3FPVA

Crystal structure of hbps
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
141
structure length
141
Chain Sequence
VAARGGELTQSTHLTLEAATKAARAAVEAAEKDGRHVSVAVVDRNGNTLVTLRGDGAGPQSYESAERKAFTAVSWNAPTSELAKRLAQAPTLKDIPGTLFLAGGTPVTAKGAPVAGIGVAGAPSGDLDEQYARAGAAVLGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extracellular haem-binding protein
publication title The oligomeric assembly of the novel haem-degrading protein HbpS is essential for interaction with its cognate two-component sensor kinase
pubmed doi rcsb
source organism Streptomyces reticuli
molecule tags Heme binding protein
total genus 38
structure length 141
sequence length 141
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3fpvA01
4CLCE 4CLCD 4CLCC 4NKPA 3FPVA 3FPWA 4BMWA 4CLCB 4CLCA 2A2LA 5CX7A
chains in the Genus database with same CATH superfamily
3BYDA 3ULFA 4KZ3A 2YKHA 5CECA 1T19A 4PAUA 4ID4A 4QB8A 2V9AA 1G6AA 1K55A 3IF6A 1QMFA 3SH7A 1MKMA 4DE2A 1DY6A 1WYCA 4R3BA 1P9WA 2VA0A 2H0YA 2AVXA 1YPRA 5DF8A 3F1NB 1L0GA 3T1QB 5C5KA 1K25A 5GLCA 2QWSA 2X71A 3ZHHA 4WM9A 2H5SA 5F83A 5GHZA 5KSHA 5HD3A 1FCNA 1G6OA 4R0QA 2I72A 3C5AA 3DTEA 4R23A 3WS5A 4L9EA 3RTYA 2Q0OA 1CK3A 3BFCA 1JTDA 5TGFA 2Y4AA 5CXWA 4S2IA 1ZG6A 2W0NA 4LCMA 1NLZA 1L0EA 3C30A 1BZAA 3V67A 3MZDA 2ZOHA 3E4QA 3FKVA 3PBTA 3SH8A 3DTKA 3LUQA 1KE0A 4GS9A 3LGOA 2WAFA 1CI8A 1FIKA 1PIOA 2P7JA 2XFSA 1TEMA 4Y0TA 5FATA 2ZMVA 3HLEA 4KZAA 3QP6A 2WK0A 5FSRA 2C5WB 3S1YA 3MXQA 5DF7A 1NZUA 4QY6A 4CLCC 1O7EA 2W3EA 4B93A 1V9ZA 4R4SA 2V20A 1H0MA 4WN5A 1CEFA 1L0FA 4BL2A 3LEQA 5CTNA 1PZOA 3HCYA 4H8RA 4UQIM 1RGYA 1SZVA 1S1YA 4QY5A 1KDSA 3BY9A 5HD5A 1GHMA 4E3IA 3CUEC 3T4SA 3HUMA 3W8KA 3G2YA 3GSGA 2PR6A 1DJCA 3C7UA 1S0WA 1T1AA 1OTDA 5HAQA 5FQKA 3Q7VA 1OMEA 4X53A 4C75A 3B33A 4K0XA 4RX3A 2IWBA 2P04A 5IHVA 1GHIA 3FG8A 3OPLA 4NKPA 2M7VA 2V0UA 3SS3A 2A2LA 4CQHA 1S4RA 3N8RA 3O3VA 2J9OA 4IJGA 5FAPA 3LR4A 4H6JB 3B47A 3IWOA 2Y2MA 1T1BA 3PTEA 3NDEA 3RH8B 5M18A 4LV2A 4WLAA 1S6RA 2PDRA 2WZZA 2O9BA 1G68A 3N7WA 4K91A 2V0WA 1HD8A 4MEZA 3E4PA 1SKOB 4YWZA 3T4JA 5F1FA 1GSVA 3VOZA 2J3TC 3IBJA 1I2WA 2MJ6A 3PBNA 1OTBA 4EWFA 1MY8A 4PKYA 2XK1A 3NECA 4OQGA 3F1PB 4IBRA 1IKIA 5HZHA 2VV7A 1E3UA 1BTLA 3H7WA 2K7SA 4F3LA 2P9VB 2ZL1B 1YSPA 4JXGA 3OOVA 3RXWA 2HDSA 2QYBA 2O99A 3NOUC 1ZKJA 4LENA 3MZEA 3UE1A 1W7FA 3GRJA 1XFQA 3UN7A 5DJTA 1WE4A 1YLJA 4GLQA 2WKRA 3AGDA 1PRQA 2VZWA 3G31A 4OQIA 4XUZA 4PPRA 3UB6A 1M40A 2WKIA 3IX4A 2WKPA 2BLSA 4HQAA 2XGNA 3HREA 1VHMA 1XJ6A 3NIAA 1DRMA 4EBPA 3LR0A 2PD7A 1ESUA 3MJQA 4L9FA 3HJIA 3ICYA 1VETA 1ALQA 1ODVA 1SDNA 3C4PA 4FD8A 5TR7A 1NZOA 1K55C 1IFQA 4HIAA 4E04A 3A3DA 3IF6C 3FV7A 3PHYA 4I5SA 3LIBA 1HTZA 1KGFA 1MWRA 2ZMFA 4HJ4A 2BTFP 3NOPC 1FCMA 1NY0A 2QHKA 2EWWA 4JF4A 3MF0A 3S7NA 4DRTA 4JKTA 2Y2LA 4P6ZS 4CLCE 3OCLA 4Y0UA 3EQVA 4Q8IA 3IH8A 2OLUA 5EVID 4N9KA 3JYIA 3AGEA 4BBUA 3VE4A 2Y2KA 1HVBA 1D7EA 1OTAA 4MBFA 1OTIA 2ZQ9A 2ZC3B 3VOLA 4OPQA 4ZJ2A 2WKEA 4MN7A 4JGRA 2H0TA 1FR1A 1TS8A 3UE6A 3LO7A 3A3EA 3LIDA 2J9PA 1LSWA 2B5RA 4KENB 1PZPA 1KVLA 2PHYA 5E2EA 2DCFA 2ZC4B 5JYPA 5A92A 3CLOA 4O8GA 2JCHA 4HP9A 5L09A 1MWTA 1LT0A 3PAEA 5DVAA 3IQAA 1LHYA 3QNCA 2WYXA 3CHWP 2VGKA 3E2KA 2Y2IA 2HP6A 4WL9A 3HBRA 3FYZA 3CZDA 5J8XA 5KZHA 4E3OA 2VGLM 4KQRA 4ETZA 2HJ9C 3VSLA 1GA9A 3GMWA 1NRJA 3CWFA 1FR6A 2Y2NA 1YLPA 1XP4A 2XQZA 1J3WA 3G2ZA 4E3MA 3LY3A 2XF3A 1KE3A 1KGEA 3ZG5A 2RL3A 4OOLA 4X56A 4GCZA 3BJNA 3T1XA 4CPKA 1HZOA 2V2FF 3OPPA 1FQGA 2W3HA 4PMAA 3RJUA 3MKEA 3D4FA 1IELA 4OOMA 4ZRRA 3N8LA 2W3GA 4D60A 4N1HA 3IWIA 3BFGA 4E3LA 4GDBA 1PWDA 2XA7M 3T4LA 1JWPA 4I3IA 4R3AA 1DJAA 4HOIA 1RGZA 1RP5A 4AFIA 1T1CA 2JE5A 1F2KA 1FCOA 2EA9A 3HLWA 1TVFA 4X55A 4G3WA 1YM1A 3D3OA 4K08A 5FDSA 4GHIA 4BD1A 4FSFA 4P6BA 4JLFA 4O0PA 5FAOA 4UAAA 1K0KA 2DNSA 3CMZA 3KX0X 1E25A 3DTMA 5I5LA 1PFLA 4R4RA 3B42A 4B4XA 1T18A 4KUOA 3HVFA 3N6IA 3UE0A 3QP2A 3VP2A 1M6KA 4Y7PA 3A3JA 4GNUA 4S2PA 2UWXA 5JYOA 1JTGA 2JKGA 2ZD8A 5FQIA 1JNUA 1CI9A 3RXXA 3UDIA 2XEPA 1UGUA 1YQSA 3HLFA 2KX6A 5HARA 4KZ4A 1ZC2A 2BG1A 1CQAA 5HDCA 3PBOA 1VM1A 4MMNA 3O5YA 1OT6A 3VSKA 4PM7A 1ERQA 3ZG7B 4JGQA 3C2WA 3WS1A 2P08A 4LPZA 4XUXA 4IBXA 1K6SA 2L4RA 1O07A 3DAVA 3QP8A 5E43A 4GOGA 3ZYTA 3ITAA 4HESA 4O7DA 3UPOA 5G4YA 5LBRA 5F68A 2ZQCA 5E2FA 5HWVA 3U2AA 4MN5A 5J3WA 3Q1FA 4MBHA 3T4TA 2L0WA 5EVIA 4EV4A 1ES3A 1SCWA 3ZGAB 4ZJ3A 2QJ7A 5FEGA 3D72A 4M4XA 1NYMA 5EECA 1ZHHB 2IWCA 3SZTA 4U3TA 3C4OA 5HDSA 4C3QA 5FDHA 4N92A 3FWLA 4L9GA 1MWSA 3W4QA 4S2LA 2V1BA 4X68A 2Y91A 2V8CA 2OSUA 3UPNA 3E98A 3EQUA 3BQAA 5FQJA 1XKZA 2QPNA 3MQ0A 4P85A 5DKLA 4OH0A 4MLLA 3ZG8B 1Q2PA 2INWA 5F1GA 4EBNA 5J4EA 1X0OA 2W1TA 1XXMA 4Y17A 2XRNA 5G18A 4HJ3A 1VQQA 1XA1A 1NYYA 3QP4A 3KYZA 3O88A 4RYEA 3IXBA 5CEDA 4XT2A 2XLNA 1W63Q 4EU0A 3B3XA 4Y13A 4OLDA 4DDYA 2B95A 4BBTA 3MXSA 2OV5A 3E2LA 5FL3A 2O9AA 2LB5A 3R7WB 4BJPA 3IXGA 1IYQA 3UB7A 1DP6A 1SHVA 1KGGA 5FEFA 3F1NA 4EXOA 1MXOA 4MN6A 2NUPC 4EQIA 4FCFA 4ME4A 3OPRA 3ZVWA 3G34A 4B4ZA 3NC8A 4HP4A 5A90A 2VEAA 5DFXA 1YLTA 4EW7A 4DDSA 3BQ8A 4EBLA 4BMWA 3MFDA 3P98A 4PHTA 3K2NA 4MCWA 1YLYA 1KVMA 2XH9A 5IU1A 2R9WA 3BECA 2XDMA 3IBRA 3ZDJA 3BWLA 4JF5A 2PD8A 4DF6A 5HW3A 1Y4OA 2JKFA 3VFFA 3LI8A 4ZTKA 2Y79A 1W5DA 4WBGA 2ZBBA 5AVFA 4B9OA 2X01A 3KYQA 4F94A 2E8IA 2HZ5A 3IS2B 5DTTA 1MKIA 4KG6A 5I94A 2ZLYA 4HHDA 5A93A 1DP8A 3UE3A 4DJ2A 4X69A 3VP4A 1KOUA 4C6YA 3UDFA 4JXSA 2FZ0A 1KDWA 3QP1A 2PBDP 5M19A 3UDXA 1NXYA 1N9NA 1TDGA 2HP9A 2DRWA 4RA7A 3SS4A 2EFUA 3EEHA 1LL9A 3CITA 2D02A 1W79A 2EX9A 2Q9NA 2VV8A 4H6JA 1SKFA 1UWNX 4KZ8A 2KLIA 1VB6A 1ES2A 3BEBA 5KSCA 4GJ4A 3MKFA 3BRMA 4A5RA 3PBSA 1ERMA 3MS6A 4GW9A 1SKOA 3PAGA 2ZQ8A 5CERA 2GJ3A 3C38A 5L8MA 4YINA 1G28A 2OLVA 3IH9A 4HJ6A 4DE3A 4EEPA 4ARZB 5F82A 1STZA 1BYWA 2WGWB 3F1PA 2B18A 3O86A 5L10A 5HPIA 3IXHA 4KG2A 3DW0A 2PU2A 4IVIA 4Y5FA 1PYYA 4IHQA 2E8JA 2P9VA 2ZL1A 1FSYA 5EVIC 2HDUA 3DTIA 3CJMA 3SW1A 2KDKA 2WUQA 3FPVA 1NRFA 5HL6A 2XROA 1MWUA 4OONA 2Y2OA 3G35A 3G32A 3UO9A 4PM6A 2WAEA 4DJ3A 3GQZA 2BASA 3Q81A 4S2OA 5K5BA 2HP5A 2OWJA 2JN7A 4E3JA 5HL1A 4NXEA 1XGIA 1XJ2A 1FILA 3WRZA 2A24B 3PR6A 3F1OB 4R3JA 2ZJ9A 3IX3A 2HPBA 4WZ4A 5DTKA 3OBFA 4JF6A 4KZ5A 3TJZC 5FA7A 3A0VA 2J80A 4RX2A 3OPHA 1OJ5A 4CLCB 1D1JA 1F9IA 4WELA 4YNRA 4QU3A 3K3CA 1XX2A 3CG5A 2W1RA 4L0LA 4LRXC 2Z6DA 3W4OA 2Q9MA 3DBAA 5FI7A 4FH2A 2HF6A 3PBQA 3QNBA 4OP8A 3HLBA 4R70A 3FKWA 1VEUB 4P87A 5FAQA 3OC2A 4M3KA 3VE3A 1ZG4A 1PNEA 5DFYA 3CPTB 4YFMA 2QJ5A 2WGIA 4GB7A 4QWOA 1ZTUA 2XSSA 1YT4A 2D01A 1TS0A 1S4SA 1K57A 1U60A 5KMWA 3KSIA 2ZC5B 5CRFA 3BW6A 4OLGA 3N8SA 3GVBA 5FASA 3QP5A 3TW8A 1KE4A 5EV0A 4DXCA 5AJGA 5TBMB 4I38A 1D06A 4OPZA 5HAIA 2ZC7A 2PU4A 3H82B 5EOEA 1TS6A 5EE8A 3LICA 1XPBA 4GDNA 2QKPA 5GHXA 4G3KA 3HL9A 3D9YA 1BLHA 4KQDA 2Y2PA 3UMDA 4X25A 2VV6A 4GN2A 4HEFA 3T12B 5HWWA 2G7UA 4FUWA 3LIFA 1F98A 4E6WA 1PW8A 2FH5A 1P0ZA 3UPPA 2PR5A 1LSXA 5IS1A 3GECA 3NDGA 5EVLA 3V5MA 1FSWA 3BLSA 3GDIA 4DMZA 3L9KA 4ZAMA 1Z09A 1IEMA 3GTCA 4KZ9A 2WADA 1BLSA 2HJEA 4II7A 2GNXA 4LLOB 3HUNA 4UA7A 4WMCD 3RFBA 3WS2A 4N9LA 4D2OA 3BLMA 1S66L 5CHJA 3W4PA 3IX8A 3VP1A 4NXBA 3SOIA 1EWZA 4U0XA 2Y8HA 1SDEA 1K38A 4YOFA 3BM6A 2FFYA 4LV1A 2V1ZA 2WKQA 4EERA 4WEJA 1TS7A 5EPHA 5EFWA 2EXAA 3LFVA 1JVJA 4S2KA 5CGWA 4JXWA 2JC7A 5FI2A 2JKTI 4LRYC 1MPLA 4EUZA 3KYEA 3GR2A 1OTEA 4R38A 4QPRA 1EI5A 1K54A 2PRFA 3BFEA 4OP5A 1YLZA 1L3LA 5MC7A 5EVEA 5AQ7A 2JKTM 3Q82A 5F6AA 3OCNA 4UA9A 3IF6B 4LFUA 3UB8A 5CGSA 2EX2A 4Q0HA 3P7NA 4U0TA 4NG2A 1LL8A 4EQ1A 5FQ9A 1K56D 1PWGA 3I7JA 4HI4A 2VK3A 4OKPA 1J9MA 3C7VA 2H28A 3G4PA 2GZAA 4P6ZM 4OPYA 4UEYA 3BY8A 2HDQA 3AGFA 3T1SA 4K0WA 1H8MA 5HSQA 4Y3IA 1W63M 2C6WB 1S67L 3H9WA 1OPXA 4EEUA 1W8YA 3T50A 3UB5P 3Q07A 1BUEA 1YLWA 4NEED 4DE0A 5BOHA 1K4EA 3A3FA 3MR0A 3T4OA 4GS9B 4FTXA 1LSVA 3HJKA 4QJGA 3EWKA 5FQMA 2L1MA 3ISGA 1K6RA 4KZBA 2QMIA 1I2SA 3ZCZA 3VFHA 2K31A 1HLUP 3JVUA 4Z9QA 3S7PA 1YKDA 2EFXA 4EETB 3JPUA 2I9VA 4PM5A 3VMAA 4N1XA 4KZ6A 5L2FA 3HLCA 2Y2HA 4WEKA 2ZC6B 4BLMA 3P01A 2NUTC 1WA9A 4S2NA 3V39A 3M2JA 4Y2FA 4GKUA 5GLAA 3ZQ5A 3SH9A 1IYPA 1W8QA 1LLBA 3ZFZA 3NBLA 4I39A 2A49A 3Q7VB 4JPMA 4HBUA 1XFNA 3N4IA 2JHEA 5HAPA 3ZG9B 4PKYG 1K57C 4E3KA 1Y28A 4OQHA 2ZMAA 2XD1A 2M1CA 3ZNYA 3NI9A 1IYSA 1P97A 1N9LA 1LI9A 3LYXA 3FZCA 3MSHA 5AQAA 5CHUA 4LGWA 3EOIA 3KSHA 4XXRA 1PI4A 4QD4A 3R7WA 2A3UA 3M6HA 3MZFA 4Y15A 3EGDC 2Y55A 5A91A 3NOTC 2Z6CA 3IWQA 3V50A 2FFFB 2K2NA 3JVVA 1TD5A 1YMXA 2VGLS 4WMCA 1G5UA 2WZXA 4PM8A 4ZDXA 1ES4A 2OAQ1 3EGXC 4R6LA 4CLCD 1FOFA 1N9BA 3PYPA 5M1AA 3HLGA 2J7VA 3H7WB 4F3LB 5KIZA 2RCXA 5IT5A 4JXVA 4O01A 4MDZA 3S22A 3FPWA 1P9RA 3LEZA 3NULA 3LI9A 3T4KA 1MC0A 2ZQ7A 3LIEA 3E0YA 4R1GA 1H3QA 2XA7S 3IXDA 3PXPA 2IA2A 4WYYA 1S1ZA 2R9XA 4Q0IA 4JBFA 3E4OA 1PWCA 2PAVP 5EM1A 2W3DA 5D3OA 4IUKA 4BL3A 2EWVA 3O87A 3KSGA 3TE8A 2CC1A 3IHBA 1AWIA 1GCEA 2W3FA 3UMEA 4DKIA 2VJWA 3IS2A 4EUVA 4OQ0A 2HGVA 1GSWA 1K56A 3K3DA 1IYOA 1K54C 2ACGA 2IWDA 2OAP1 2Y2JA 1VETB 3L7HA 4E3NA 2G2UA 3KSFA 5G4ZA 1N4OA 1Z6FA 3DWKA 4NETA 4RVAA 5EUAA 2UV0E 3A3IA 4RQ9A 4JGOA 3ZVTA 3T4QA 5CGXA 2J3TD 5FQQA 5EM0A 4GD8A 2ZM8A 3BFFA 1XA7A 3S7OA 5EOOA 5AVEA 2PYRA 3C8CA 1GHPA 2ZOIA 1GSXA 4GD6A 4MBKA 1E4DA 4E6XA 4WZ5A 3WS0A 2DMWA 4IEDA 4Y0OA 4HH2A 3MBZA 2KOIA 1CEGA 2M7UA 4NXFA 5GL9A 4OPRA 5F5YA 3KO6A 2Z2MB 4DE1A 1BLCA 4DN0A 1WYBA 3MQQA 2JBFA 3EEAA 5DJUA 1RCJA 2O0YA 4P0MA 1XGJA 3WWXA 5A8BA 5E2HA 1Y54A 2H10A 4KG5A 5CEBA 4CJNA 3ZNTA 4ETXA 3GV9A 1L0DA 3ZG0A 2VKSA 1H8YA 2EX8A 4GZBA 5E2GA 4ARZA 4KUKA 3G30A 2WGWA 2XR0A 1Q2QA 5TFQA 2Y2QA 2WKHA 2Y2GA 4LCLA 4NK3A 1ES5A 2EX6A 2VGJA 4LRZE 5DF9A 1IOUA 1QMEA 3VV4A 3UNWA 5U47A 4G3VA 2CMNA 3W2ZA 3P09A 5HFOA 3VP0A 3WRTA 4ZJ1A 3MMHA 1XJ3A 1ESIA 4S2NC 1MBLA 1DJBA 5GLDA 1BT5A 1LI0A 3IF5A 2W27A 1BLPA 1ONHA 5GLBA 2V8FA 3G6OA 2ZQDA 1F5MA 3TOIA 4KQQA 1EW0A 2G2WA 3FC7A 3TSGA 1N9OA 2A24A 3F1OA 5HX9A 2PBYA 3NCKA 1PI5A 3ITBA 3LIAA 1C3BA 5J7EA 4WUJA 2GX5A 5AQBA 4BD0A 4OVDA 4HBTA 1I5QA 1BULA 1BSGA 4KZ7A 1V9YA 2ZQAA 4CLCA 2GDNA 3WS4A 3VP3A 4BBVA 1NWZA 2ZM2A 3A0RA 2OWHA 3LR5A 4Q0JA 4NXGA 4X6TA 2PT7A 4I3JA 1K4FA 3LY4A 3U4LP 5CHMA 5GHYA 3PBRA 5TJJA 4GHIB 4X1LA 1YMSA 4OOYA 1JWVA 3TG9A 1CJFA 2XFTA 3HUOA 5CX7A 2J3WA 1VEUA 1UWPX 4I3AA 3MXRA 3CUEA 1YAXA 3LCEA 5HDDA 1EROA 1NLYA 3CPTA 4BQMA 1NJ4A 1ACFA 4UQIS 3MQOA 3V3RA 1TF1A 4HH3A 2EXBA 2LB9A 1OT9A 2V1AA 1TDLA 4KQOA 4HY8A 5F69A 2QZ6A 1PW1A 1ONGA 2VLGA 2Y59A 3BFDA 4UA6A 3NHQA 5FI6A 2YKFA 4IVKA 3R4KA 5TBMA 4BENA 2R78A 1LL5A 4PM9A 3H82A 4ZBEA 3UB9A 5AQ9A 2OOLA 4S2JA 2HDRA 1H8ZA 3S7QA 4LV3A 4BWIA 1A0KA 3QHYA 3OLOA 3IT9A 4QHCA 4JGPA 3TRCA 5CTMA 1AXBA 1JWZA 4S2MA 2Z2LB 2PYPA 1MZUA 3HLDA 2WGVA 3MFXA 3M6BA 3DWZA 1DP9A 3IHAA 4X1MA 2B02A 4IUHA 2J8YA 3OZHA 4DXBA 2VX8A 4LV0A 3NY4A 2ZM0A 5EVIB 2P74A 4WF0A 5DTSA 4FOFA 2X02A 3M2KA 3V3SA 1YSQA 3UY6A 2HV1A 3S4XA 1XJ4A 3Q7ZA 4MNRA 4EESA 3VOYA 5L07A 3CI6A 1CF0A 3NJAA 2JKRI 3SS5A 1E3UD 5HPFA 2O9CA 4Z1WA 1IKGA 3T1RA 1L2SA 3A0SA 3LR3A 4WZ5C 2XD5A 4FH4A 4HNBA 1H5XA 2W1TB 4B88A 5DKKA 5HWTA 2JKRM 4UHUA 1GA0A 3CAXA 4ESPA 1OJGA 4XT2B
chains in the Genus database with same CATH topology
3JVVA 2K2NA 3ULFA 1TD5A 3FPVA 2VGLS 2XROA 5HL6A 2XA7M 2OAQ1 3T4LA 3EGXC 4R6LA 4CLCD 2YKHA 4I3IA 3PYPA 4R3AA 1T19A 4PAUA 4HOIA 4DJ3A 2V9AA 2BASA 3H7WB 4F3LB 5KIZA 4AFIA 1T1CA 5K5BA 1MKMA 5IT5A 4O01A 2OWJA 2JN7A 1P9WA 2VA0A 2EA9A 4MDZA 4NXEA 1XJ2A 3F1NB 2A24B 3FPWA 1P9RA 4G3WA 3PR6A 3F1OB 3D3OA 5C5KA 4K08A 2QWSA 3LI9A 3T4KA 1MC0A 3LIEA 4GHIA 3E0YA 4FSFA 5KSHA 3OBFA 5HD3A 4O0PA 1H3QA 3TJZC 2XA7S 3A0VA 1G6OA 3KX0X 3PXPA 2IA2A 2J80A 5I5LA 1S1ZA 3B42A 4L9EA 4Q0IA 3RTYA 1T18A 1OJ5A 3E4OA 4CLCB 1F9IA 4WELA 4YNRA 4KUOA 2W3DA 3K3CA 4IUKA 2EWVA 3KSGA 2W1RA 4L0LA 4LRXC 2W0NA 3TE8A 2Z6DA 3DBAA 1NLZA 3C30A 2HF6A 3PBQA 2W3FA 3UMEA 3V67A 1JNUA 2VJWA 2ZOHA 1UGUA 3E4QA 3IS2A 4EUVA 2HGVA 1GSWA 3PBTA 4R70A 3K3DA 3OC2A 3LUQA 4GS9A 2OAP1 2KX6A 3VE3A 5HDCA 2P7JA 5DFYA 3PBOA 3KSFA 5G4ZA 2ZMVA 2QJ5A 4RQ9A 4MMNA 4JGOA 3O5YA 3T4QA 1ZTUA 2XSSA 3MXQA 1OT6A 2D01A 2J3TD 4CLCC 2W3EA 4B93A 1V9ZA 1TS0A 1S4SA 4JGQA 3C2WA 3KSIA 2P08A 4LPZA 4WN5A 3BW6A 3S7OA 5AVEA 3TW8A 2PYRA 3C8CA 2L4RA 5AJGA 2ZOIA 3HCYA 4UQIM 5TBMB 4I38A 1GSXA 1D06A 3ZYTA 1S1YA 3H82B 1TS6A 5G4YA 5LBRA 5F68A 2DMWA 3LICA 5HWVA 3U2AA 2QKPA 3BY9A 5HD5A 4HH2A 3CUEC 4MN5A 3T4SA 4G3KA 5J3WA 2KOIA 2PR6A 4KQDA 2M7UA 3UMDA 3T4TA 2L0WA 4NXFA 1T1AA 2VV6A 5F5YA 3KO6A 1OTDA 2QJ7A 3D72A 4M4XA 4DN0A 3B33A 5HWWA 1ZHHB 2G7UA 3MQQA 3LIFA 2P04A 3EEAA 5DJUA 5HDSA 2O0YA 3FG8A 1F98A 4NKPA 2FH5A 1P0ZA 2M7VA 5A8BA 2V0UA 2PR5A 1LSXA 4L9GA 2A2LA 4CQHA 5IS1A 3GECA 4ETXA 1S4RA 2V1BA 4IJGA 3LR4A 4H6JB 2VKSA 3B47A 3E98A 3EQUA 3GDIA 3BQAA 4ARZA 4DMZA 1T1BA 4KUKA 3RH8B 3MQ0A 5DKLA 4WLAA 2INWA 2PDRA 5J4EA 1X0OA 2O9BA 2W1TA 4LRZE 2XRNA 4HJ3A 5DF9A 2V0WA 2HJEA 4II7A 2GNXA 3E4PA 4LLOB 3RFBA 1IOUA 3VV4A 4YWZA 3T4JA 1GSVA 3KYZA 1S66L 4NXBA 2J3TC 3IBJA 4G3VA 2CMNA 3W2ZA 2MJ6A 3PBNA 4XT2A 1OTBA 1W63Q 4PKYA 2Y8HA 3MMHA 3F1PB 4EU0A 1XJ3A 4YOFA 4BBTA 5HZHA 2W27A 2VV7A 2WKQA 4EERA 3H7WA 5FL3A 4WEJA 2K7SA 1TS7A 2O9AA 5EFWA 3LFVA 4F3LA 3G6OA 2LB5A 3R7WB 1F5MA 4BJPA 2JKTI 4LRYC 1EW0A 1YSPA 3UB7A 3OOVA 1OTEA 3FC7A 4R38A 2QYBA 4QPRA 1DP6A 2O99A 1N9OA 3F1NA 2A24A 3NOUC 4EXOA 3F1OA 4MN6A 2NUPC 3LIAA 5J7EA 1XFQA 5MC7A 4WUJA 5DJTA 4ME4A 2JKTM 4HP4A 2VEAA 5F6AA 2GX5A 3OCNA 4GLQA 5DFXA 2WKRA 4EW7A 3UB8A 1V9YA 3BQ8A 4BMWA 2VZWA 4CLCA 4Q0HA 3UB6A 3P7NA 2WKPA 1LL8A 4PHTA 4BBVA 3K2NA 4MCWA 4EQ1A 1NWZA 3A0RA 2OWHA 3LR5A 4HQAA 4HI4A 4Q0JA 5IU1A 4NXGA 2PT7A 4I3JA 1VHMA 1XJ6A 3PBRA 5TJJA 4GHIB 3IBRA 2H28A 1DRMA 3BWLA 5CX7A 3LR0A 2GZAA 2PD8A 4P6ZM 2J3WA 2PD7A 4UEYA 3BY8A 2W3GA 1UWPX 3MJQA 4I3AA 3HJIA 4L9FA 3ICYA 3CUEA 1YAXA 5HDDA 3LI8A 1NLYA 2Y79A 1ODVA 1H8MA 2ZBBA 5HSQA 4Y3IA 1W63M 4UQIS 1S67L 3H9WA 1OPXA 3MQOA 4EEUA 1IFQA 4HIAA 5AVFA 4E04A 1TF1A 4B9OA 3T50A 4HH3A 3KYQA 2LB9A 3PHYA 4I5SA 3LIBA 1OT9A 2V1AA 4KQOA 4HY8A 4NEED 3IS2B 5F69A 2ZMFA 4HJ4A 3NOPC 2QHKA 2EWWA 2VLGA 3MR0A 3T4OA 3MF0A 4GS9B 3S7NA 3NHQA 4P6ZS 2YKFA 3R4KA 4CLCE 5TBMA 3OCLA 1LSVA 3HJKA 4HHDA 2R78A 3EWKA 3EQVA 2L1MA 1DP8A 3UE3A 3H82A 3UB9A 4DJ2A 2OOLA 3S7QA 4BWIA 4BBUA 3VE4A 1KOUA 1D7EA 2K31A 1OTAA 3OLOA 3JVUA 2FZ0A 1OTIA 3S7PA 4JGPA 1YKDA 3TRCA 4EETB 2I9VA 3VOLA 1N9NA 4MN7A 2PYPA 4JGRA 1MZUA 1TS8A 3UE6A 4WEKA 3LIDA 3P01A 1LSWA 2NUTC 3MFXA 1WA9A 4Y2FA 3EEHA 3CITA 1DP9A 2D02A 2PHYA 2B02A 4IUHA 2VV8A 3ZQ5A 4H6JA 1UWNX 2VX8A 3CLOA 2KLIA 4O8GA 1VB6A 4HP9A 4I39A 1LT0A 4WF0A 4GJ4A 4FOFA 1XFNA 3PBSA 2JHEA 4GW9A 4PKYG 1YSQA 4WL9A 1Y28A 2HV1A 2GJ3A 1XJ4A 3C38A 5L8MA 2M1CA 4EESA 2VGLM 4ETZA 1G28A 3CI6A 3NJAA 2JKRI 2HJ9C 4HJ6A 1P97A 2O9CA 4Z1WA 4EEPA 5HPFA 1N9LA 1NRJA 4ARZB 3CWFA 1STZA 3A0SA 1BYWA 3F1PA 3LR3A 2B18A 3LYXA 5HPIA 4HNBA 2W1TB 3EOIA 3KSHA 4Y5FA 5DKKA 5HWTA 4IHQA 4OOLA 3R7WA 4GCZA 2JKRM 3BJNA 3EGDC 2W3HA 3CAXA 3NOTC 2Z6CA 4OOMA 1OJGA 4XT2B 4ZRRA 3SW1A 2KDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLC E;  4CLC D;  4CLC C;  4NKP A;  3FPV A;  3FPW A;  4BMW A;  4CLC B;  4CLC A;  2A2L A;  5CX7 A; 
#chains in the Genus database with same CATH topology
 3BYD A;  3ULF A;  4KZ3 A;  2YKH A;  5CEC A;  1T19 A;  4PAU A;  4ID4 A;  4QB8 A;  2V9A A;  1G6A A;  1K55 A;  3IF6 A;  1QMF A;  3SH7 A;  1MKM A;  4DE2 A;  1DY6 A;  1WYC A;  4R3B A;  1P9W A;  2VA0 A;  2H0Y A;  2AVX A;  1YPR A;  5DF8 A;  3F1N B;  1L0G A;  3T1Q B;  5C5K A;  1K25 A;  5GLC A;  2QWS A;  2X71 A;  3ZHH A;  4WM9 A;  2H5S A;  5F83 A;  5GHZ A;  5KSH A;  5HD3 A;  1FCN A;  1G6O A;  4R0Q A;  2I72 A;  3C5A A;  3DTE A;  4R23 A;  3WS5 A;  4L9E A;  3RTY A;  2Q0O A;  1CK3 A;  3BFC A;  1JTD A;  5TGF A;  2Y4A A;  5CXW A;  4S2I A;  1ZG6 A;  2W0N A;  4LCM A;  1NLZ A;  1L0E A;  3C30 A;  1BZA A;  3V67 A;  3MZD A;  2ZOH A;  3E4Q A;  3FKV A;  3PBT A;  3SH8 A;  3DTK A;  3LUQ A;  1KE0 A;  4GS9 A;  3LGO A;  2WAF A;  1CI8 A;  1FIK A;  1PIO A;  2P7J A;  2XFS A;  1TEM A;  4Y0T A;  5FAT A;  2ZMV A;  3HLE A;  4KZA A;  3QP6 A;  2WK0 A;  5FSR A;  2C5W B;  3S1Y A;  3MXQ A;  5DF7 A;  1NZU A;  4QY6 A;  4CLC C;  1O7E A;  2W3E A;  4B93 A;  1V9Z A;  4R4S A;  2V20 A;  1H0M A;  4WN5 A;  1CEF A;  1L0F A;  4BL2 A;  3LEQ A;  5CTN A;  1PZO A;  3HCY A;  4H8R A;  4UQI M;  1RGY A;  1SZV A;  1S1Y A;  4QY5 A;  1KDS A;  3BY9 A;  5HD5 A;  1GHM A;  4E3I A;  3CUE C;  3T4S A;  3HUM A;  3W8K A;  3G2Y A;  3GSG A;  2PR6 A;  1DJC A;  3C7U A;  1S0W A;  1T1A A;  1OTD A;  5HAQ A;  5FQK A;  3Q7V A;  1OME A;  4X53 A;  4C75 A;  3B33 A;  4K0X A;  4RX3 A;  2IWB A;  2P04 A;  5IHV A;  1GHI A;  3FG8 A;  3OPL A;  4NKP A;  2M7V A;  2V0U A;  3SS3 A;  2A2L A;  4CQH A;  1S4R A;  3N8R A;  3O3V A;  2J9O A;  4IJG A;  5FAP A;  3LR4 A;  4H6J B;  3B47 A;  3IWO A;  2Y2M A;  1T1B A;  3PTE A;  3NDE A;  3RH8 B;  5M18 A;  4LV2 A;  4WLA A;  1S6R A;  2PDR A;  2WZZ A;  2O9B A;  1G68 A;  3N7W A;  4K91 A;  2V0W A;  1HD8 A;  4MEZ A;  3E4P A;  1SKO B;  4YWZ A;  3T4J A;  5F1F A;  1GSV A;  3VOZ A;  2J3T C;  3IBJ A;  1I2W A;  2MJ6 A;  3PBN A;  1OTB A;  4EWF A;  1MY8 A;  4PKY A;  2XK1 A;  3NEC A;  4OQG A;  3F1P B;  4IBR A;  1IKI A;  5HZH A;  2VV7 A;  1E3U A;  1BTL A;  3H7W A;  2K7S A;  4F3L A;  2P9V B;  2ZL1 B;  1YSP A;  4JXG A;  3OOV A;  3RXW A;  2HDS A;  2QYB A;  2O99 A;  3NOU C;  1ZKJ A;  4LEN A;  3MZE A;  3UE1 A;  1W7F A;  3GRJ A;  1XFQ A;  3UN7 A;  5DJT A;  1WE4 A;  1YLJ A;  4GLQ A;  2WKR A;  3AGD A;  1PRQ A;  2VZW A;  3G31 A;  4OQI A;  4XUZ A;  4PPR A;  3UB6 A;  1M40 A;  2WKI A;  3IX4 A;  2WKP A;  2BLS A;  4HQA A;  2XGN A;  3HRE A;  1VHM A;  1XJ6 A;  3NIA A;  1DRM A;  4EBP A;  3LR0 A;  2PD7 A;  1ESU A;  3MJQ A;  4L9F A;  3HJI A;  3ICY A;  1VET A;  1ALQ A;  1ODV A;  1SDN A;  3C4P A;  4FD8 A;  5TR7 A;  1NZO A;  1K55 C;  1IFQ A;  4HIA A;  4E04 A;  3A3D A;  3IF6 C;  3FV7 A;  3PHY A;  4I5S A;  3LIB A;  1HTZ A;  1KGF A;  1MWR A;  2ZMF A;  4HJ4 A;  2BTF P;  3NOP C;  1FCM A;  1NY0 A;  2QHK A;  2EWW A;  4JF4 A;  3MF0 A;  3S7N A;  4DRT A;  4JKT A;  2Y2L A;  4P6Z S;  4CLC E;  3OCL A;  4Y0U A;  3EQV A;  4Q8I A;  3IH8 A;  2OLU A;  5EVI D;  4N9K A;  3JYI A;  3AGE A;  4BBU A;  3VE4 A;  2Y2K A;  1HVB A;  1D7E A;  1OTA A;  4MBF A;  1OTI A;  2ZQ9 A;  2ZC3 B;  3VOL A;  4OPQ A;  4ZJ2 A;  2WKE A;  4MN7 A;  4JGR A;  2H0T A;  1FR1 A;  1TS8 A;  3UE6 A;  3LO7 A;  3A3E A;  3LID A;  2J9P A;  1LSW A;  2B5R A;  4KEN B;  1PZP A;  1KVL A;  2PHY A;  5E2E A;  2DCF A;  2ZC4 B;  5JYP A;  5A92 A;  3CLO A;  4O8G A;  2JCH A;  4HP9 A;  5L09 A;  1MWT A;  1LT0 A;  3PAE A;  5DVA A;  3IQA A;  1LHY A;  3QNC A;  2WYX A;  3CHW P;  2VGK A;  3E2K A;  2Y2I A;  2HP6 A;  4WL9 A;  3HBR A;  3FYZ A;  3CZD A;  5J8X A;  5KZH A;  4E3O A;  2VGL M;  4KQR A;  4ETZ A;  2HJ9 C;  3VSL A;  1GA9 A;  3GMW A;  1NRJ A;  3CWF A;  1FR6 A;  2Y2N A;  1YLP A;  1XP4 A;  2XQZ A;  1J3W A;  3G2Z A;  4E3M A;  3LY3 A;  2XF3 A;  1KE3 A;  1KGE A;  3ZG5 A;  2RL3 A;  4OOL A;  4X56 A;  4GCZ A;  3BJN A;  3T1X A;  4CPK A;  1HZO A;  2V2F F;  3OPP A;  1FQG A;  2W3H A;  4PMA A;  3RJU A;  3MKE A;  3D4F A;  1IEL A;  4OOM A;  4ZRR A;  3N8L A;  2W3G A;  4D60 A;  4N1H A;  3IWI A;  3BFG A;  4E3L A;  4GDB A;  1PWD A;  2XA7 M;  3T4L A;  1JWP A;  4I3I A;  4R3A A;  1DJA A;  4HOI A;  1RGZ A;  1RP5 A;  4AFI A;  1T1C A;  2JE5 A;  1F2K A;  1FCO A;  2EA9 A;  3HLW A;  1TVF A;  4X55 A;  4G3W A;  1YM1 A;  3D3O A;  4K08 A;  5FDS A;  4GHI A;  4BD1 A;  4FSF A;  4P6B A;  4JLF A;  4O0P A;  5FAO A;  4UAA A;  1K0K A;  2DNS A;  3CMZ A;  3KX0 X;  1E25 A;  3DTM A;  5I5L A;  1PFL A;  4R4R A;  3B42 A;  4B4X A;  1T18 A;  4KUO A;  3HVF A;  3N6I A;  3UE0 A;  3QP2 A;  3VP2 A;  1M6K A;  4Y7P A;  3A3J A;  4GNU A;  4S2P A;  2UWX A;  5JYO A;  1JTG A;  2JKG A;  2ZD8 A;  5FQI A;  1JNU A;  1CI9 A;  3RXX A;  3UDI A;  2XEP A;  1UGU A;  1YQS A;  3HLF A;  2KX6 A;  5HAR A;  4KZ4 A;  1ZC2 A;  2BG1 A;  1CQA A;  5HDC A;  3PBO A;  1VM1 A;  4MMN A;  3O5Y A;  1OT6 A;  3VSK A;  4PM7 A;  1ERQ A;  3ZG7 B;  4JGQ A;  3C2W A;  3WS1 A;  2P08 A;  4LPZ A;  4XUX A;  4IBX A;  1K6S A;  2L4R A;  1O07 A;  3DAV A;  3QP8 A;  5E43 A;  4GOG A;  3ZYT A;  3ITA A;  4HES A;  4O7D A;  3UPO A;  5G4Y A;  5LBR A;  5F68 A;  2ZQC A;  5E2F A;  5HWV A;  3U2A A;  4MN5 A;  5J3W A;  3Q1F A;  4MBH A;  3T4T A;  2L0W A;  5EVI A;  4EV4 A;  1ES3 A;  1SCW A;  3ZGA B;  4ZJ3 A;  2QJ7 A;  5FEG A;  3D72 A;  4M4X A;  1NYM A;  5EEC A;  1ZHH B;  2IWC A;  3SZT A;  4U3T A;  3C4O A;  5HDS A;  4C3Q A;  5FDH A;  4N92 A;  3FWL A;  4L9G A;  1MWS A;  3W4Q A;  4S2L A;  2V1B A;  4X68 A;  2Y91 A;  2V8C A;  2OSU A;  3UPN A;  3E98 A;  3EQU A;  3BQA A;  5FQJ A;  1XKZ A;  2QPN A;  3MQ0 A;  4P85 A;  5DKL A;  4OH0 A;  4MLL A;  3ZG8 B;  1Q2P A;  2INW A;  5F1G A;  4EBN A;  5J4E A;  1X0O A;  2W1T A;  1XXM A;  4Y17 A;  2XRN A;  5G18 A;  4HJ3 A;  1VQQ A;  1XA1 A;  1NYY A;  3QP4 A;  3KYZ A;  3O88 A;  4RYE A;  3IXB A;  5CED A;  4XT2 A;  2XLN A;  1W63 Q;  4EU0 A;  3B3X A;  4Y13 A;  4OLD A;  4DDY A;  2B95 A;  4BBT A;  3MXS A;  2OV5 A;  3E2L A;  5FL3 A;  2O9A A;  2LB5 A;  3R7W B;  4BJP A;  3IXG A;  1IYQ A;  3UB7 A;  1DP6 A;  1SHV A;  1KGG A;  5FEF A;  3F1N A;  4EXO A;  1MXO A;  4MN6 A;  2NUP C;  4EQI A;  4FCF A;  4ME4 A;  3OPR A;  3ZVW A;  3G34 A;  4B4Z A;  3NC8 A;  4HP4 A;  5A90 A;  2VEA A;  5DFX A;  1YLT A;  4EW7 A;  4DDS A;  3BQ8 A;  4EBL A;  4BMW A;  3MFD A;  3P98 A;  4PHT A;  3K2N A;  4MCW A;  1YLY A;  1KVM A;  2XH9 A;  5IU1 A;  2R9W A;  3BEC A;  2XDM A;  3IBR A;  3ZDJ A;  3BWL A;  4JF5 A;  2PD8 A;  4DF6 A;  5HW3 A;  1Y4O A;  2JKF A;  3VFF A;  3LI8 A;  4ZTK A;  2Y79 A;  1W5D A;  4WBG A;  2ZBB A;  5AVF A;  4B9O A;  2X01 A;  3KYQ A;  4F94 A;  2E8I A;  2HZ5 A;  3IS2 B;  5DTT A;  1MKI A;  4KG6 A;  5I94 A;  2ZLY A;  4HHD A;  5A93 A;  1DP8 A;  3UE3 A;  4DJ2 A;  4X69 A;  3VP4 A;  1KOU A;  4C6Y A;  3UDF A;  4JXS A;  2FZ0 A;  1KDW A;  3QP1 A;  2PBD P;  5M19 A;  3UDX A;  1NXY A;  1N9N A;  1TDG A;  2HP9 A;  2DRW A;  4RA7 A;  3SS4 A;  2EFU A;  3EEH A;  1LL9 A;  3CIT A;  2D02 A;  1W79 A;  2EX9 A;  2Q9N A;  2VV8 A;  4H6J A;  1SKF A;  1UWN X;  4KZ8 A;  2KLI A;  1VB6 A;  1ES2 A;  3BEB A;  5KSC A;  4GJ4 A;  3MKF A;  3BRM A;  4A5R A;  3PBS A;  1ERM A;  3MS6 A;  4GW9 A;  1SKO A;  3PAG A;  2ZQ8 A;  5CER A;  2GJ3 A;  3C38 A;  5L8M A;  4YIN A;  1G28 A;  2OLV A;  3IH9 A;  4HJ6 A;  4DE3 A;  4EEP A;  4ARZ B;  5F82 A;  1STZ A;  1BYW A;  2WGW B;  3F1P A;  2B18 A;  3O86 A;  5L10 A;  5HPI A;  3IXH A;  4KG2 A;  3DW0 A;  2PU2 A;  4IVI A;  4Y5F A;  1PYY A;  4IHQ A;  2E8J A;  2P9V A;  2ZL1 A;  1FSY A;  5EVI C;  2HDU A;  3DTI A;  3CJM A;  3SW1 A;  2KDK A;  2WUQ A;  3FPV A;  1NRF A;  5HL6 A;  2XRO A;  1MWU A;  4OON A;  2Y2O A;  3G35 A;  3G32 A;  3UO9 A;  4PM6 A;  2WAE A;  4DJ3 A;  3GQZ A;  2BAS A;  3Q81 A;  4S2O A;  5K5B A;  2HP5 A;  2OWJ A;  2JN7 A;  4E3J A;  5HL1 A;  4NXE A;  1XGI A;  1XJ2 A;  1FIL A;  3WRZ A;  2A24 B;  3PR6 A;  3F1O B;  4R3J A;  2ZJ9 A;  3IX3 A;  2HPB A;  4WZ4 A;  5DTK A;  3OBF A;  4JF6 A;  4KZ5 A;  3TJZ C;  5FA7 A;  3A0V A;  2J80 A;  4RX2 A;  3OPH A;  1OJ5 A;  4CLC B;  1D1J A;  1F9I A;  4WEL A;  4YNR A;  4QU3 A;  3K3C A;  1XX2 A;  3CG5 A;  2W1R A;  4L0L A;  4LRX C;  2Z6D A;  3W4O A;  2Q9M A;  3DBA A;  5FI7 A;  4FH2 A;  2HF6 A;  3PBQ A;  3QNB A;  4OP8 A;  3HLB A;  4R70 A;  3FKW A;  1VEU B;  4P87 A;  5FAQ A;  3OC2 A;  4M3K A;  3VE3 A;  1ZG4 A;  1PNE A;  5DFY A;  3CPT B;  4YFM A;  2QJ5 A;  2WGI A;  4GB7 A;  4QWO A;  1ZTU A;  2XSS A;  1YT4 A;  2D01 A;  1TS0 A;  1S4S A;  1K57 A;  1U60 A;  5KMW A;  3KSI A;  2ZC5 B;  5CRF A;  3BW6 A;  4OLG A;  3N8S A;  3GVB A;  5FAS A;  3QP5 A;  3TW8 A;  1KE4 A;  5EV0 A;  4DXC A;  5AJG A;  5TBM B;  4I38 A;  1D06 A;  4OPZ A;  5HAI A;  2ZC7 A;  2PU4 A;  3H82 B;  5EOE A;  1TS6 A;  5EE8 A;  3LIC A;  1XPB A;  4GDN A;  2QKP A;  5GHX A;  4G3K A;  3HL9 A;  3D9Y A;  1BLH A;  4KQD A;  2Y2P A;  3UMD A;  4X25 A;  2VV6 A;  4GN2 A;  4HEF A;  3T12 B;  5HWW A;  2G7U A;  4FUW A;  3LIF A;  1F98 A;  4E6W A;  1PW8 A;  2FH5 A;  1P0Z A;  3UPP A;  2PR5 A;  1LSX A;  5IS1 A;  3GEC A;  3NDG A;  5EVL A;  3V5M A;  1FSW A;  3BLS A;  3GDI A;  4DMZ A;  3L9K A;  4ZAM A;  1Z09 A;  1IEM A;  3GTC A;  4KZ9 A;  2WAD A;  1BLS A;  2HJE A;  4II7 A;  2GNX A;  4LLO B;  3HUN A;  4UA7 A;  4WMC D;  3RFB A;  3WS2 A;  4N9L A;  4D2O A;  3BLM A;  1S66 L;  5CHJ A;  3W4P A;  3IX8 A;  3VP1 A;  4NXB A;  3SOI A;  1EWZ A;  4U0X A;  2Y8H A;  1SDE A;  1K38 A;  4YOF A;  3BM6 A;  2FFY A;  4LV1 A;  2V1Z A;  2WKQ A;  4EER A;  4WEJ A;  1TS7 A;  5EPH A;  5EFW A;  2EXA A;  3LFV A;  1JVJ A;  4S2K A;  5CGW A;  4JXW A;  2JC7 A;  5FI2 A;  2JKT I;  4LRY C;  1MPL A;  4EUZ A;  3KYE A;  3GR2 A;  1OTE A;  4R38 A;  4QPR A;  1EI5 A;  1K54 A;  2PRF A;  3BFE A;  4OP5 A;  1YLZ A;  1L3L A;  5MC7 A;  5EVE A;  5AQ7 A;  2JKT M;  3Q82 A;  5F6A A;  3OCN A;  4UA9 A;  3IF6 B;  4LFU A;  3UB8 A;  5CGS A;  2EX2 A;  4Q0H A;  3P7N A;  4U0T A;  4NG2 A;  1LL8 A;  4EQ1 A;  5FQ9 A;  1K56 D;  1PWG A;  3I7J A;  4HI4 A;  2VK3 A;  4OKP A;  1J9M A;  3C7V A;  2H28 A;  3G4P A;  2GZA A;  4P6Z M;  4OPY A;  4UEY A;  3BY8 A;  2HDQ A;  3AGF A;  3T1S A;  4K0W A;  1H8M A;  5HSQ A;  4Y3I A;  1W63 M;  2C6W B;  1S67 L;  3H9W A;  1OPX A;  4EEU A;  1W8Y A;  3T50 A;  3UB5 P;  3Q07 A;  1BUE A;  1YLW A;  4NEE D;  4DE0 A;  5BOH A;  1K4E A;  3A3F A;  3MR0 A;  3T4O A;  4GS9 B;  4FTX A;  1LSV A;  3HJK A;  4QJG A;  3EWK A;  5FQM A;  2L1M A;  3ISG A;  1K6R A;  4KZB A;  2QMI A;  1I2S A;  3ZCZ A;  3VFH A;  2K31 A;  1HLU P;  3JVU A;  4Z9Q A;  3S7P A;  1YKD A;  2EFX A;  4EET B;  3JPU A;  2I9V A;  4PM5 A;  3VMA A;  4N1X A;  4KZ6 A;  5L2F A;  3HLC A;  2Y2H A;  4WEK A;  2ZC6 B;  4BLM A;  3P01 A;  2NUT C;  1WA9 A;  4S2N A;  3V39 A;  3M2J A;  4Y2F A;  4GKU A;  5GLA A;  3ZQ5 A;  3SH9 A;  1IYP A;  1W8Q A;  1LLB A;  3ZFZ A;  3NBL A;  4I39 A;  2A49 A;  3Q7V B;  4JPM A;  4HBU A;  1XFN A;  3N4I A;  2JHE A;  5HAP A;  3ZG9 B;  4PKY G;  1K57 C;  4E3K A;  1Y28 A;  4OQH A;  2ZMA A;  2XD1 A;  2M1C A;  3ZNY A;  3NI9 A;  1IYS A;  1P97 A;  1N9L A;  1LI9 A;  3LYX A;  3FZC A;  3MSH A;  5AQA A;  5CHU A;  4LGW A;  3EOI A;  3KSH A;  4XXR A;  1PI4 A;  4QD4 A;  3R7W A;  2A3U A;  3M6H A;  3MZF A;  4Y15 A;  3EGD C;  2Y55 A;  5A91 A;  3NOT C;  2Z6C A;  3IWQ A;  3V50 A;  2FFF B;  2K2N A;  3JVV A;  1TD5 A;  1YMX A;  2VGL S;  4WMC A;  1G5U A;  2WZX A;  4PM8 A;  4ZDX A;  1ES4 A;  2OAQ 1;  3EGX C;  4R6L A;  4CLC D;  1FOF A;  1N9B A;  3PYP A;  5M1A A;  3HLG A;  2J7V A;  3H7W B;  4F3L B;  5KIZ A;  2RCX A;  5IT5 A;  4JXV A;  4O01 A;  4MDZ A;  3S22 A;  3FPW A;  1P9R A;  3LEZ A;  3NUL A;  3LI9 A;  3T4K A;  1MC0 A;  2ZQ7 A;  3LIE A;  3E0Y A;  4R1G A;  1H3Q A;  2XA7 S;  3IXD A;  3PXP A;  2IA2 A;  4WYY A;  1S1Z A;  2R9X A;  4Q0I A;  4JBF A;  3E4O A;  1PWC A;  2PAV P;  5EM1 A;  2W3D A;  5D3O A;  4IUK A;  4BL3 A;  2EWV A;  3O87 A;  3KSG A;  3TE8 A;  2CC1 A;  3IHB A;  1AWI A;  1GCE A;  2W3F A;  3UME A;  4DKI A;  2VJW A;  3IS2 A;  4EUV A;  4OQ0 A;  2HGV A;  1GSW A;  1K56 A;  3K3D A;  1IYO A;  1K54 C;  2ACG A;  2IWD A;  2OAP 1;  2Y2J A;  1VET B;  3L7H A;  4E3N A;  2G2U A;  3KSF A;  5G4Z A;  1N4O A;  1Z6F A;  3DWK A;  4NET A;  4RVA A;  5EUA A;  2UV0 E;  3A3I A;  4RQ9 A;  4JGO A;  3ZVT A;  3T4Q A;  5CGX A;  2J3T D;  5FQQ A;  5EM0 A;  4GD8 A;  2ZM8 A;  3BFF A;  1XA7 A;  3S7O A;  5EOO A;  5AVE A;  2PYR A;  3C8C A;  1GHP A;  2ZOI A;  1GSX A;  4GD6 A;  4MBK A;  1E4D A;  4E6X A;  4WZ5 A;  3WS0 A;  2DMW A;  4IED A;  4Y0O A;  4HH2 A;  3MBZ A;  2KOI A;  1CEG A;  2M7U A;  4NXF A;  5GL9 A;  4OPR A;  5F5Y A;  3KO6 A;  2Z2M B;  4DE1 A;  1BLC A;  4DN0 A;  1WYB A;  3MQQ A;  2JBF A;  3EEA A;  5DJU A;  1RCJ A;  2O0Y A;  4P0M A;  1XGJ A;  3WWX A;  5A8B A;  5E2H A;  1Y54 A;  2H10 A;  4KG5 A;  5CEB A;  4CJN A;  3ZNT A;  4ETX A;  3GV9 A;  1L0D A;  3ZG0 A;  2VKS A;  1H8Y A;  2EX8 A;  4GZB A;  5E2G A;  4ARZ A;  4KUK A;  3G30 A;  2WGW A;  2XR0 A;  1Q2Q A;  5TFQ A;  2Y2Q A;  2WKH A;  2Y2G A;  4LCL A;  4NK3 A;  1ES5 A;  2EX6 A;  2VGJ A;  4LRZ E;  5DF9 A;  1IOU A;  1QME A;  3VV4 A;  3UNW A;  5U47 A;  4G3V A;  2CMN A;  3W2Z A;  3P09 A;  5HFO A;  3VP0 A;  3WRT A;  4ZJ1 A;  3MMH A;  1XJ3 A;  1ESI A;  4S2N C;  1MBL A;  1DJB A;  5GLD A;  1BT5 A;  1LI0 A;  3IF5 A;  2W27 A;  1BLP A;  1ONH A;  5GLB A;  2V8F A;  3G6O A;  2ZQD A;  1F5M A;  3TOI A;  4KQQ A;  1EW0 A;  2G2W A;  3FC7 A;  3TSG A;  1N9O A;  2A24 A;  3F1O A;  5HX9 A;  2PBY A;  3NCK A;  1PI5 A;  3ITB A;  3LIA A;  1C3B A;  5J7E A;  4WUJ A;  2GX5 A;  5AQB A;  4BD0 A;  4OVD A;  4HBT A;  1I5Q A;  1BUL A;  1BSG A;  4KZ7 A;  1V9Y A;  2ZQA A;  4CLC A;  2GDN A;  3WS4 A;  3VP3 A;  4BBV A;  1NWZ A;  2ZM2 A;  3A0R A;  2OWH A;  3LR5 A;  4Q0J A;  4NXG A;  4X6T A;  2PT7 A;  4I3J A;  1K4F A;  3LY4 A;  3U4L P;  5CHM A;  5GHY A;  3PBR A;  5TJJ A;  4GHI B;  4X1L A;  1YMS A;  4OOY A;  1JWV A;  3TG9 A;  1CJF A;  2XFT A;  3HUO A;  5CX7 A;  2J3W A;  1VEU A;  1UWP X;  4I3A A;  3MXR A;  3CUE A;  1YAX A;  3LCE A;  5HDD A;  1ERO A;  1NLY A;  3CPT A;  4BQM A;  1NJ4 A;  1ACF A;  4UQI S;  3MQO A;  3V3R A;  1TF1 A;  4HH3 A;  2EXB A;  2LB9 A;  1OT9 A;  2V1A A;  1TDL A;  4KQO A;  4HY8 A;  5F69 A;  2QZ6 A;  1PW1 A;  1ONG A;  2VLG A;  2Y59 A;  3BFD A;  4UA6 A;  3NHQ A;  5FI6 A;  2YKF A;  4IVK A;  3R4K A;  5TBM A;  4BEN A;  2R78 A;  1LL5 A;  4PM9 A;  3H82 A;  4ZBE A;  3UB9 A;  5AQ9 A;  2OOL A;  4S2J A;  2HDR A;  1H8Z A;  3S7Q A;  4LV3 A;  4BWI A;  1A0K A;  3QHY A;  3OLO A;  3IT9 A;  4QHC A;  4JGP A;  3TRC A;  5CTM A;  1AXB A;  1JWZ A;  4S2M A;  2Z2L B;  2PYP A;  1MZU A;  3HLD A;  2WGV A;  3MFX A;  3M6B A;  3DWZ A;  1DP9 A;  3IHA A;  4X1M A;  2B02 A;  4IUH A;  2J8Y A;  3OZH A;  4DXB A;  2VX8 A;  4LV0 A;  3NY4 A;  2ZM0 A;  5EVI B;  2P74 A;  4WF0 A;  5DTS A;  4FOF A;  2X02 A;  3M2K A;  3V3S A;  1YSQ A;  3UY6 A;  2HV1 A;  3S4X A;  1XJ4 A;  3Q7Z A;  4MNR A;  4EES A;  3VOY A;  5L07 A;  3CI6 A;  1CF0 A;  3NJA A;  2JKR I;  3SS5 A;  1E3U D;  5HPF A;  2O9C A;  4Z1W A;  1IKG A;  3T1R A;  1L2S A;  3A0S A;  3LR3 A;  4WZ5 C;  2XD5 A;  4FH4 A;  4HNB A;  1H5X A;  2W1T B;  4B88 A;  5DKK A;  5HWT A;  2JKR M;  4UHU A;  1GA0 A;  3CAX A;  4ESP A;  1OJG A;  4XT2 B; 
#chains in the Genus database with same CATH homology
 3JVV A;  2K2N A;  3ULF A;  1TD5 A;  3FPV A;  2VGL S;  2XRO A;  5HL6 A;  2XA7 M;  2OAQ 1;  3T4L A;  3EGX C;  4R6L A;  4CLC D;  2YKH A;  4I3I A;  3PYP A;  4R3A A;  1T19 A;  4PAU A;  4HOI A;  4DJ3 A;  2V9A A;  2BAS A;  3H7W B;  4F3L B;  5KIZ A;  4AFI A;  1T1C A;  5K5B A;  1MKM A;  5IT5 A;  4O01 A;  2OWJ A;  2JN7 A;  1P9W A;  2VA0 A;  2EA9 A;  4MDZ A;  4NXE A;  1XJ2 A;  3F1N B;  2A24 B;  3FPW A;  1P9R A;  4G3W A;  3PR6 A;  3F1O B;  3D3O A;  5C5K A;  4K08 A;  2QWS A;  3LI9 A;  3T4K A;  1MC0 A;  3LIE A;  4GHI A;  3E0Y A;  4FSF A;  5KSH A;  3OBF A;  5HD3 A;  4O0P A;  1H3Q A;  3TJZ C;  2XA7 S;  3A0V A;  1G6O A;  3KX0 X;  3PXP A;  2IA2 A;  2J80 A;  5I5L A;  1S1Z A;  3B42 A;  4L9E A;  4Q0I A;  3RTY A;  1T18 A;  1OJ5 A;  3E4O A;  4CLC B;  1F9I A;  4WEL A;  4YNR A;  4KUO A;  2W3D A;  3K3C A;  4IUK A;  2EWV A;  3KSG A;  2W1R A;  4L0L A;  4LRX C;  2W0N A;  3TE8 A;  2Z6D A;  3DBA A;  1NLZ A;  3C30 A;  2HF6 A;  3PBQ A;  2W3F A;  3UME A;  3V67 A;  1JNU A;  2VJW A;  2ZOH A;  1UGU A;  3E4Q A;  3IS2 A;  4EUV A;  2HGV A;  1GSW A;  3PBT A;  4R70 A;  3K3D A;  3OC2 A;  3LUQ A;  4GS9 A;  2OAP 1;  2KX6 A;  3VE3 A;  5HDC A;  2P7J A;  5DFY A;  3PBO A;  3KSF A;  5G4Z A;  2ZMV A;  2QJ5 A;  4RQ9 A;  4MMN A;  4JGO A;  3O5Y A;  3T4Q A;  1ZTU A;  2XSS A;  3MXQ A;  1OT6 A;  2D01 A;  2J3T D;  4CLC C;  2W3E A;  4B93 A;  1V9Z A;  1TS0 A;  1S4S A;  4JGQ A;  3C2W A;  3KSI A;  2P08 A;  4LPZ A;  4WN5 A;  3BW6 A;  3S7O A;  5AVE A;  3TW8 A;  2PYR A;  3C8C A;  2L4R A;  5AJG A;  2ZOI A;  3HCY A;  4UQI M;  5TBM B;  4I38 A;  1GSX A;  1D06 A;  3ZYT A;  1S1Y A;  3H82 B;  1TS6 A;  5G4Y A;  5LBR A;  5F68 A;  2DMW A;  3LIC A;  5HWV A;  3U2A A;  2QKP A;  3BY9 A;  5HD5 A;  4HH2 A;  3CUE C;  4MN5 A;  3T4S A;  4G3K A;  5J3W A;  2KOI A;  2PR6 A;  4KQD A;  2M7U A;  3UMD A;  3T4T A;  2L0W A;  4NXF A;  1T1A A;  2VV6 A;  5F5Y A;  3KO6 A;  1OTD A;  2QJ7 A;  3D72 A;  4M4X A;  4DN0 A;  3B33 A;  5HWW A;  1ZHH B;  2G7U A;  3MQQ A;  3LIF A;  2P04 A;  3EEA A;  5DJU A;  5HDS A;  2O0Y A;  3FG8 A;  1F98 A;  4NKP A;  2FH5 A;  1P0Z A;  2M7V A;  5A8B A;  2V0U A;  2PR5 A;  1LSX A;  4L9G A;  2A2L A;  4CQH A;  5IS1 A;  3GEC A;  4ETX A;  1S4R A;  2V1B A;  4IJG A;  3LR4 A;  4H6J B;  2VKS A;  3B47 A;  3E98 A;  3EQU A;  3GDI A;  3BQA A;  4ARZ A;  4DMZ A;  1T1B A;  4KUK A;  3RH8 B;  3MQ0 A;  5DKL A;  4WLA A;  2INW A;  2PDR A;  5J4E A;  1X0O A;  2O9B A;  2W1T A;  4LRZ E;  2XRN A;  4HJ3 A;  5DF9 A;  2V0W A;  2HJE A;  4II7 A;  2GNX A;  3E4P A;  4LLO B;  3RFB A;  1IOU A;  3VV4 A;  4YWZ A;  3T4J A;  1GSV A;  3KYZ A;  1S66 L;  4NXB A;  2J3T C;  3IBJ A;  4G3V A;  2CMN A;  3W2Z A;  2MJ6 A;  3PBN A;  4XT2 A;  1OTB A;  1W63 Q;  4PKY A;  2Y8H A;  3MMH A;  3F1P B;  4EU0 A;  1XJ3 A;  4YOF A;  4BBT A;  5HZH A;  2W27 A;  2VV7 A;  2WKQ A;  4EER A;  3H7W A;  5FL3 A;  4WEJ A;  2K7S A;  1TS7 A;  2O9A A;  5EFW A;  3LFV A;  4F3L A;  3G6O A;  2LB5 A;  3R7W B;  1F5M A;  4BJP A;  2JKT I;  4LRY C;  1EW0 A;  1YSP A;  3UB7 A;  3OOV A;  1OTE A;  3FC7 A;  4R38 A;  2QYB A;  4QPR A;  1DP6 A;  2O99 A;  1N9O A;  3F1N A;  2A24 A;  3NOU C;  4EXO A;  3F1O A;  4MN6 A;  2NUP C;  3LIA A;  5J7E A;  1XFQ A;  5MC7 A;  4WUJ A;  5DJT A;  4ME4 A;  2JKT M;  4HP4 A;  2VEA A;  5F6A A;  2GX5 A;  3OCN A;  4GLQ A;  5DFX A;  2WKR A;  4EW7 A;  3UB8 A;  1V9Y A;  3BQ8 A;  4BMW A;  2VZW A;  4CLC A;  4Q0H A;  3UB6 A;  3P7N A;  2WKP A;  1LL8 A;  4PHT A;  4BBV A;  3K2N A;  4MCW A;  4EQ1 A;  1NWZ A;  3A0R A;  2OWH A;  3LR5 A;  4HQA A;  4HI4 A;  4Q0J A;  5IU1 A;  4NXG A;  2PT7 A;  4I3J A;  1VHM A;  1XJ6 A;  3PBR A;  5TJJ A;  4GHI B;  3IBR A;  2H28 A;  1DRM A;  3BWL A;  5CX7 A;  3LR0 A;  2GZA A;  2PD8 A;  4P6Z M;  2J3W A;  2PD7 A;  4UEY A;  3BY8 A;  2W3G A;  1UWP X;  3MJQ A;  4I3A A;  3HJI A;  4L9F A;  3ICY A;  3CUE A;  1YAX A;  5HDD A;  3LI8 A;  1NLY A;  2Y79 A;  1ODV A;  1H8M A;  2ZBB A;  5HSQ A;  4Y3I A;  1W63 M;  4UQI S;  1S67 L;  3H9W A;  1OPX A;  3MQO A;  4EEU A;  1IFQ A;  4HIA A;  5AVF A;  4E04 A;  1TF1 A;  4B9O A;  3T50 A;  4HH3 A;  3KYQ A;  2LB9 A;  3PHY A;  4I5S A;  3LIB A;  1OT9 A;  2V1A A;  4KQO A;  4HY8 A;  4NEE D;  3IS2 B;  5F69 A;  2ZMF A;  4HJ4 A;  3NOP C;  2QHK A;  2EWW A;  2VLG A;  3MR0 A;  3T4O A;  3MF0 A;  4GS9 B;  3S7N A;  3NHQ A;  4P6Z S;  2YKF A;  3R4K A;  4CLC E;  5TBM A;  3OCL A;  1LSV A;  3HJK A;  4HHD A;  2R78 A;  3EWK A;  3EQV A;  2L1M A;  1DP8 A;  3UE3 A;  3H82 A;  3UB9 A;  4DJ2 A;  2OOL A;  3S7Q A;  4BWI A;  4BBU A;  3VE4 A;  1KOU A;  1D7E A;  2K31 A;  1OTA A;  3OLO A;  3JVU A;  2FZ0 A;  1OTI A;  3S7P A;  4JGP A;  1YKD A;  3TRC A;  4EET B;  2I9V A;  3VOL A;  1N9N A;  4MN7 A;  2PYP A;  4JGR A;  1MZU A;  1TS8 A;  3UE6 A;  4WEK A;  3LID A;  3P01 A;  1LSW A;  2NUT C;  3MFX A;  1WA9 A;  4Y2F A;  3EEH A;  3CIT A;  1DP9 A;  2D02 A;  2PHY A;  2B02 A;  4IUH A;  2VV8 A;  3ZQ5 A;  4H6J A;  1UWN X;  2VX8 A;  3CLO A;  2KLI A;  4O8G A;  1VB6 A;  4HP9 A;  4I39 A;  1LT0 A;  4WF0 A;  4GJ4 A;  4FOF A;  1XFN A;  3PBS A;  2JHE A;  4GW9 A;  4PKY G;  1YSQ A;  4WL9 A;  1Y28 A;  2HV1 A;  2GJ3 A;  1XJ4 A;  3C38 A;  5L8M A;  2M1C A;  4EES A;  2VGL M;  4ETZ A;  1G28 A;  3CI6 A;  3NJA A;  2JKR I;  2HJ9 C;  4HJ6 A;  1P97 A;  2O9C A;  4Z1W A;  4EEP A;  5HPF A;  1N9L A;  1NRJ A;  4ARZ B;  3CWF A;  1STZ A;  3A0S A;  1BYW A;  3F1P A;  3LR3 A;  2B18 A;  3LYX A;  5HPI A;  4HNB A;  2W1T B;  3EOI A;  3KSH A;  4Y5F A;  5DKK A;  5HWT A;  4IHQ A;  4OOL A;  3R7W A;  4GCZ A;  2JKR M;  3BJN A;  3EGD C;  2W3H A;  3CAX A;  3NOT C;  2Z6C A;  4OOM A;  1OJG A;  4XT2 B;  4ZRR A;  3SW1 A;  2KDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...