3FPVA

Crystal structure of hbps
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
141
structure length
141
Chain Sequence
VAARGGELTQSTHLTLEAATKAARAAVEAAEKDGRHVSVAVVDRNGNTLVTLRGDGAGPQSYESAERKAFTAVSWNAPTSELAKRLAQAPTLKDIPGTLFLAGGTPVTAKGAPVAGIGVAGAPSGDLDEQYARAGAAVLGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extracellular haem-binding protein
publication title The oligomeric assembly of the novel haem-degrading protein HbpS is essential for interaction with its cognate two-component sensor kinase
pubmed doi rcsb
source organism Streptomyces reticuli
molecule tags Heme binding protein
total genus 38
structure length 141
sequence length 141
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3fpvA01
4NKPA 4CLCC 3FPWA 2A2LA 5CX7A 4BMWA 4CLCE 4CLCD 4CLCB 3FPVA 4CLCA
chains in the Genus database with same CATH superfamily
1OTIA 3EWKA 3BFFA 4AFIA 3PBSA 2Y2GA 4CPKA 2V1ZA 4KUOA 2JHEA 3Q1FA 1FCOA 1I2SA 1XPBA 3LIFA 4P6ZS 3LIDA 3WRZA 3KYEA 1NLZA 1NRJA 5EVIB 5HPIA 3JYIA 3W4OA 3IH8A 3A3IA 5M18A 5EECA 2O9AA 2QJ7A 4I3JA 3T4OA 4M3KA 1GCEA 4JLFA 5CGXA 3IS2A 4MBKA 5EUAA 3CG5A 2XEPA 1YLPA 1ZHHB 2OWJA 2Y2IA 3A0RA 1YQSA 3VOYA 3EGDC 4NXFA 2C5WB 4Q0IA 4UA7A 1AXBA 1E25A 2Y91A 4RQ9A 4RYEA 5FASA 5JYPA 1MKIA 3NIAA 3LR3A 3E2LA 3UE1A 3KSGA 3SW1A 2WUQA 3ZQ5A 3FKVA 1GHMA 3IF5A 1XA1A 3LIAA 3B33A 3QP2A 5L2FA 4LENA 4P87A 4ZDXA 3B42A 1H3QA 4DE0A 2ZQCA 2J9PA 4BBTA 1S4RA 4EU0A 5CXWA 2WKEA 5DJUA 1O7EA 3R4KA 3CMZA 2Y2OA 2A2LA 3DWKA 3HVFA 2EWWA 1L2SA 3O3VA 5G18A 2VA0A 2K31A 4A5RA 4DE1A 4MMNA 3MFDA 1E3UD 3NULA 3MR0A 1NZUA 2LB9A 2CC1A 1H8YA 3SOIA 2XROA 2B5RA 3E4PA 1K25A 3GECA 4X68A 1QMFA 3H82B 2XK1A 3K3CA 1DJBA 3KSIA 3GTCA 2L4RA 1JWVA 2P04A 4I3IA 1BT5A 1BZAA 3HJIA 3S7PA 1IYSA 3V3RA 1XXMA 4ID4A 3CUEC 3IF6B 4EBLA 5F6AA 2HDUA 2Z6CA 4N9KA 3T1SA 3ITAA 4ZBEA 2QWSA 4EQ1A 5FQQA 3MZEA 3DTEA 1HVBA 4BLMA 5M1AA 4MN5A 3ZGAB 3TG9A 4G3KA 3DTIA 5HSQA 3UB5P 5EVIC 3T12B 5EM1A 5DF8A 3R7WA 1ES3A 1OTEA 4EETB 2Y2PA 3K3DA 5IHVA 4BWIA 4F3LB 1VHMA 1GHIA 3HCYA 4BD1A 2ZLYA 4OP5A 5TR7A 1MWUA 1XFQA 1ZTUA 2PYRA 4R70A 4Z9QA 3FKWA 4ARZB 4KZ3A 2QZ6A 4MDZA 2J8YA 3ZNTA 5EVEA 4OQHA 3N4IA 4NG2A 3U4LP 2ZBBA 2EX6A 2PBDP 1DJAA 3IWQA 1MWTA 2J7VA 3GV9A 3M2JA 4E3JA 4OONA 3LY4A 4L9FA 1IYPA 4IHQA 1IYQA 4HHDA 5HDCA 1H5XA 1H8MA 4HJ6A 2P74A 2DRWA 3H7WA 1WYBA 5EOEA 1DP8A 4HY8A 2QYBA 4KZ4A 3BECA 3UPNA 4DRTA 4BD0A 1UWPX 1K4EA 4GDNA 1ZC2A 3V5MA 3OPLA 2GX5A 1YLWA 1YPRA 2VGLM 4Y7PA 2W1TA 5E43A 3JPUA 3PAGA 1E3UA 2IA2A 4GKUA 3OZHA 2JKTI 3H9WA 4QPRA 2HDQA 1IFQA 1HLUP 3E2KA 4OOLA 4S2JA 4XUXA 4MNRA 3PBQA 5HAQA 1JNUA 2WKPA 4H6JB 1LHYA 1TS0A 4BQMA 4JXSA 2DMWA 3VOLA 1GSWA 3IF6C 2L1MA 2CMNA 3OOVA 4JF5A 2P7JA 1XA7A 1JWPA 3C7UA 4HBUA 4GZBA 4U0XA 2WKIA 3G31A 4DMZA 2V0UA 4JGPA 3V50A 4C3QA 4L9EA 4WZ4A 1MWRA 1P0ZA 2JKRI 1F2KA 4P6ZM 4N1HA 1CJFA 3FWLA 4JPMA 4B88A 3G2YA 5AQ7A 5KMWA 3P98A 1U60A 3O86A 4HEFA 3NBLA 4OLDA 1TD5A 1IOUA 4DJ3A 5MC7A 2QJ5A 2D01A 1VEUB 1W7FA 3F1NA 4KG2A 1KE3A 3A3FA 3VSLA 4GHIA 3UDXA 2G7UA 4EBNA 3IX8A 1HZOA 4Y2FA 1L0DA 4S2MA 2EX9A 3GDIA 4IBRA 5E2EA 5EVLA 3CUEA 2Y8HA 5D3OA 1TF1A 3LO7A 4Y13A 5L09A 4G3VA 5F68A 5HW3A 3VP3A 1PWGA 5DFXA 4HBTA 5I5LA 3ZVWA 3UY6A 5F69A 3QP4A 1N9LA 2QMIA 5EM0A 3PHYA 4R1GA 4UQIM 1YKDA 3G32A 1TDLA 3W8KA 2Y55A 1MWSA 1YMSA 3NECA 3RTYA 4BBUA 1MKMA 3HLFA 4OPYA 5HL6A 2HF6A 2PYPA 5FI6A 4ZTKA 2XD5A 4GDBA 3ISGA 1BULA 1CF0A 5CTNA 3T1RA 2KX6A 2O9BA 1LLBA 5HDDA 3N8SA 5DVAA 3QNCA 3NDGA 4KQDA 1LL8A 1NRFA 2QHKA 2OLVA 4UAAA 5GLCA 2WGVA 3G6OA 4XT2B 4ZJ3A 2DCFA 4MN7A 5KIZA 3UPOA 5HAPA 1EWZA 2IWCA 3FV7A 1WYCA 3W4PA 1NY0A 3LI9A 3O5YA 1ES5A 2INWA 3BRMA 1MPLA 2HP9A 2ZL1B 1T1CA 1MZUA 2W3FA 1KOUA 3HUMA 3NHQA 5J3WA 3UB8A 3VFHA 4I3AA 2WAEA 3FC7A 5HL1A 3SZTA 1J3WA 1JTDA 2VGLS 1DJCA 3H82A 4ZAMA 5DTSA 1N9NA 4QD4A 3QP5A 1K55A 3Q7VB 3QP6A 3M2KA 5FEGA 5L10A 2Q9NA 4QB8A 4YNRA 5GHXA 2PDRA 5FA7A 2EA9A 4JF4A 4R3BA 2HP6A 3IF6A 3T4JA 2ZJ9A 1BLHA 3CITA 1V9YA 4BMWA 5HZHA 3RJUA 3SS4A 4IVKA 2PRFA 3ZYTA 1P9WA 3IHBA 4Y5FA 3KYZA 1OMEA 4N92A 1XGJA 3G4PA 4CLCB 1LSVA 1G28A 4LFUA 2XH9A 3W2ZA 2J3TD 3BFGA 4X25A 4R3JA 3IXDA 2H0TA 2Y2QA 2GDNA 2ZQAA 3D9YA 3BFEA 4KG6A 1VETB 1XJ3A 3KSFA 4EUZA 3TE8A 3I7JA 3RH8B 1MXOA 4HJ3A 4RX2A 3A0SA 3TRCA 5AQ9A 4ARZA 5FQKA 1W8QA 5FATA 2BG1A 4GD6A 4ETXA 3T1QB 1PZPA 3NC8A 3ZG7B 2PD8A 1TS7A 1KE0A 5BOHA 5FQJA 1K54C 1P9RA 2W0NA 4KZ6A 3F1PB 4JF6A 2A24B 3LIEA 3MZDA 3WS5A 4HH3A 4GS9A 2H28A 3JVUA 4R0QA 5FAOA 3BWLA 5FDHA 2HJEA 2V9AA 4E3KA 4PM6A 4S2PA 1Z6FA 3HUNA 4UA6A 2XF3A 4QHCA 3OBFA 1GHPA 1ODVA 3LIBA 2R9WA 5J4EA 5HFOA 4Q8IA 4OQ0A 3E0YA 3S7QA 5FDSA 3D3OA 2V2FF 4GJ4A 5TGFA 2EX2A 1ONHA 2WGWA 4UQIS 1W8YA 1K6RA 5CECA 4KZ7A 1NYMA 3PBRA 5HDSA 4WMCD 5GL9A 3UB9A 4OVDA 3E4QA 4ME4A 3UN7A 2JCHA 3OCLA 1FSWA 3FG8A 4LRYC 4ESPA 1UGUA 2HDSA 4G3WA 5I94A 2W3EA 3LYXA 1FIKA 4LPZA 2M7VA 2WADA 1H8ZA 4L9GA 4QY6A 2PU4A 3M6HA 3Q81A 4WLAA 4HP4A 4PM7A 4CLCC 1Y28A 3BJNA 4LRXC 2EFUA 4PHTA 1TS8A 4U0TA 3MQOA 3CZDA 2JN7A 3UMEA 3BLMA 3VE3A 4OOYA 3DW0A 3DAVA 4X56A 4QWOA 1YAXA 1K0KA 2O99A 2W27A 4PKYG 5CGSA 4F94A 1A0KA 1S6RA 4Q0HA 4WUJA 2A49A 4IJGA 4LV2A 3KYQA 2DNSA 3UMDA 4K91A 4FUWA 4LGWA 1NWZA 4K08A 5G4ZA 2XGNA 3C2WA 3MJQA 5FL3A 3U2AA 3B47A 2Y59A 1S66L 5K5BA 4B93A 4JXWA 3T4KA 1LL5A 5TBMA 4OLGA 2ZC6B 1OTDA 3VV4A 4FOFA 2A3UA 5FAPA 4RVAA 4BJPA 3NOPC 4WZ5C 3DTKA 3CWFA 1G68A 2R78A 3ZFZA 1K38A 1LI9A 3UPPA 4KENB 1QMEA 5DTKA 3MKFA 1N4OA 4YINA 3E4OA 5AQBA 3MMHA 2P9VA 1L3LA 1GA9A 3K2NA 3IBJA 4IBXA 4UHUA 4RX3A 1FSYA 3TJZC 3T4LA 4K0XA 3VMAA 3L9KA 1ESIA 3BLSA 1IYOA 2WAFA 2EFXA 1CI9A 2Y2LA 3EEAA 3C7VA 3P7NA 3UDFA 4II7A 5LBRA 5EVID 1STZA 5CX7A 2FH5A 4WMCA 1KE4A 3ZVTA 3BYDA 5EOOA 1K57C 3C30A 3VP2A 1TVFA 1VQQA 3QNBA 1XJ2A 2OAQ1 4E3MA 3BY9A 1RGZA 1VB6A 1LL9A 3GRJA 5GLBA 3VP4A 3DBAA 2OOLA 1LSWA 3G2ZA 5IS1A 2ZC7A 4PPRA 5AVEA 4Z1WA 3V67A 1ZKJA 1JWZA 5HWVA 4CQHA 3QP1A 1S0WA 1ESUA 2I72A 2ZM2A 2J80A 4EV4A 3F1OA 1I2WA 4YFMA 4DF6A 3BFDA 1VM1A 4RA7A 4S2OA 4EEPA 3HL9A 4WN5A 1PNEA 3GVBA 3HJKA 3S7NA 4DN0A 2ZM0A 3VOZA 4WBGA 4C6YA 3VP0A 1PZOA 4FSFA 5HARA 1IKIA 1XKZA 5GHYA 1W79A 2RCXA 4EWFA 2ZQ7A 5CTMA 4D2OA 4LV1A 2VEAA 3RXXA 1F98A 3IXGA 1DP9A 3Q7VA 1S67L 2XDMA 1NLYA 2WKRA 1KGFA 3C38A 4KZ8A 3T4SA 3BQ8A 4DJ2A 2Z2MB 1N9BA 3VSKA 4Q0JA 1G5UA 3PYPA 4NXGA 4PM5A 3G34A 2QPNA 2XLNA 1H0MA 4EERA 3R7WB 1SDNA 3MSHA 1G6OA 1RP5A 4BENA 4HJ4A 4LV0A 4HESA 4IUHA 5IT5A 2V0WA 3E98A 1G6AA 3LGOA 4BL3A 3HREA 2H0YA 1RGYA 3RXWA 3B3XA 1XP4A 2K7SA 3BW6A 3OPHA 4M4XA 3WWXA 4BBVA 4E3OA 2PAVP 4EBPA 2Y79A 2M7UA 1VETA 1YSPA 2VV7A 3C8CA 4LV3A 1ZG6A 4X55A 1NXYA 4GW9A 4E3LA 3EOIA 2VGJA 5EVIA 2KOIA 4WELA 3IHAA 2JKTM 1KVLA 1OTAA 4KQQA 1KGEA 4L0LA 4X1MA 3LCEA 2X02A 3MBZA 3MS6A 4GB7A 1T1BA 4D60A 4YWZA 3H7WB 3LICA 2V20A 5J8XA 5G4YA 3LUQA 1FQGA 3UE0A 3MZFA 4HQAA 5A8BA 3F1PA 2PHYA 4JGOA 2A24A 4HH2A 2ZC3B 5HD5A 4MEZA 2UV0E 4X6TA 3HLCA 1L0FA 3G35A 1L0EA 1KDWA 1GSVA 4N1XA 5EE8A 5EFWA 4PAUA 5AVFA 3CI6A 2VGKA 4UA9A 4OPQA 5HWWA 3WS1A 1ERQA 1BSGA 3C4PA 3GSGA 2ZMFA 2EX8A 3T1XA 4OPRA 2PBYA 4KZ5A 5DF7A 1OJ5A 1JTGA 4FH4A 1OTBA 3VP1A 3CHWP 1K57A 1BYWA 3HLEA 3ZNYA 4HIAA 3BEBA 5A91A 3UO9A 5GLAA 4U3TA 1P97A 4OQIA 4NKPA 2GJ3A 1Z09A 4JGQA 1FILA 4KZ9A 1KDSA 2UWXA 1OPXA 3BFCA 1RCJA 1D06A 3HBRA 3Q82A 1SKFA 4ZRRA 3OPPA 4C75A 1GSXA 3T4TA 1C3BA 2XD1A 1JVJA 4O8GA 1SKOB 2R9XA 2D02A 3HLGA 5CRFA 4JXGA 3ZDJA 2ZD8A 3S22A 3F1NB 4Y3IA 3IBRA 1T1AA 5KSHA 3SH7A 4UEYA 4GHIB 1YLYA 4NETA 5F1GA 3IX4A 1V9ZA 5HWTA 2X01A 2OLUA 5FQ9A 3PBTA 4R4RA 2WZZA 2WYXA 2W3DA 3D72A 4F3LA 1NJ4A 1PWDA 3ITBA 2XFSA 2EXBA 4QY5A 3WS0A 5A93A 3D4FA 3UE6A 4R4SA 5GLDA 1I5QA 4DE3A 1K56D 1YLJA 4P0MA 3FYZA 3C5AA 4WYYA 5E2FA 3A3DA 4E04A 2FFYA 4GN2A 4GNUA 5J7EA 3IWOA 2RL3A 5F1FA 5JYOA 2C6WB 3FPVA 2ZMVA 1CEFA 1DY6A 4MLLA 3VFFA 4JBFA 1EW0A 3ULFA 3A3JA 5AJGA 3MKEA 2HGVA 1S4SA 1D7EA 3AGEA 1CEGA 3S4XA 3S1YA 2XRNA 2JKFA 1Y54A 4O01A 3AGFA 3CPTB 1FOFA 4H8RA 3GMWA 3IXBA 3PXPA 4OH0A 4R6LA 2BLSA 1XFNA 1MC0A 2K2NA 3TOIA 3O88A 2O0YA 3NOTC 5E2GA 5F82A 4JXVA 3HLWA 1EI5A 2E8JA 5F83A 3OLOA 3EEHA 2ZOHA 5DKLA 2W3HA 4PM9A 2WKQA 3OPRA 3IH9A 2V8CA 1OT9A 4JGRA 4YOFA 5M19A 3MF0A 4H6JA 2NUPC 4B4ZA 1BLPA 2WK0A 3S7OA 2AVXA 4DKIA 4EUVA 2HPBA 2JKGA 2M1CA 4FD8A 4XUZA 1BTLA 3MXSA 4ZJ1A 3TW8A 4CLCE 1X0OA 3ZG8B 3DWZA 4N9LA 4O0PA 1F5MA 3FZCA 4E3NA 2ZQ8A 3NOUC 4WEKA 1WA9A 2Y2HA 1PIOA 2XR0A 1T18A 4S2LA 4GLQA 2ZM8A 4DDSA 1XGIA 1SCWA 1Q2PA 2Y2MA 1E4DA 1XX2A 1YM1A 2VK3A 1ALQA 2PT7A 3NI9A 1ES2A 3OC2A 4R38A 2Z2LB 4Y0UA 4I39A 3SS3A 2NUTC 3NY4A 5CHUA 4QU3A 3P09A 3KX0X 1VEUA 3G30A 1K56A 4OKPA 3PAEA 2L0WA 4ZJ2A 3UNWA 4WF0A 3HLBA 2J9OA 4S2IA 3TSGA 1SZVA 1ACFA 2Y4AA 1MY8A 1PI4A 3CLOA 3Q07A 2HDRA 5TFQA 2V1BA 2HZ5A 4EXOA 5U47A 2H10A 5FQMA 1YT4A 1IELA 3UDIA 4LCMA 2B18A 3MQ0A 1TDGA 4IEDA 3FPWA 4R23A 3P01A 4B4XA 2VKSA 1LI0A 2OV5A 2IWDA 1S1YA 2ZQDA 3PTEA 2VX8A 5FI2A 2XQZA 1J9MA 2ZC4B 4CJNA 2H5SA 4Y0TA 5FEFA 3HUOA 2YKHA 4CLCD 4PM8A 3L7HA 3V39A 4WM9A 4FH2A 3IS2B 3IWIA 1XJ6A 3SH8A 1OT6A 4EW7A 2FFFB 4LCLA 5DKKA 4NEED 2PR5A 2FZ0A 3Q7ZA 1M40A 1CQAA 3ZG5A 1K4FA 4X53A 3T4QA 1TEMA 4GOGA 2ZOIA 2G2UA 3T50A 2BTFP 5CGWA 4ETZA 2Z6DA 3CJMA 3PR6A 4WEJA 4QJGA 4GS9B 4KQRA 5KZHA 2W3GA 2ACGA 3PBNA 2JC7A 5DTTA 4HI4A 1EROA 1BLSA 3ZCZA 2JE5A 1BUEA 1K54A 5FSRA 1Y4OA 1FCMA 1ZG4A 3AGDA 5EV0A 1KGGA 3VE4A 1F9IA 4XT2A 2XA7M 1FR1A 1PYYA 2B02A 3BM6A 1M6KA 2WGIA 1SHVA 1L0GA 3SS5A 2WZXA 3LI8A 1YLTA 1K55C 3N8LA 3NDEA 3ZHHA 2WGWB 1PRQA 2BASA 1LT0A 4I38A 2ZL1A 1W5DA 1S1ZA 4IVIA 1FR6A 3C4OA 5F5YA 1KVMA 1Q2QA 3LFVA 3LR4A 4MBHA 3EQUA 4S2NC 2GZAA 1LSXA 3KO6A 4O7DA 1ONGA 5GHZA 2V1AA 1DP6A 1YMXA 5EPHA 3BY8A 4GCZA 4S2KA 2Q9MA 3RFBA 2EWVA 2I9VA 5CEBA 4GD8A 2VV6A 5DF9A 1D1JA 4P6BA 5A90A 3W4QA 2OSUA 2MJ6A 2OWHA 2JBFA 4OP8A 2X71A 3SH9A 3LR5A 2E8IA 1WE4A 4Y17A 2HJ9C 3GQZA 1PI5A 1BLCA 1GA0A 1SKOA 2ZMAA 4NK3A 1PWCA 5A92A 3PBOA 4PMAA 2Q0OA 2VLGA 4X69A 4WL9A 2Y2NA 2Y2KA 4CLCA 1O07A 5HPFA 4B9OA 3O87A 5TJJA 2PD7A 5TBMB 3EGXC 1XJ4A 3LR0A 3A3EA 2VJWA 2WKHA 1NYYA 3ZG0A 1CK3A 4E3IA 5L07A 4DXBA 3NCKA 3QHYA 3UE3A 1IEMA 1W63M 2LB5A 2Y2JA 4KUKA 2KDKA 3IXHA 1ES4A 2VV8A 1UWNX 2P9VB 3HLDA 1OJGA 4DXCA 4HP9A 4KG5A 2XSSA 4LRZE 4FCFA 5KSCA 4E6XA 5IU1A 4EQIA 1CI8A 1SDEA 2PU2A 4KZBA 5DJTA 5C5KA 4WZ5A 3KSHA 4X1LA 4Y0OA 5FQIA 4K0WA 4OQGA 3CPTA 1N9OA 4HOIA 4I5SA 1HTZA 4LLOB 5HAIA 2OAP1 2W1TB 1YSQA 4NXBA 3NJAA 3MFXA 4P85A 2V8FA 3LEQA 5HD3A 2JKRM 2QKPA 3WS2A 4OOMA 5CERA 3LEZA 1PFLA 2ZC5B 5CHJA 4PKYA 1PW1A 5CEDA 3M6BA 1MBLA 4MBFA 3UB6A 5FAQA 3CAXA 3DTMA 1DRMA 2J3WA 3JVVA 1PW8A 2KLIA 1TS6A 4KQOA 4OPZA 3A0VA 2J3TC 1T19A 3UB7A 3ICYA 2O9CA 4DDYA 4R3AA 4XXRA 2W1RA 3F1OB 3IT9A 2HV1A 5L8MA 1IKGA 2PR6A 5E2HA 2EXAA 2XFTA 4Y15A 2YKFA 3N8RA 4MCWA 1ERMA 4E6WA 2P08A 3QP8A 3MQQA 3GR2A 3WRTA 1FCNA 1AWIA 1W63Q 4HNBA 5FI7A 1HD8A 2B95A 2HP5A 2GNXA 4KZAA 3N6IA 3MXQA 1NZOA 4FTXA 2G2WA 4EESA 1K6SA 1YLZA 2XA7S 4MN6A 4EEUA 4IUKA 4BL2A 3IQAA 5HX9A 3WS4A 2VZWA 5CHMA 3MXRA 3LY3A 4S2NA 3BQAA 4NXEA 4JKTA 3EQVA 2IWBA 3IX3A 3OCNA 2ZQ9A 4DE2A 5AQAA 3N7WA 5DFYA 3V3SA 3ZG9B
chains in the Genus database with same CATH topology
5AVEA 1OTIA 3EWKA 4AFIA 4Z1WA 2PT7A 3V67A 3PBSA 3OC2A 3RTYA 4KUOA 4R38A 5HWVA 4BBUA 2JHEA 4CQHA 1MKMA 4I39A 5HL6A 2NUTC 2HF6A 3LIFA 2PYPA 3LIDA 4P6ZS 1NLZA 2J80A 3F1OA 3KX0X 1NRJA 4EEPA 2KX6A 2L0WA 4WN5A 5HPIA 2O9BA 4WF0A 3HJKA 5HDDA 3S7NA 4DN0A 3CLOA 2O9AA 4KQDA 2QJ7A 1LL8A 4I3JA 3T4OA 2V1BA 4EXOA 4FSFA 2QHKA 3G6OA 3IS2A 2VEAA 4XT2B 4MN7A 5KIZA 2B18A 1F98A 3MQ0A 1DP9A 3FPWA 3P01A 1ZHHB 1S67L 2OWJA 1NLYA 3A0RA 2VKSA 2WKRA 3LI9A 3C38A 3O5YA 3T4SA 2INWA 3BQ8A 3EGDC 4NXFA 1S1YA 1T1CA 2VX8A 4Q0IA 4DJ2A 1MZUA 2W3FA 4Q0JA 1KOUA 4RQ9A 3NHQA 5J3WA 3UB8A 3PYPA 4NXGA 4I3AA 3FC7A 2YKHA 3LR3A 4EERA 3R7WB 4CLCD 1G6OA 3KSGA 3SW1A 3ZQ5A 2VGLS 3IS2B 4HJ4A 4IUHA 5IT5A 2V0WA 3H82A 1XJ6A 1N9NA 3E98A 1OT6A 4EW7A 3LIAA 5DKKA 3B33A 4NEED 2PR5A 2FZ0A 4YNRA 2PDRA 2EA9A 2K7SA 3B42A 3T4QA 1H3QA 2ZOIA 3BW6A 4M4XA 3T4JA 4BBVA 3CITA 3T50A 1V9YA 4BBTA 1S4RA 4EU0A 2Y79A 2M7UA 4ETZA 5DJUA 3R4KA 2A2LA 4BMWA 5HZHA 2EWWA 1YSPA 2VV7A 2Z6DA 3C8CA 3PR6A 4WEJA 2VA0A 2K31A 4GS9B 4GW9A 4MMNA 3EOIA 2W3GA 2KOIA 3ZYTA 4WELA 3MR0A 2LB9A 3PBNA 1P9WA 4HI4A 2XROA 4Y5FA 3E4PA 3KYZA 2JKTM 3GECA 1OTAA 3H82B 3K3CA 4L0LA 4CLCB 3KSIA 1LSVA 1G28A 2L4RA 3W2ZA 2P04A 3VE4A 4I3IA 2J3TD 3HJIA 1F9IA 4XT2A 2XA7M 3S7PA 2B02A 1T1BA 3LI8A 3CUEC 4YWZA 3H7WB 3LICA 5F6AA 5G4YA 1XJ3A 2Z6CA 3KSFA 3TE8A 3LUQA 4EQ1A 2QWSA 3RH8B 2BASA 4HJ3A 1LT0A 4I38A 4HQAA 1S1ZA 3F1PA 5A8BA 2PHYA 3A0SA 3TRCA 4ARZA 5F5YA 4JGOA 2A24A 4HH2A 4MN5A 3LFVA 3LR4A 5HD5A 3EQUA 4ETXA 4G3KA 2GZAA 5HSQA 1LSXA 1GSVA 3R7WA 3KO6A 5EFWA 2V1AA 2PD8A 4PAUA 1DP6A 1OTEA 5AVFA 1TS7A 3CI6A 3BY8A 4GCZA 1P9RA 3RFBA 4EETB 2EWVA 2I9VA 5HWWA 3K3DA 4BWIA 2W0NA 4F3LB 2VV6A 1VHMA 5DF9A 2ZMFA 3HCYA 1XFQA 1ZTUA 3F1PB 2PYRA 2MJ6A 4R70A 2OWHA 4ARZB 2A24B 3LIEA 3LR5A 4MDZA 2HJ9C 1OJ5A 4HH3A 1OTBA 4GS9A 2H28A 3JVUA 3BWLA 1BYWA 2ZBBA 2HJEA 2V9AA 4HIAA 3PBOA 2VLGA 4WL9A 1P97A 3OBFA 4CLCA 4NKPA 1ODVA 2GJ3A 3LIBA 4JGQA 5HPFA 4L9FA 5J4EA 4B9OA 4IHQA 4HHDA 1OPXA 5HDCA 5TJJA 3E0YA 3S7QA 1H8MA 4HJ6A 2PD7A 3D3OA 5TBMB 1D06A 3EGXC 1XJ4A 3LR0A 4GJ4A 4ZRRA 3H7WA 4UQIS 1GSXA 2VJWA 1DP8A 4HY8A 3T4TA 2QYBA 3PBRA 5HDSA 1UWPX 4O8GA 3UB9A 3E4QA 4ME4A 2D02A 2GX5A 3UE3A 1W63M 4LRYC 2LB5A 3FG8A 3OCLA 4KUKA 1UGUA 2KDKA 2VGLM 3F1NB 2W1TA 4Y3IA 3IBRA 2VV8A 1T1AA 1UWNX 4G3WA 5KSHA 2W3EA 3LYXA 4LPZA 4UEYA 2M7VA 2IA2A 1OJGA 4GHIB 4HP9A 2JKTI 3H9WA 4QPRA 2XSSA 4LRZE 1V9ZA 5HWTA 1IFQA 4L9GA 4OOLA 3PBQA 3PBTA 4WLAA 5IU1A 4HP4A 1JNUA 4CLCC 2WKPA 2W3DA 3D72A 5DJTA 1Y28A 4H6JB 3BJNA 4LRXC 5C5KA 4F3LA 1TS0A 4PHTA 1TS8A 3KSHA 3MQOA 2JN7A 3UMEA 3VE3A 2DMWA 3VOLA 1GSWA 3UE6A 1N9OA 2L1MA 1YAXA 2CMNA 4HOIA 3OOVA 2O99A 2W27A 4I5SA 4PKYG 4LLOB 2OAP1 2W1TB 4Q0HA 1YSQA 2P7JA 4WUJA 4NXBA 3NJAA 3MFXA 4IJGA 4E04A 5J7EA 3KYQA 5HD3A 2JKRM 3UMDA 4DMZA 2QKPA 2V0UA 4JGPA 4L9EA 3FPVA 2ZMVA 4OOMA 1P0ZA 2JKRI 1NWZA 4K08A 4P6ZM 5G4ZA 3C2WA 3MJQA 1EW0A 5FL3A 4PKYA 3ULFA 3U2AA 5AJGA 3B47A 2HGVA 1S4SA 1D7EA 1S66L 5K5BA 4B93A 3T4KA 3UB6A 2XRNA 3CAXA 1DRMA 5TBMA 4O01A 2J3WA 3JVVA 2KLIA 1OTDA 3VV4A 4FOFA 3PXPA 1TS6A 4KQOA 4BJPA 4R6LA 3A0VA 2J3TC 3NOPC 1T19A 3CWFA 3UB7A 3ICYA 1XFNA 1MC0A 2R78A 2K2NA 2O9CA 1TD5A 4R3AA 2W1RA 3F1OB 1IOUA 4DJ3A 5MC7A 2HV1A 5L8MA 2O0YA 2QJ5A 2D01A 3NOTC 3F1NA 2PR6A 3E4OA 2YKFA 3MMHA 3OLOA 4GHIA 4MCWA 3EEHA 2ZOHA 3K2NA 2G7UA 3IBJA 5DKLA 2W3HA 2P08A 2WKQA 3TJZC 3MQQA 3T4LA 4Y2FA 1OT9A 4JGRA 1W63Q 4YOFA 3MF0A 4HNBA 4H6JA 2NUPC 3GDIA 3CUEA 2GNXA 2Y8HA 3S7OA 3MXQA 1TF1A 4EUVA 3EEAA 3P7NA 4EESA 4G3VA 2XA7S 2M1CA 4II7A 5F68A 4MN6A 5LBRA 4EEUA 4IUKA 1STZA 5CX7A 2FH5A 3TW8A 4CLCE 1X0OA 5DFXA 2VZWA 3C30A 4O0PA 5I5LA 1F5MA 1XJ2A 2OAQ1 3BQAA 4NXEA 3EQVA 3BY9A 3NOUC 5F69A 1VB6A 4WEKA 1WA9A 1N9LA 3DBAA 1T18A 3OCNA 2OOLA 4GLQA 1LSWA 3PHYA 4UQIM 5DFYA 5IS1A 1YKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NKP A;  4CLC C;  3FPW A;  2A2L A;  5CX7 A;  4BMW A;  4CLC E;  4CLC D;  4CLC B;  3FPV A;  4CLC A; 
#chains in the Genus database with same CATH topology
 1OTI A;  3EWK A;  3BFF A;  4AFI A;  3PBS A;  2Y2G A;  4CPK A;  2V1Z A;  4KUO A;  2JHE A;  3Q1F A;  1FCO A;  1I2S A;  1XPB A;  3LIF A;  4P6Z S;  3LID A;  3WRZ A;  3KYE A;  1NLZ A;  1NRJ A;  5EVI B;  5HPI A;  3JYI A;  3W4O A;  3IH8 A;  3A3I A;  5M18 A;  5EEC A;  2O9A A;  2QJ7 A;  4I3J A;  3T4O A;  4M3K A;  1GCE A;  4JLF A;  5CGX A;  3IS2 A;  4MBK A;  5EUA A;  3CG5 A;  2XEP A;  1YLP A;  1ZHH B;  2OWJ A;  2Y2I A;  3A0R A;  1YQS A;  3VOY A;  3EGD C;  4NXF A;  2C5W B;  4Q0I A;  4UA7 A;  1AXB A;  1E25 A;  2Y91 A;  4RQ9 A;  4RYE A;  5FAS A;  5JYP A;  1MKI A;  3NIA A;  3LR3 A;  3E2L A;  3UE1 A;  3KSG A;  3SW1 A;  2WUQ A;  3ZQ5 A;  3FKV A;  1GHM A;  3IF5 A;  1XA1 A;  3LIA A;  3B33 A;  3QP2 A;  5L2F A;  4LEN A;  4P87 A;  4ZDX A;  3B42 A;  1H3Q A;  4DE0 A;  2ZQC A;  2J9P A;  4BBT A;  1S4R A;  4EU0 A;  5CXW A;  2WKE A;  5DJU A;  1O7E A;  3R4K A;  3CMZ A;  2Y2O A;  2A2L A;  3DWK A;  3HVF A;  2EWW A;  1L2S A;  3O3V A;  5G18 A;  2VA0 A;  2K31 A;  4A5R A;  4DE1 A;  4MMN A;  3MFD A;  1E3U D;  3NUL A;  3MR0 A;  1NZU A;  2LB9 A;  2CC1 A;  1H8Y A;  3SOI A;  2XRO A;  2B5R A;  3E4P A;  1K25 A;  3GEC A;  4X68 A;  1QMF A;  3H82 B;  2XK1 A;  3K3C A;  1DJB A;  3KSI A;  3GTC A;  2L4R A;  1JWV A;  2P04 A;  4I3I A;  1BT5 A;  1BZA A;  3HJI A;  3S7P A;  1IYS A;  3V3R A;  1XXM A;  4ID4 A;  3CUE C;  3IF6 B;  4EBL A;  5F6A A;  2HDU A;  2Z6C A;  4N9K A;  3T1S A;  3ITA A;  4ZBE A;  2QWS A;  4EQ1 A;  5FQQ A;  3MZE A;  3DTE A;  1HVB A;  4BLM A;  5M1A A;  4MN5 A;  3ZGA B;  3TG9 A;  4G3K A;  3DTI A;  5HSQ A;  3UB5 P;  5EVI C;  3T12 B;  5EM1 A;  5DF8 A;  3R7W A;  1ES3 A;  1OTE A;  4EET B;  2Y2P A;  3K3D A;  5IHV A;  4BWI A;  4F3L B;  1VHM A;  1GHI A;  3HCY A;  4BD1 A;  2ZLY A;  4OP5 A;  5TR7 A;  1MWU A;  1XFQ A;  1ZTU A;  2PYR A;  4R70 A;  4Z9Q A;  3FKW A;  4ARZ B;  4KZ3 A;  2QZ6 A;  4MDZ A;  2J8Y A;  3ZNT A;  5EVE A;  4OQH A;  3N4I A;  4NG2 A;  3U4L P;  2ZBB A;  2EX6 A;  2PBD P;  1DJA A;  3IWQ A;  1MWT A;  2J7V A;  3GV9 A;  3M2J A;  4E3J A;  4OON A;  3LY4 A;  4L9F A;  1IYP A;  4IHQ A;  1IYQ A;  4HHD A;  5HDC A;  1H5X A;  1H8M A;  4HJ6 A;  2P74 A;  2DRW A;  3H7W A;  1WYB A;  5EOE A;  1DP8 A;  4HY8 A;  2QYB A;  4KZ4 A;  3BEC A;  3UPN A;  4DRT A;  4BD0 A;  1UWP X;  1K4E A;  4GDN A;  1ZC2 A;  3V5M A;  3OPL A;  2GX5 A;  1YLW A;  1YPR A;  2VGL M;  4Y7P A;  2W1T A;  5E43 A;  3JPU A;  3PAG A;  1E3U A;  2IA2 A;  4GKU A;  3OZH A;  2JKT I;  3H9W A;  4QPR A;  2HDQ A;  1IFQ A;  1HLU P;  3E2K A;  4OOL A;  4S2J A;  4XUX A;  4MNR A;  3PBQ A;  5HAQ A;  1JNU A;  2WKP A;  4H6J B;  1LHY A;  1TS0 A;  4BQM A;  4JXS A;  2DMW A;  3VOL A;  1GSW A;  3IF6 C;  2L1M A;  2CMN A;  3OOV A;  4JF5 A;  2P7J A;  1XA7 A;  1JWP A;  3C7U A;  4HBU A;  4GZB A;  4U0X A;  2WKI A;  3G31 A;  4DMZ A;  2V0U A;  4JGP A;  3V50 A;  4C3Q A;  4L9E A;  4WZ4 A;  1MWR A;  1P0Z A;  2JKR I;  1F2K A;  4P6Z M;  4N1H A;  1CJF A;  3FWL A;  4JPM A;  4B88 A;  3G2Y A;  5AQ7 A;  5KMW A;  3P98 A;  1U60 A;  3O86 A;  4HEF A;  3NBL A;  4OLD A;  1TD5 A;  1IOU A;  4DJ3 A;  5MC7 A;  2QJ5 A;  2D01 A;  1VEU B;  1W7F A;  3F1N A;  4KG2 A;  1KE3 A;  3A3F A;  3VSL A;  4GHI A;  3UDX A;  2G7U A;  4EBN A;  3IX8 A;  1HZO A;  4Y2F A;  1L0D A;  4S2M A;  2EX9 A;  3GDI A;  4IBR A;  5E2E A;  5EVL A;  3CUE A;  2Y8H A;  5D3O A;  1TF1 A;  3LO7 A;  4Y13 A;  5L09 A;  4G3V A;  5F68 A;  5HW3 A;  3VP3 A;  1PWG A;  5DFX A;  4HBT A;  5I5L A;  3ZVW A;  3UY6 A;  5F69 A;  3QP4 A;  1N9L A;  2QMI A;  5EM0 A;  3PHY A;  4R1G A;  4UQI M;  1YKD A;  3G32 A;  1TDL A;  3W8K A;  2Y55 A;  1MWS A;  1YMS A;  3NEC A;  3RTY A;  4BBU A;  1MKM A;  3HLF A;  4OPY A;  5HL6 A;  2HF6 A;  2PYP A;  5FI6 A;  4ZTK A;  2XD5 A;  4GDB A;  3ISG A;  1BUL A;  1CF0 A;  5CTN A;  3T1R A;  2KX6 A;  2O9B A;  1LLB A;  5HDD A;  3N8S A;  5DVA A;  3QNC A;  3NDG A;  4KQD A;  1LL8 A;  1NRF A;  2QHK A;  2OLV A;  4UAA A;  5GLC A;  2WGV A;  3G6O A;  4XT2 B;  4ZJ3 A;  2DCF A;  4MN7 A;  5KIZ A;  3UPO A;  5HAP A;  1EWZ A;  2IWC A;  3FV7 A;  1WYC A;  3W4P A;  1NY0 A;  3LI9 A;  3O5Y A;  1ES5 A;  2INW A;  3BRM A;  1MPL A;  2HP9 A;  2ZL1 B;  1T1C A;  1MZU A;  2W3F A;  1KOU A;  3HUM A;  3NHQ A;  5J3W A;  3UB8 A;  3VFH A;  4I3A A;  2WAE A;  3FC7 A;  5HL1 A;  3SZT A;  1J3W A;  1JTD A;  2VGL S;  1DJC A;  3H82 A;  4ZAM A;  5DTS A;  1N9N A;  4QD4 A;  3QP5 A;  1K55 A;  3Q7V B;  3QP6 A;  3M2K A;  5FEG A;  5L10 A;  2Q9N A;  4QB8 A;  4YNR A;  5GHX A;  2PDR A;  5FA7 A;  2EA9 A;  4JF4 A;  4R3B A;  2HP6 A;  3IF6 A;  3T4J A;  2ZJ9 A;  1BLH A;  3CIT A;  1V9Y A;  4BMW A;  5HZH A;  3RJU A;  3SS4 A;  4IVK A;  2PRF A;  3ZYT A;  1P9W A;  3IHB A;  4Y5F A;  3KYZ A;  1OME A;  4N92 A;  1XGJ A;  3G4P A;  4CLC B;  1LSV A;  1G28 A;  4LFU A;  2XH9 A;  3W2Z A;  2J3T D;  3BFG A;  4X25 A;  4R3J A;  3IXD A;  2H0T A;  2Y2Q A;  2GDN A;  2ZQA A;  3D9Y A;  3BFE A;  4KG6 A;  1VET B;  1XJ3 A;  3KSF A;  4EUZ A;  3TE8 A;  3I7J A;  3RH8 B;  1MXO A;  4HJ3 A;  4RX2 A;  3A0S A;  3TRC A;  5AQ9 A;  4ARZ A;  5FQK A;  1W8Q A;  5FAT A;  2BG1 A;  4GD6 A;  4ETX A;  3T1Q B;  1PZP A;  3NC8 A;  3ZG7 B;  2PD8 A;  1TS7 A;  1KE0 A;  5BOH A;  5FQJ A;  1K54 C;  1P9R A;  2W0N A;  4KZ6 A;  3F1P B;  4JF6 A;  2A24 B;  3LIE A;  3MZD A;  3WS5 A;  4HH3 A;  4GS9 A;  2H28 A;  3JVU A;  4R0Q A;  5FAO A;  3BWL A;  5FDH A;  2HJE A;  2V9A A;  4E3K A;  4PM6 A;  4S2P A;  1Z6F A;  3HUN A;  4UA6 A;  2XF3 A;  4QHC A;  3OBF A;  1GHP A;  1ODV A;  3LIB A;  2R9W A;  5J4E A;  5HFO A;  4Q8I A;  4OQ0 A;  3E0Y A;  3S7Q A;  5FDS A;  3D3O A;  2V2F F;  4GJ4 A;  5TGF A;  2EX2 A;  1ONH A;  2WGW A;  4UQI S;  1W8Y A;  1K6R A;  5CEC A;  4KZ7 A;  1NYM A;  3PBR A;  5HDS A;  4WMC D;  5GL9 A;  3UB9 A;  4OVD A;  3E4Q A;  4ME4 A;  3UN7 A;  2JCH A;  3OCL A;  1FSW A;  3FG8 A;  4LRY C;  4ESP A;  1UGU A;  2HDS A;  4G3W A;  5I94 A;  2W3E A;  3LYX A;  1FIK A;  4LPZ A;  2M7V A;  2WAD A;  1H8Z A;  4L9G A;  4QY6 A;  2PU4 A;  3M6H A;  3Q81 A;  4WLA A;  4HP4 A;  4PM7 A;  4CLC C;  1Y28 A;  3BJN A;  4LRX C;  2EFU A;  4PHT A;  1TS8 A;  4U0T A;  3MQO A;  3CZD A;  2JN7 A;  3UME A;  3BLM A;  3VE3 A;  4OOY A;  3DW0 A;  3DAV A;  4X56 A;  4QWO A;  1YAX A;  1K0K A;  2O99 A;  2W27 A;  4PKY G;  5CGS A;  4F94 A;  1A0K A;  1S6R A;  4Q0H A;  4WUJ A;  2A49 A;  4IJG A;  4LV2 A;  3KYQ A;  2DNS A;  3UMD A;  4K91 A;  4FUW A;  4LGW A;  1NWZ A;  4K08 A;  5G4Z A;  2XGN A;  3C2W A;  3MJQ A;  5FL3 A;  3U2A A;  3B47 A;  2Y59 A;  1S66 L;  5K5B A;  4B93 A;  4JXW A;  3T4K A;  1LL5 A;  5TBM A;  4OLG A;  2ZC6 B;  1OTD A;  3VV4 A;  4FOF A;  2A3U A;  5FAP A;  4RVA A;  4BJP A;  3NOP C;  4WZ5 C;  3DTK A;  3CWF A;  1G68 A;  2R78 A;  3ZFZ A;  1K38 A;  1LI9 A;  3UPP A;  4KEN B;  1QME A;  5DTK A;  3MKF A;  1N4O A;  4YIN A;  3E4O A;  5AQB A;  3MMH A;  2P9V A;  1L3L A;  1GA9 A;  3K2N A;  3IBJ A;  4IBX A;  4UHU A;  4RX3 A;  1FSY A;  3TJZ C;  3T4L A;  4K0X A;  3VMA A;  3L9K A;  1ESI A;  3BLS A;  1IYO A;  2WAF A;  2EFX A;  1CI9 A;  2Y2L A;  3EEA A;  3C7V A;  3P7N A;  3UDF A;  4II7 A;  5LBR A;  5EVI D;  1STZ A;  5CX7 A;  2FH5 A;  4WMC A;  1KE4 A;  3ZVT A;  3BYD A;  5EOO A;  1K57 C;  3C30 A;  3VP2 A;  1TVF A;  1VQQ A;  3QNB A;  1XJ2 A;  2OAQ 1;  4E3M A;  3BY9 A;  1RGZ A;  1VB6 A;  1LL9 A;  3GRJ A;  5GLB A;  3VP4 A;  3DBA A;  2OOL A;  1LSW A;  3G2Z A;  5IS1 A;  2ZC7 A;  4PPR A;  5AVE A;  4Z1W A;  3V67 A;  1ZKJ A;  1JWZ A;  5HWV A;  4CQH A;  3QP1 A;  1S0W A;  1ESU A;  2I72 A;  2ZM2 A;  2J80 A;  4EV4 A;  3F1O A;  1I2W A;  4YFM A;  4DF6 A;  3BFD A;  1VM1 A;  4RA7 A;  4S2O A;  4EEP A;  3HL9 A;  4WN5 A;  1PNE A;  3GVB A;  3HJK A;  3S7N A;  4DN0 A;  2ZM0 A;  3VOZ A;  4WBG A;  4C6Y A;  3VP0 A;  1PZO A;  4FSF A;  5HAR A;  1IKI A;  1XKZ A;  5GHY A;  1W79 A;  2RCX A;  4EWF A;  2ZQ7 A;  5CTM A;  4D2O A;  4LV1 A;  2VEA A;  3RXX A;  1F98 A;  3IXG A;  1DP9 A;  3Q7V A;  1S67 L;  2XDM A;  1NLY A;  2WKR A;  1KGF A;  3C38 A;  4KZ8 A;  3T4S A;  3BQ8 A;  4DJ2 A;  2Z2M B;  1N9B A;  3VSK A;  4Q0J A;  1G5U A;  3PYP A;  4NXG A;  4PM5 A;  3G34 A;  2QPN A;  2XLN A;  1H0M A;  4EER A;  3R7W B;  1SDN A;  3MSH A;  1G6O A;  1RP5 A;  4BEN A;  4HJ4 A;  4LV0 A;  4HES A;  4IUH A;  5IT5 A;  2V0W A;  3E98 A;  1G6A A;  3LGO A;  4BL3 A;  3HRE A;  2H0Y A;  1RGY A;  3RXW A;  3B3X A;  1XP4 A;  2K7S A;  3BW6 A;  3OPH A;  4M4X A;  3WWX A;  4BBV A;  4E3O A;  2PAV P;  4EBP A;  2Y79 A;  2M7U A;  1VET A;  1YSP A;  2VV7 A;  3C8C A;  4LV3 A;  1ZG6 A;  4X55 A;  1NXY A;  4GW9 A;  4E3L A;  3EOI A;  2VGJ A;  5EVI A;  2KOI A;  4WEL A;  3IHA A;  2JKT M;  1KVL A;  1OTA A;  4KQQ A;  1KGE A;  4L0L A;  4X1M A;  3LCE A;  2X02 A;  3MBZ A;  3MS6 A;  4GB7 A;  1T1B A;  4D60 A;  4YWZ A;  3H7W B;  3LIC A;  2V20 A;  5J8X A;  5G4Y A;  3LUQ A;  1FQG A;  3UE0 A;  3MZF A;  4HQA A;  5A8B A;  3F1P A;  2PHY A;  4JGO A;  2A24 A;  4HH2 A;  2ZC3 B;  5HD5 A;  4MEZ A;  2UV0 E;  4X6T A;  3HLC A;  1L0F A;  3G35 A;  1L0E A;  1KDW A;  1GSV A;  4N1X A;  5EE8 A;  5EFW A;  4PAU A;  5AVF A;  3CI6 A;  2VGK A;  4UA9 A;  4OPQ A;  5HWW A;  3WS1 A;  1ERQ A;  1BSG A;  3C4P A;  3GSG A;  2ZMF A;  2EX8 A;  3T1X A;  4OPR A;  2PBY A;  4KZ5 A;  5DF7 A;  1OJ5 A;  1JTG A;  4FH4 A;  1OTB A;  3VP1 A;  3CHW P;  1K57 A;  1BYW A;  3HLE A;  3ZNY A;  4HIA A;  3BEB A;  5A91 A;  3UO9 A;  5GLA A;  4U3T A;  1P97 A;  4OQI A;  4NKP A;  2GJ3 A;  1Z09 A;  4JGQ A;  1FIL A;  4KZ9 A;  1KDS A;  2UWX A;  1OPX A;  3BFC A;  1RCJ A;  1D06 A;  3HBR A;  3Q82 A;  1SKF A;  4ZRR A;  3OPP A;  4C75 A;  1GSX A;  3T4T A;  1C3B A;  2XD1 A;  1JVJ A;  4O8G A;  1SKO B;  2R9X A;  2D02 A;  3HLG A;  5CRF A;  4JXG A;  3ZDJ A;  2ZD8 A;  3S22 A;  3F1N B;  4Y3I A;  3IBR A;  1T1A A;  5KSH A;  3SH7 A;  4UEY A;  4GHI B;  1YLY A;  4NET A;  5F1G A;  3IX4 A;  1V9Z A;  5HWT A;  2X01 A;  2OLU A;  5FQ9 A;  3PBT A;  4R4R A;  2WZZ A;  2WYX A;  2W3D A;  3D72 A;  4F3L A;  1NJ4 A;  1PWD A;  3ITB A;  2XFS A;  2EXB A;  4QY5 A;  3WS0 A;  5A93 A;  3D4F A;  3UE6 A;  4R4S A;  5GLD A;  1I5Q A;  4DE3 A;  1K56 D;  1YLJ A;  4P0M A;  3FYZ A;  3C5A A;  4WYY A;  5E2F A;  3A3D A;  4E04 A;  2FFY A;  4GN2 A;  4GNU A;  5J7E A;  3IWO A;  2RL3 A;  5F1F A;  5JYO A;  2C6W B;  3FPV A;  2ZMV A;  1CEF A;  1DY6 A;  4MLL A;  3VFF A;  4JBF A;  1EW0 A;  3ULF A;  3A3J A;  5AJG A;  3MKE A;  2HGV A;  1S4S A;  1D7E A;  3AGE A;  1CEG A;  3S4X A;  3S1Y A;  2XRN A;  2JKF A;  1Y54 A;  4O01 A;  3AGF A;  3CPT B;  1FOF A;  4H8R A;  3GMW A;  3IXB A;  3PXP A;  4OH0 A;  4R6L A;  2BLS A;  1XFN A;  1MC0 A;  2K2N A;  3TOI A;  3O88 A;  2O0Y A;  3NOT C;  5E2G A;  5F82 A;  4JXV A;  3HLW A;  1EI5 A;  2E8J A;  5F83 A;  3OLO A;  3EEH A;  2ZOH A;  5DKL A;  2W3H A;  4PM9 A;  2WKQ A;  3OPR A;  3IH9 A;  2V8C A;  1OT9 A;  4JGR A;  4YOF A;  5M19 A;  3MF0 A;  4H6J A;  2NUP C;  4B4Z A;  1BLP A;  2WK0 A;  3S7O A;  2AVX A;  4DKI A;  4EUV A;  2HPB A;  2JKG A;  2M1C A;  4FD8 A;  4XUZ A;  1BTL A;  3MXS A;  4ZJ1 A;  3TW8 A;  4CLC E;  1X0O A;  3ZG8 B;  3DWZ A;  4N9L A;  4O0P A;  1F5M A;  3FZC A;  4E3N A;  2ZQ8 A;  3NOU C;  4WEK A;  1WA9 A;  2Y2H A;  1PIO A;  2XR0 A;  1T18 A;  4S2L A;  4GLQ A;  2ZM8 A;  4DDS A;  1XGI A;  1SCW A;  1Q2P A;  2Y2M A;  1E4D A;  1XX2 A;  1YM1 A;  2VK3 A;  1ALQ A;  2PT7 A;  3NI9 A;  1ES2 A;  3OC2 A;  4R38 A;  2Z2L B;  4Y0U A;  4I39 A;  3SS3 A;  2NUT C;  3NY4 A;  5CHU A;  4QU3 A;  3P09 A;  3KX0 X;  1VEU A;  3G30 A;  1K56 A;  4OKP A;  3PAE A;  2L0W A;  4ZJ2 A;  3UNW A;  4WF0 A;  3HLB A;  2J9O A;  4S2I A;  3TSG A;  1SZV A;  1ACF A;  2Y4A A;  1MY8 A;  1PI4 A;  3CLO A;  3Q07 A;  2HDR A;  5TFQ A;  2V1B A;  2HZ5 A;  4EXO A;  5U47 A;  2H10 A;  5FQM A;  1YT4 A;  1IEL A;  3UDI A;  4LCM A;  2B18 A;  3MQ0 A;  1TDG A;  4IED A;  3FPW A;  4R23 A;  3P01 A;  4B4X A;  2VKS A;  1LI0 A;  2OV5 A;  2IWD A;  1S1Y A;  2ZQD A;  3PTE A;  2VX8 A;  5FI2 A;  2XQZ A;  1J9M A;  2ZC4 B;  4CJN A;  2H5S A;  4Y0T A;  5FEF A;  3HUO A;  2YKH A;  4CLC D;  4PM8 A;  3L7H A;  3V39 A;  4WM9 A;  4FH2 A;  3IS2 B;  3IWI A;  1XJ6 A;  3SH8 A;  1OT6 A;  4EW7 A;  2FFF B;  4LCL A;  5DKK A;  4NEE D;  2PR5 A;  2FZ0 A;  3Q7Z A;  1M40 A;  1CQA A;  3ZG5 A;  1K4F A;  4X53 A;  3T4Q A;  1TEM A;  4GOG A;  2ZOI A;  2G2U A;  3T50 A;  2BTF P;  5CGW A;  4ETZ A;  2Z6D A;  3CJM A;  3PR6 A;  4WEJ A;  4QJG A;  4GS9 B;  4KQR A;  5KZH A;  2W3G A;  2ACG A;  3PBN A;  2JC7 A;  5DTT A;  4HI4 A;  1ERO A;  1BLS A;  3ZCZ A;  2JE5 A;  1BUE A;  1K54 A;  5FSR A;  1Y4O A;  1FCM A;  1ZG4 A;  3AGD A;  5EV0 A;  1KGG A;  3VE4 A;  1F9I A;  4XT2 A;  2XA7 M;  1FR1 A;  1PYY A;  2B02 A;  3BM6 A;  1M6K A;  2WGI A;  1SHV A;  1L0G A;  3SS5 A;  2WZX A;  3LI8 A;  1YLT A;  1K55 C;  3N8L A;  3NDE A;  3ZHH A;  2WGW B;  1PRQ A;  2BAS A;  1LT0 A;  4I38 A;  2ZL1 A;  1W5D A;  1S1Z A;  4IVI A;  1FR6 A;  3C4O A;  5F5Y A;  1KVM A;  1Q2Q A;  3LFV A;  3LR4 A;  4MBH A;  3EQU A;  4S2N C;  2GZA A;  1LSX A;  3KO6 A;  4O7D A;  1ONG A;  5GHZ A;  2V1A A;  1DP6 A;  1YMX A;  5EPH A;  3BY8 A;  4GCZ A;  4S2K A;  2Q9M A;  3RFB A;  2EWV A;  2I9V A;  5CEB A;  4GD8 A;  2VV6 A;  5DF9 A;  1D1J A;  4P6B A;  5A90 A;  3W4Q A;  2OSU A;  2MJ6 A;  2OWH A;  2JBF A;  4OP8 A;  2X71 A;  3SH9 A;  3LR5 A;  2E8I A;  1WE4 A;  4Y17 A;  2HJ9 C;  3GQZ A;  1PI5 A;  1BLC A;  1GA0 A;  1SKO A;  2ZMA A;  4NK3 A;  1PWC A;  5A92 A;  3PBO A;  4PMA A;  2Q0O A;  2VLG A;  4X69 A;  4WL9 A;  2Y2N A;  2Y2K A;  4CLC A;  1O07 A;  5HPF A;  4B9O A;  3O87 A;  5TJJ A;  2PD7 A;  5TBM B;  3EGX C;  1XJ4 A;  3LR0 A;  3A3E A;  2VJW A;  2WKH A;  1NYY A;  3ZG0 A;  1CK3 A;  4E3I A;  5L07 A;  4DXB A;  3NCK A;  3QHY A;  3UE3 A;  1IEM A;  1W63 M;  2LB5 A;  2Y2J A;  4KUK A;  2KDK A;  3IXH A;  1ES4 A;  2VV8 A;  1UWN X;  2P9V B;  3HLD A;  1OJG A;  4DXC A;  4HP9 A;  4KG5 A;  2XSS A;  4LRZ E;  4FCF A;  5KSC A;  4E6X A;  5IU1 A;  4EQI A;  1CI8 A;  1SDE A;  2PU2 A;  4KZB A;  5DJT A;  5C5K A;  4WZ5 A;  3KSH A;  4X1L A;  4Y0O A;  5FQI A;  4K0W A;  4OQG A;  3CPT A;  1N9O A;  4HOI A;  4I5S A;  1HTZ A;  4LLO B;  5HAI A;  2OAP 1;  2W1T B;  1YSQ A;  4NXB A;  3NJA A;  3MFX A;  4P85 A;  2V8F A;  3LEQ A;  5HD3 A;  2JKR M;  2QKP A;  3WS2 A;  4OOM A;  5CER A;  3LEZ A;  1PFL A;  2ZC5 B;  5CHJ A;  4PKY A;  1PW1 A;  5CED A;  3M6B A;  1MBL A;  4MBF A;  3UB6 A;  5FAQ A;  3CAX A;  3DTM A;  1DRM A;  2J3W A;  3JVV A;  1PW8 A;  2KLI A;  1TS6 A;  4KQO A;  4OPZ A;  3A0V A;  2J3T C;  1T19 A;  3UB7 A;  3ICY A;  2O9C A;  4DDY A;  4R3A A;  4XXR A;  2W1R A;  3F1O B;  3IT9 A;  2HV1 A;  5L8M A;  1IKG A;  2PR6 A;  5E2H A;  2EXA A;  2XFT A;  4Y15 A;  2YKF A;  3N8R A;  4MCW A;  1ERM A;  4E6W A;  2P08 A;  3QP8 A;  3MQQ A;  3GR2 A;  3WRT A;  1FCN A;  1AWI A;  1W63 Q;  4HNB A;  5FI7 A;  1HD8 A;  2B95 A;  2HP5 A;  2GNX A;  4KZA A;  3N6I A;  3MXQ A;  1NZO A;  4FTX A;  2G2W A;  4EES A;  1K6S A;  1YLZ A;  2XA7 S;  4MN6 A;  4EEU A;  4IUK A;  4BL2 A;  3IQA A;  5HX9 A;  3WS4 A;  2VZW A;  5CHM A;  3MXR A;  3LY3 A;  4S2N A;  3BQA A;  4NXE A;  4JKT A;  3EQV A;  2IWB A;  3IX3 A;  3OCN A;  2ZQ9 A;  4DE2 A;  5AQA A;  3N7W A;  5DFY A;  3V3S A;  3ZG9 B; 
#chains in the Genus database with same CATH homology
 5AVE A;  1OTI A;  3EWK A;  4AFI A;  4Z1W A;  2PT7 A;  3V67 A;  3PBS A;  3OC2 A;  3RTY A;  4KUO A;  4R38 A;  5HWV A;  4BBU A;  2JHE A;  4CQH A;  1MKM A;  4I39 A;  5HL6 A;  2NUT C;  2HF6 A;  3LIF A;  2PYP A;  3LID A;  4P6Z S;  1NLZ A;  2J80 A;  3F1O A;  3KX0 X;  1NRJ A;  4EEP A;  2KX6 A;  2L0W A;  4WN5 A;  5HPI A;  2O9B A;  4WF0 A;  3HJK A;  5HDD A;  3S7N A;  4DN0 A;  3CLO A;  2O9A A;  4KQD A;  2QJ7 A;  1LL8 A;  4I3J A;  3T4O A;  2V1B A;  4EXO A;  4FSF A;  2QHK A;  3G6O A;  3IS2 A;  2VEA A;  4XT2 B;  4MN7 A;  5KIZ A;  2B18 A;  1F98 A;  3MQ0 A;  1DP9 A;  3FPW A;  3P01 A;  1ZHH B;  1S67 L;  2OWJ A;  1NLY A;  3A0R A;  2VKS A;  2WKR A;  3LI9 A;  3C38 A;  3O5Y A;  3T4S A;  2INW A;  3BQ8 A;  3EGD C;  4NXF A;  1S1Y A;  1T1C A;  2VX8 A;  4Q0I A;  4DJ2 A;  1MZU A;  2W3F A;  4Q0J A;  1KOU A;  4RQ9 A;  3NHQ A;  5J3W A;  3UB8 A;  3PYP A;  4NXG A;  4I3A A;  3FC7 A;  2YKH A;  3LR3 A;  4EER A;  3R7W B;  4CLC D;  1G6O A;  3KSG A;  3SW1 A;  3ZQ5 A;  2VGL S;  3IS2 B;  4HJ4 A;  4IUH A;  5IT5 A;  2V0W A;  3H82 A;  1XJ6 A;  1N9N A;  3E98 A;  1OT6 A;  4EW7 A;  3LIA A;  5DKK A;  3B33 A;  4NEE D;  2PR5 A;  2FZ0 A;  4YNR A;  2PDR A;  2EA9 A;  2K7S A;  3B42 A;  3T4Q A;  1H3Q A;  2ZOI A;  3BW6 A;  4M4X A;  3T4J A;  4BBV A;  3CIT A;  3T50 A;  1V9Y A;  4BBT A;  1S4R A;  4EU0 A;  2Y79 A;  2M7U A;  4ETZ A;  5DJU A;  3R4K A;  2A2L A;  4BMW A;  5HZH A;  2EWW A;  1YSP A;  2VV7 A;  2Z6D A;  3C8C A;  3PR6 A;  4WEJ A;  2VA0 A;  2K31 A;  4GS9 B;  4GW9 A;  4MMN A;  3EOI A;  2W3G A;  2KOI A;  3ZYT A;  4WEL A;  3MR0 A;  2LB9 A;  3PBN A;  1P9W A;  4HI4 A;  2XRO A;  4Y5F A;  3E4P A;  3KYZ A;  2JKT M;  3GEC A;  1OTA A;  3H82 B;  3K3C A;  4L0L A;  4CLC B;  3KSI A;  1LSV A;  1G28 A;  2L4R A;  3W2Z A;  2P04 A;  3VE4 A;  4I3I A;  2J3T D;  3HJI A;  1F9I A;  4XT2 A;  2XA7 M;  3S7P A;  2B02 A;  1T1B A;  3LI8 A;  3CUE C;  4YWZ A;  3H7W B;  3LIC A;  5F6A A;  5G4Y A;  1XJ3 A;  2Z6C A;  3KSF A;  3TE8 A;  3LUQ A;  4EQ1 A;  2QWS A;  3RH8 B;  2BAS A;  4HJ3 A;  1LT0 A;  4I38 A;  4HQA A;  1S1Z A;  3F1P A;  5A8B A;  2PHY A;  3A0S A;  3TRC A;  4ARZ A;  5F5Y A;  4JGO A;  2A24 A;  4HH2 A;  4MN5 A;  3LFV A;  3LR4 A;  5HD5 A;  3EQU A;  4ETX A;  4G3K A;  2GZA A;  5HSQ A;  1LSX A;  1GSV A;  3R7W A;  3KO6 A;  5EFW A;  2V1A A;  2PD8 A;  4PAU A;  1DP6 A;  1OTE A;  5AVF A;  1TS7 A;  3CI6 A;  3BY8 A;  4GCZ A;  1P9R A;  3RFB A;  4EET B;  2EWV A;  2I9V A;  5HWW A;  3K3D A;  4BWI A;  2W0N A;  4F3L B;  2VV6 A;  1VHM A;  5DF9 A;  2ZMF A;  3HCY A;  1XFQ A;  1ZTU A;  3F1P B;  2PYR A;  2MJ6 A;  4R70 A;  2OWH A;  4ARZ B;  2A24 B;  3LIE A;  3LR5 A;  4MDZ A;  2HJ9 C;  1OJ5 A;  4HH3 A;  1OTB A;  4GS9 A;  2H28 A;  3JVU A;  3BWL A;  1BYW A;  2ZBB A;  2HJE A;  2V9A A;  4HIA A;  3PBO A;  2VLG A;  4WL9 A;  1P97 A;  3OBF A;  4CLC A;  4NKP A;  1ODV A;  2GJ3 A;  3LIB A;  4JGQ A;  5HPF A;  4L9F A;  5J4E A;  4B9O A;  4IHQ A;  4HHD A;  1OPX A;  5HDC A;  5TJJ A;  3E0Y A;  3S7Q A;  1H8M A;  4HJ6 A;  2PD7 A;  3D3O A;  5TBM B;  1D06 A;  3EGX C;  1XJ4 A;  3LR0 A;  4GJ4 A;  4ZRR A;  3H7W A;  4UQI S;  1GSX A;  2VJW A;  1DP8 A;  4HY8 A;  3T4T A;  2QYB A;  3PBR A;  5HDS A;  1UWP X;  4O8G A;  3UB9 A;  3E4Q A;  4ME4 A;  2D02 A;  2GX5 A;  3UE3 A;  1W63 M;  4LRY C;  2LB5 A;  3FG8 A;  3OCL A;  4KUK A;  1UGU A;  2KDK A;  2VGL M;  3F1N B;  2W1T A;  4Y3I A;  3IBR A;  2VV8 A;  1T1A A;  1UWN X;  4G3W A;  5KSH A;  2W3E A;  3LYX A;  4LPZ A;  4UEY A;  2M7V A;  2IA2 A;  1OJG A;  4GHI B;  4HP9 A;  2JKT I;  3H9W A;  4QPR A;  2XSS A;  4LRZ E;  1V9Z A;  5HWT A;  1IFQ A;  4L9G A;  4OOL A;  3PBQ A;  3PBT A;  4WLA A;  5IU1 A;  4HP4 A;  1JNU A;  4CLC C;  2WKP A;  2W3D A;  3D72 A;  5DJT A;  1Y28 A;  4H6J B;  3BJN A;  4LRX C;  5C5K A;  4F3L A;  1TS0 A;  4PHT A;  1TS8 A;  3KSH A;  3MQO A;  2JN7 A;  3UME A;  3VE3 A;  2DMW A;  3VOL A;  1GSW A;  3UE6 A;  1N9O A;  2L1M A;  1YAX A;  2CMN A;  4HOI A;  3OOV A;  2O99 A;  2W27 A;  4I5S A;  4PKY G;  4LLO B;  2OAP 1;  2W1T B;  4Q0H A;  1YSQ A;  2P7J A;  4WUJ A;  4NXB A;  3NJA A;  3MFX A;  4IJG A;  4E04 A;  5J7E A;  3KYQ A;  5HD3 A;  2JKR M;  3UMD A;  4DMZ A;  2QKP A;  2V0U A;  4JGP A;  4L9E A;  3FPV A;  2ZMV A;  4OOM A;  1P0Z A;  2JKR I;  1NWZ A;  4K08 A;  4P6Z M;  5G4Z A;  3C2W A;  3MJQ A;  1EW0 A;  5FL3 A;  4PKY A;  3ULF A;  3U2A A;  5AJG A;  3B47 A;  2HGV A;  1S4S A;  1D7E A;  1S66 L;  5K5B A;  4B93 A;  3T4K A;  3UB6 A;  2XRN A;  3CAX A;  1DRM A;  5TBM A;  4O01 A;  2J3W A;  3JVV A;  2KLI A;  1OTD A;  3VV4 A;  4FOF A;  3PXP A;  1TS6 A;  4KQO A;  4BJP A;  4R6L A;  3A0V A;  2J3T C;  3NOP C;  1T19 A;  3CWF A;  3UB7 A;  3ICY A;  1XFN A;  1MC0 A;  2R78 A;  2K2N A;  2O9C A;  1TD5 A;  4R3A A;  2W1R A;  3F1O B;  1IOU A;  4DJ3 A;  5MC7 A;  2HV1 A;  5L8M A;  2O0Y A;  2QJ5 A;  2D01 A;  3NOT C;  3F1N A;  2PR6 A;  3E4O A;  2YKF A;  3MMH A;  3OLO A;  4GHI A;  4MCW A;  3EEH A;  2ZOH A;  3K2N A;  2G7U A;  3IBJ A;  5DKL A;  2W3H A;  2P08 A;  2WKQ A;  3TJZ C;  3MQQ A;  3T4L A;  4Y2F A;  1OT9 A;  4JGR A;  1W63 Q;  4YOF A;  3MF0 A;  4HNB A;  4H6J A;  2NUP C;  3GDI A;  3CUE A;  2GNX A;  2Y8H A;  3S7O A;  3MXQ A;  1TF1 A;  4EUV A;  3EEA A;  3P7N A;  4EES A;  4G3V A;  2XA7 S;  2M1C A;  4II7 A;  5F68 A;  4MN6 A;  5LBR A;  4EEU A;  4IUK A;  1STZ A;  5CX7 A;  2FH5 A;  3TW8 A;  4CLC E;  1X0O A;  5DFX A;  2VZW A;  3C30 A;  4O0P A;  5I5L A;  1F5M A;  1XJ2 A;  2OAQ 1;  3BQA A;  4NXE A;  3EQV A;  3BY9 A;  3NOU C;  5F69 A;  1VB6 A;  4WEK A;  1WA9 A;  1N9L A;  3DBA A;  1T18 A;  3OCN A;  2OOL A;  4GLQ A;  1LSW A;  3PHY A;  4UQI M;  5DFY A;  5IS1 A;  1YKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...