 3R3OA 3C46A 4A3LG 4DR1L 2R7ZG 4GNXB 2L9HA 4F7XA 2JE6I 4C1NI 1FD7D 2O2LD 1STNA 5C44B 1CKNA 3J80E 2PMZE 1LLRD 1H9MA 1MHWC 3VR2A 4LFCQ 5DEHA 1H9SA 2QGQA
chains in the Genus database with same CATH topology
4PMWA 1WTOA 4H13C 2F0DA 5ELDA 2FJ2A 5M9OA 1DZ1A 1BOSA 4K2LA 4RGTA 3S1NB 1QG7A 5JVG3 1X3PA 1SJED 4OO1H 1Y1VB 3S17B 3MHBA 1HCZA 1WTVA 1PTOF 1R4QB 4IUQA 1GUTA 1MSHA 2WB1B 1PTOH 1X3QA 1O80A 3IL8A 2E74C 5LL6S 3QWNA 1PTOD 4DF7A 2NN6G 3MXGA 3EFXD 1Q1BA 1CA5A 5D65A 3S9WA 1F9PA 1ET6A 2FMCA 4FXDA 4M8AA 2EYPA 2WKDA 2PPBC 1CZWA 2NTTA 1Q8IA 1SEBD 2K28A 3DUZA 3K6OA 2WIIB 1IKLA 2X69A 1HA5A 1STEA 4TRDA 5EBDA 3OHXC 2F0JA 2L0CA 1SYGA 3TSSA 1SYEA 4FXKC 2F0WA 4H0LC 1EL0A 3WDNA 2BE5C 4Q0FA 3VR4A 4BBSB 3H91A 4WORA 2K1BA 1RD9D 2WACA 1B50A 1ENFA 5KYLA 3J7AF 3DEPA 1G2SA 4CJ2C 3HKZB 2KECA 4LJZC 2EYJA 4J8QA 1PTOB 1OXVA 3I4MB 5CV4A 2B8GA 4N9TA 1YNNC 3M7GA 4Z9CB 3SK5A 2M2LA 2FMMA 3BYTB 2HCIA 2SDFA 1DYQA 4L6TB 4QUFA 4QB4A 4N9PA 3JAML 2IL8A 4H7BA 4BWGB 1EY0A 1QOHA 4EQPA 3C2PA 1EFID 2F0PA 3TP6A 1HPCA 2HCCA 3QOLA 1SAPA 2N55A 4KY6A 1EU3A 5ISRA 1B2TA 3S1MB 2A6EC 1R9TB 4IUVA 3CRKC 2ZT9C 4R8NA 2F1MA 2PZWA 2KVMA 3D4RA 3F2UA 3NTIA 4FYDA 1E2VA 4RHRA 3FVQA 4RH6A 3R93A 3GTPB 3HOXB 2XWBB 1Q90A 4C3JG 2O5JC 2K5DA 3G7LA 1F2YA 1W6KA 2JA8B 1B1ZA 3DWAA 1C4QA 3I3CA 4C3JB 1WTQA 1GUSA 1DJRD 2QILA 2F3WA 1Y69U 3CRLC 2JA5B 4A3FB 4GZYC 1GHKA 2KQ3A 3OSOA 3BVGA 1HXYD 1E2ZA 1T5EA 5T1GA 3L3OC 3OWFA 3A8IE 1AFPA 5JEAJ 4RGMA 2B2VC 4XQQA 4FP5D 2L55A 2BE5D 4BY7B 3A7AB 2F0MA 5IGGA 2KUMA 4A3KB 1CFMA 1STGA 4XTCS 2MGSA 1HTLD 4WRDA 1AP0A 2DNCA 2WKCA 4PMCA 3OOCA 5D14A 5BN3A 4A3BB 3NQTA 5IGFA 2C5CA 3VR6A 1I4XA 1U4PA 2ICEC 1H9JA 2XIWA 3U9OA 2PW7A 3PUVA 5F2DA 5AFWA 2KHSA 5M5YB 3FRPB 1SXTA 1O7LA 1M8AA 2O4XA 3K5NA 3I90A 3SR1A 3BS1A 1EZ6A 2EY6A 2OT2A 1STYA 2A6ED 2I07B 5JEAG 1VMPA 1TY2A 2EY1A 3K7AB 1I4RA 3VYRA 5IGCA 1AEXA 4FXGC 3CHBD 1B9NA 4U68A 2RA4A 3FEWX 1U4LA 1U4MA 3GTLB 5D3IB 1UAPA 1BR9A 1A15A 3TMEA 1GHJA 5E3FA 5JJZA 5IGBA 1D5XC 2PMZB 4X3SA 4A3EB 4ODGA 1JOQA 4HEDA 1K8OA 2XN9C 3MFYA 1KDAA 3GO5A 1WCMB 1GXDC 4LAAA 1E2WA 5KNDA 5CV6A 5BN4A 3HOZB 1PFMA 5J22A 2IW3A 3TP8A 2MHVA 3QOJA 1RF2D 3VYSA 1OO9B 3EVQA 4YIJA 1MBYA 1TS3A 5FLXL 2F0TA 5ELCA 4C56C 3S15B 3QG1A 1D2BA 1Z7TA 2IX0A 3EROA 4IZ8A 3HZXA 4KKSA 2OF1A 3A54A 4R9WA 4RGNA 2GA4B 5FO7B 4CBVA 1Q12A 5HGTA 1ILPA 4NMZA 2HDLA 3BVZA 3KLSX 5C4ZA 4Y7NB 4BS9A 2KEDA 1KDCA 5EKLA 3GD7A 3P7JA 1RTNA 2L5TA 3A8KE 2NB0A 3PO3B 2KA7A 1NSNS 3SEBA 3EQLC 2HQEA 2E75C 4O1NA 1HFNA 1DD2A 3V96A 1IHZA 3OMGA 3T16A 1PRTC 4KY5A 4TSSA 4CKEA 4QIWB 1WD1A 1RCVD 1CT1D 3NK9A 3GTQB 5I9OA 1F9SA 5C6AA 2KJXA 4I7ZC 4IUUA 4RGOS 1HTPA 2RDHA 3JAME 5IT9E 4KY7A 1Z47A 1NUCA 1TIID 2JYOA 4BY1B 1TWAB 2XSCA 1CZGA 2M9VA 4KN4C 1VF5C 2B2UA 1JORA 4U673 4OO1I 1BCPB 3AU7A 2L1BA 1SMYC 1A2TA 4F8MA 5C3XA 2F0FA 2MP1A 2MPMA 5EKKA 4J1MA 4ABNA 3HEJA 3OWEB 5CC4A 2F0VA 1TKWB 3L7ZC 1G91A 1OXXK 1PYWD 2JA7B 1LTBD 1SDFA 5K5PA 3TN2A 2CQAA 1UEAB 2J7ZA 2D2CC 4FF4A 1EY8A 1K83B 1MD2D 2YYZA 4L8JA 1LTGD 3CKIB 2AUJD 2K32A 2DY8A 1T5XD 3BZDB 5C3EB 4G7HC 1JCKB 3OMCA 1I4PA 1S4ZA 2VUMB 3O13A 1TS4A 3VA5A 3GTOB 3TP7A 3OIPA 1PMRA 5KYIA 1KABA 1DONA 3PIP3 5EQ0A 1D5MC 1MSGA 4XYQA 1PRTF 5A35A 3H6MA 5JPMC 3SK8A 5EBCA 4I65A 3X3MA 4OHJA 2XVSA 1C48A 2WAQB 1PRTD 4FNFA 1S5FD 4IALA 5KNCA 1ZKOA 2FFKB 3S16B 4ZQ3A 3KLSA 2B2YC 1OXTA 4OIJA 3P75A 3GTMB 2X6GA 1B9MA 3SDZA 1Y8NB 2NUCA 1EQVA 2C9OA 3MTSA 3ONAB 5FKAC 1S5DD 4HCEA 3D6CA 2AUKA 1D6EC 2EVBA 2F0NA 4KJNA 2Z1CA 2D9UA 3SK6A 3MXNA 3ND8A 4HTHA 2EJFC 1I4HA 2K6AA 5KGUA 1SMYD 4ME5A 4QF4A 3I73A 3FPPA 5CBEE 2J4XA 4OGQC 2EOTA 5CV8A 4X3KA 1TWHB 5A2QL 2M00A 4G57A 1A2UA 4J6HA 5I4DA 3J81L 2PQEA 2SEBD 3S1RB 2IWHA 4M1UB 3TZUA 3SHLA 2ZXOA 1ICWA 1H9SA 2QCPX 4R8IA 1WTPA 1PRTB 2Y0SB 2TSSA 3AB9A 1JWUD 1EY7A 4RFBA 2LKVA 4OO1G 1HFGA 2K33A 1SYCA 3D3RA 3Q23A 2NBFA 5FLXE 2K03A 3G6JB 3E5SA 4IN3A 4E6IA 3D6WA 5I6WA 1Y1WB 4KMUC 2JEAI 3QB3A 2QF7A 1Y8OB 1LT4D 3A55A 2HDMA 1EQTA 2D62A 1KDBA 2PZTA 4IUTA 3L9AX 4QCLA 1SYDA 1F2MA 1DCZA 2NZ1D 3DXJC 2LFNA 1UUPA 1B4OA 5CV5A 2ENBA 1PZJD 3VA7A 2V4DA 1HHVA 1ZXTA 3BDCA 2F03A 2F0HA 5IODA 3R2TA 1I3QB 1G291 2JA6B 5CYUA 4NDXA 3KBXA 2PW5A 4XQJA 4Q5VA 1PFNA 5LL6X 1JQYD 5ELEA 1JWSD 2A74C 3GV3A 3MXUA 2L11A 3IFDA 1DOLA 2EYOA 1EYDA 3HRZC 4HMIA 3EA6A 3HS0C 4EVOA 1LTTD 1HQRD 1LACA 1OXUA 3QO2A 1GOZA 4MN3A 4XXEA 1NCVA 2A5HA 3Q24A 4RA8A 4IQZA 1AZPA 2SNMA 1TVXA 4FF3A 1QILA 2QEJC 3I91A 2F0KA 5G3LF 4KD3A 4K5XA 2F0UA 1STHA 1LT5D 3M7NA 1A3UA 3CQZB 5G3LD 3PUXA 3LWEA 1B44D 3P20A 3BDLA 1JE4A 3MZ5A 4PV1C 3IKJA 1KLGD 3T53B 4K2KA 1C8CA 2R3ZA 2R92B 1F2LA 5E4WC 4JK1C 5D3DA 4RHSA 3W2DA 4FVMA 5E4XA 1EZ8A 1JICA 5J39A 5COYA 4XT1B 5JEAH 3H0GB 4XIGS 1V1PA 1GJXA 1ENCA 5NUCA 3HOYB 4A93B 4HSVA 2XWJB 2A73B 4ZAIA 1VDZA 3PUWA 4RKBA 3T51B 3ITPA 3KLRA 2RDGA 1EIHA 1DM0B 5DM63 1TS5A 2XRQD 2EYMA 3KUPA 2R6GA 4MHEA 5K36H 3A8JE 1IYUA 1KTKA 4DXGA 2G9DA 3J80L 1BBXC 1EY4A 2N88A 3PV0A 1CHPD 4KN7C 2K04A 2VB3X 3ERQA 2B2WA 1XWEA 1U9RA 2EYHA 1QWYA 1Q3LA 1BDOA 4HMJA 4TKOB 2JSOA 3WOEA 1V1OA 3M85A 2IJ0A 1EY6A 2F0QA 3H3VC 1TT2A 2RDFA 2RKSA 2CHBD 3M4OB 5M5WB 5J1ZA 3VR3A 1SYFA 2Q8RE 2NTSA 1BXTA 3M4YA 3U9SA 3MAQA 4A3DB 4C3IB 1CQFA 3I8ZA 1A6XA 1CQVA 3Q22A 3I70A 2K7VA 3PIO3 4TQUS 2KCCA 2PYKA 4HN7A 2RSNA 4X3TA 3URYA 3R2IA 1NAPA 1M4VA 2IT1A 5A2QE 1O78A 5C0XH 3HOVB 4O42A 1EEID 4ZUJA 3NE5B 1BQQT 4ULLA 1X32A 1BO0A 1CK1A 3OW7A 4DXFA 2FINB 2DNEA 1A3TA 1I4GA 2EYLA 4DAVA 1ZYRC 3MXPA 1TS2A 1HQMC 4LMQD 1LTAD 1RODA 2RBMA 4BA2I 5EGTA 3AMUA 1L0XB 1SNCA 5M3FB 4FF2A 3DEOA 4CJ1B 5BN5A 1G8ZD 2E2DC 4ILWA 5FOBB 4DAPA 4CKBA 4QUCA 2E76C 2KOLA 4EQNA 1B53A 1XXGA 2Z4IA 3D8GA 4C3HG 4OL7A 4IFDH 1V8QA 3V05A 2NVXB 2ZXRA 2AWNA 4X3UA 1CTMA 1IL8A 3HG9A 1Q1EA 2B2VA 2A69C 4C3HB 3VYUA 3BYYB 1LTRD 3BG3A 4KKUA 4V190 1S5CD 1SE4A 1J8IA 1HA6A 4B9XA 5KRUA 3NBHA 2B63B 4CGYB 1ET9A 3GTKB 3TZDA 1RKNA 2Q8TA 3J7AV 1JB3A 1TQOA 1SE3A 4NP5A 1EOTA 2L12A 2JP1A 5IOCA 2L4NA 3T4AC 3VYTA 5DNFA 4NW2A 3J7YW 1QNUA 4KK7A 5EPJA 4KI0A 4EGVA 2D5DA 1B3AA 4ZK9B 1CHQD 5E1FA 2B2TA 3W3AA 2K05A 2NVYB 2LS01 2AQ1B 1TY0A 1ZYRD 2F0EA 3OIQA 3S14B 1ENAA 3HP3A 2BCOA 3Q0AA 1WD0A 4CKCA 4A3GB 1O7ZA 4DA2A 2F0SA 3GV6A 5TSSA 3LNNA 2G9HD 3S2HB 3D4WA 1KLUD 4OIKA 4BBRB 1D1IA 5IIFA 3M3YB 4KJOA 1JWMD 5FO9B 5KIXA 4C1NK 1SNDA 1TR5A 1XTCD 4LK1C 2NN6H 2I46A 5JVH3 4NKLA 3NQIA 5C4XB 2E2HB 5DAUA 3HOUB 2FHTA 2QDBA 5CR3A 5JPNC 2NWGA 4PNYA 4UAIA 1SYBA 4K5WA 2PZUA 2A69D 1H9SB 1HUNA 3E0JA 2ICIA 1VMCA 1EYCA 1I6HB 3K57A 2ID0A 2BA0A 2TMPA 2IX1A 1FYCA 2R7ZB 4KTAA 1F2ZA 2BDNA 4IUNA 1H9KA 3RD4A 4RAUC 3DWQA 4DK1A 2XNAC 2SOBA 2BA1A 3SK4A 3HOWB 1NR4A 1EY9A 1LTID 4XT3B 4ZKCB 1IW7C 5I2YA 3NPPA 2VNUD 2RSOA 4V0BA 1EY5A 1EU4A 1RDPD 2F0IA 2RVLA 2EY5A 4RCOA 5IGDA 1BUVT 4MIUA 5C4JB 3RZDB 4DFAA 4XYOA 3MVVA 2BOSA 4K6DA 2B2WC 3FMCA 2LMCB 3QJYA 3E6ZX 1JOOA 2R61A 3N6RA 2EJMA 2A68C 5JOBA 3I4LA 2EYFA 2PO4A 3P1HA 1D1KA 1I6VC 1D5ZC 2XRSD 5FK9C 3TP5A 1HRJA 1AN8A 1LABA 1ML0D 2K5QA 1A3VA 3HGBA 3K59A 2NVTB 4HR7B 4RWSC 1FR3A 1SJHD 3DMUA 4RKLA 1EIGA 2SNSA 4A3MB 3MA2B 3X3NA 2J0TD 1TWGB 1SFOB 2X6LA 3MC0B 3NP8A 5CV7A 2EPBA 4DNTB 5I9PA 1SNPA 4WJWA 1TWCB 2AQ2B 1YNJC 1V43A 2VB2X 1ILQA 1GUWA 5CBAE 4DGZA 4IUPA 2NYZD 2PNRC 5EJWA 2LY7A 2OEOA 5IT9L 5KEEA 4A3JB 3NSWA 1LT3D 3GP7A 3SE0A 1H9RA 4FF1A 1SNOA 1BNZA 1CA6A 2BDOA 3BVMA 1RJTA 4HCSA 1IW7D 4H44C 4WFN3 1SBBB 3IFTA 1AZQA 1L0YB 1OXSC 5EPKA 5EKIA 4P2CB 3MEHA 1EWHA 2HUGA 2IPKD 3I72A 3D4DA 2F3VA 2K01A 3LX0A 3Q6SA 1ZEQX 3FKIB 3R8BA 3H94A 4DU9A 2A68D 1SNQA 3K58A 5JAVA 4JBWA 1TU2B 2B2YA 1XX8A 3EJIA 3FDTA 4XDXA 4DAYA 1GUNA 3K5OA 3NHHA 2EE1A 2IX3A 2WP8J 5C0XI 1S5ED 1V1PB 3RMHA 5FO8B 2AWOA 3TDQA 4DK0A 3K5LA 1IYVA 2VXWA 1QB5D 1AW7A 5IGEA 3NUCA 2B2UC 3GTJB 3KBGA 1LV9A 1Z6HA 5C4HA 3PUYA 1G6ZA 2F0GA 1YNND 3D31A 5C5MA 4K8IA 1YNJD 3DWPA 4FO2A 2H4OA 3MWYW 1BCPC 5EPLA 4S3SA 3N52A 3DM1A 1JC7A 2O5IC 3MFGA 1LTSD 5C3WA 1QE6A 1O7YA 1G2TA 3C1FA 4PMBA 3WOFA 1K8MA 4UDUC 2WINB 2B2TC 4F88A 4ZRZA 1SNMA 4IURA 1GUOA 1LO5D 4ZKBB 2A6HC 3NTKA 2QKIC 3H09A 4C2MB 2NVQB 2JEBI 4IFDI 1KNEA 4C3IG 1LT6D 5CV9A 3UI2A 2CW0C 5CGKA 2Z4HA 3A56A 2DY7A 4DNRB 3K5MA 1WTRA 1Y8PB 3S1QB 2MJ8A 1GUGA 3VR5A 3RZOB 3NWTA 3C3LA 1PDQA 5K36G 3NTHA 2R93B 2K5WA 3ZYYX 3TBIB 3IAYA 4K5VA 1SE2A 1FNVA 2Z8LA 2OXPA 1F9QA 2EDGA 3GTGB 1S5BD 1JR0D 4G7OC 5C0XJ 4B9WA 1FNUA 3J81E 2WV6D 4KHZA 1XYIA 5KNBA 2EJGC 2YU9B 1VCIA 3SVMA 3T56B 1DXMA 1DOKA 3LWUA 5I2XA 5LHY1 4K14A 4KV6A 1WTXA 4RCNA 2EZVA 3DHQA 2B8FA 1U4RA 2PCFB 1I4QA 1ESRA 1BCPF 3NWSA 1F9RA 3I4NB 1PLFA 1BCPD 1CM9A 3PMFA 3KK7A 4L63B 3SXHA 3PO2B 2MUYA 1BF4A 3S2DB 2EY2A 5DM73 1I50B 1ESFA 4KKTA 4DN4M 4A3IB 4IFDJ 1UNSA 3NXWA 1ONLA 2A6HD 1PZID 1PZKD 5C0XG 4ZUIA 1EYAA 4BA1I 4ZYSA 2NN6I 4K8JA 5T1IA 2DN8A 4B08A 3OPOA 5M3MB 1IKMA 1STAA 4HAEA 5CORA 1MI2A 3ND9A 5ELFA 2F4IA 3BDOA 4K6LA 2H1EA 1VF7A 2CW0D 5M5XB 2JXMB 4ZLTF 4G7ZC 4XQNA 1QJOA 3RUZA 5CMDA 3QIAA 1FNWA 1JOKA 3V2TA 4CHTB 2ZXPA 1STBA 4G4KA 2F0OA 4EQOA 1W6JA 5HURA 4AYBB 1WTWA 1PTOC 3CU7A 2E2IB 1DOMA 4IFDG 1FGBD 4QMGA 1RHPA 3NBIA 1QNKA 1PFBA 2AQ3B 3GQBA 2RQXA 1EWCA 3RLFA 2B39A 1R4PB 1SSOA 4KD4A 2KEEA 2E2JB 4F87A 1RTOA 1E0BA 3C1EA 3FPUB 2EXZA 1WVLA 1J9OA 1KAAA 1TWFB 1II3A 1EEFD 1KNAA 2F0LA 3T13A 1HUMA 5C5LA 1CI3M 1PXUA 4CJ0B 1NR2A 3KF8A 4HSPA 3PUZA 2Q8IB 5I6YA 5ELBA 4KHVA 4ID6A 1F77A 3K0YA 2KCNA 3A7LA 1QCBD 2CVRA 1MGSA 3R3OA 3C46A 2L9HA 4F7XA 2JE6I 4C1NI 1FD7D 2O2LD 1STNA 5C44B 3J80E 1LLRD 1H9MA 3VR2A 5DEHA 4PQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HED A;  3SVM A;  2B2V C;  1WTO A;  4XT3 B;  1TVX A;  1G2S A;  4CJ2 C;  1WD1 A;  1DOK A;  2KEC A;  1G6Z A;  2FJ2 A;  4ZKC B;  1F9S A;  1DON A;  1WTX A;  1DZ1 A;  3HP3 A;  3I91 A;  5EQ0 A;  1MSG A;  1HFG A;  2RSO A;  4IUU A;  1WTW A;  3MWY W;  2KUM A;  5EPL A;  1WD0 A;  1QG7 A;  3DEO A;  4CJ1 B;  1U4R A;  2RVL A;  3N52 A;  1X3P A;  2MGS A;  3DM1 A;  1DOM A;  1O7Z A;  1AP0 A;  2K03 A;  4QUC A;  2KOL A;  1PFM A;  1RHP A;  3GV6 A;  1ESR A;  1BNZ A;  3LWE A;  1B53 A;  1QE6 A;  1WTV A;  1QNK A;  1O7Y A;  1CA6 A;  1PFB A;  2M2L A;  2JYO A;  4IUQ A;  1G2T A;  1MSH A;  1RJT A;  2FFK B;  1JE4 A;  2FMM A;  3D6W A;  4HCS A;  2HCI A;  1F9R A;  1X3Q A;  5D14 A;  2SDF A;  1O80 A;  3IL8 A;  2B2W C;  4QUF A;  2Q8R E;  1PLF A;  4OIK A;  1AZQ A;  1C8C A;  2R3Z A;  1CM9 A;  1F2L A;  2B2U A;  1SSO A;  2B2Y C;  2B2T C;  5E4W C;  4OIJ A;  2IL8 A;  4X3U A;  4IUR A;  2KEE A;  1U4P A;  2X6G A;  4ZKB B;  1IL8 A;  2HDM A;  5EPK A;  5E4X A;  1EQT A;  1E0B A;  1RTO A;  2HCC A;  2L1B A;  3FPU B;  5EKI A;  1SAP A;  2B2V A;  2N55 A;  1JIC A;  3I8Z A;  2XIW A;  3MTS A;  4IUT A;  1WVL A;  3ONA B;  2HUG A;  1CA5 A;  1B2T A;  1J9O A;  5COY A;  1BF4 A;  4XT1 B;  2MP1 A;  2NZ1 D;  4IUV A;  1KNE A;  5D65 A;  5AFW A;  4DN4 M;  2MPM A;  1F9P A;  2K01 A;  1B4O A;  4R9W A;  2KVM A;  3F2U A;  2D9U A;  3UI2 A;  3Q6S A;  2FHT A;  1J8I A;  1HA6 A;  1HHV A;  1ZXT A;  2NWG A;  2RSN A;  1M8A A;  1KNA A;  4HSV A;  4UAI A;  3TZD A;  4X3T A;  3R93 A;  1G91 A;  3I90 A;  1HUM A;  1NAP A;  2DY7 A;  2K28 A;  1HRJ A;  1ML0 D;  1WTR A;  2Q8T A;  4CJ0 B;  1HUN A;  1NR2 A;  4ZAI A;  1IKL A;  5T1I A;  2MJ8 A;  2X69 A;  1ILP A;  1VMC A;  1IKM A;  5COR A;  3G7L A;  4HAE A;  4RWS C;  1MI2 A;  3KBX A;  4O42 A;  5CBE E;  1VMP A;  1PFN A;  1SDF A;  2HDL A;  3TN2 A;  1EIG A;  1EIH A;  1EOT A;  2B2Y A;  2H1E A;  1PDQ A;  2EOT A;  4X3K A;  2L12 A;  2J7Z A;  1XX8 A;  2JP1 A;  2KED A;  3GV3 A;  3I3C A;  2X6L A;  2L11 A;  2L4N A;  1X32 A;  3FDT A;  1BO0 A;  4XDX A;  3IFD A;  2BDN A;  2RA4 A;  3KUP A;  1DOL A;  4U68 A;  5DNF A;  3P7J A;  1RTN A;  2FIN B;  4MHE A;  1WTQ A;  2CVR A;  2EPB A;  4NW2 A;  1MGS A;  1U4L A;  1F9Q A;  1U4M A;  2EE1 A;  4RAU C;  1EL0 A;  4ZLT F;  2L9H A;  5EPJ A;  3QO2 A;  1BBX C;  2N88 A;  4MN3 A;  1A15 A;  1B3A A;  2DY8 A;  2VXW A;  5CMD A;  1HFN A;  2K04 A;  4LMQ D;  1ILQ A;  2B2W A;  3H91 A;  1ICW A;  5T1G A;  4ZK9 B;  2K1B A;  5CBA E;  1GUW A;  1NCV A;  2B2U C;  5JJZ A;  1S4Z A;  2B2T A;  4IUP A;  1NR4 A;  4R8I A;  2NYZ D;  4RA8 A;  1LV9 A;  1XYI A;  4X3S A;  1ROD A;  2K05 A;  5EJW A;  1WTP A;  1AZP A;  1B50 A;  3DEP A;  1Q3L A; 
#chains in the Genus database with same CATH topology
 4PMW A;  1J5E Q;  1WTO A;  4H13 C;  2F0D A;  5ELD A;  4DV4 Q;  2FJ2 A;  5M9O A;  3A5Z B;  4BBS H;  1DZ1 A;  1BOS A;  4K2L A;  2WB1 G;  4RGT A;  3PIO A;  3S1N B;  1QG7 A;  3MXN B;  5JVG 3;  1X3P A;  1Y1W H;  1SJE D;  4OO1 H;  1Y1V B;  4L5Q A;  3S17 B;  3MHB A;  1HCZ A;  3PF4 A;  1WTV A;  1PTO F;  1R4Q B;  1WOC A;  4IUQ A;  1KAW A;  1GUT A;  1MSH A;  4R4Q A;  2WB1 B;  1PTO H;  1X3Q A;  3I4M H;  1O80 A;  3IL8 A;  2E74 C;  5LL6 S;  3QWN A;  1PTO D;  1VQD A;  4DF7 A;  1PH6 A;  5H1S E;  2NN6 G;  1KQS A;  3MXG A;  4GOP C;  3EFX D;  1Q1B A;  1CA5 A;  5D65 A;  5IP9 H;  4CDE C;  3S9W A;  1F9P A;  1ET6 A;  4WJ4 A;  2FMC A;  4FXD A;  2JA6 H;  4M8A A;  2EYP A;  2WKD A;  4LUO A;  1VQC A;  2PPB C;  1CZW A;  2NTT A;  4MZ9 A;  1Q8I A;  1SEB D;  2K28 A;  3DUZ A;  3S1M H;  3K6O A;  4JI3 L;  1R9T H;  2WII B;  1IKL A;  2CH4 A;  2X69 A;  1HA5 A;  1STE A;  3L0O A;  4TRD A;  1X3E A;  4HJ7 A;  5EBD A;  3OHX C;  4JI8 Q;  4HIM A;  2F0J A;  2L0C A;  3GTP H;  3HOX H;  1SYG A;  3TSS A;  1SYE A;  4P73 A;  4A3M G;  3KJP A;  2VS1 A;  3J7Z C;  4FXK C;  2F0W A;  4H0L C;  1EL0 A;  2JA8 H;  3WDN A;  2BE5 C;  4Q0F A;  1HZ9 A;  3HKZ G;  1K0S A;  1VQJ A;  1U0L A;  3VR4 A;  4BBS B;  3H91 A;  4WOR A;  2K1B A;  1RD9 D;  2WAC A;  1HNW L;  3BU2 A;  1B50 A;  1ENF A;  5KYL A;  3J7A F;  2KEN A;  3DEP A;  4A3F H;  4QIW E;  1KXL A;  1G2S A;  4CJ2 C;  4B3R L;  3HKZ B;  2KEC A;  4IPC A;  4LJZ C;  2EYJ A;  1PV4 A;  4J8Q A;  1L1O C;  1PTO B;  1OXV A;  5GAD C;  5FJ8 H;  5CV4 A;  3I4M B;  2B8G A;  4N9T A;  1X9N A;  1YNN C;  3W1G A;  4DR7 Q;  2RHQ B;  3M7G A;  1RIP A;  4Z9C B;  2JN4 A;  3STB C;  3JAM c;  2KCT A;  5IT9 c;  2JA9 A;  3SK5 A;  4A3J G;  4BY7 H;  2M2L A;  2CWA A;  2FMM A;  3BYT B;  4HJ5 A;  2HCI A;  2SDF A;  2A8V A;  4A3K H;  1DYQ A;  1KIX A;  4L6T B;  1X3F A;  3AQQ A;  4QUF A;  4QB4 A;  4N9P A;  3JAM L;  1HNW Q;  4AYB E;  2IL8 A;  4H7B A;  3FP9 A;  4BWG B;  3H0G H;  1EY0 A;  1QOH A;  4EQP A;  4DV3 L;  3C2P A;  1EFI D;  2F0P A;  1IBM L;  2HCC A;  1HPC A;  3QOL A;  3TP6 A;  1SAP A;  2N55 A;  4KY6 A;  3M4P A;  1EU3 A;  5ISR A;  3HOY H;  1B2T A;  4B3R Q;  3S1M B;  2A6E C;  4A75 A;  1HNX L;  1R9T B;  4IUV A;  4LUZ A;  2OTJ A;  3CRK C;  2ZT9 C;  2OQ0 A;  4OXP A;  4R8N A;  2F1M A;  2PZW A;  2R7D A;  2KVM A;  3D4R A;  3F2U A;  3NTI A;  2HHH L;  4FYD A;  1E2V A;  4RHR A;  1EYG A;  3FVQ A;  4RH6 A;  3R93 A;  3GTP B;  3HOX B;  2XWB B;  1Q90 A;  4C3J G;  2O5J C;  1PH4 A;  2VQF L;  2K5D A;  3FKI G;  4EQ5 A;  3G7L A;  5LMN W;  1F2Y A;  1JJ2 A;  4UP8 A;  1W6K A;  2JA8 B;  1B1Z A;  3DWA A;  3K81 C;  4LWC A;  1C4Q A;  3I3C A;  1QVC A;  4DV3 Q;  4QJF A;  1S40 A;  4C3J B;  1IBM Q;  5IYB H;  1WTQ A;  1GUS A;  4QGU A;  1DJR D;  2QIL A;  2F3W A;  1JMC A;  3TEH B;  1Y69 U;  1HNX Q;  3CRL C;  2JA5 B;  4A3F B;  4GZY C;  1GHK A;  2KQ3 A;  3OSO A;  3BVG A;  1HXY D;  2K4K A;  2HHH Q;  1E2Z A;  1T5E A;  5T1G A;  3L3O C;  1N36 L;  3OWF A;  4IJH A;  3A8I E;  1AFP A;  5JEA J;  1UE6 A;  4RGM A;  3CF5 A;  2OTL A;  2DJG C;  3GTL H;  2B2V C;  2VQF Q;  4XQQ A;  2PNH A;  4YWM A;  4FP5 D;  2L55 A;  2ATW A;  2GN5 A;  2BE5 D;  3WWV A;  1PH1 A;  4BY7 B;  1N33 L;  5GAE C;  3A7A B;  2F0M A;  5IGG A;  2KUM A;  4A3B G;  4A3K B;  1CFM A;  1STG A;  4XTC S;  4A3E H;  2MGS A;  1HTL D;  4WRD A;  2WAQ E;  1AP0 A;  2Q2T A;  4P72 A;  2DNC A;  4DR6 L;  2WKC A;  4PMC A;  3OOC A;  5D14 A;  4NB3 A;  4NXN L;  5BN3 A;  4A3B B;  4JI0 L;  4YCW A;  3NQT A;  5IGF A;  2C5C A;  3T1H L;  1N36 Q;  3VR6 A;  3FHW A;  3HOZ H;  1I4X A;  1U4P A;  1PYS B;  2ICE C;  1QVF A;  1H9J A;  4GOP B;  3STB D;  2XIW A;  3U9O A;  1I5F A;  1KD1 C;  2IHF A;  5ELN A;  2F52 A;  2PW7 A;  3PUV A;  5F2D A;  5AFW A;  2KHS A;  1N33 Q;  2DJF C;  4A76 A;  5M5Y B;  3FRP B;  1SXT A;  2KCM A;  1O7L A;  3HOV H;  3CCR A;  1M8A A;  2O4X A;  3K5N A;  3AFQ A;  3I90 A;  3SR1 A;  3BS1 A;  1EZ6 A;  2EY6 A;  2OT2 A;  1STY A;  3QR8 A;  2A6E D;  2I07 B;  5JEA G;  4N8X 1;  3OW2 A;  1VMP A;  1TY2 A;  4NXN Q;  1AH9 A;  4JV5 L;  4JI0 Q;  2EY1 A;  3K7A B;  1I4R A;  3VYR A;  1YVC A;  3KDF B;  5IGC A;  5GRO A;  1AEX A;  4FXG C;  3CHB D;  1KC8 C;  1B9N A;  4U68 A;  2RA4 A;  3U4Z A;  1IZ6 A;  2ASB A;  3FEW X;  1U4L A;  1U4M A;  1UE1 A;  3TS2 A;  3GTL B;  4HJA A;  1CSQ A;  5D3I B;  1UAP A;  1BR9 A;  2F4V L;  1A15 A;  1WCM G;  1Q7Y C;  3TME A;  1GHJ A;  5E3F A;  5LMU L;  5JJZ A;  3H15 A;  5IGB A;  4NPS A;  3PO3 H;  4JBM A;  1D5X C;  2PMZ B;  4X3S A;  4HJ9 A;  4A3E B;  4DV7 L;  4ODG A;  1JOQ A;  4HED A;  1K8O A;  2XN9 C;  3MFY A;  1KDA A;  5LMN L;  3GO5 A;  2Z6K A;  4A4I A;  1VQN A;  1WCM B;  4JV5 Q;  4OWX B;  1L1O B;  4DR5 L;  1TXY A;  5E7N A;  1GXD C;  4LAA A;  1N8R C;  3KOJ A;  1E2W A;  5KND A;  5CV6 A;  5BN4 A;  3HOZ B;  1PFM A;  2B3G A;  1D7Q A;  3GTQ H;  2NVX H;  2R7F A;  5FLX c;  5J22 A;  2IW3 A;  3TP8 A;  4NXM L;  2MHV A;  3UDF A;  3L2P A;  3QOJ A;  1RF2 D;  3VYS A;  3W1B A;  2F4V Q;  4C3H H;  1OO9 B;  3EVQ A;  3K0X A;  4YIJ A;  1MBY A;  5LMU Q;  1TS3 A;  5FLX L;  3CCS A;  3I4N G;  4DV7 Q;  2F0T A;  5ELC A;  4C56 C;  4BY1 H;  3S15 B;  2ZTE A;  3QG1 A;  1TWA H;  1QZG A;  1D2B A;  1Z7T A;  2IX0 A;  5LMN Q;  3ERO A;  3G48 A;  3HZX A;  4IZ8 A;  1M90 C;  4KKS A;  5L37 A;  1YHB A;  2OF1 A;  3A54 A;  4DR5 Q;  2UXC Q;  3A5U A;  4R9W A;  4RGN A;  1B3Q A;  2GA4 B;  1SMX A;  5FO7 B;  4LF7 L;  4CBV A;  4DUY Q;  1Q12 A;  3CMA A;  4A3I G;  1BBU A;  4IO9 A;  5HGT A;  1ILP A;  1SN8 A;  4NMZ A;  2HDL A;  3BVZ A;  3KLS X;  4O0A A;  5C4Z A;  4Y7N B;  4BS9 A;  4H02 A;  1VQ4 A;  2KED A;  1KDC A;  5EKL A;  3GD7 A;  2JA7 H;  3P7J A;  1RTN A;  1GM5 A;  2L5T A;  3A8K E;  4YHH L;  2NB0 A;  3PO3 B;  2KA7 A;  1NSN S;  3SEB A;  1L2F A;  5J3B A;  3EQL C;  2HQE A;  4X65 L;  2E75 C;  2NVY H;  4O1N A;  1WJJ A;  1HFN A;  1DD2 A;  1ICF B;  3DM3 A;  4R4T A;  3V96 A;  4LF7 Q;  1IHZ A;  1YIJ A;  3S14 H;  4P75 A;  3OMG A;  2UU9 L;  3T16 A;  1PRT C;  4KY5 A;  2CWP A;  4TSS A;  4CKE A;  4QIW B;  1WD1 A;  1GVP A;  1RCV D;  3J80 i;  1CT1 D;  3NK9 A;  4J15 A;  5I9O A;  3GTQ B;  1F9S A;  5C6A A;  4A3G H;  2KJX A;  4YCU A;  4JI7 L;  4I7Z C;  2VW9 A;  4IUU A;  4DPG A;  1FGU A;  4RGO S;  2VY3 A;  3GTO H;  1HTP A;  3CW2 C;  3E0E A;  2RDH A;  2LXJ A;  3NBH B;  3JAM E;  4HIO A;  5IT9 E;  4YHH Q;  3TS0 A;  4KY7 A;  3CD6 A;  4YWL A;  4AYB G;  1Z47 A;  1NUC A;  1TII D;  2JYO A;  4BY1 B;  1TWA B;  1QUQ A;  2XSC A;  2E5L Q;  1CZG A;  2M9V A;  4KN4 C;  1VF5 C;  3CP0 A;  2B2U A;  2PQA A;  3I7F A;  1JOR A;  1X56 A;  1N34 L;  4U67 3;  4OO1 I;  1BCP B;  3AU7 A;  2L1B A;  2E2H H;  2UU9 Q;  1SMY C;  3HOU H;  1YZ6 A;  1A2T A;  4F8M A;  3S16 H;  5C3X A;  2F0F A;  2MP1 A;  4JI7 Q;  4IPG A;  2MPM A;  5EKK A;  1K3R A;  4J1M A;  4ABN A;  2A1A A;  3GTM H;  1WTH A;  3HEJ A;  3OWE B;  2CQO A;  5CC4 A;  1I6H H;  2F0V A;  1TKW B;  3L7Z C;  2NZO A;  1G91 A;  1OXX K;  2N8N A;  1PYW D;  2JA7 B;  3F2D A;  5IY0 A;  1LTB D;  1SDF A;  1PYB A;  5K5P A;  3TN2 A;  1NMF A;  5IYD H;  2CQA A;  1UEA B;  2J7Z A;  2D2C C;  4FF4 A;  4BXX G;  1EY8 A;  1K83 B;  3CCV A;  1N34 Q;  5C3E G;  1MD2 D;  2YYZ A;  1WYD A;  4GS3 A;  2VUM G;  4L8J A;  2HIV A;  1LTG D;  1Q86 C;  4JI4 L;  3CKI B;  2AUJ D;  2K32 A;  2YTX A;  5BR8 L;  3HOW H;  4LFC L;  1J5E L;  2DY8 A;  1T5X D;  3BZD B;  5C3E B;  4G7H C;  1JCK B;  1TWH H;  3OMC A;  1I4P A;  1S4Z A;  2VUM B;  3G71 A;  3O13 A;  1TS4 A;  3VA5 A;  3M4Q A;  3GTO B;  3TP7 A;  1EWI A;  3OIP A;  1PMR A;  5KYI A;  4QL5 A;  2I5H A;  1VS0 A;  1KAB A;  3E9H A;  1DON A;  3PIP 3;  5EQ0 A;  1K8A C;  1D5M C;  1MSG A;  4XYQ A;  1PRT F;  5A35 A;  3H6M A;  5JPM C;  4KLK A;  3SK8 A;  5EBC A;  4I65 A;  3X3M A;  3K80 C;  4OHJ A;  2XVS A;  1C48 A;  2WAQ B;  1PRT D;  4JI4 Q;  4FNF A;  1S5F D;  4IAL A;  4GNX A;  1SLJ A;  5BR8 Q;  5KNC A;  1ZKO A;  2FFK B;  3CCU A;  4ZCK A;  3S16 B;  1Y1V G;  4ZQ3 A;  3KLS A;  1XNQ L;  3RN2 A;  1HZA A;  2B2Y C;  1OXT A;  3UDG A;  4OIJ A;  3P75 A;  3GTM B;  2X6G A;  1SRU A;  1B9M A;  3SDZ A;  1Y8N B;  4CDC C;  1LM0 A;  2NUC A;  1EQV A;  2C9O A;  3MTS A;  1XNR L;  3ONA B;  5FKA C;  4PQX A;  1S5D D;  4ME3 A;  4HCE A;  3D6C A;  2AUK A;  1D6E C;  2EVB A;  1Y14 B;  2F0N A;  4KJN A;  2Z1C A;  2D9U A;  2K5V A;  3SK6 A;  1HJP A;  4I7A A;  3MXN A;  1V1Q A;  4JI8 L;  4JYA L;  3ND8 A;  4HTH A;  2EJF C;  3CPF A;  4OEL B;  1I4H A;  2K6A A;  2PI2 A;  5KGU A;  1SMY D;  4ME5 A;  1TWG H;  3RLO A;  4QF4 A;  3I73 A;  3FPP A;  3OYY A;  2UUC Q;  5CBE E;  2J4X A;  1SE8 A;  1CKM A;  1XNQ Q;  4OGQ C;  2EOT A;  5CV8 A;  4X3K A;  2Q2I A;  4EX5 A;  1UE5 A;  1I3Q H;  1TWC H;  1TWH B;  5A2Q L;  2M00 A;  3ICE A;  1XNR Q;  4G57 A;  3I2Z A;  3CXC A;  1A2U A;  4J6H A;  5I4D A;  3J81 L;  2PQE A;  4YY3 Q;  2SEB D;  1GKH A;  3S1R B;  3EBE A;  2IWH A;  4M1U B;  3CME A;  3TZU A;  3SHL A;  2A19 A;  1XPO A;  2ZXO A;  1ICW A;  3I55 A;  4JYA Q;  2QCP X;  4R8I A;  2JJQ A;  1WTP A;  4TVA B;  1PRT B;  1UE7 A;  2Y0S B;  2TSS A;  4BBS G;  1YJW A;  1HH2 P;  4DR7 L;  3AB9 A;  1Z9F A;  1JWU D;  4JOI A;  1EY7 A;  4RFB A;  3AEV A;  2LKV A;  1Y1W G;  4DV1 L;  1BVS A;  1HFG A;  1VQM A;  1VQO A;  4OO1 G;  5IE8 A;  2K33 A;  1SYC A;  3D3R A;  2HT1 A;  3Q23 A;  2NBF A;  1B7Y B;  5FLX E;  2K03 A;  1EIF A;  3I4M G;  3G6J B;  4UHV A;  2QDL A;  3E5S A;  3PQI A;  4IN3 A;  4E6I A;  3D6W A;  5I6W A;  3CPW A;  1AE2 A;  1Y1W B;  4KMU C;  2JEA I;  1C0A A;  3QB3 A;  4X64 L;  1YNX A;  2QF7 A;  3I56 A;  1Y8O B;  3CQZ H;  1LT4 D;  4A3C H;  3A55 A;  2HDM A;  1EQT A;  2D62 A;  1KDB A;  5IP9 G;  2PZT A;  4IUT A;  2Z6K C;  3L9A X;  2Q2U A;  4QCL A;  1SYD A;  1F2M A;  1DCZ A;  2JA6 G;  2NZ1 D;  3CAM A;  1LTL A;  3DXJ C;  2LFN A;  3F2C A;  3UDX A;  2R92 H;  2GVB A;  1UUP A;  1B4O A;  4GN4 B;  4DV1 Q;  3ERS X;  2ENB A;  5CV5 A;  1PZJ D;  3VA7 A;  2V4D A;  1HHV A;  1ZXT A;  3BDC A;  2F03 A;  2F0H A;  4HID A;  5IOD A;  3R2T A;  1VQK A;  1I3Q B;  1G29 1;  2JA6 B;  1HZB A;  5CYU A;  4NDX A;  4LFB L;  3KBX A;  2PW5 A;  4XQJ A;  4Q5V A;  1PFN A;  1X3G A;  1JQY D;  5LL6 X;  3HOX G;  4A93 H;  4X64 Q;  5ELE A;  1JWS D;  2A74 C;  3GV3 A;  3MXU A;  4GKJ L;  4LF8 Q;  2L11 A;  1YHA A;  1VQ8 A;  3IFD A;  1DOL A;  2JA8 G;  4LW1 A;  3DLL A;  1JB7 A;  1EQQ A;  1YJN A;  2EYO A;  1EYD A;  3HRZ C;  4HMI A;  3EA6 A;  3GTJ H;  3HS0 C;  4EVO A;  1OXU A;  1LAC A;  1LTT D;  1HQR D;  3QO2 A;  1GOZ A;  4N8F A;  4MN3 A;  2VL6 A;  4OON A;  1VQP A;  4XXE A;  2JA5 G;  4A3F G;  1NCV A;  1VQG A;  2A5H A;  2CKZ B;  3Q24 A;  4RA8 A;  4IQZ A;  1AZP A;  1NJI C;  2SNM A;  3E9I A;  1TVX A;  4FF3 A;  4LFB Q;  5FJ8 G;  2YV5 A;  3HFZ B;  1QIL A;  2QEJ C;  3I91 A;  2F0K A;  1XMO Q;  5G3L F;  4KD3 A;  2MFI A;  4K5X A;  2F0U A;  1STH A;  4GKJ Q;  1LT5 D;  4GN3 B;  4BY7 G;  3M7N A;  1A3U A;  3CQZ B;  5G3L D;  3PUX A;  3KLW A;  1A8V A;  3LWE A;  4A3K G;  1NMG A;  1B44 D;  3P20 A;  3BDL A;  1JE4 A;  4UP9 A;  3MZ5 A;  4PV1 C;  3IKJ A;  4R1J A;  4DR4 L;  1KLG D;  3H0G G;  3T53 B;  1W2B A;  4K2K A;  1G51 A;  4C2M H;  1C8C A;  2R3Z A;  2R92 B;  1F2L A;  5E4W C;  4JK1 C;  5D3D A;  4RHS A;  3W2D A;  4GKK L;  4FVM A;  3M4O H;  5M5W H;  3HOY G;  2BH8 A;  2NZH A;  5E4X A;  3A74 A;  4QY7 A;  1EZ8 A;  1JIC A;  2UXD L;  4DAY B;  5J39 A;  4POF A;  5COY A;  4XT1 B;  5JEA H;  3H0G B;  4OWW B;  4XIG S;  2UXB L;  1XTD A;  2RCN A;  1V1P A;  1GJX A;  1WI5 A;  1ENC A;  3S1Q H;  5NUC A;  3HOY B;  4A3D H;  4A93 B;  4C3I H;  2G5D A;  3CCE A;  4IJL A;  4HSV A;  3CCQ A;  1OTC A;  2XWJ B;  1EIY B;  5FLM G;  2A73 B;  4ZAI A;  2R93 H;  1VDZ A;  3PUW A;  4RKB A;  3T51 B;  3ITP A;  4HIK A;  3KLR A;  4DR4 Q;  2MQH A;  2ZTC A;  2RDG A;  1EIH A;  2N3S A;  1DM0 B;  1MIU A;  4PZ6 A;  5DM6 3;  1TS5 A;  2XRQ D;  5IYB G;  1UEB A;  4JI6 L;  2ZM6 Q;  4GKK Q;  2EYM A;  3KUP A;  2R6G A;  3PCO B;  1JJC B;  4MHE A;  5K36 H;  3A8J E;  1CKO A;  2UXD Q;  1IYU A;  1KTK A;  4DXG A;  4IOA A;  2G9D A;  3J80 L;  2K75 A;  1O7I A;  2AHO B;  1EY4 A;  2N88 A;  2Z0S A;  3PV0 A;  1K8G A;  1BBX C;  2UXB Q;  1CHP D;  4KN7 C;  2K04 A;  2VB3 X;  3ERQ A;  3J81 j;  2B2W A;  1RL2 A;  1XWE A;  2JK8 A;  1U9R A;  2I0Q A;  2EYH A;  1QWY A;  1Q3L A;  1BDO A;  2K14 A;  4L5S A;  4HMJ A;  4TKO B;  4AQY L;  1XMQ L;  2JSO A;  1W3S A;  5HGQ A;  3T1Y L;  3WOE A;  4A3E G;  1V1O A;  4DK6 C;  3KDF A;  3M85 A;  4JI6 Q;  2IJ0 A;  1EY6 A;  2F0Q A;  3BZK A;  2WFW A;  3H3V C;  1TT2 A;  2RDF A;  2RKS A;  2CHB D;  3M4O B;  5M5W B;  5J1Z A;  1XPR A;  5M3F H;  3PO2 H;  3VR3 A;  2Y0S E;  3H3V I;  3JAM i;  1SYF A;  3HOZ G;  1VQF A;  2Q8R E;  1MJC A;  1XJV A;  2I5M X;  4LF5 L;  1I50 H;  2UXC L;  2NTS A;  1BXT A;  3M4Y A;  3U9S A;  3MAQ A;  4A3D B;  4C3I B;  1CQF A;  3I8Z A;  1A6X A;  1CQV A;  4AQY Q;  3Q22 A;  1XMQ Q;  4POG A;  3I70 A;  1VQB A;  2K7V A;  2KBN A;  1UWV A;  3PIO 3;  4DUY L;  4TQU S;  3T1Y Q;  2KCC A;  3HOV G;  1L1O A;  2PYK A;  4QQB X;  4HN7 A;  5M3M H;  3UDI A;  2RSN A;  1NBW A;  4X3T A;  3URY A;  3R2I A;  1NAP A;  1M4V A;  1PA6 A;  2IT1 A;  5A2Q E;  1O78 A;  2CCZ A;  5C0X H;  3HOV B;  4O42 A;  1EEI D;  1K9M C;  4ZUJ A;  3NE5 B;  2B63 H;  1BQQ T;  1KRS A;  3GTK H;  4YCV A;  4ULL A;  4LF5 Q;  1X32 A;  1BO0 A;  1CK1 A;  2MO0 A;  3OW7 A;  1VQ7 A;  4DXF A;  2FIN B;  1YBY A;  1A3T A;  1I4G A;  2DNE A;  2EYL A;  2P5Z X;  4DAV A;  1ZYR C;  3MXP A;  1TS2 A;  1HQM C;  3PO3 G;  4LMQ D;  2RHS B;  4B3S Q;  3BZC A;  1LTA D;  4DK3 C;  4DR2 Q;  1ROD A;  4JVZ A;  1I94 L;  3CCJ A;  2RBM A;  4APV A;  4BA2 I;  5EGT A;  3AMU A;  2E2I H;  2RF4 A;  1L0X B;  1SNC A;  5M3F B;  3ULJ A;  4FF2 A;  3DEO A;  4CJ1 B;  4P71 A;  5BN5 A;  1G8Z D;  2E2D C;  4ILW A;  5FOB B;  4DAP A;  2E5L L;  4DV2 L;  4CKB A;  4QUC A;  2E76 C;  2KOL A;  4EQN A;  1B53 A;  1XXG A;  2Z4I A;  3D8G A;  4C3H G;  4OL7 A;  4IFD H;  3UE1 A;  1IXR A;  1V8Q A;  2Z6B A;  3V05 A;  2XGT A;  3H3V H;  2NVX B;  4BY1 G;  1TWF H;  2ZXR A;  2AWN A;  4X3U A;  5GQO A;  1CTM A;  2MNA A;  2OQK A;  1IL8 A;  3HG9 A;  3U50 C;  1Q1E A;  2B2V A;  2A69 C;  1I94 Q;  4C3H B;  5GAG C;  1YJ9 A;  4X6A H;  4OX9 Q;  4JOI C;  3VYU A;  3S2H H;  1Q82 C;  1HR0 W;  3BYY B;  2ZJR A;  1LTR D;  3BG3 A;  4BBR H;  3K8A A;  4KKU A;  4V19 0;  3TRE A;  3M3Y H;  1S5C D;  1K28 A;  1SE4 A;  1J8I A;  1HA6 A;  4RMF A;  4B9X A;  5KRU A;  3NBH A;  5JJK A;  2IY5 B;  2B63 B;  4CGY B;  1ET9 A;  3GTK B;  3TZD A;  4DV2 Q;  1RKN A;  2Q8T A;  4X62 L;  3J7A V;  1JB3 A;  3AFP A;  1TQO A;  5C4X H;  1FJG L;  5IP7 H;  1SE3 A;  3ULL A;  5JJI A;  1AE3 A;  4NP5 A;  1D8L A;  1EOT A;  2JA7 G;  2L12 A;  2JP1 A;  5IOC A;  2L4N A;  3T4A C;  3VYT A;  5DNF A;  3KF6 A;  4DR3 L;  5IYC H;  3RN5 A;  4NW2 A;  2CFM A;  5C44 H;  3J7Y W;  1QNU A;  4KK7 A;  1LYL A;  2ZTD A;  5EPJ A;  4KI0 A;  4EGV A;  2D5D A;  4A3L H;  2R7Z H;  1B3A A;  4ZK9 B;  1DGS A;  1CHQ D;  5E1F A;  2B2T A;  3W3A A;  2K05 A;  3Q8D A;  4DUZ L;  3S1N H;  2NVY B;  4A3G G;  4X62 Q;  2LS0 1;  2AQ1 B;  2K50 A;  1TY0 A;  1ZYR D;  1FJG Q;  3K7U C;  2F0E A;  3OIQ A;  3S14 B;  1ENA A;  3HP3 A;  3NEM A;  3KFU A;  4JCV E;  2BCO A;  3Q0A A;  4MNO A;  1WD0 A;  5ELO A;  4CKC A;  2EIF A;  1EFW A;  4DR3 Q;  4A3G B;  1O7Z A;  4DA2 A;  2F0S A;  3GV6 A;  5TSS A;  1ASY A;  3KF8 B;  3LNN A;  2G9H D;  1H95 A;  3S2H B;  2DUD A;  3D4W A;  2WAQ G;  1KLU D;  4OIK A;  4BBR B;  4B3M Q;  1D1I A;  5IIF A;  3M3Y B;  4IPD A;  5C4J H;  4KJO A;  1JWM D;  5FO9 B;  3RZD H;  5KIX A;  4C1N K;  4DUZ Q;  1SND A;  1M1K C;  1TR5 A;  1XTC D;  4LK1 C;  2NN6 H;  1V9P A;  1MJE A;  2I46 A;  5JVH 3;  4NKL A;  3NQI A;  5C4X B;  2E2H B;  5DAU A;  3HOU B;  2UUC L;  2FHT A;  2QDB A;  5CR3 A;  5JPN C;  2NWG A;  1N32 Q;  4PNY A;  1CKN B;  1NTG A;  4UAI A;  1SYB A;  4AIM A;  4K5W A;  2PZU A;  3M9B A;  2A69 D;  4FDB A;  1H9S B;  1FL0 A;  1HUN A;  3E0J A;  2ICI A;  3MEF A;  5IYD G;  1VMC A;  1EYC A;  1I6H B;  3K57 A;  2ID0 A;  3EN2 A;  2BA0 A;  2VQE L;  2TMP A;  2IX1 A;  4YY3 L;  1E3P A;  1B8A A;  1FYC A;  2F3I A;  3D0F A;  4KTA A;  1F2Z A;  2R7Z B;  2QW7 A;  2BDN A;  4IUN A;  2K5H A;  3HOW G;  1H9K A;  3RD4 A;  4MTN A;  2NVT H;  1HR0 L;  4RAU C;  4JI2 L;  4A3M H;  3DWQ A;  2EXD A;  4DK1 A;  1QZH A;  1SFO H;  4LF6 L;  4R4I A;  2XNA C;  2SOB A;  2QEX A;  2BA1 A;  3SK4 A;  4DR1 Q;  3HOW B;  2VZA A;  1NR4 A;  5HY6 A;  3J81 c;  1EY9 A;  1YHQ A;  1X54 A;  1LTI D;  4IPH A;  2RCF A;  3CCM A;  4XT3 B;  4ZKC B;  1IW7 C;  2K5N A;  2V1C C;  5I2Y A;  3NPP A;  2VNU D;  2Y0S G;  1NY4 A;  2RSO A;  4V0B A;  2VQE Q;  1EY5 A;  1EU4 A;  1RDP D;  5IWA L;  2F0I A;  4JG2 A;  2RVL A;  2EY5 A;  4RCO A;  5IGD A;  2C35 B;  1BUV T;  4Y52 H;  4DV0 L;  4MIU A;  5C4J B;  3RZD B;  4DFA A;  1HR0 Q;  4XYO A;  3MVV A;  4JI2 Q;  2Q2H A;  2BOS A;  4K6D A;  2JQO A;  2N49 A;  4LF6 Q;  1S3O A;  2B2W C;  4A3J H;  3FMC A;  5GAH C;  2LMC B;  3QJY A;  1E22 A;  3E6Z X;  1JOO A;  3I4O A;  2R61 A;  3N6R A;  3ULP A;  2EJM A;  1HZC A;  2H5X A;  2A68 C;  5JOB A;  3I4L A;  2EYF A;  2BH2 A;  2PO4 A;  3CC2 A;  3P1H A;  3U58 A;  1CSP A;  2MO1 A;  5IWA Q;  1D1K A;  1I6V C;  1D5Z C;  2XRS D;  5FK9 C;  3TP5 A;  4DV0 Q;  1HRJ A;  1AN8 A;  1LAB A;  1ML0 D;  3SGI A;  4X66 L;  4LF8 L;  2K5Q A;  3E3X A;  1A3V A;  3HGB A;  1Q81 C;  3K59 A;  3J7A 5;  2NVT B;  4HR7 B;  4RWS C;  1FR3 A;  1SJH D;  4O2D A;  4C3J H;  3DMU A;  1PH8 A;  4RKL A;  1EIG A;  2SNS A;  4A3M B;  3MA2 B;  3X3N A;  2J0T D;  3FKI H;  1TWG B;  2LXK A;  1SFO B;  2X6L A;  2JA5 H;  4JI3 Q;  3MC0 B;  3NP8 A;  5CV7 A;  2EPB A;  4DNT B;  5I9P A;  1BBW A;  3VDY A;  3RNU A;  1SNP A;  3G4S A;  4WJW A;  1TWC B;  2IHE A;  2AQ2 B;  1YNJ C;  2QA4 A;  1V43 A;  1QVG A;  2VB2 X;  1ILQ A;  1GUW A;  5CBA E;  4DGZ A;  1NE3 A;  1K73 C;  1XMO L;  3GDE A;  4IUP A;  2NYZ D;  2PNR C;  5EJW A;  5EAY A;  1KL9 A;  4X66 Q;  2LY7 A;  4IOC A;  2OEO A;  4P74 A;  5IT9 L;  4DV5 L;  4LFA L;  5KEE A;  4A3J B;  1X55 A;  3NSW A;  1LT3 D;  3GP7 A;  1VQI A;  3SE0 A;  1H9R A;  4A3B H;  1E7Z A;  4FF1 A;  1SNO A;  1BNZ A;  1CA6 A;  4YWK A;  2BDO A;  3BVM A;  1RJT A;  3LGJ A;  4HCS A;  1IW7 D;  4H44 C;  4WFN 3;  4JI1 L;  1SBB B;  3IFT A;  4PZ8 A;  1L0W A;  4DV6 L;  1AZQ A;  4A3C G;  2EQS A;  1PH2 A;  1L0Y B;  1OXS C;  1MKH A;  1K0R A;  4UP7 A;  5EPK A;  4R4C A;  5EKI A;  4P2C B;  3MEH A;  3ZJY C;  5M5Y H;  3CCL A;  4GLA C;  1EWH A;  1IBK L;  2R92 G;  5FLM H;  1A63 A;  3PGZ A;  2HUG A;  2IPK D;  3I72 A;  3D4D A;  4DV5 Q;  2F3V A;  2K01 A;  3LX0 A;  3PSI A;  3Q6S A;  4LFA Q;  1ZEQ X;  3FKI B;  3R8B A;  1PH5 A;  3H94 A;  3K7A H;  2ZM6 L;  5DLQ E;  4WJ3 M;  4A93 G;  4DU9 A;  2A68 D;  3B6Y A;  1SNQ A;  3K58 A;  4RG1 A;  5JAV A;  4JBW A;  4JI1 Q;  1TU2 B;  2B2Y A;  4DV6 Q;  3PF5 A;  2HQL A;  3NEN A;  4DAM A;  1XX8 A;  4OWT B;  3EJI A;  3FDT A;  3PIP A;  4XDX A;  3J81 i;  2ZJQ A;  1IBK Q;  4DAY A;  1GUN A;  3K5O A;  1VQL A;  3NHH A;  2EE1 A;  2IX3 A;  2WP8 J;  5C0X I;  1S5E D;  3RZO H;  1V1P B;  3RMH A;  1FVI A;  2AWO A;  2ALY B;  3TDQ A;  5FO8 B;  4DK0 A;  3K5L A;  1IYV A;  2VXW A;  1QB5 D;  1AW7 A;  5IGE A;  3NUC A;  3TQY A;  1VQH A;  2B2U C;  3GTJ B;  1WCM H;  3KBG A;  1PFS A;  1LV9 A;  4JBJ A;  3J80 c;  3A0J A;  1SR3 A;  1Z6H A;  3GTG H;  4GN5 A;  5C4H A;  4GOP A;  1WFQ A;  3PUY A;  1G6Z A;  2F0G A;  1YNN D;  3D31 A;  3W5O A;  4PG3 A;  5C5M A;  4K8I A;  2KHJ A;  4FO2 A;  1YNJ D;  3DWP A;  3JC6 6;  4ALP A;  2H4O A;  3MWY W;  1BCP C;  5EPL A;  4R4O A;  1X6O A;  4S3S A;  3ER0 A;  3N52 A;  1PVO A;  2YU9 H;  3DM1 A;  1JC7 A;  2PI2 E;  2O5I C;  3MFG A;  1LTS D;  5C3W A;  1QE6 A;  1O7Y A;  1G2T A;  1VQE A;  3C1F A;  2WB1 E;  1C9O A;  4L5T A;  4JW0 A;  4PMB A;  4K0K L;  3WOF A;  3S15 H;  1ASZ A;  1E24 A;  1K8M A;  4UDU C;  3F1Z A;  2WIN B;  1JE5 A;  2B2T C;  4ZRZ A;  4F88 A;  4DR6 Q;  1SNM A;  4IUR A;  1B70 B;  1GUO A;  1LO5 D;  2A6H C;  4ZKB B;  1PHJ A;  3NTK A;  2QKI C;  3H09 A;  2K52 A;  4C2M B;  2NVQ B;  1IBL L;  2JEB I;  3F2B A;  4LNQ A;  3I4N H;  1K3B C;  4IFD I;  3T1H Q;  1KNE A;  4A3D G;  4HJ8 A;  4C3I G;  2Z9H A;  1LT6 D;  5CV9 A;  3UI2 A;  2CW0 C;  5CGK A;  3AYH B;  2R93 G;  1VQ6 A;  2Z4H A;  3A56 A;  2DY7 A;  4DNR B;  4UY8 C;  3K5M A;  1WTR A;  4LUV A;  3S2D H;  1Y8P B;  3EIV A;  4Y7N H;  3S1Q B;  2MJ8 A;  2DGY A;  4A3I H;  4DNI A;  4K0K Q;  1GUG A;  3VR5 A;  3RZO B;  3NWT A;  3C3L A;  1PDQ A;  1EUJ A;  5K36 G;  3NTH A;  2R93 B;  2B29 A;  2K5W A;  4JPB W;  3ZYY X;  3TBI B;  3IAY A;  1LUZ A;  4K5V A;  1SE2 A;  1FNV A;  2Z8L A;  1JT8 A;  1NNX A;  4B3S L;  1IBL Q;  2OXP A;  1F9Q A;  2EDG A;  4DR2 L;  4GNX C;  3GTG B;  1S5B D;  2GVA A;  1JR0 D;  4G7O C;  2HIX A;  5C0X J;  4B9W A;  3CC7 A;  1FNU A;  3J81 E;  2WV6 D;  2YTV A;  4KHZ A;  5M5X H;  1XYI A;  5KNB A;  1JJG A;  1VQA A;  4KHP L;  2EJG C;  2YU9 B;  1VCI A;  3SVM A;  1T9H A;  3T56 B;  3S24 A;  3HKZ E;  3KJO A;  1KHI A;  1DXM A;  1DOK A;  3LWU A;  5I2X A;  5LHY 1;  4K14 A;  3G6E A;  4KV6 A;  1WTX A;  3RR5 A;  4RCN A;  2EZV A;  5JJL A;  3DHQ A;  2OWO A;  2B8F A;  1U4R A;  2PCF B;  1PH3 A;  5M3F G;  1I4Q A;  1GD7 A;  2OCE A;  3PO2 G;  2ES2 A;  1C7Y A;  1ESR A;  1BCP F;  3NWS A;  1J6Q A;  1F9R A;  3OTO L;  3I4N B;  1PLF A;  4OX9 L;  1BCP D;  1CM9 A;  3PMF A;  3KK7 A;  4L63 B;  3SXH A;  4CDD C;  1G6P A;  3PO2 B;  4NXM Q;  4KHP Q;  3TRZ A;  1PH7 A;  1E1T A;  2MUY A;  3CC4 A;  1BF4 A;  3S2D B;  2EY2 A;  5DM7 3;  4JI5 L;  1I50 B;  1ESF A;  4KKT A;  4DN4 M;  1VQ9 A;  5M3M G;  4A3I B;  3IRB A;  4IFD J;  1UNS A;  3NXW A;  2KHI A;  1ONL A;  1VQ5 A;  2E2J H;  1HNZ L;  4PZ7 A;  2A6H D;  4LF4 L;  1Q8K A;  1PZI D;  1PZK D;  5C0X G;  4ZUI A;  2E8G A;  1U5K A;  1XPU A;  1EYA A;  1S72 A;  4BA1 I;  4JC0 A;  4ZYS A;  2NN6 I;  1K83 H;  4K8J A;  5T1I A;  1A0I A;  1YI2 A;  2DN8 A;  4B08 A;  2B63 G;  3OPO A;  5M3M B;  1IKM A;  1STA A;  4HAE A;  5COR A;  1MI2 A;  3ND9 A;  5ELF A;  2F4I A;  3OTO Q;  3BDO A;  1YEZ A;  4K6L A;  2H1E A;  1BKB A;  3KYH C;  1KRT A;  1VF7 A;  2AMC B;  2CW0 D;  2CH4 W;  4B3T L;  1E1O A;  4BXX H;  1EOV A;  5M5X B;  2YTY A;  5C3E H;  2JXM B;  4JI5 Q;  4ZLT F;  4G7Z C;  2VUM H;  1YIT A;  2ZJP A;  1QUQ B;  4XQN A;  1GO3 E;  4GLV B;  1QJO A;  3RUZ A;  5CMD A;  1P16 A;  3QIA A;  1HNZ Q;  2PQA B;  1EQR A;  2LSS A;  4LF4 Q;  1FNW A;  1JOK A;  3V2T A;  4X65 Q;  4JBK A;  4CHT B;  2ZXP A;  1STB A;  4G4K A;  2UUA L;  3U4V A;  1IL2 A;  2F0O A;  4EQO A;  2UUB L;  1W6J A;  5HUR A;  4AYB B;  5AJ3 L;  1WTW A;  1PTO C;  3KF6 B;  2NVQ H;  4B3T Q;  4AH6 A;  3CU7 A;  2E2I B;  1IYJ B;  1DOM A;  4IFD G;  1FGB D;  4B3M L;  1N9W A;  4QMG A;  4UPA A;  2FXQ A;  1RHP A;  3BJU A;  3NBI A;  2AKW B;  1QNK A;  1PFB A;  4LF9 L;  2AQ3 B;  3GQB A;  2L15 A;  4MTK A;  2RQX A;  2XTI A;  1EWC A;  3RLF A;  2B39 A;  1R4P B;  1Y1V H;  1SSO A;  1SRO A;  4KD4 A;  3S17 H;  2KEE A;  2E2J B;  4F87 A;  1RTO A;  1E0B A;  3C1E A;  3FPU B;  1P8L A;  2EXZ A;  1WVL A;  4BBR G;  1N32 L;  1J9O A;  1KAA A;  2UUA Q;  1TWF B;  4CDF C;  1Q46 A;  2UUB Q;  1A62 A;  1CUK A;  1PH9 A;  4L5R C;  5AJ3 Q;  3F8T A;  1II3 A;  1EEF D;  1KNA A;  2N78 A;  2F0L A;  3T13 A;  5C4X G;  2D0O A;  1HUM A;  5IP7 G;  3HOU G;  5C5L A;  2HD3 A;  1CI3 M;  1PXU A;  4CJ0 B;  1NR2 A;  4LF9 Q;  3KF8 A;  4DKA C;  4DV4 L;  4HSP A;  3PUZ A;  2D0P A;  2I5L X;  4OEM B;  2Q8I B;  5I6Y A;  3UE0 A;  3HKS A;  5ELB A;  4KHV A;  4ID6 A;  5IYC G;  3NEL A;  1F77 A;  3K0Y A;  3RLN A;  3S1R H;  4GLX A;  2KCN A;  3A7L A;  5C44 G;  1QCB D;  2CVR A;  1MGS A;  1X65 A;  3R3O A;  3C46 A;  4A3L G;  4DR1 L;  2R7Z G;  4GNX B;  2L9H A;  4F7X A;  2JE6 I;  4C1N I;  1FD7 D;  2O2L D;  1STN A;  5C44 B;  1CKN A;  3J80 E;  2PMZ E;  1LLR D;  1H9M A;  1MHW C;  3VR2 A;  4LFC Q;  5DEH A;  1H9S A;  2QGQ A; 
#chains in the Genus database with same CATH homology
 4PMW A;  1WTO A;  4H13 C;  2F0D A;  5ELD A;  2FJ2 A;  5M9O A;  1DZ1 A;  1BOS A;  4K2L A;  4RGT A;  3S1N B;  1QG7 A;  5JVG 3;  1X3P A;  1SJE D;  4OO1 H;  1Y1V B;  3S17 B;  3MHB A;  1HCZ A;  1WTV A;  1PTO F;  1R4Q B;  4IUQ A;  1GUT A;  1MSH A;  2WB1 B;  1PTO H;  1X3Q A;  1O80 A;  3IL8 A;  2E74 C;  5LL6 S;  3QWN A;  1PTO D;  4DF7 A;  2NN6 G;  3MXG A;  3EFX D;  1Q1B A;  1CA5 A;  5D65 A;  3S9W A;  1F9P A;  1ET6 A;  2FMC A;  4FXD A;  4M8A A;  2EYP A;  2WKD A;  2PPB C;  1CZW A;  2NTT A;  1Q8I A;  1SEB D;  2K28 A;  3DUZ A;  3K6O A;  2WII B;  1IKL A;  2X69 A;  1HA5 A;  1STE A;  4TRD A;  5EBD A;  3OHX C;  2F0J A;  2L0C A;  1SYG A;  3TSS A;  1SYE A;  4FXK C;  2F0W A;  4H0L C;  1EL0 A;  3WDN A;  2BE5 C;  4Q0F A;  3VR4 A;  4BBS B;  3H91 A;  4WOR A;  2K1B A;  1RD9 D;  2WAC A;  1B50 A;  1ENF A;  5KYL A;  3J7A F;  3DEP A;  1G2S A;  4CJ2 C;  3HKZ B;  2KEC A;  4LJZ C;  2EYJ A;  4J8Q A;  1PTO B;  1OXV A;  3I4M B;  5CV4 A;  2B8G A;  4N9T A;  1YNN C;  3M7G A;  4Z9C B;  3SK5 A;  2M2L A;  2FMM A;  3BYT B;  2HCI A;  2SDF A;  1DYQ A;  4L6T B;  4QUF A;  4QB4 A;  4N9P A;  3JAM L;  2IL8 A;  4H7B A;  4BWG B;  1EY0 A;  1QOH A;  4EQP A;  3C2P A;  1EFI D;  2F0P A;  3TP6 A;  1HPC A;  2HCC A;  3QOL A;  1SAP A;  2N55 A;  4KY6 A;  1EU3 A;  5ISR A;  1B2T A;  3S1M B;  2A6E C;  1R9T B;  4IUV A;  3CRK C;  2ZT9 C;  4R8N A;  2F1M A;  2PZW A;  2KVM A;  3D4R A;  3F2U A;  3NTI A;  4FYD A;  1E2V A;  4RHR A;  3FVQ A;  4RH6 A;  3R93 A;  3GTP B;  3HOX B;  2XWB B;  1Q90 A;  4C3J G;  2O5J C;  2K5D A;  3G7L A;  1F2Y A;  1W6K A;  2JA8 B;  1B1Z A;  3DWA A;  1C4Q A;  3I3C A;  4C3J B;  1WTQ A;  1GUS A;  1DJR D;  2QIL A;  2F3W A;  1Y69 U;  3CRL C;  2JA5 B;  4A3F B;  4GZY C;  1GHK A;  2KQ3 A;  3OSO A;  3BVG A;  1HXY D;  1E2Z A;  1T5E A;  5T1G A;  3L3O C;  3OWF A;  3A8I E;  1AFP A;  5JEA J;  4RGM A;  2B2V C;  4XQQ A;  4FP5 D;  2L55 A;  2BE5 D;  4BY7 B;  3A7A B;  2F0M A;  5IGG A;  2KUM A;  4A3K B;  1CFM A;  1STG A;  4XTC S;  2MGS A;  1HTL D;  4WRD A;  1AP0 A;  2DNC A;  2WKC A;  4PMC A;  3OOC A;  5D14 A;  5BN3 A;  4A3B B;  3NQT A;  5IGF A;  2C5C A;  3VR6 A;  1I4X A;  1U4P A;  2ICE C;  1H9J A;  2XIW A;  3U9O A;  2PW7 A;  3PUV A;  5F2D A;  5AFW A;  2KHS A;  5M5Y B;  3FRP B;  1SXT A;  1O7L A;  1M8A A;  2O4X A;  3K5N A;  3I90 A;  3SR1 A;  3BS1 A;  1EZ6 A;  2EY6 A;  2OT2 A;  1STY A;  2A6E D;  2I07 B;  5JEA G;  1VMP A;  1TY2 A;  2EY1 A;  3K7A B;  1I4R A;  3VYR A;  5IGC A;  1AEX A;  4FXG C;  3CHB D;  1B9N A;  4U68 A;  2RA4 A;  3FEW X;  1U4L A;  1U4M A;  3GTL B;  5D3I B;  1UAP A;  1BR9 A;  1A15 A;  3TME A;  1GHJ A;  5E3F A;  5JJZ A;  5IGB A;  1D5X C;  2PMZ B;  4X3S A;  4A3E B;  4ODG A;  1JOQ A;  4HED A;  1K8O A;  2XN9 C;  3MFY A;  1KDA A;  3GO5 A;  1WCM B;  1GXD C;  4LAA A;  1E2W A;  5KND A;  5CV6 A;  5BN4 A;  3HOZ B;  1PFM A;  5J22 A;  2IW3 A;  3TP8 A;  2MHV A;  3QOJ A;  1RF2 D;  3VYS A;  1OO9 B;  3EVQ A;  4YIJ A;  1MBY A;  1TS3 A;  5FLX L;  2F0T A;  5ELC A;  4C56 C;  3S15 B;  3QG1 A;  1D2B A;  1Z7T A;  2IX0 A;  3ERO A;  4IZ8 A;  3HZX A;  4KKS A;  2OF1 A;  3A54 A;  4R9W A;  4RGN A;  2GA4 B;  5FO7 B;  4CBV A;  1Q12 A;  5HGT A;  1ILP A;  4NMZ A;  2HDL A;  3BVZ A;  3KLS X;  5C4Z A;  4Y7N B;  4BS9 A;  2KED A;  1KDC A;  5EKL A;  3GD7 A;  3P7J A;  1RTN A;  2L5T A;  3A8K E;  2NB0 A;  3PO3 B;  2KA7 A;  1NSN S;  3SEB A;  3EQL C;  2HQE A;  2E75 C;  4O1N A;  1HFN A;  1DD2 A;  3V96 A;  1IHZ A;  3OMG A;  3T16 A;  1PRT C;  4KY5 A;  4TSS A;  4CKE A;  4QIW B;  1WD1 A;  1RCV D;  1CT1 D;  3NK9 A;  3GTQ B;  5I9O A;  1F9S A;  5C6A A;  2KJX A;  4I7Z C;  4IUU A;  4RGO S;  1HTP A;  2RDH A;  3JAM E;  5IT9 E;  4KY7 A;  1Z47 A;  1NUC A;  1TII D;  2JYO A;  4BY1 B;  1TWA B;  2XSC A;  1CZG A;  2M9V A;  4KN4 C;  1VF5 C;  2B2U A;  1JOR A;  4U67 3;  4OO1 I;  1BCP B;  3AU7 A;  2L1B A;  1SMY C;  1A2T A;  4F8M A;  5C3X A;  2F0F A;  2MP1 A;  2MPM A;  5EKK A;  4J1M A;  4ABN A;  3HEJ A;  3OWE B;  5CC4 A;  2F0V A;  1TKW B;  3L7Z C;  1G91 A;  1OXX K;  1PYW D;  2JA7 B;  1LTB D;  1SDF A;  5K5P A;  3TN2 A;  2CQA A;  1UEA B;  2J7Z A;  2D2C C;  4FF4 A;  1EY8 A;  1K83 B;  1MD2 D;  2YYZ A;  4L8J A;  1LTG D;  3CKI B;  2AUJ D;  2K32 A;  2DY8 A;  1T5X D;  3BZD B;  5C3E B;  4G7H C;  1JCK B;  3OMC A;  1I4P A;  1S4Z A;  2VUM B;  3O13 A;  1TS4 A;  3VA5 A;  3GTO B;  3TP7 A;  3OIP A;  1PMR A;  5KYI A;  1KAB A;  1DON A;  3PIP 3;  5EQ0 A;  1D5M C;  1MSG A;  4XYQ A;  1PRT F;  5A35 A;  3H6M A;  5JPM C;  3SK8 A;  5EBC A;  4I65 A;  3X3M A;  4OHJ A;  2XVS A;  1C48 A;  2WAQ B;  1PRT D;  4FNF A;  1S5F D;  4IAL A;  5KNC A;  1ZKO A;  2FFK B;  3S16 B;  4ZQ3 A;  3KLS A;  2B2Y C;  1OXT A;  4OIJ A;  3P75 A;  3GTM B;  2X6G A;  1B9M A;  3SDZ A;  1Y8N B;  2NUC A;  1EQV A;  2C9O A;  3MTS A;  3ONA B;  5FKA C;  1S5D D;  4HCE A;  3D6C A;  2AUK A;  1D6E C;  2EVB A;  2F0N A;  4KJN A;  2Z1C A;  2D9U A;  3SK6 A;  3MXN A;  3ND8 A;  4HTH A;  2EJF C;  1I4H A;  2K6A A;  5KGU A;  1SMY D;  4ME5 A;  4QF4 A;  3I73 A;  3FPP A;  5CBE E;  2J4X A;  4OGQ C;  2EOT A;  5CV8 A;  4X3K A;  1TWH B;  5A2Q L;  2M00 A;  4G57 A;  1A2U A;  4J6H A;  5I4D A;  3J81 L;  2PQE A;  2SEB D;  3S1R B;  2IWH A;  4M1U B;  3TZU A;  3SHL A;  2ZXO A;  1ICW A;  1H9S A;  2QCP X;  4R8I A;  1WTP A;  1PRT B;  2Y0S B;  2TSS A;  3AB9 A;  1JWU D;  1EY7 A;  4RFB A;  2LKV A;  4OO1 G;  1HFG A;  2K33 A;  1SYC A;  3D3R A;  3Q23 A;  2NBF A;  5FLX E;  2K03 A;  3G6J B;  3E5S A;  4IN3 A;  4E6I A;  3D6W A;  5I6W A;  1Y1W B;  4KMU C;  2JEA I;  3QB3 A;  2QF7 A;  1Y8O B;  1LT4 D;  3A55 A;  2HDM A;  1EQT A;  2D62 A;  1KDB A;  2PZT A;  4IUT A;  3L9A X;  4QCL A;  1SYD A;  1F2M A;  1DCZ A;  2NZ1 D;  3DXJ C;  2LFN A;  1UUP A;  1B4O A;  5CV5 A;  2ENB A;  1PZJ D;  3VA7 A;  2V4D A;  1HHV A;  1ZXT A;  3BDC A;  2F03 A;  2F0H A;  5IOD A;  3R2T A;  1I3Q B;  1G29 1;  2JA6 B;  5CYU A;  4NDX A;  3KBX A;  2PW5 A;  4XQJ A;  4Q5V A;  1PFN A;  5LL6 X;  1JQY D;  5ELE A;  1JWS D;  2A74 C;  3GV3 A;  3MXU A;  2L11 A;  3IFD A;  1DOL A;  2EYO A;  1EYD A;  3HRZ C;  4HMI A;  3EA6 A;  3HS0 C;  4EVO A;  1LTT D;  1HQR D;  1LAC A;  1OXU A;  3QO2 A;  1GOZ A;  4MN3 A;  4XXE A;  1NCV A;  2A5H A;  3Q24 A;  4RA8 A;  4IQZ A;  1AZP A;  2SNM A;  1TVX A;  4FF3 A;  1QIL A;  2QEJ C;  3I91 A;  2F0K A;  5G3L F;  4KD3 A;  4K5X A;  2F0U A;  1STH A;  1LT5 D;  3M7N A;  1A3U A;  3CQZ B;  5G3L D;  3PUX A;  3LWE A;  1B44 D;  3P20 A;  3BDL A;  1JE4 A;  3MZ5 A;  4PV1 C;  3IKJ A;  1KLG D;  3T53 B;  4K2K A;  1C8C A;  2R3Z A;  2R92 B;  1F2L A;  5E4W C;  4JK1 C;  5D3D A;  4RHS A;  3W2D A;  4FVM A;  5E4X A;  1EZ8 A;  1JIC A;  5J39 A;  5COY A;  4XT1 B;  5JEA H;  3H0G B;  4XIG S;  1V1P A;  1GJX A;  1ENC A;  5NUC A;  3HOY B;  4A93 B;  4HSV A;  2XWJ B;  2A73 B;  4ZAI A;  1VDZ A;  3PUW A;  4RKB A;  3T51 B;  3ITP A;  3KLR A;  2RDG A;  1EIH A;  1DM0 B;  5DM6 3;  1TS5 A;  2XRQ D;  2EYM A;  3KUP A;  2R6G A;  4MHE A;  5K36 H;  3A8J E;  1IYU A;  1KTK A;  4DXG A;  2G9D A;  3J80 L;  1BBX C;  1EY4 A;  2N88 A;  3PV0 A;  1CHP D;  4KN7 C;  2K04 A;  2VB3 X;  3ERQ A;  2B2W A;  1XWE A;  1U9R A;  2EYH A;  1QWY A;  1Q3L A;  1BDO A;  4HMJ A;  4TKO B;  2JSO A;  3WOE A;  1V1O A;  3M85 A;  2IJ0 A;  1EY6 A;  2F0Q A;  3H3V C;  1TT2 A;  2RDF A;  2RKS A;  2CHB D;  3M4O B;  5M5W B;  5J1Z A;  3VR3 A;  1SYF A;  2Q8R E;  2NTS A;  1BXT A;  3M4Y A;  3U9S A;  3MAQ A;  4A3D B;  4C3I B;  1CQF A;  3I8Z A;  1A6X A;  1CQV A;  3Q22 A;  3I70 A;  2K7V A;  3PIO 3;  4TQU S;  2KCC A;  2PYK A;  4HN7 A;  2RSN A;  4X3T A;  3URY A;  3R2I A;  1NAP A;  1M4V A;  2IT1 A;  5A2Q E;  1O78 A;  5C0X H;  3HOV B;  4O42 A;  1EEI D;  4ZUJ A;  3NE5 B;  1BQQ T;  4ULL A;  1X32 A;  1BO0 A;  1CK1 A;  3OW7 A;  4DXF A;  2FIN B;  2DNE A;  1A3T A;  1I4G A;  2EYL A;  4DAV A;  1ZYR C;  3MXP A;  1TS2 A;  1HQM C;  4LMQ D;  1LTA D;  1ROD A;  2RBM A;  4BA2 I;  5EGT A;  3AMU A;  1L0X B;  1SNC A;  5M3F B;  4FF2 A;  3DEO A;  4CJ1 B;  5BN5 A;  1G8Z D;  2E2D C;  4ILW A;  5FOB B;  4DAP A;  4CKB A;  4QUC A;  2E76 C;  2KOL A;  4EQN A;  1B53 A;  1XXG A;  2Z4I A;  3D8G A;  4C3H G;  4OL7 A;  4IFD H;  1V8Q A;  3V05 A;  2NVX B;  2ZXR A;  2AWN A;  4X3U A;  1CTM A;  1IL8 A;  3HG9 A;  1Q1E A;  2B2V A;  2A69 C;  4C3H B;  3VYU A;  3BYY B;  1LTR D;  3BG3 A;  4KKU A;  4V19 0;  1S5C D;  1SE4 A;  1J8I A;  1HA6 A;  4B9X A;  5KRU A;  3NBH A;  2B63 B;  4CGY B;  1ET9 A;  3GTK B;  3TZD A;  1RKN A;  2Q8T A;  3J7A V;  1JB3 A;  1TQO A;  1SE3 A;  4NP5 A;  1EOT A;  2L12 A;  2JP1 A;  5IOC A;  2L4N A;  3T4A C;  3VYT A;  5DNF A;  4NW2 A;  3J7Y W;  1QNU A;  4KK7 A;  5EPJ A;  4KI0 A;  4EGV A;  2D5D A;  1B3A A;  4ZK9 B;  1CHQ D;  5E1F A;  2B2T A;  3W3A A;  2K05 A;  2NVY B;  2LS0 1;  2AQ1 B;  1TY0 A;  1ZYR D;  2F0E A;  3OIQ A;  3S14 B;  1ENA A;  3HP3 A;  2BCO A;  3Q0A A;  1WD0 A;  4CKC A;  4A3G B;  1O7Z A;  4DA2 A;  2F0S A;  3GV6 A;  5TSS A;  3LNN A;  2G9H D;  3S2H B;  3D4W A;  1KLU D;  4OIK A;  4BBR B;  1D1I A;  5IIF A;  3M3Y B;  4KJO A;  1JWM D;  5FO9 B;  5KIX A;  4C1N K;  1SND A;  1TR5 A;  1XTC D;  4LK1 C;  2NN6 H;  2I46 A;  5JVH 3;  4NKL A;  3NQI A;  5C4X B;  2E2H B;  5DAU A;  3HOU B;  2FHT A;  2QDB A;  5CR3 A;  5JPN C;  2NWG A;  4PNY A;  4UAI A;  1SYB A;  4K5W A;  2PZU A;  2A69 D;  1H9S B;  1HUN A;  3E0J A;  2ICI A;  1VMC A;  1EYC A;  1I6H B;  3K57 A;  2ID0 A;  2BA0 A;  2TMP A;  2IX1 A;  1FYC A;  2R7Z B;  4KTA A;  1F2Z A;  2BDN A;  4IUN A;  1H9K A;  3RD4 A;  4RAU C;  3DWQ A;  4DK1 A;  2XNA C;  2SOB A;  2BA1 A;  3SK4 A;  3HOW B;  1NR4 A;  1EY9 A;  1LTI D;  4XT3 B;  4ZKC B;  1IW7 C;  5I2Y A;  3NPP A;  2VNU D;  2RSO A;  4V0B A;  1EY5 A;  1EU4 A;  1RDP D;  2F0I A;  2RVL A;  2EY5 A;  4RCO A;  5IGD A;  1BUV T;  4MIU A;  5C4J B;  3RZD B;  4DFA A;  4XYO A;  3MVV A;  2BOS A;  4K6D A;  2B2W C;  3FMC A;  2LMC B;  3QJY A;  3E6Z X;  1JOO A;  2R61 A;  3N6R A;  2EJM A;  2A68 C;  5JOB A;  3I4L A;  2EYF A;  2PO4 A;  3P1H A;  1D1K A;  1I6V C;  1D5Z C;  2XRS D;  5FK9 C;  3TP5 A;  1HRJ A;  1AN8 A;  1LAB A;  1ML0 D;  2K5Q A;  1A3V A;  3HGB A;  3K59 A;  2NVT B;  4HR7 B;  4RWS C;  1FR3 A;  1SJH D;  3DMU A;  4RKL A;  1EIG A;  2SNS A;  4A3M B;  3MA2 B;  3X3N A;  2J0T D;  1TWG B;  1SFO B;  2X6L A;  3MC0 B;  3NP8 A;  5CV7 A;  2EPB A;  4DNT B;  5I9P A;  1SNP A;  4WJW A;  1TWC B;  2AQ2 B;  1YNJ C;  1V43 A;  2VB2 X;  1ILQ A;  1GUW A;  5CBA E;  4DGZ A;  4IUP A;  2NYZ D;  2PNR C;  5EJW A;  2LY7 A;  2OEO A;  5IT9 L;  5KEE A;  4A3J B;  3NSW A;  1LT3 D;  3GP7 A;  3SE0 A;  1H9R A;  4FF1 A;  1SNO A;  1BNZ A;  1CA6 A;  2BDO A;  3BVM A;  1RJT A;  4HCS A;  1IW7 D;  4H44 C;  4WFN 3;  1SBB B;  3IFT A;  1AZQ A;  1L0Y B;  1OXS C;  5EPK A;  5EKI A;  4P2C B;  3MEH A;  1EWH A;  2HUG A;  2IPK D;  3I72 A;  3D4D A;  2F3V A;  2K01 A;  3LX0 A;  3Q6S A;  1ZEQ X;  3FKI B;  3R8B A;  3H94 A;  4DU9 A;  2A68 D;  1SNQ A;  3K58 A;  5JAV A;  4JBW A;  1TU2 B;  2B2Y A;  1XX8 A;  3EJI A;  3FDT A;  4XDX A;  4DAY A;  1GUN A;  3K5O A;  3NHH A;  2EE1 A;  2IX3 A;  2WP8 J;  5C0X I;  1S5E D;  1V1P B;  3RMH A;  5FO8 B;  2AWO A;  3TDQ A;  4DK0 A;  3K5L A;  1IYV A;  2VXW A;  1QB5 D;  1AW7 A;  5IGE A;  3NUC A;  2B2U C;  3GTJ B;  3KBG A;  1LV9 A;  1Z6H A;  5C4H A;  3PUY A;  1G6Z A;  2F0G A;  1YNN D;  3D31 A;  5C5M A;  4K8I A;  1YNJ D;  3DWP A;  4FO2 A;  2H4O A;  3MWY W;  1BCP C;  5EPL A;  4S3S A;  3N52 A;  3DM1 A;  1JC7 A;  2O5I C;  3MFG A;  1LTS D;  5C3W A;  1QE6 A;  1O7Y A;  1G2T A;  3C1F A;  4PMB A;  3WOF A;  1K8M A;  4UDU C;  2WIN B;  2B2T C;  4F88 A;  4ZRZ A;  1SNM A;  4IUR A;  1GUO A;  1LO5 D;  4ZKB B;  2A6H C;  3NTK A;  2QKI C;  3H09 A;  4C2M B;  2NVQ B;  2JEB I;  4IFD I;  1KNE A;  4C3I G;  1LT6 D;  5CV9 A;  3UI2 A;  2CW0 C;  5CGK A;  2Z4H A;  3A56 A;  2DY7 A;  4DNR B;  3K5M A;  1WTR A;  1Y8P B;  3S1Q B;  2MJ8 A;  1GUG A;  3VR5 A;  3RZO B;  3NWT A;  3C3L A;  1PDQ A;  5K36 G;  3NTH A;  2R93 B;  2K5W A;  3ZYY X;  3TBI B;  3IAY A;  4K5V A;  1SE2 A;  1FNV A;  2Z8L A;  2OXP A;  1F9Q A;  2EDG A;  3GTG B;  1S5B D;  1JR0 D;  4G7O C;  5C0X J;  4B9W A;  1FNU A;  3J81 E;  2WV6 D;  4KHZ A;  1XYI A;  5KNB A;  2EJG C;  2YU9 B;  1VCI A;  3SVM A;  3T56 B;  1DXM A;  1DOK A;  3LWU A;  5I2X A;  5LHY 1;  4K14 A;  4KV6 A;  1WTX A;  4RCN A;  2EZV A;  3DHQ A;  2B8F A;  1U4R A;  2PCF B;  1I4Q A;  1ESR A;  1BCP F;  3NWS A;  1F9R A;  3I4N B;  1PLF A;  1BCP D;  1CM9 A;  3PMF A;  3KK7 A;  4L63 B;  3SXH A;  3PO2 B;  2MUY A;  1BF4 A;  3S2D B;  2EY2 A;  5DM7 3;  1I50 B;  1ESF A;  4KKT A;  4DN4 M;  4A3I B;  4IFD J;  1UNS A;  3NXW A;  1ONL A;  2A6H D;  1PZI D;  1PZK D;  5C0X G;  4ZUI A;  1EYA A;  4BA1 I;  4ZYS A;  2NN6 I;  4K8J A;  5T1I A;  2DN8 A;  4B08 A;  3OPO A;  5M3M B;  1IKM A;  1STA A;  4HAE A;  5COR A;  1MI2 A;  3ND9 A;  5ELF A;  2F4I A;  3BDO A;  4K6L A;  2H1E A;  1VF7 A;  2CW0 D;  5M5X B;  2JXM B;  4ZLT F;  4G7Z C;  4XQN A;  1QJO A;  3RUZ A;  5CMD A;  3QIA A;  1FNW A;  1JOK A;  3V2T A;  4CHT B;  2ZXP A;  1STB A;  4G4K A;  2F0O A;  4EQO A;  1W6J A;  5HUR A;  4AYB B;  1WTW A;  1PTO C;  3CU7 A;  2E2I B;  1DOM A;  4IFD G;  1FGB D;  4QMG A;  1RHP A;  3NBI A;  1QNK A;  1PFB A;  2AQ3 B;  3GQB A;  2RQX A;  1EWC A;  3RLF A;  2B39 A;  1R4P B;  1SSO A;  4KD4 A;  2KEE A;  2E2J B;  4F87 A;  1RTO A;  1E0B A;  3C1E A;  3FPU B;  2EXZ A;  1WVL A;  1J9O A;  1KAA A;  1TWF B;  1II3 A;  1EEF D;  1KNA A;  2F0L A;  3T13 A;  1HUM A;  5C5L A;  1CI3 M;  1PXU A;  4CJ0 B;  1NR2 A;  3KF8 A;  4HSP A;  3PUZ A;  2Q8I B;  5I6Y A;  5ELB A;  4KHV A;  4ID6 A;  1F77 A;  3K0Y A;  2KCN A;  3A7L A;  1QCB D;  2CVR A;  1MGS A;  3R3O A;  3C46 A;  2L9H A;  4F7X A;  2JE6 I;  4C1N I;  1FD7 D;  2O2L D;  1STN A;  5C44 B;  3J80 E;  1LLR D;  1H9M A;  3VR2 A;  5DEH A;  4PQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...