3FQ4A

Crystal structure of the calx-beta domain of integrin beta4
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
109
Chain Sequence
MRDVVSFEQPEFSVSRGDQVARIPVIRRVLDGGKSQVSYRTQDGTAQGNRDYIPVEGELLFQPGEAWKELQVKLLELRQVRRFHVQLSNPKFGAHLGQPHSTTIIIRDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Calx-beta domain of the integrin beta4 subunit: insights into function and cation-independent stability
pubmed doi rcsb
molecule keywords Integrin beta-4
molecule tags Cell adhesion
source organism Homo sapiens
total genus 25
structure length 109
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3fq4A00
3GINA 3RB5A 2QVKA 3FQ4A 3RB7A 2FWSA 2LT9A 2KLTA 3E9UA 3EADA 3FSOA 3H6AA 3US9A 3E9TA 2DPKA 2QVMA 2KLSA 2FWUA
chains in the Genus database with same CATH superfamily
1IC4L 4KRPD 4RIRA 1NGQL 2CNYA 5AWNH 1E2WA 4JK0D 1NL0H 1QQDA 4HPHA 2W38A 2EDWA 4HK0A 1AG6A 4QCIA 3WFCH 2GAZB 1QLFA 5F7EH 3SCMC 2J25A 4NQDE 5I2IA 3GRWA 1L5GB 3HG1A 5ERWB 1IT9H 1VGKB 2K78A 4NQQA 2HSIA 1BBJB 1OAZL 1GC1C 3HBZA 4OZFG 1E4XI 2WXIA 1A7NH 4HUWA 1EHLL 4B9YA 2E56A 2YKLL 4NT6B 3T4AC 4XMVA 1XF4B 4ZNCD 1HCYA 1E6OH 1QFHA 3KNBA 2ZAIA 5E6IC 2F1EA 1X44A 3MVSA 2V9UA 5DWUH 2G60L 4JKKA 1KZYA 1B6UA 1XGPA 3OKNA 4JDVB 4JFEB 2GJ6A 4C47A 1MRDH 2JMRA 6PCYA 4N2CA 5AW7B 2EDBA 4ACTA 1VDGA 1LWJA 2XV6B 1XBDA 5I8EA 1VFOA 2L4OA 1KB5A 2R27A 1LE9A 2DQJL 3ISYA 4F9PA 1IFHL 2FD6L 4NHUB 5KYUB 2AVFA 3CVHL 3DDGA 4JFED 5KN5B 2EAEA 2AQTA 3CDZA 2UYLB 4YSPA 1EA9C 1LEIA 2WB7A 1YNLL 1EEUA 4YHOL 5E8NB 4PJAF 4HT1H 4A66A 15C8L 3P69A 3B37A 4GBXD 5C92A 1ET5A 1CG9B 4OB5H 1PY9A 1Y6MR 2WXFA 5JOEA 3K4AA 4QRTB 2BSSA 3FONA 2WW8A 3SPJA 3VU2A 2V7NB 5IR1A 5L0QB 2NT0A 3P3RA 3PXHA 3BJ91 2APTA 4X8GA 4XO8A 4OZFB 5KOVC 3R8BB 4DZBB 2F58L 2G2RB 4GP5B 1AC0A 4M61A 2NSXA 3LNDA 5K9OA 4TQHA 3GI8L 1U8IA 4WHCA 3GSWB 1YEKL 2WN2A 2W07B 4M5SA 4XOBA 1XSJA 1BPLB 2HFEB 3A6CL 5IFJB 1DQDH 4O51B 5DVMA 1ONQB 4YC2C 1K3IA 3F7VA 5DR5L 3KMDA 5D7HA 4XVUC 4GXVH 5DJ8A 3SQBA 3QB7C 1PG7H 3FCSA 1MFBH 3JWDL 2ETWA 1QD0A 2EDQA 1HHGB 5KSBE 4UMSA 3RZWA 2AJ3B 4PJ8A 1R3JA 4GSDL 2MCMA 1JXFA 3JVFC 5HYSA 3QIUC 1AZUA 2PYED 5LQBL 1HIMH 3RU8H 2VW7A 1U8PB 2FEDC 3SY6A 5I0DA 4YO0B 1O7SA 1JERA 2EEFA 3FOMA 4YFLF 4X6EB 2R0WH 1J1PH 1V7NH 2XWJA 4Z23A 5CD5C 4AMXA 4L9DA 2VXVH 2JB5L 3MACL 3SE4A 1Z3GH 1DBML 5KVEL 2VN7A 1AGBB 3UAJC 1MXGA 3BVTA 5AZ2H 2WANA 4ZG1A 3A5VA 1JYXA 2QPEB 3HUJB 5DHEA 2BNRB 3OKEA 1JDCA 4L1LA 3TV3L 2CBPA 1A6VH 1HE8A 4UNUA 1VFAB 3TWYA 4UQ2A 1JN6B 1QA9A 4MJ6B 2PR4H 5AVSB 1NOAA 4DOHB 4WFHD 1WUZA 4TSBH 2X0UA 4F7EB 5DMIL 1KCLA 4WCYL 4ODSH 4FKKA 3UYPB 2YARA 2VM9A 4JL1A 4S1DC 4Y2DA 4P46B 1HEZA 2QEJA 4HKXA 2G3MA 5CCJA 4KFZC 1ZLVK 2C1OA 2HJLB 3O11A 5DT1H 2PTVA 2APBA 5HDBE 4XMLL 3MRGB 6CGTA 3FKUS 4U1MA 1XF3B 4PQXA 1JCKA 5DJ6B 3WYRA 3MXWH 5HYQB 3U2SA 2XZZA 3DX9A 4ZSOA 1VKXA 3SE3A 5EZJA 2XZAL 1GZPA 4M4RA 2XKUA 4P2QB 4P46D 5F3HA 2ZWSA 2PP9A 3UROR 4LT7A 1MQKH 3S3BB 4Q0XH 3B2DC 4YS4A 3D2UB 4NO2A 1LO2L 4NSKA 4NKMA 6TAAA 1XXDC 3APDA 4XP5H 3VXSE 2VSDA 4JG5A 4AQ8C 3QDMB 3T8MA 1GW0A 4MJIB 4JZJB 4Z78A 2K3HA 1QEXA 4G6JL 3DETC 4YWGH 3FB8A 3IFOB 1OM3H 4DIXA 3QFDB 4P2QD 4G42B 5K9JL 2Y2WA 3IVKB 1QSFE 2CHDA 4X5WB 2DY2A 3HZKB 4KK6D 3PJNA 3N42F 4F7MA 3QHFL 2JJTC 5GSRA 4D0BB 4LARH 2J8UA 3NCYS 5I30H 1P4IL 4MJID 1B0GB 4M5YH 3FQRB 4PRHD 2O1AA 4HJ0C 2X2UA 1L0YA 2YZ8A 3EXJA 2WLYA 4FEMA 4MD0B 4OUOA 1OT1A 2FO8A 4NM8H 4Y4HA 5KWYC 1VZGA 1SVCP 5HHNB 2R2EB 3QO0A 1HKFA 3QBTB 3SJVD 4HKBA 5FCUL 1E9QB 1MW0A 2HXAA 4U1KA 4KZEL 3CK0L 1E27B 4NGHH 2R2HA 4U1LA 5KYXB 2H4EA 3D3VD 2K3TA 4G7YH 2IG2H 4Z5RB 4K7PH 1GZQA 1I7RA 2A2QT 1UJ3B 1X5ZA 3BIKA 5INCB 3MKGA 5A3IC 1UD8A 3LNIA 2OZ4A 2P52A 1CLZH 3VRIB 4B9IA 1JMXA 3DWTA 3ARFA 4OLXL 4LL9A 4RGNE 4A63A 2RMNA 2HWZL 5CF3A 5HGDA 1AR1C 1LWRA 3QUKB 1EAPB 1ZT7A 2G2NA 3DV6A 5IGXL 43CAA 2W9DL 2ZPKH 1KGCE 4U6HA 2H0JA 3UTTB 5I0XA 5LDUA 2WZAA 2E74C 3LZFL 1FPTH 1H15A 4MXQD 5B8CB 2Z65C 3ZZ1A 4GKZA 1E5UI 3H7LA 3N1FC 1BOGB 3AW5A 4IKJA 4LHUG 1G5GA 2A1WH 1EUUA 4OLZL 1HCFX 5E6UB 1UZ8B 1XIWA 1QFPA 2UY6B 1KCSH 5H35A 2W5PA 3O41B 3VMPA 5JORA 2AXFA 4HIPA 3GHEL 1NAMB 3X12A 4CN6A 4Y5XB 3UTTD 3BLPX 4UT9L 3BW9A 3U2IA 1N26A 4CW1B 5HVFB 1YEJH 3Q1SH 3RDTA 5BVJB 3FUIA 4M1GH 4E36A 2AJYH 5E08H 4QOKB 4K7PY 4Z76A 1UCBL 3NSFA 2J8UF 2WAQA 4QD2E 2V2TB 4PRPE 4NKQB 1FRGH 3J07A 4HBCL 5ICZB 4N90E 3IXAB 3B7TA 1JJUA 1B90A 5K5YA 1SBSH 2ZX7A 4M7LH 2FJHA 1K4DA 2CJSA 3ZX1A 1P7HL 4Z7OB 5AW3B 3RUGE 4H4NA 1WITA 4QOKD 3TLRA 3EW3B 4ZRGA 3KL0A 4Z0BH 3WXWH 3OJMB 4K07A 4DN3L 1T5XA 1IX2A 1JF1A 1JV2B 1W91A 2LE9A 4KKLD 3OSVA 5CINL 2YD5A 4KVPA 2V37A 5T5NF 4C54A 5JHDA 3VXMA 4XGZB 3STBA 3WFHB 3M7OA 4E0RA 2R9HC 3V0IA 2W60B 1ECZA 3UJIH 2VUOA 5F3BA 1FVCB 4JFFB 5DJDB 4D8PB 4GIAA 3K71A 3WMPA 2F68X 3EAKA 1CIUA 1KCUH 1NJ9B 2GI7A 4PJCE 3BH8A 3FT0A 4J3XA 5GZNC 4WJG3 4DETA 4EI5C 3REVA 2B15A 4LHUB 3V0DA 4H8WL 4U4BA 1OCCB 3FCTA 2DB8A 4JHWL 1SMAA 3K74B 2C3GA 1TJHL 1SN0A 5KS9E 2XETA 4URKA 4IBWA 1GC1H 1HILB 4PJHB 1MQ8A 4M1DL 4Z3GA 4D0CA 3OC5A 1S4IA 1FNFA 4FZEL 4KJWC 3IGFA 3MV8A 3MAWA 3RIKA 3HHSB 4GSQA 3WIIH 3NH7H 3FDWA 1UYWL 4LHUD 2HJKA 1IGMH 3PGDA 5F93C 3RJOA 3C87A 4HJSA 3OGOE 3BSHA 4NZUH 5HGAA 2DQHH 1U8LA 5CSGA 3VD0A 4IOIA 4PLKC 1G6RA 1F18A 4NZDA 3HJEA 4HUXA 12E8L 1AHMA 4UAOC 4WHYH 1NBQA 5FUZL 2VXQH 4TQIA 2FGWL 2NXZC 4NJAL 4XVTL 4F33B 3LS4L 2UWEA 4RWHA 3THMH 2Y1AA 4KXZI 4LGRB 4EI6B 3CU7A 3QWNA 3SIKA 5SWQB 2EECA 1N5YL 3DV4B 4WFGE 1FO0H 2ZXBA 1H3WM 1RD6A 5JW4N 4I4WB 3CXDL 4YMPA 1KN2H 1QNZL 4WK4B 5FM8A 1ADQH 3VVVA 4Y4FA 1X5GA 2FX7H 2XQBH 4JKNA 4YQXL 3S88H 1FFRA 2HH0H 5L8KB 3MRBB 1G0XA 1TF4A 2XN0A 1KNOB 3LN4A 5GS3A 1IQDB 2WBXA 2F74A 3U82B 3WEBA 4HAFA 3TIDB 2RGSA 5E2TH 1TU2B 1YECL 1A6ZA 1FIGL 1VFUA 1G9NH 2EH7L 4AENB 4HWUA 2BZ7A 2BP0B 4JRYB 3KLHC 3EYUH 1F2QA 3HBPA 4UZUA 2LABA 4L2LA 1UUSA 1CIDA 4TUJB 4HV8B 4PJEE 5DEGA 4XX1E 3MV7A 3PNWA 4KY1L 4EBQL 4JM0A 1QEWA 1WQVT 1X7QA 5C0DB 3UGUA 1WJ3A 2IO5A 4DPBX 2MKLC 5BV7L 3V2AR 1BQHG 5EC1A 3M1BB 4WK0B 3W0WB 5I6LA 3Q8EA 4JM2F 3GXPA 1BHGA 4P4KB 4G1MB 3C6LA 4TNWK 3KYKH 3EBIA 4OBSA 4U6XA 5CS7A 4Z3EA 1DL7H 5CMAA 4GMTH 1DQLL 4H40A 4S1RH 3BAIA 3MJ8B 3TTYA 3MLRH 5A2LH 1HAWA 4RWYL 2AABL 1WA2X 5GIRA 4QKTA 3WELA 4JJ5A 2PPFA 5EO0A 5HHOD 2B16A 2OULB 4CILA 2COVD 3IJYB 5JA9A 1QLRA 3QRLA 1YNKL 1ZEAH 2F2HA 2XXGA 2X9ZA 3W0WD 4JFPA 1HH6A 1UWEH 2BM3A 4DKFH 3EGSB 4P4KD 2UWEF 1FAKT 2BRRH 4R7DB 2A0LC 4TV3A 5G5DB 3WUWA 4NQVA 4QRQA 2QQLL 2NW3B 1CICC 1E28B 3IB4A 1OB1B 1ZLUK 1L9MA 1RERA 2P47B 5IHUH 3VXTB 3CDYA 1S7UA 1LO0L 4OJFL 1IBGH 3LPGA 2CU9A 3OAUH 4FTVA 1IBDA 3RIFK 1TXKA 1UADC 3IDMB 3U9UB 1R5VB 4ETYA 5FA4A 5I73C 4GAJH 4IU3B 2AQSA 5C0FB 3FRUA 4PCTA 1CZ8H 2H5UA 1QFOA 4YUEH 3QCUL 4E9YA 1PZBA 4FAAB 5EBGA 4GAFB 1G7LB 1RUQH 4RISL 2QVFB 3Q44A 3RPIB 5IREA 2J1ZA 1GS8A 5FOBA 2KQNA 4L8SA 2I07A 1EZVX 2CM5A 4L5FL 2XQ0A 3O6LH 5ITFB 2R0KL 3KBHE 2KI6A 4Z6AT 3CDCA 3I50H 3FXIC 3SE8H 4YSQA 2DV6A 4UUJA 5D1ZA 1VF5C 1JXDA 1NPNA 4OW6A 1R5WB 3TEZA 4WHDA 1ZSDB 2A74B 3FH7A 1TYRA 4RAVB 5I6PA 3WMSA 3F12B 1MUJB 1QTPA 3EFOB 2C1PA 3MRPB 4K5MA 4WWKA 2PXYA 3LN5B 2F8XC 2GIYA 1A9BA 4YK4C 1PZDA 1OGAD 4L5FE 1XH3A 3DOSB 4GKSA 3BUDA 4MSWB 3NIGF 4FFZH 3RTLA 4YHPB 5KG9B 3Q5YA 4JE4B 3F01A 5B1JA 2A38A 3QRGH 3TBSB 2UXVA 4OQTL 2WGNB 3C5XA 4XC1H 1YMMB 4XVSL 3TN0C 2AEOA 3QQ3A 4ONOA 2UY7A 1UD2A 5EU7E 5M7QA 5I1AB 3D6GA 3O8XA 3U0PA 2P8PA 2HVJB 4QKXB 1U8OA 3BN3B 2ZYHA 5BZDA 4KNSA 2RCSH 4MS6A 1E4XH 2XTJE 2PCFA 1FYTA 3JWDC 1XO8A 4U33A 3K81A 3I02B 4WTZA 4XCYB 3DX7A 2XNAA 4FFWD 5CD3B 3DXAE 4P2RE 5C0NC 1NDMB 1CO1A 1BZOA 4I0PD 4QRRD 4HG4K 4EZKA 3QORB 5DQJA 3HE7A 5CEZL 5I1GL 4LOFA 1I9JL 1P5VB 3AXIA 3FU5A 3GLEA 1JFQL 2YMXH 1N9PA 4BELD 5LGKA 2BVQB 3OPZL 1NCCH 3DHPA 2XBZA 3M8OL 2VWEE 2J6EH 4G6ML 4IIQB 4ODWA 2XZCH 2QVIA 4Y19D 3VE0B 3ZK0A 4L4VE 4HKZB 5EOCJ 3QORD 1A4AA 4M93C 3ZYJA 2Y22A 5EZPA 1Z5HA 1RHHA 3AG2B 3RFRA 2ZE0A 1FH5L 3OMZA 3CN0A 4ZMYA 5AW4B 3HPLA 1VADB 4GUCA 1H5BB 2BNQA 4KHXH 3QPXH 4X9GA 1XF2A 4WW2F 1SJMA 5TGBA 5HVGB 5HDQH 4XWOD 4Z7UE 2XBDA 4NFDA 3ABGA 1SY6A 4Y5YB 3UBXG 4GW4A 3EYQD 5IIEB 5K9KB 3FQUB 1BDYA 1I1AA 1V10A 4HXBL 4A68A 2BVUA 1PU0A 1WBZB 1WISA 3DURA 3ENEA 3M07A 4KTDL 4TF4A 4WWID 4KC3B 5AW2B 1AGEB 2B1OA 5G55A 4FFVD 4HIIA 1NGWA 4Z3JA 3OLGA 2TSAA 3P30L 2FYYA 1MF2L 4PJGB 4WNJA 2OXGB 3QPQC 2JJVA 3MJ7A 1GHFL 4F37K 2IQAB 2R69H 5FV1L 1KXVC 3F05A 1ZT1A 4L29B 2G5BA 2ZWZA 3ZRFC 4ZW3A 2GTQA 1ZIAA 3TL5A 4PMFA 4XNYH 1JNHA 1BD2A 5IVZB 4ICXA 2IBGA 3RTQD 5ABZA 1TR7A 1UXSA 4LCWE 3VXRE 2CXKA 3QDJE 3SYAA 5GGVH 5A2KH 3V7AE 3FBQA 2X89D 4HH8A 2XFGB 5EULV 4Z3FA 1NGPL 1OLLA 1ZPLA 3BPOB 1HOEA 2FUQA 5FC9A 2V33A 5DMJB 3BEWA 3MLXL 1WUNT 4BFIB 5FYLL 4KGLA 3IBOA 1KG0B 1NFDE 4ZW5A 4P3DB 4JY4B 1CGSH 3HZYA 3MUGB 1IE5A 4PJIA 1NSNH 2R4SL 4MMXA 4LL1A 4QGTA 3U48A 4N2NA 2BOBB 3VYOA 1T0MB 4MCYA 1X7TA 2YMTA 2XSKA 1FL6A 2JXMA 4RGNC 4L4TE 2FYVA 5I71B 5IFHL 2DKUA 2JJWA 3C09C 1WZ1L 4JPQA 4R4BA 4F7PB 3ATBA 5DD1H 3VACA 2TAAA 3NRFA 3MRQB 1XGYL 5FYLE 3CFNA 4JFDA 3U0WL 4GQQA 4KUZH 5DVPA 5SX4I 4XBMA 1S7VA 5INDA 1XSIA 2NCEA 4X4YA 3F6LA 4PWEA 1NCBH 4KOCA 4ZS7H 1GOGA 4FQCL 3T2OA 3ECWA 4HOXA 5EU6E 2KL6A 2HRPH 2Z0UA 3WHXB 4GXFA 1YEEL 2AC0A 4IRZA 4M6OL 5GGVY 2DMKA 3RWCB 5JO5A 2A6JA 4J4PD 1HHIA 3OLEA 3OAYK 2E7CA 3MOAH 2AZUA 4G70B 1D5XA 1CDHA 1A3RL 3BUIA 2NY4C 5GRUL 3SKNB 3HN8A 2CALA 4XMPH 4XZUB 4HS6B 1RUPH 3AUWB 4KKAD 2EQDA 2J1XA 1JMZA 2DZEA 3ESMA 4Y88A 5KJRH 3ARSA 3GSUA 3TF7C 3PG2A 3WKPA 5AALA 4F3FB 1KMGA 1JRHL 2H32B 3OSKA 3D85D 3KPQB 3WSQL 2P49B 1Q72H 4I18C 4PV8A 1MRCH 1F1AA 4NQEE 4RFOH 1QBLH 4S1SL 2E59A 1L0QA 1HQ4B 3PWPE 4JFYA 3ZOAA 5CJ8A 4LRIC 1SF5A 3MRJA 2IPKB 3W9DA 4LL4A 4UV4H 2OTPA 4PJIF 2AFNA 2K9UA 2Z34A 3S9DB 1QASA 1IU1A 2XYCA 4XBEL 1M1SA 5EBLB 4C59B 1I1YB 4IK7A 1KJMB 3L4CA 2BZCA 3UTQB 4LNRA 5BOZG 3IFLH 2BIPA 5I5MA 4YBLC 2ZKHL 1SNRA 4IHOB 1T7WA 3SOBL 2FSEB 2CMRH 2ERJB 1Q0XH 3EJTA 3V5KB 2X3AA 5JPMC 1SJVA 2DWEA 4CMMB 3WDIA 3IDJB 4H26B 1BW8A 5IV2B 4ZDHA 2EE9A 2Y4SA 1IKFL 3ISWA 4G8FA 2DQDH 4XNZC 1E4WL 1QR4A 3VB9A 1W15A 3X14A 1C1EH 5JR1H 3QJXA 3FQNB 8FABA 1MCDA 4XP4H 5CBEB 3V0HA 3MU3A 3ARQA 5K59E 5A43C 1R3IH 3MBXH 1A3ZA 1IC4H 1EHKB 4B9CA 2ADIA 4UINL 4ELME 5DCCA 1NGQH 4Z7VA 3P0GB 3FL7A 4G1EA 2OSYA 3K8KA 1MZYA 3CE1A 3TA4D 4J8RB 1MXDA 2CNZA 2ZAHA 4GI9A 1DEDA 4XMWA 4YSRA 4DHLA 2BVOA 5CLYA 4XCEB 4CADA 3GRGA 1G7IA 4AL8L 4PV9B 5IVXE 4F8LA 1UA6L 3BAEL 1OAZH 4RIRB 3CN1A 2BC4B 5EBMA 3FQTA 4A7QA 1EHLH 2YN3A 4QHNB 4QO1A 4HK0B 4QCIB 5HYEA 4OCLC 1H8NA 2R4RL 1RZJC 1QLFB 3ARXA 2XWDA 5IEKA 2C34A 2IQ9L 4JRXE 5I2IB 5EWIL 4Q8BA 1DJSA 1WPCA 1PX3A 3HG1B 4UU9B 3DARA 3FTGA 2KS0A 4X98B 5E1QA 3UJJL 2G60H 3KGRA 2R83A 3KG5A 1C5DA 1W0YT 2FBOJ 4HUWB 3EO0B 1RUKL 3RQ3A 1J0JA 4U6YA 4J39A 2X0WA 4Q6IA 1Z9PA 2ARWA 4N2IA 1BQLH 3QUMA 1TVBB 3F6IA 3KEHA 1FIEA 1S78D 3O2VL 4TQPA 2ICES 1NIDA 3KNBB 3QUZA 1IV8A 2DD8L 3IE4A 3HG1D 3EJZC 4L23A 2ZSWB 3P9WB 4JQVC 2CE6A 2DQJH 1IFHH 1U91A 2FD6H 3OKNB 2JH2A 3CVHH 3US1A 2GJ6B 1Z9NA 2E7BA 3GSXB 1PSKL 3J27A 5DA4A 5HYSG 2NYKA 1YNLH 5I8EB 1CLOL 1F00I 1P7KA 4YHOH 2JIXA 3B8SA 4XCNB 15C8H 1LE9B 2BY3A 3OZ9L 5H4YA 4B60A 3FH8A 2Y24A 3APNA 4Z7VF 4HK3J 4JJOA 3CDZB 1FNSL 1FORL 1KTBA 2DOCA 5ISZB 2ZIDA 3PXJA 2GJ6D 1LEIB 1VESA 4YGAB 2X05A 4ZYKA 4ZZFA 3EOTL 3ZDXF 1AZBA 2YAEA 4HF5L 1CF8L 3Q5TA 3QQDA 3WN6A 2F58H 4JQXA 2OMBA 2JKRM 1NANI 3HMXA 5HPMB 1IILE 2G3XA 3EADA 3GI8H 3LNFA 4PJDE 1NLDL 5F0LB 5ENWA 5BV7C 3VGDA 1YEKH 3NSYA 1ZHNA 2BSSB 3FONB 2XY2A 3QGVA 2XN9A 4IS6A 3A6CH 3OVUB 3C5ZA 5IR1B 4FTDA 3S5LG 4EIGB 4QXGL 3TESA 3V0GA 4AEFA 4IMKA 5MEQB 5FR3A 3JWDH 5DS2A 1ZDSA 3TFKC 5KVGH 5J3HD 3ULVD 1U36A 3D1MC 4GKNA 5K9OB 1U8IB 3MLPA 4I85A 1GA2A 4APQA 4G8EA 4GSDH 4LLAA 1NMAL 3KLLA 2CQVA 2W0PA 2OV0A 1H8LA 4HLZG 5L88L 2CJUL 5I1CL 5LQBH 1JZIA 1CXFA 3VFOA 2E5EA 3D07A 3F7VB 3E1F1 5DJ8B 3FU6A 3FCSB 5MEOA 1AOZA 2NY7L 4W9ZA 4JFZL 5KW9L 3PWJA 1Q9LA 2J6WA 2JB5H 1JGDA 3MACH 1XXFC 4AE1A 1DBMH 4NBXB 5KVEH 4KVNH 4J3WA 4PJ8B 1R3JB 4LQFL 3KPSD 4AMKH 3KZ8A 5HYSB 1Y18A 4EIBA 1ZTMA 4D9LL 1M56B 3QS3A 5FW8A 3MUJA 5DJXA 4YPJA 3W11D 1U33A 5E1HB 4YDLC 1EJ8A 4PBDA 2X7LB 4LB8A 4OLUL 4C4KT 4X5PA 3N06B 3TT3L 4KROB 5F97E 4CDGC 3DSFL 2OJEA 1P9MA 1O5DT 4PJ8D 1E0OB 3P77A 4M4PA 5DMIH 2VKWA 2W0FA 4WCYH 4ZFGL 1J9CT 3WNPA 3HNTL 4U3XA 3OKEB 4ZFOL 2Q7NA 2A9AA 3ZTJG 4MDJA 1CK0L 4UQ2B 1QA9B 4XMLH 4XXCC 4ZO8A 3FB7A 5EU7C 3BO8A 4GFTB 4WNSA 3S5LB 3T1FA 3OXSA 4JO1L 4F7TA 3UOAB 4XMXA 4MD5A 1D2PA 2XTJC 1EFQA 1HEZB 3P4OA 4HKXB 5DEJA 2XZAH 1MVUA 2EDKA 4QTHB 3O11B 3WNOA 4ODTL 4R2GC 1ROCA 1LO2H 5T5NG 1BVKA 1F45A 3S35L 4J3OD 1QFWH 5HI4D 2WKOA 2EIDA 3SODB 4G6JH 3U2SB 4C55A 4ZSOB 4I87A 4O9HL 1ZVSA 2Z8RA 5EZJB 1GZPB 4Y2DD 5BS0E 5F3HB 1SQMA 2DTML 3VO0A 3CZUB 5K9JH 2XTLA 4BSVA 5T3ZE 2AEPL 2VWEC 2A6IA 5JOFA 4NO2B 3FB6B 4NSKB 1A9EA 1T21B 3FB5A 3H55A 4IGBC 4OZ4A 3MV9E 4PTUA 4ATWA 1OZTG 1QBMH 2BSRA 3QHFH 2CGZA 4Z78B 2FWLB 43C9A 2DL9A 3FB8B 1OAQL 5GISL 4MMZC 2D3NA 5D96B 2Z8WC 4ODVL 4Q14A 2VDQL 4BINA 2RD0A 4XNXL 1HSAA 4BKLA 5MENE 4HIJA 1Y0LB 1FCGA 1NICA 2I27N 3P9MB 5DJZA 4F7MB 5FCUH 4OZGE 1TQVA 3KDMA 1M7DA 5GSRB 4MD4A 2J8UB 3CK0H 3FFCA 5HDRA 1TTUA 4KZEH 2CWRA 3FT2A 1MWAA 3S3PA 25C8L 2D3LA 4UDTA 3UIYA 1V55B 1CL7L 4FXLA 4M48L 2QMKA 4OF8A 4QF1A 4Y4HB 5F6IB 1PEZA 3OX8B 3QO0B 1JF5A 1QI3A 3NN8B 4FNUA 4OLXH 5IQMA 4HKBB 2VRAA 4IOFD 2HWZH 4WI5A 4U1KB 2FO1A 1TPXC 1X4XA 2WN3A 1INEL 3MMEA 1HYRC 1OKEA 4U1LB 2R2HB 5E6SB 5AOJA 5IGXH 4WI8A 3ALWA 1GZQB 2W9DH 2G0LA 1LL1A 1ZPUA 1PLGL 2HFTA 4H13C 3ZZLA 4HD5A 4Z7NE 4HGWA 3LZFH 4DP1X 4X2UA 4Y4HD 1GGIL 2CKBL 3ARFB 4Z77A 4N0UE 1RIUL 4PJFE 3EDKA 1IVTA 5HGDB 1NTDA 4AKOA 5F1NA 2FX9H 2AJUL 1GYUA 5ACMA 3EFDL 4OLZH 2WKOF 5FFGA 4I48A 1ZA3A 1KGJA 2VN3A 3DV6B 4G6FB 4UOW0 4EVNA 43CAB 3U7YL 5D72L 3AMLA 2YC1A 4U6HB 1KLUA 5DZNA 3GHEH 2CO4A 4PJ9A 4UT9H 1PD0A 5I8OL 3WS3A 5GS0L 4GKZB 1XHHA 3ARFD 4G9FA 2B5IC 3FUKA 1HJCA 3H9HA 4N6QA 2Q7YA 1FVDA 2EIMB 1DVFA 4JM4L 1N3NB 4YXLL 4JY6A 4DUVA 1XIWB 4UZSA 5H35B 1V5JA 1W8OA 1EDQA 2KBGA 4HBCH 4N25A 2BW5A 5JORB 4O02L 5EIVA 5GGUA 3X12B 4PD4K 3BW9B 3QA3A 4HJGA 3RDTB 4JKPL 4DN4L 2QVMA 1ITBB 5E2WL 5D2NB 3WUZA 4WAFA 1X5HA 1XTLA 4DN3H 3MDJA 1XIWD 4Y9FA 3SDDA 1A3LL 3D50A 5CINH 4PJHE 4BIKA 1WAAA 3NCBB 3QULA 3J8F7 1EK3A 5B38A 2FJHB 2YJLA 5FX3A 5JPNA 1FE8L 3REWA 1K4DB 3RDTD 2GYSA 3PCYA 4NUPA 3S8WA 3M45A 3QC6X 2VDKH 2BSTB 4HHGA 4IYKA 1JF1B 3U4EA 5DHDA 4BQBA 4YDKL 3S98A 4B5ZA 1OVZA 2VDML 3QEGL 2VLME 2W65A 3EHBB 5DK3A 3I3DA 3L2MA 4PCYA 3VXMB 5JHDB 4E0RB 4H8WH 3BOVA 1FI8C 4BGLA 4OCWL 3MGOA 4Q6KA 5F3BB 2NX5A 3ZMRA 1TJHH 3K71B 5BNXD 4AQ1A 1QZNA 4IW4C 4M1DH 3JWNG 3BH8B 4X50A 1K5WA 4FZEH 2Y25A 4X9YA 5A7BA 3REVB 3CC5A 3UTPE 3UERA 1UYWH 5JHDD 3VXMD 1YG9A 5DEZA 4NDMA 5ITBL 4MCNA 5MERA 3VRLF 5IB3A 2HTLC 1SEQL 5TF1L 1GGTA 2BSBA 1YNTA 3DMMA 2AI0L 2R51A 12E8H 2X1PA 1D7BA 4D0CB 3I6GA 3IKCA 5FUZH 3MV8B 2GJRA 2FGWH 2IALA 3OZKA 4JM2B 4NJAH 4XVTH 4CU6A 3LS4H 3SCMA 4JRYE 5KEZA 2GIMA 2HJKB 1WVZA 3OHXC 5JMOC 2DH3A 2YHGA 3ZDWA 1D7CA 4WV1B 1N5YH 3BN9C 5D7SL 3K2IA 2YAOA 5HGAB 1U8LB 5A6LA 1R24A 3CXDH 3V4PL 5IQLA 4Z7IA 5BRZE 1ETJA 1QNZH 4HUXB 4E42A 4TL4A 2E8YA 5KVDL 1V3MA 4QY8A 4N0CD 3MV8D 4YQXH 5DS1A 2UWEB 3T4AA 4IBSA 5J1SC 1WAAF 4IKNA 5ID0B 4EF3A 1B9ZA 1XGUB 4WEEA 4R84A 5E6IA 3SQOL 1YECH 1FIGH 2EH7H 2IH1A 1SXBA 2WO2B 4Y4FB 1GR7A 2VXQA 1KJ2A 3LN9A 2H26B 5HHMB 5KVDE 4E9XA 1RPKA 1MVFA 2PWGA 2VDOL 2F74B 4KY1H 3V6FB 5SX4H 4EBQH 4JVPA 1FO0A 4GRWE 4P9HH 5DXWA 4GSXA 3V6ZA 3UL4A 2EDOA 5BV7H 1SJHA 1TZAA 1KWKA 4YVNA 4Y4FD 1EMTL 1I8MB 4WI7A 2YPVL 2V4LA 2NZ9D 5DEGB 1MJ7L 5HHMD 4M8QA 5EF2A 3L3DA 3MV7B 5BW7C 1DQLH 1MCCA 3BSZL 5I1DA 1I7ZA 1KJVA 5CJBA 1QEWB 1X7QB 1KYUA 2Q86A 4RWYH 4PLJD 2AABH 4Z9KB 3VUAA 1YNTF 1AI1L 2SEBA 3CHOA 3T1WA 2LOEA 4PJXA 3EYFB 4ZI8A 5A2IH 4KI1A 1UXWA 4U6XB 2NMSA 4LDEB 2V3FA 5CMAB 4ELDA 2Q3XA 4HH9A 3VFNA 2DPKA 1BZQK 2QQLH 1NLBL 1OSYA 1SMOA 1UA7A 4KXDA 5I82A 1TNNA 5LBSA 3DTDA 5GIRB 2LAGB 4JJ5B 5EO0B 1XSKA 1LO0H 1XX9C 1QLRB 4OJFH 3BDYL 3K6NA 4FG6D 4XO4A 2OR9L 3RX8A 3TJPA 3C8HA 3F7PC 3CFQA 3PIQA 3MLSL 3WUWB 3C6LD 4RRPM 1G1KA 3BC9A 3DO4A 4NQVB 4QRQB 5F7LB 1A4CA 4A6YA 4DEWA 4K2UL 3QCUH 2DYRB 1CL7I 1S7UB 4RISH 4WEBL 5E70A 4WTZG 2WXHA 4AGLA 2HG0A 2MQCA 3QIUA 1JFHA 4L5FH 1YMME 3POHA 5C0AA 3U46A 3WE1A 2EADA 2E46A 1C08A 2FZ3A 3FRUB 1LWHA 1IL1B 1MCNA 3NDZE 4M8RA 5GGTL 3P3UA 2C9AA 3SPGA 1IZKA 5IUCA 3KJ6L 1XMEB 3UAJA 2ZJSL 5FOBB 3B9VA 4L8SB 2I07B 3OMNB 4FTVD 5FKPB 3PWVB 2F5AL 3QNXA 4IBLT 3EJSA 3K2MC 4TSCL 1KOAA 2AW2A 2VR6A 3P3YA 5D1ZB 4UUJB 4X80L 5CO1A 3LRLA 1KIUA 2Z7UA 4OQTH 3MJGX 4ZOCA 4XVSH 3E6HA 5CSZA 1OP5H 4MYPA 5GS2H 5E6ZA 2VMEA 2GQHA 2C1PB 3RWFA 2PXYB 1KIRB 2CO3A 4JJHA 4TVPD 3MUZ1 4UM9A 1XH3B 3RBGA 3R8QA 4GKSB 1S7WA 4FMFA 2GBAA 4JZOB 4CU7A 4ZS6D 4DK5A 5D1ZD 4ZQKA 1CYWA 1KTKE 2D7QA 4FZ8L 4PY8I 3QQ3B 2WB1A 1E5ZA 1LD9A 1QP1A 1I1FA 4HKJA 5CEZH 2DQEL 4FQ1L 3O8XB 3U0PB 5I1GH 1P1ZA 1DQML 1I9JH 1E9OA 1NCGA 1U8OB 4ISVA 3V6BR 4WWKD 2PXYD 3I3EA 1RZGA 5IB2A 1FYTB 1KPVA 1PBYA 1UOLA 2YA1A 5DD0L 4FFZA 2Y23A 1XZ0A 2XNAB 2BIQA 1KTRL 3ALXA 1AQKL 1AXSA 3OPZH 3D69A 2Z7YA 5JXEC 2IDTA 3M8OH 1QFUL 3GM8A 4G6MH 4RMBA 4Y4KB 4AQ8A 3HE7B 4YLBA 4MDRA 3O8XD 2ZONA 3MRKA 4WI4A 2ZUTA 5EIIA 1FH5H 1OPGL 5DC9B 4U3SA 5DO2D 4ZUWA 1FYTD 5CGYD 4URTB 4HFWA 1SOKA 1PZSA 4ZFQA 1A22B 4ODWB 4XRCB 2QLVB 3H9SE 2JJTA 5IW1A 4GT7A 3HE7D 5IKCA 2YAFA 5JHBA 2DLFL 2NOYA 1W80A 2W92A 4IRJC 1XCWA 3BH4A 2NNAA 4HXBH 1YJDL 3HPLB 1IC0A 4XPHH 4ZMAT 1ULVA 2BNQB 2WXNA 4KTDH 2O5YL 4OY9A 1ZK5A 3B8YA 3BPNC 5TGBB 2CKNA 5F7DA 5C6TL 2X10A 3TTSA 3P30H 1MF2H 1NANH 2AXGB 3D08A 3U36A 5IM7B 3HAEA 3X11A 1GHFH 4GW4B 1AXTL 4D8OA 2WV3A 1I1AB 3DURB 3Q1EA 3TONA 1ROWA 1F11A 2BNQD 3L3KA 5DJAA 4HIIB 3W9EA 2ZNXA 3S6CA 2FYYB 4XB7A 2NY1B 3ZO0A 3LQMA 3PQYA 4NHCL 4O2EA 1MNNA 5FGRA 1NGPH 2DKMA 3CFBA 2EIEA 3ES6A 5HYJA 3BVNB 4FLRA 4BYHA 1I1AD 2QR0A 3F64A 2MCPH 4LQ1A 2NUTA 2EVIA 2K0RA 1S5IH 2HT3D 1BD2B 1GYWA 4MBOA 2R4SH 3RKDD 3HC2A 2EDNA 1A6PA 4FRWA 5GQBA 2NY1D 5HDOA 5EO9A 1XCTA 1KCBA 4UOQA 3L3IA 4X4KA 1T83C 4QGYA 5IW6A 3BEWB 5JOPD 1HK6A 5IFHH 1WZ1H 2F6AA 4W81A 4Y2NA 2EEAA 3NJGA 1XZWA 1GRWA 1XGYH 3X13A 3HZYB 1BD2D 1CFBA 2XT1B 3AQYA 4PJIB 4QRSB 3CHQA 3U0WH 2Q0ZX 4R97C 1NOFA 1QSVA 2F53A 4X7DC 3HC4L 2VMJA 2Q8AH 3GUTB 1QR1A 1WV7T 4MCYB 1WBYA 4PJ5E 1RIVL 1KB3A 1UKTA 3QSKB 2F0CA 1FL6B 2AJSL 4FQCH 4EQ3A 2I24N 3DO7A 4WUUB 1WDAA 4ZD3L 4L3CA 4JDTL 4R4BB 3RY4A 3P9LA 1U3ZA 1YEEH 2C9RA 3D87B 4PGBA 4UNTA 3SPVA 4M6OH 4HOMA 4AQZA 2Z4TA 1PNDA 5C3LD 4GUPA 4JFHE 1S7VB 5INDB 2XCMC 3F7LA 1TSRA 3U7WL 4X4YB 3RWGA 1WWWX 2ENQA 4P04A 4KMQA 5GRUH 1BFSA 1A65A 4RSVA 4BH8A 2GSGA 2YLKA 4CN4A 1J10A 5EEXA 3HG3A 1UOVA 1JD7A 4J3VA 1ODUA 1MCIA 3P1VA 2L7EA 3QQ4A 5JO5B 2A6JB 1HHIB 1CQYA 1JRHH 3H8NA 3KLAB 4JFDD 1JWMA 3TEWA 5DMKA 3QZNA 1A6TA 2KZBA 3WSQH 4NCDA 3RL1A 3OR6A 5GZNA 4KJYB 2HLEB 4FXKC 4EI5A 1C7SA 4S1SH 2BIIA 4N5EC 2TRHA 3KJ4B 5GS0C 4OIAA 5A16A 1ED3A 3GSUB 3TJHD 5B7MA 2WNWA 3WNLA 2DM4A 1ORSA 4RCAA 4I9XA 3H6JA 3SKMA 5T33L 2VZ1A 5CJXC 3NYKA 2PPDA 4XBEH 2D3JA 3MRRB 4PV8B 4U1GC 1X9QA 1A1OA 3C9NA 4QRPA 2ZKHH 1OGTA 5CEXB 3SOBH 3FUEA 3I84A 4JFYB 4NQSA 5FGBC 2CHZA 4WQOA 1SN2A 4BDVA 3MRJB 2DLIA 2P44B 2WQUA 4PJAE 3W9DB 2Y3AA 4NB7A 2WLJA 4JS7A 1IKFH 4C4BA 4BRVA 2VMCA 2NW2A 1E4WH 4LNRB 1M9WA 4HALA 5C0IA 3VD2A 1YUHA 2VZSA 4GO8A 4HUCA 2WWKO 1QYGL 2GG1A 3OLIA 4JKWA 1FQ9C 2YGVA 4DGUA 4UINH 4ZDHB 1WHOA 4D9QD 1ORQB 3AB0C 4FJ6A 2BP8A 1KIQA 3VSTA 2XUWA 3VSQA 1RKRA 4Z1PA 4ANXA 3BGAA 1JHTA 2X6VA 3X14B 3K2KA 1Z5YD 2XXFA 4WFEE 3BKYL 5HYFA 1NC4A 4A2GA 2EDDA 4N1CA 2ZUYA 1BAFH 3GXTA 4XWGL 4AL8H 4N26A 1UA6H 3BAEH 5DC0A 1FZKA 2ADIB 4Z7VB 5A6MA 3FZUD 4G1EB 3UG5A 3HNSH 1UH3A 3ECBA 4NQDA 5B39A 1CT8A 2R4RH 3EGDA 2APWA 4GQ9H 4TKWA 5IHLB 5KUMA 3ZDXB 4FE9A 5AEAA 4OFQA 2BVOB 5EWIH 5FYJL 3WD5L 1CE6A 1ZIBA 4CADB 5DSCB 1R3KA 1G7IB 2J5LC 4P3CL 1KB9J 4PCSA 5LHDA 4RH4A 2YD4A 3AS2A 3UJJH 4AKQA 2ICWJ 1ICTA 3LS5L 4FG0A 3QXAA 5EBMB 5DFWH 4YH6A 1IMHC 4XPTH 2QTEA 1RUKH 1BZ8A 1X5LA 3T0BA 4R7NB 4GO9A 2J72A 4UF7C 5IEKB 3BVXA 3X3FL 1URZA 3GIZL 3KPOA 3O2VH 4NJ9L 1O6SA 5E95B 5ISZE 2DD8H 1P4BL 3FTGB 3DVNB 5FYJE 3PWNB 1C5DB 4KX7A 1B4JL 1HU8A 2ARJA 4U6YB 1OTTD 1UZ6F 2P8MA 1AZCA 4WEUD 1YYLL 1AO7A 1Q0EA 4RMUA 3QUMB 2GJPA 2AQ1A 1PSKH 5J1TC 3BD5A 5IQ9B 1Y1UA 1AE6L 1CLOH 2BS8A 3OZ9H 1CICA 1U91B 3TCXA 1M9SA 1SYVA 2H6UA 2YA0A 2JCCE 2V5TA 4WTXA 5A2AA 4RMTA 1FNSH 1FORH 5A1AA 2G9HA 1JGUL 1ZKAA 3F62A 4NP9A 4H88L 4U1IB 2O4EA 5IEHA 4QRBA 2EZ0D 3EOTH 3UBXI 4HF5H 1CF8H 3QUZD 2JIXB 4LPTA 3ET9F 4JCWA 1KFAL 1F4WL 4HAKA 1NLDH 2O30A 2QGBA 5BO0D 4XN5A 5HDLA 4PWKA 3FTWA 2VB5A 4ZYKB 1R33A 4QXGH 4JB9H 3QQDB 4FLOA 3HN5A 3ZL1A 5AAPA 2JIXD 4PW3A 1V54B 2YSTA 1DJXA 4TLUA 1HSBA 5ENWB 5I9QB 3W57A 3Q6GL 3TF4A 1ZHNB 4G7QB 4OJEH 1NMAH 3IMVA 2XN9B 4IS6B 5AUMA 5L88H 3C5ZB 5I1CH 5EEZA 1KFGA 1U41A 1ASPA 4UI2A 5J13B 5ANME 4KHTL 4D0DB 5DHVH 1BAGA 1U92A 4L3EE 5KSBA 3P4NB 4KMLB 2NY7H 4JFZH 1KYOK 5GRZA 5KW9H 3EGXA 2Y3NA 2QELA 5CZXC 3RI5K 3BWAB 5ICXA 1XT5A 2X09A 2CUHA 4BE5A 4APQB 4G8EB 4LQFH 4RGMC 4D9LH 3MA9L 4GP4B 2XFXA 3TN0A 1H6UA 1JTOA 4HIHA 3C5ZD 2V5RA 1UA3A 3ZMEA 2ENJA 1RMFL 3HC3L 3QJFA 1ZD6A 4OLUH 5MEOB 1M42A 4XMUA 3PWJB 4N2EA 1Q9LB 1JGDB 1AD0A 3KW7A 3QJSB 4LGPB 3DSFH 4TUUA 1ZXQA 4BQCA 4Y7OC 2X6MA 5CU5A 3EYOA 2IBZY 4APQD 1CB4A 1Y18B 1SHMA 3EH1A 3H4FA 4AM0A 1I9IL 4ZFGH 5DJXB 2BHFA 1I8IA 3HNTH 4LF3B 2Z8VC 3SYCA 1TLMA 2J1YA 1INQA 1J1OH 2DM7A 1CK0H 1IM3B 3GSRA 1AZRA 3ZGHA 4ANVA 3ETBF 5E5LA 5SWZE 2OJEB 1UT9A 1RCYA 2H6PA 3D2TA 2AXWA 4JO1H 1ZT4B 5IFAL 3KXFE 4V2BA 5D70L 4IIQC 4YHYC 2W0FB 5HTSA 2XWBA 1RURL 4FEIA 2GC7C 2LT9A 1W72L 5F3FA 3BPCA 1YQ2A 4WEMB 1IC7L 4EJ1C 4IEFA 1B4LA 2E47A 3F7KA 4TRPH 5FDWA 1TEGA 4MDJB 5DURB 3DX3A 1OTUD 1YDPA 4N2BA 4AE0A 3RYMA 3H2QA 5E6RB 4ODTH 2COQA 3RY6C 3FB7B 2XI9A 3BO8B 3T1FB 3S35H 1TJGL 3OXSB 4F7TB 2QZQA 2RACA 4KO5A 3TX4A 3IJSA 2A83A 2LFGA 4MD5B 5BZWB 2B2XL 1DQQA 1LQBC 2NT1A 3MTXA 3UO8B 4O9HH 4N1HB 3P4OB 4CKQA 5B7FA 2EYSA 4M3HA 3RG1C 1E7VA 3BFQG 4F57L 2AEPH 1SVZA 3FPYA 4ADJA 1Y6KR 4MNQE 1C7TA 3TS8A 3KM1A 1RZPA 5EORL 1KLFA 2BZDA 1OF0A 4NQTA 2DTSA 4UQ9A 3S5ZA 3CQPA 3WLWD 1T4WA 1JVKA 4G83A 1OAQH 5GISH 1QSFA 1VERA 4M6AA 4ODVH 1UENA 2VDQH 4BSVB 5IROC 2VZVA 2A6IB 1KXVA 1A9EB 3FB5B 4XNXH 3RGVC 4OZ4B 2VIRA 5TDPB 3T6XA 2BSRB 4X7CC 3PY9A 4KUCD 2B9BA 4TUKL 4PGCA 4A7GA 25C8H 2L3BA 3CN3A 4KKBD 43C9B 1KY7A 1V7ML 4N8UA 4DCQB 2GSIA 4HUVA 1CL7H 3QR0A 4M48H 4ZPTB 5SWSD 3TH2T 3MLZL 3WLBA 1VENA 1HSAB 4BKLB 4HIJB 2DICA 1OLZA 2DWDA 2YMOA 2HPOA 4QWWC 4Y8DC 5DJZB 4N28A 3GXUB 1M7DB 3KDMB 4MD4B 4S0TD 1INEH 3FFCB 2WXKA 3F2LA 2W59A 3FT2B 3T77B 2WLKA 5E8EA 4RBPK 4UDTB 4AEHL 3L9RA 2FAUA 3IK2A 4RLDA 5E4AA 1PLGH 4AQAA 2J44A 1A0QH 4QF1B 5HDBF 1YJDC 1GGIH 4JKLA 2CKBH 1XCXA 4K71C 1UWYA 5CP7A 1IEAA 1RIUH 4BK5C 5C0RL 1SXNA 3DYMA 2AJUH 4TUOA 5B38G 3EFDH 3OKOA 3FFCD 4NLHA 4NKDA 4AMWA 1U3HC 2KLRA 3MJ9A 2OBGA 3QNYA 5D72H 3U7YH 4I88A 2P8LA 1N70A 5D2NE 5AOLA 1R6VA 2AJZA 3VFMA 2J20A 4HGWB 3BDXA 5IBLD 2ZXGA 3IGAA 1AG0A 2J2ZB 2HRLA 3QEQA 1U8HB 4Z77B 5I8OH 5GS0H 1W0VA 1JZDC 3L7EA 1LP9A 5M95B 2WSDA 1EJ6A 1BQUA 3FQYA 4JM4H 2RR3A 4I48B 1ZA3B 4YXLH 1T66D 1I3VA 3PAYA 4FNLL 2YC1B 1KLUB 2ZP9A 3K8MA 4AGOA 3IDIA 1RSYA 4O02H 3NQIA 2YQ3A 2O61A 4AYDC 4PJ9B 3BGMA 4UOZA 1PX4A 4G9FB 3ZQXA 3VDBA 5FLVA 3H9HB 3L4TA 2WZ0A 4M7ZB 4JKPH 4DN4H 1JBJA 1FVDB 1NEZG 3Q3GA 1DVFB 5LGHL 4PRPA 5E2WH 4JY6B 4ZMOA 1XF5A 5F9JB 1HQRA 2VDLL 2WNXA 2HAZA 1J11A 1HXKA 1SF3A 4A7GF 4YSUA 4ZMPA 1DVSA 4OZIE 1PQZA 1A3LH 1Q94A 5GGUB 1DUYA 4I18A 4JVWA 4XI5D 2Q1EA 3C8KA 1II4E 4JDZA 4UQAA 5F2FA 2QHLA 3QA3B 4HJGB 2DMCA 1OSZA 2X4UA 1FE8H 3RUGA 4LLYA 1YO4A 2MKWA 3B7UX 3LY6A 1CLCA 1A6AB 2JKNA 4FQXD 3N0PB 3CN2A 4LRIA 2HVBA 4NWUL 1KULA 1U0QA 5C2BL 3UPCA 3KS0H 1DVFD 1VFBA 3OC8A 3RWEB 4JPWL 1FFPA 4YDKH 4QTFA 2VDMH 3QEGH 1TZIB 3U0TA 4YFDB 2Q3ZA 5CP3H 2C7UA 1UUNA 5DU7A 4TXVB 2E7MA 5GGSY 3VJ6A 5B38B 5JPNB 3DVGB 2D9QB 1WFNA 4OCWH 3LHPL 5IJVA 3LKRA 4J1UB 1LHZA 5JPMA 1RK0B 5DJCB 3SO3C 2VUKA 5DRNA 1N8OE 3B5TA 1U8KB 3NFPA 5DDHA 2PPCA 4FA7B 2ZYIA 5F1SA 4MZ2A 4JE0A 2W65B 5T1KA 3IU3A 3SDDD 1JOIA 4IMLA 3W38A 1RZFL 3FQ4A 4WHYG 1N67A 5ITBH 5KS9A 4W9KC 4X0KA 4S0SD 3BLKA 3FMGL 1SEQH 2EIJB 3NCFB 4H25A 5TF1H 4A67A 2AI0H 4P8QA 1HH9A 1RJLA 3MYJA 2CCWA 1C8QA 1OK0A 4E9QA 2GW5A 3Q2WA 3DNKA 3FT1A 4O2FA 5I6KA 1NEZB 1HHKA 3FS9A 4NN7C 1U4FA 4NDMB 5MERB 5D7SH 4ZW6A 4CMHC 1CGYA 4XR8C 2ZUQB 2NX5D 1YNTB 3DMMB 3V4PH 4HHWA 5C0BE 3QDGA 3WEOA 4MCZA 3I6GB 5DI8B 5I66B 2BCKA 5KVDH 3TH3T 2IALB 2WYTA 4PP1D 4NNPH 3ERXA 1U2YA 2ED7A 2HVKA 1P7QA 3SCMB 2HN7A 4GRWH 2OX5A 4EN2A 4DNLA 1FV1A 1WICA 4FOMA 1U8JB 2ZKMX 1R24B 3SQOH 4E42B 3EUUA 4FQLL 4GAYB 1GS6X 4QY8B 3BI9X 2DIEA 4RMQA 1NCNA 3ZSTA 1SOSA 4NUJA 5I26A 5F9WC 2VDOH 5FPIA 3MUY1 3TCTA 3ASWA 4XNQA 2QDWA 4X7SL 2D0FA 4JQVA 2J8HA 3NIGE 4Q97A 1JPFA 4EO5A 4RNRB 3CSYA 5GPRA 1HWGB 2IH1B 4PJCF 3IGLA 4YLQT 1EMTH 1NUGA 5KSAC 3E80A 3DX8A 4GW5A 5AVQB 5J12C 1NPJA 2YPVH 1B2YA 1NUDA 1K3ZA 2ID5A 1OCZB 1J0YA 2OMVA 2BS9A 4N0YL 3BSZH 1PY4A 4HQQH 1FO0B 3JV0A 3V6ZB 5E6ID 2V8MA 1UJTA 1UG9A 3LXUX 3QT2A 4YR6A 5J06A 3QW9A 1SJHB 2XWXA 1JHKL 3ATEA 2E7HA 5JDSA 3CZKA 1EEZA 4M8QB 3L3DB 3LZRA 4FNQA 3MYZA 5I1DB 4TNGA 3N41F 4TNEA 1KJVB 1KCKA 2Q86B 2PN5A 2P5WE 3OWEA 5E7FA 1T89C 4MQSB 2EDYA 5E4IA 3T8XA 2UZXA 1W2KT 2SEBB 3BDYH 4PJXB 3CX5J 4Q2ZB 3CPLA 3NCWA 2OR9H 2X38A 4JCLA 2CBQA 1UFUA 1UT2A 4PBWD 1UXWB 4IRSC 2AQ3A 2ZYRA 2GC4C 3MLSH 4WZ9A 4X6FB 4AT6A 1PW3A 4HH9B 3VFNB 3HZMA 1WBXA 4S2SB 4NXKA 4FYSA 3QIWC 4GKLA 3B2UC 1SM3L 3NA4A 4FQ2L 3ABKB 3CZLA 2XRAL 4K2UH 4MXVE 3CJJA 3L5WB 3G5WA 2HCZX 3WKNA 1D5MB 2NY0C 3CIQA 5EH1A 1YQVL 3PIQB 4YC2B 3FO0L 2GTWB 2CDEA 4X6DE 3NIFF 2IGLA 4CVUA 1A1MA 2Q2EB 2W9EH 2VZUA 2C4XA 2IPUK 5GGTH 2I9TA 4CJ0A 3KJ6H 2PYEE 4GKOA 3IU4L 3BZ5A 1HE7A 2ZJSH 2FDBP 3QIUB 4L9LC 1HVXA 1QRNA 4PJEF 3DGCR 5E4EC 5C0AB 1OQXA 4DZ8A 4IM8A 1C08B 2F5AH 2FZ3B 1UEYA 4EUPH 4TSCH 4XVUD 4HGKC 4X80H 4UQ3A 3CVBA 2X88A 4LCYA 1PD6A 2VXUL 1ZTXL 3N43F 1QABA 3QIUD 1KTCA 2E6JA 5C0AD 3WJJC 3QNXB 1T6WA 3H6AA 1K9TA 2FEDD 2QJDA 2YD9A 3ZPDA 1UTDA 4F1SA 4P57A 4WFHE 3DLQR 3FN9A 4AJVA 5C8JA 2JI1A 5CD5D 4XXCA 1WE5A 5AKRA 5FYKD 4I3RL 2HPTA 2N7BA 3WNIA 2A77L 3UTSA 2UX6A 4FZ8H 4RZCA 3UAJD 3E6HB 5CSZB 5CSBA 1T6BX 2WKLA 1CLVA 2DQEH 4FQ1H 1PCXA 3RWFB 4AI7A 1DQMH 1C5BL 2E27L 1OP3K 3T6QC 4R4NC 2Q10A 4N87A 1ZTXE 1NH6A 1E8YA 4UM9B 1S7WB 3DXAA 4P2RA 2KKQA 5DD0H 3NG5A 2B59A 3HR6A 3HI1B 4AYFA 1NCTA 4ZQKB 4FXTA 1AQKH 3PNRB 5LXGL 3Q8CA 1D3CA 1P6WA 1QFUH 2X4TA 1U30A 1FGNL 2O5ZL 1LD9B 3LZPA 1I1FB 1E30A 2H3NA 4HKJB 4PB0L 3WDJA 1MAKA 1P1ZB 5C9JA 5CBAA 1E9OB 3GMPA 4MASA 4N24A 4ISVB 4DFHA 4LSQL 4S1DD 4TNVF 1OPGH 1KPVB 5C3TA 4UM9D 3UABA 1DP0A 3OQ3B 3QAZC 1ZWIA 1AXSB 3NPSC 2C3VB 2J1WA 3D69B 3IDXL 4IGBA 5GRVL 4L4VA 3ZYIA 4XP1L 1DSYA 4CKVX 5AB0A 3UZQA 1NCAL 3LTVA 2VLLA 1ACZA 1IEHA 3MRKB 2DLFH 4MMZA 5EIIB 4QR7A 4U3SB 5DD3L 1IAKA 4IBYA 4JFVA 4NOFA 4BSWA 1YJDH 4HFWB 5G2NA 5CR1A 1BJMA 2O5YH 4PRHE 2WKGA 1LE5A 2FQDA 2N4IA 2WCGA 4Z7UA 1AIFB 3P0VL 5M94B 5C6TH 4XMTA 1WRFA 3QCVL 5IKCB 4Z8FL 4H1LH 5B3NA 4MKMA 1RJCA 1U93A 3DETD 3SJVE 2AEWA 3IN0A 3BIBX 3CMOL 4X4ZA 2VDNL 2NNAB 1UM5L 4AIEA 1RP8A 5CXPA 3CH1A 4JHVA 4TPRL 2FEEI 3D3VE 3F00A 4AYBA 4ZJ9A 2NCMA 1RLWA 5F7DB 3UACA 5I1JH 3U36B 3HAEB 3X11B 4ZX3A 3EJUA 4LSUH 5IWLC 4HJ0D 5IMLA 5EHFA 4G11A 4LCWA 3VXRA 1S9XB 3L3KB 4WUUE 3CN4A 3QDJA 5DJAB 4Z7QB 2F8VA 4PWHA 2HFFA 5K1JA 3W9EB 2GK0B 3FN3A 4DVRL 3DGGA 4MLSA 2E3VA 1B6DA 3PQYB 4O2EB 3NTCH 4NAMA 1AYOA 3CFBB 3KM2A 4FI7A 2CA4A 5A3ID 1SHSA 1M05A 2JLPA 1NFDA 5A40E 5L4JA 2NUTB 2WP3O 2MOGA 4ZPVA 4BGDA 5IUSA 4G7VL 2ITEA 2YLHA 1QATA 2WP3T 1AR1D 1ACYL 3N3EA 3HC4H 4MQTB 4FCHA 3L3GA 1X5AA 1RIVH 1XCTB 2VZ3A 3PQYD 4L4TA 5EO9B 1CXEA 2AJSH 5TF0A 5HYJD 3PDGA 1A6UL 4NKIL 2APVA 4FKEA 1TQUA 4WSJA 4ZD3H 5J9PA 4S1QL 4L18A 4JDTH 3DTUB 3ZGIA 5JW4R 3SPIA 2XPZA 1WS8A 3ABMB 3F58L 5EN2A 2JCWA 3Q8FA 5I15L 3VGAC 3X13B 3EFFA 2WJ5A 3H3BC 5D2NC 4I0KA 2F53B 4Z7UF 1X6LA 1QR1B 1NMCC 3U7WH 4WFFD 2KLSA 4F8QA 5EU6A 1J8RA 2YD3A 2YGQA 3QFJB 3DO7B 4DKEH 2VYRE 1AP2A 3D30A 3L5HA 4L3CB 5E1IA 1ZMYA 5KBLA 3P9LB 1H9DA 2PTUA 4PGBB 2MNWA 3L1OL 3SPVB 2IC2A 2KPWA 1F5WA 4WW1A 2PCPA 2FLMA 1CVSC 3ZDYF 1AMXA 2F53D 5K39B 3V5HB 1XAUA 3CXFA 3EHBC 4PM1A 3ZR5A 2WNKA 3IF1A 3GI9L 4EE2A 2D7OA 2EDTA 1T1YA 1MAJA 1BECA 4K9EL 3CPUA 4AYEC 3P02A 4QLWA 1GTNA 3O2WL 1KLGB 3VRJA 5T33H 1JWMB 5DMKB 5JIKA 1KN4H 1TTGA 3KPRD 4NQEA 2XYBA 3OR6B 4LKCA 4HJEA 2DEXX 3E38A 3PWPA 1EDHA 4D9RD 4KXCA 4EI5B 2R59A 5B39G 1TNMA 2K6YA 3WIHA 3IDNA 1FN4A 2ZCZA 3FYIB 4HC1A 3V4LA 4BFRA 3DHJA 4HZ1A 4ZFZB 1OT2A 3CZGA 3SKMB 5J56B 1JTPA 2OM5A 4C83B 4PS3A 1PZ3A 4JM2C 3WNJA 5BRQA 1A1OB 4K55A 4QRPB 5GZND 3CHXA 4EI5D 3AACA 3UC0L 4WV1C 4NQSB 3OHXA 3ETBJ 3ZDZF 3I85A 1MPAL 4BDVB 1QYGH 4QJ5B 3SGEI 3M17A 4WU7A 3QI9B 2J56A 4UAOB 3B5HA 2NW2B 2H2PC 4YDZA 2GT9B 4KJWD 5F7EL 3EDFA 3BKYH 1PKOA 3WU1A 1CPUA 1YUHB 1XDTT 4QNPE 4XWGH 4ELMA 1U8NB 1XTMA 3AY4C 2EDXA 1CR9L 3WEAA 1SLWA 3CCHB 3O4OB 4PLKD 2KT6A 4JDVA 5F7FA 2BP8B 1KIQB 3HI6L 4X42A 4R4FL 1CUOA 1JHTB 1T22A 3PLYA 4DP0X 1MJ8L 5I76B 2NNFA 3EH4B 2KQMA 1BEYL 2NXZD 4ZUTB 3LB6C 5IVXA 5FYJH 3WD5H 9PCYA 1IBHA 3JWNC 4P3CH 4B9PA 3QWQB 4G8GB 3RWIA 3LS5H 4XNDA 1PZUB 4CVWA 4IBVA 3BZDA 4NQDB 3I9PA 4JRXA 5B39B 2ZP8A 4A2HA 3EGDB 2ICCA 3ZUNC 5DZVA 3GIZH 2LU5A 4NJ9H 1CE6B 1NC4D 3EUDA 3MLTA 3HE6C 1P4BH 5BW7A 2NZ1A 4Y2OA 3QXAB 1A1NB 4KWUA 2ZG3A 1B3JA 1B4JH 2WY3B 2XWZA 5A6IA 4ZO9A 1YYLH 4BUGA 2JTDA 5DWPA 3KLHD 3KPOB 3I6KA 3UZEC 4AC2A 1O6SB 3IFPA 1FCCA 1EEQA 5BUGA 4OZFA 1AE6H 4DZBA 1M6UA 1UKSA 2J8OA 2R56L 1NIAA 4OD1L 2XWEA 5I17A 3KVDD 3QPKA 4OFVA 5CGTA 1TSHA 5DJ2B 5CILL 2C7FA 2ARJB 5EDSA 4HA1A 4GP8B 2MSPA 1JGUH 1N5AA 3FT4A 4H88H 2CO1A 4JR9L 3S8GB 5T1LA 1IIKA 4ZMWA 1UGNA 3BIAX 4LXFA 3RB7A 4EOWL 1WP6A 2SODB 4X4XA 2MPAL 3H9YA 4Q6YA 1F4WH 5FHBL 4U3HA 1SYVB 3WY2A 4MTMA 1ZJAA 2R1YA 5F9OL 4DK3A 3R7RA 2AJ3A 3P0YL 2G9HB 3LIZA 3WNNA 3L08A 2IFGA 3GPSA 1AO7D 5IEHB 1E40A 3TURA 2ZUVA 4CBPA 5I73B 2HLFC 3EG9A 5IVXF 4PJDA 4X6EA 2A0LD 5K33A 2XHNA 1CICD 3T8VA 4BFNA 1F6LL 1Q9KA 3Q6GH 4ZT1A 3CVHB 1GL4B 5J5EA 3AS0A 1VLXA 1WCBA 4L1SA 4DK6A 1ZDQA 1ZANL 1FLTX 1AKJA 2VR3A 4YEFA 4KX9A 4KHTH 1BG1A 1AZNA 1U95A 4EPSA 1F2XK 2BY2A 2F54E 5EO1A 1U42A 3DROA 2JI3A 1VFAA 1HSBB 5F6HI 1VEMA 2B1AL 4KNQA 4WW2C 1FNGA 1F6AA 1SDAB 3LKOA 5IY5B 3B56A 3EO9L 3MA9H 4LEXL 3ZQWA 4LOVA 4AUUA 3UYPA 2DQUL 1OPOA 4KKPA 4HXAL 3HC3H 1U92B 2PWDA 2WQRA 5LDSA 5J6GB 5KSBB 2QPUA 4YK4B 3EGXB 2IXQA 3VWJC 3X1NA 5MP6L 5ICXB 1CXHA 1MREL 1T20A 4UILL 5CKGA 3RAJL 5IW3A 4A2FA 4JRLA 4N8PA 5DJ6A 1I9IH 2XFXB 3RPKA 4HIHB 1YSOA 1L4IA 4ODSL 4JPVL 3IEAA 4OH2A 3QG7L 3QJFB 1V05A 4QRAA 4BUQA 1K8IA 3BYYA 3HLKA 5ICYB 5DT1L 1AD0B 3ECVA 4XPGH 4QRRE 2OMWB 5IFAH 1H0DA 3ZKXB 5D70H 4KQ3H 3Q01A 2VLJE 4AEEA 2WSKA 4Y4KC 5JXEA 1SN5A 1RURH 3TN0D 1W72H 1I8IB 2X1QA 2YRZA 1IC7H 3N2JA 1TFPA 3O2DL 3QFDA 3UEZA 4G42A 3GSRB 4UDUA 3IVKA 1DBKL 1UD6A 1MQKL 4M7LT 4PJDF 5J1AA 5LNEA 4N0FB 4Y19E 2H6PB 2Q6WA 5LAXA 1TJGH 4Q52A 4MZIA 2NY5L 3B9EA 5GS1C 5C0ND 5TE7L 5C09D 3ARZA 1B4RA 3II3A 2XWBB 2FJFA 4MB3A 1ZLWK 2Z4QB 3BPCB 2B2XH 3L2LA 5E5MA 1OM3L 4IEFB 5FDWB 3VFWA 5HDBB 4NERA 2CCVA 1KPRB 1FH2A 1HS6A 1YDPB 5C9KA 3VXQA 4IRJA 3AITA 4F57H 2B8OT 2H9GA 4OLEA 5JQ6L 4BE6A 1PYWA 5HHNA 2R2EA 5EORH 4F27A 2ZUQC 3IJSB 2A83B 5JW4Q 4P4RA 2E6QA 5BS0A 3BUTA 5L2KB 1E27A 1DQQB 4ADGA 1ZY9A 3E7JA 1B0IA 4I9WD 2EYSB 4KDTC 1CGXA 3LQAH 1TQWA 4TLKA 3ZQ9A 4XPFL 2OXHA 1WZAA 2J55A 4IJTA 4NM8L 3VXSB 3DJTA 3NACL 5FGCE 1KLFB 2PCYA 1DLHA 3RNQA 3RZCB 3CFEA 3QQ9D 2OW6A 4HWBL 4A7SA 4ZX5A 1H3VA 2IDCA 4TUKH 4BA8A 2BIOA 1EAPA 1V7MH 1QSFB 3IM1A 4MZ3A 3E3QE 1UGKA 2YGNA 1YC8A 5MENA 1MLBB 3MLZH 3DI2B 5D2LF 2P46B 4OZGA 1HHHA 4UTBL 2VIRB 3F8UB 3V4UL 2VDPL 4POYA 4GO6B 3OJDB 2QQKL 4Z7WE 4PGCB 4I1NB 5EEVA 4AEHH 2GSIB 4HUVB 1QSFD 3O41A 1UB6A 3T0DA 3BAKA 3QPQD 1PF3A 3K46A 2CGYA 2P80A 3GXMA 2Z3FA 3WLBB 1T83A 1SJEB 1RJYA 1DE4B 3K5SA 2CCLA 3CC1A 5C0RH 1TYEB 3GZOA 4HGMA 2ZKYA 3EH2A 1A66A 1H8OA 3I3BA 2NR6C 5E8EB 2BVYA 2Z92A 2AXJA 3QZLA 5LN4A 3T3PE 5FB8A 5ICZA 4AQAB 3IXAA 5PAZA 4N0UA 4PJFA 4RGNB 5CP7B 1IEAB 1YEJL 3C09B 3MRDA 3AAZA 3ABLB 1WIOA 4NRXA 5B3JE 3ILPA 3OKOB 4LEOA 1HESA 4FL4C 3N1MC 3QNYB 3O9WC 4FNLH 2P8LB 2AJZB 3MUUA 4G43A 2WUCL 1JS4A 4M43L 3ARVA 3EOYG 5TDNA 4HWEH 3IGAB 2ZZUT 4RGND 2CKBA 1W0VB 4TSAL 3L7EB 4W6XB 2W60A 2J88L 1FVCA 1KY6A 3FQWA 5LGHH 5C1MB 5FIEA 2VDLH 1NJ9A 3RILA 2K8QA 4WI9A 1AQHA 1JV5A 3IDIB 1H3XA 3VI4E 2AV1A 2NY4B 3L1EA 4F9LC 3AS3A 3BGMB 2AK4E 4FXKA 1RI8A 4YXHH 3PE9A 3KJ4C 2CLVA 3QEQD 4OZGF 3PP3H 3U1QA 4NWUH 3WTSA 1P53A 4PRPB 5C2BH 2ZWLT 1XF5B 1HQRB 5BO1H 3S8FB 4JPWH 4PJHA 1QSZA 1WEJL 1G1YA 3K7UA 1Z9SA 1PQZB 1TETL 1Q94B 2ICWI 4PVLA 5CJXA 1DUYB 4I18B 5BMFL 3HHSA 4O02A 2NY4D 3C8KB 3L5XL 4JDZB 4YHIA 4NX0A 1YEDB 5J4MA 1CGWA 1OSZB 2X4UB 4X83A 1KV7A 3RUGB 3VFPA 1TG8A 4LLYB 3LHPH 5FGBA 4I2XE 2MTPA 3CFTA 3VFVA 3T04D 2JWYA 2WXLA 3TBTA 4EIZC 4PRPD 1VFBB 4LLMA 2ED6A 4HSQA 4YSOA 3KHOA 2YPKA 1ZAGA 4K3JL 4O2CB 2EDRA 3U0TB 4F33A 2VITA 3KPNA 5CHNB 1AKPA 2C7UB 3VJ6B 4YBLB 1RZFH 3QS2A 1TITA 4PJFF 2X6CA 5IJVB 4NZUL 3LKRB 3V0VA 2CR6A 3FMGH 2OA9A 4I4WA 4PJCB 5DRNB 3TCLB 4GYBA 2ICEC 4JZNA 3NFPB 3MPCA 3T3ME 2F7QA 5DDHB 3UG4A 2XXMB 3I75A 2J4WL 4Q9RL 3IU3B 4XNZB 1S7QB 2FRGP 4IMLB 1PY0A 2YFNA 4OCXL 2C8NA 3TYFA 3QXVA 2YUXA 5CP3A 3V0AC 5DFVC 4X0KB 1IQDA 4K9EC 3V4VL 1W9XA 1FZOB 4H25B 3TIDA 3C8DA 2CAKA 4OM1L 1CBVL 5C3IA 2MIZA 3MYJB 4HS8L 4QUOA 4JFOA 5T3XL 4AENA 1IGIL 4JRYA 1YPZF 3OF6D 2HH0L 4O2FB 5T1KD 1DJIA 2IH3B 1FG2A 1R5IA 3ATFA 1UT1A 3AQDA 3LDBB 4HV8A 2KH2B 3N41B 4V1DB 4KDWA 4ZMNA 5JW3H 1GXEA 3QE5A 3V8OA 5BRZA 3ZHNA 3FRPG 3FFDB 5KJ4A 2IADA 1YEWA 3GRWL 3QJUB 4FQLH 4E68A 1N18A 3L4YA 4MCZB 2BCKB 3P11L 1WIUA 4Q4EA 1IM9A 3M1BA 1IAMA 2N7AA 4NC1E 5ALBL 5T3XE 1DSWA 1P7QB 2HVKB 2YOAA 3QRBA 2HN7B 2OX5B 4G1MA 1XWVA 1FV1B 1CYXA 2ZUXA 2OFQA 1RAMA 1A7BA 4X7SH 1UD5A 3MJ8A 1HJBC 2HMIC 3O4LB 2X2YA 2HKFL 3O6FC 3GC3A 4FXGC 3E9UA 4DP5X 2XC8A 3QDGD 3GBEA 3B2XA 5AVTB 4JPIA 4I0CC 3BFWA 4L1DA 3GM0A 1M2VA 3I6SA 4WFGD 1EZSA 1DQTA 5G5DA 3OAZH 4N0YH 4EXPX 2XA3A 4XNQB 5E00A 4MHHG 4PPTA 4XOCA 1E28A 2V0AA 1JPFB 4QXTB 3CSYB 3VXTA 1DHKA 4L48A 3CIAA 3D4CA 3ATDA 1JHKH 1AS8A 1KB5L 4PJEB 3DX8B 1URIA 4GW5B 4WENB 1EAOA 4B53A 1WYJA 1M3IA 1BIIB 1R5VA 2OMVB 1N0XL 3FQ2A 1Q8MA 3ILQC 3EJZD 4N85A 5IHUL 1HOCA 1NOLA 2EH8L 4AWJC 1RK7A 1FJ1A 1IBGL 1F41A 1X3DA 3N43B 2BY0A 2I85A 3NCCB 4JMNA 3RPIA 3ZT6A 5JDSB 1DBJL 2JF1A 4FQQB 3M46A 1Z3RA 4G6AC 3FRPB 1EEZB 1BREA 3L95B 1ACCA 2AEQL 1PJWA 3GLDA 4HOZA 2OMNA 3GFUA 1LK2A 2R7EA 1SM3H 3BSZA 3AMKA 4PWJA 3QNZB 4FQ2H 1BQHA 2XRAH 1MFUA 5I9QC 4MVBC 3RP1A 1KEML 4X5QA 4JFQB 1A8ZA 3SDYL 3T8XB 1JSYA 4AKPA 1KCVL 1TOXA 5BV7B 2D0GA 1GGUA 4AVIA 1ZSDA 3RIAK 2V8LA 4KZCA 5J13C 5CFHA 3FO0H 4AT6B 3MRPA 3O6LL 3HZMB 1WBXB 2IVFC 4FA6A 2PYFA 3R0NA 1S9YA 3DOSA 3HG4A 4F2EA 1ZS8A 2HUEA 4YHPA 1ZV2A 1BZ7A 3IU4H 1WCQA 1YMMA 4OIIL 5J11C 1Q1PA 1EPFA 2YKKA 4FQIL 1SOQA 4G7RB 3SGEH 2CDEB 3CFKB 3BAYA 2VGLM 1GTFA 2DBJA 1PEWA 4GRWF 4A2LA 3KPSE 3VX0A 3DIDA 5I18H 3H85A 2I9TB 3EXLA 3SBWC 3TFKD 2AVGA 1UH2A 2ZUWA 4MJ4A 1R0AL 1C5CL 3ESUF 2VXUH 3HG2A 1ZTXH 4H2CA 3HI5L 4DZ8B 3RLSA 5FECA 4PHZA 4XN8A 1LK3H 4AVHA 5EU3A 4DGWC 5I6XB 3LNEA 5J6GA 5IOPA 4I3RH 2BVQA 2A77H 1RQ5A 3POCA 2VO8A 4IQHA 4LCYB 2GABA 4IIQA 5I8CA 1XL4A 4NZRL 3WAJA 1QRND 1T5KA 5T1DL 1JZ8A 1C5BH 2E27H 4JO2L 3B83A 1Z5LA 2Q76A 4P57B 3T9WA 2G0KA 3IDYC 4EUPA 5C8JB 4OU3A 4KGJA 2CH8A 4NZTL 4FG4A 3RY6A 5LXGH 1ETB1 1NCCL 2GBTA 3BKJL 4RZCB 1BQKA 5E56A 1AGDA 1FGNH 2O5ZH 2XZCL 1NBZB 3B6SA 4FFWC 5H8DA 1PG7X 4I8DA 1KBWA 2XTJB 1BA9A 1N68A 3Q05A 2MWCA 4LRNL 3AU0A 4FC3E 4LSQH 1MFNA 5E99L 3RJQB 3DXAB 4M3JA 1E5AA 3L3HB 4P2RB 3MO1A 2B59B 1PIFA 3FQUA 1QACA 1RVFL 4NAJA 4AYFB 1HNYA 3IE9A 2A9NL 3IDXH 1OY3B 2A4ZA 2X4TB 1AGEA 1AANA 3UTSD 5E8DL 4KKZA 2H3NB 4XP1H 4WO0A 1R75A 3U4KA 3UYRL 1NCAH 3GMPB 5D4QA 5KBDA 1O9WA 3PABB 3V7AG 2DI8A 3DTXB 4N22A 4MS8C 2VQUA 5DD3H 2IQAA 3H4HA 3DXAD 4P2RD 1MFEL 2K7QA 5TE6H 3BP5A 5IROA 4NC0B 1ZWIB 2IIJA 4R2GD 3D39D 4IGBB 3RGVA 4L4VB 5D7LE 5DHYA 1ID5I 4KRLB 5IVZA 1X5XA 4RA0C 4UNIA 3UZQB 32C2B 3QCVH 2R0LL 4RGOL 3A6OA 5GS2D 5HJ3A 2VLLB 3SYOA 5E0QA 4Z8FH 4YSEA 3SDXE 4JDEA 3VWKC 1IAKB 1M4KA 5CNHA 3CMOH 2Q2LA 2VDNH 4BSWB 2WQSA 2F1AA 1JZ5A 3S3CB 2FTAA 5F7HA 3OAWA 1IAOA 4OVUA 3L7FB 4TPRH 4BFIA 1CWVA 2VERA 4L4VD 1DQJA 1LE5B 1ACXA 4Z7UB 5AG8A 5J8OA 1K8DB 4X5XA 5IBTL 4OAWB 5HHQA 4HK3N 3S4SG 1K2DB 1MCKA 4AY0A 3GWJA 3MI6A 2WCPA 4OKVA 1U6AL 3VFTA 4IU2A 4ZOBA 3CH1B 4IBUA 3LEXA 3VXNA 4BK5A 1REIA 5JIMA 3GLZA 4LBAA 1TPXB 5LGYA 4G82A 2OZ4L 3UBXA 2WBWB 5E7BA 4DVRH 3E3QC 5C07E 4J2QA 2MOVA 1D5ZB 4U2ZA 4H1LA 1U3HA 4QJ3B 2ODHA 3RTQC 5HVHC 1J9RA 3AFLA 4WGKA 5JIIA 5IMLB 1DTUA 1ZHBA 2Z93A 1MLCA 3WHXA 4LCWB 3VXRB 3QDJB 2N0MA 4G7VH 2HFFB 2H8PA 5SV3A 3DGGB 1IZJA 1ACYH 1NGZB 1IAIL 3E0GA 5EUOE 1TKWB 1QTSA 5L2JA 2PABA 1A6UH 1M05B 4NKIH 3S0PA 1NFDB 2FBRA 4S1QH 4HBQA 4ZPVB 5I15H 2VRKA 2B5IB 4LCWD 1JZHA 2OJZL 3CWGA 3QDJD 1I3GL 5LBGA 4PJ5A 3ARDD 3NJMA 1JGLL 3LNGA 2EP6A 3L3GB 5I8KL 4QDGA 4EKJA 4L4TB 1I1RA 2P5EE 2K8MA 4BD4A 4LFHG 2WXPA 4YNYA 4RFNB 4W93A 3R19A 1MCOL 5J9PB 2JKIS 3WBDA 5AOZA 2VLKE 1HQ4A 3L1OH 2Y9RT 3B4NA 3M86A 2CA3A 5IJCC 3EFFB 3TNMB 3S4SB 3TPUB 4MX7A 2VC2L 4K7PX 2BW4A 4WVRA 4H0GA 2ZUSA 2GCYA 1MEXL 1DVYA 1ID2A 2CUIA 2EXWC 5AB1A 1RZ7L 1OALA 1Q72L 4BQ8A 4L4TD 3FO1A 2DJSA 2IEPA 4QYAA 3CFMA 1WF5A 3GI9H 2XWRA 2Y5TA 4IHOA 1RZIA 3ZTDC 2DF3A 3V5KA 2OMZA 4K9EH 4WW1B 2PCPB 5FYLD 3LKNB 3IDJA 4XMKL 4H26A 3BSGA 5T5FH 3O2WH 4KK9C 1UEMA 3AGWA 4P2OC 4ZO6A 1BMGA 5FLUA 1CFVH 1W6LA 5EU6D 3IF1B 1JDDA 3FQNA 1T1YB 5CBEA 4P9MH 5FYKU 3LIUA 1T6VN 5E4OA 3LV3A 3VG9C 2LFEA 1G0YR 3VRJB 4LE8A 4NQEB 3IPEA 5CGBA 2EVHA 1XV8A 4L8BB 4J8RA 3QRFM 3PWPB 2YAPA 3CZFB 4E41B 3F5WA 1L7IL 2F7PA 4GI6A 4KI5E 2VR5A 3UC0H 3O3AA 4H5SA 5EN3A 4PJAA 3AQZA 2GJZA 3IDNB 1MPAH 1SLXA 3WS6C 3G6JF 1WFMA 3ARGC 4PS7A 1DBAL 2M83A 1A6WL 3MCKA 2BC4A 2AQRA 2QVTA 1UWXH 2DQFB 3CLEL 2OPCA 2Z9TA 1NFIA 2X9YA 4G8GE 3BZEA 1CFTA 3PP4L 1EXGA 4QHNA 3K4ZA 1G6RL 2VMFA 5DVKA 3PWPD 4QHUA 3OHXB 3HHRB 3V9EA 4M5TA 4UU9A 4Y5VC 2GHZA 2NTSP 1N4XL 4X98A 2WPGA 3M17B 3DA0A 1CR9H 4WU7B 4JNXA 2HTLD 2WINB 3DRTA 4LFHD 5HJDA 2FNWA 3EO0A 1CDYA 3HI6H 4NRZA 4R4FH 2OCCB 5EA0L 3JTTA 2OMUB 4MGXA 1MJ8H 1CD9B 3GBNL 4TLSA 1IIIA 1BEYH 1DVZA 1TVBA 1ZVNA 3ARBB 3JTBA 4P06A 4TS6A 4ZO7A 5DC2A 2NLJB 3U9PL 4Q89A 4Z18A 3EOAA 1TTBA 4ELMB 2ZSWA 3FHEA 3BN9D 3CBJB 3FUHA 4B97A 3AQXA 3CFJA 3FF7A 1IE4A 1AXIB 2RB8A 3UFIA 1L7TL 4KDVA 3ZXAC 5A2FA 4H7VA 1T22B 5KSAA 5LCVA 3G9VA 1BQLL 1NA8A 1O6TA 2W91A 2YWYA 3GSXA 4JW3A 5E1AA 5IHZA 5SX5K 5KSVA 4UCFA 5IVXB 3BRDA 5F7BA 3D5OF 1NCWL 4KBPA 4XCNA 2B3IA 5IT2L 3NQKA 2BY1A 4K7FA 2VR7A 3RWIB 3NEXA 3PS6A 3S96A 4NC1C 1R17A 3O3EA 1VEOA 4JRXB 3ZYOA 1GYVA 3MNVA 3OBAA 5ISZA 4I3SH 3CLFL 3NT0A 4R0LB 1XD0A 5F7WC 5HSFA 3D0LA 1F3JA 3ULUL 3V9FA 3MLTB 4MAYC 1LDSA 3MBWA 1ZVYA 2P42B 3EKCA 4N2GA 4OD1H 2R56H 4KKCC 3WFBL 2R1XB 5HPMA 3HR5B 4Y2OB 3IJHA 5CILH 1G9NC 1H19A 1NCHA 3KYMB 1T89A 1MCSA 1Q9WA 4JRXD 3D0VA 4JR9H 2XLLA 2YOCA 4E9RA 2QPSA 4NFCA 4ZTPL 3I6KB 5I75B 3IFPB 4IRSA 1T7VA 1FL3B 4EOWH 4OM0L 4G3YL 4A39A 3ULUE 2MPAH 2E0PA 5MEQA 3QIWA 5I17B 2JCCA 4NN5C 2HP4A 5FHBH 4Y1TA 2BSCA 2XWTA 3QJRB 5F9OH 2OI9C 2HX7A 4NQUA 3MRLA 2DQCL 3P0YH 5IOKA 1N5AB 3FT4B 3IN2A 1ZJBA 5T1LB 3TC9A 5ESAA 3ELAT 3KGUA 5K1NA 1ANUA 4X4XB 3RWJB 1NIBA 2CD0A 5KVGL 2VJ8A 2FIRT 1JE6A 2R1YB 3LH9A 3MRNA 4XXDA 1BVZA 2DQGL 3HFFA 4GG6E 1HHJB 3S48A 3L13A 3ZT7A 5ACLA 3V0EA 1ZANH 4L9LA 2XXCB 5T1LD 1UACL 4GT0A 1Z7JA 1D6VL 2X7LA 3EG9B 2E4FA 4PJDB 3W2DL 5EEWA 4HCRA 1YC7A 2EXTA 2YD7A 3QWOB 2UXTA 4U3CA 2B1AH 4AW4A 1BQ5A 1BEXA 1Q9KB 1TTRA 3BMVA 2XWCA 4KVNL 3VI3F 5KVGE 4JFUA 1RU9L 1WCBB 2CDGA 3EO9H 3L8QA 5ANMA 4LEXH 4DO5A 1AKJB 3INUL 4L3EA 2DQUH 4HXAH 1U95B 3MLYH 3WJJA 1IAII 2ZX5A 5EO1B 3DROB 5JDJA 4O58L 5JTWA 4C8XA 2E8ZA 3PREA 5MP6H 3GB7B 1PCSA 1FNGB 1F6AB 1KBGL 3S5LA 1MREH 4YVUA 4UILH 2C26A 3RAJH 3LKOB 1KTDB 2XIDA 4RZKA 2NZIA 4QYOA 1AOHA 5CJ5A 3WFDL 5KVEE 3IKKA 4JPVH 3ZHKA 1AKJD 1N59A 3U1SL 2BNRD 2P7TA 3QG7H 4QTHA 4Q7DA 3MCLL 2R2BB 2IXQB 3MRFA 2DRUA 4OLYL 3QDAA 1BF8A 4OGXL 2JCCF 1Z6JT 5FF6A 1T20B 2BOCA 2IANE 3UPRA 2Z35A 4P5MA 1AQMA 1BXXA 4HHAB 3WEMA 1NFAA 2FJUB 4TMPA 3LRSB 3JXAA 3V7MA 5L2KE 1K8IB 3O2DH 5SWZA 4N2DA 4NEHB 1MY7A 4B95C 5D2LB 1DBKH 3KXFA 3U4BH 4K9JA 3FB6A 3AROA 1T21A 1H0DB 3LKQA 1QFWL 2NY5H 4CSTA 3KPMA 5TE7H 1TEYA 4G5ZL 1JPGA 2H0FA 1F8TL 2N3JA 3SPHA 3QUXB 3FSOA 2QPDB 1PIGA 1YLBB 2EO9A 3DUHA 2EC8A 2C9SA 4UDUB 3OKKB 1EO8L 3CSBA 5J1AB 5JQ6H 5HGHA 2Q6WB 1YRKA 4XXWC 5LAXB 3O3DA 2LVCA 3D2UD 3MFFA 1Y0LA 5E6YA 4B6ZA 3P9MA 1YAZA 7FABL 1QBML 3NJLA 5JXED 4MQXC 2FJFB 4KRMB 3QDMD 4K3DL 5CZKA 1VCAA 2GB2A 2ZWNA 3CHSA 5B22A 1W72A 4LU5L 4JKMA 2WWNA 5E5MB 2ITDA 4ZFOB 3VFWB 2HG5A 2XA8L 2IH8A 4X7TA 3VXQB 4MNQA 4XPFH 1N7ML 3X3GL 4XPBL 4IRJB 5D5ME 4B0MB 2Z1KA 2H9GB 2PLTA 1B9KA 3L5JA 1FNEB 1PYWB 3OX8A 1XR8A 3NACH 3NN8A 1SY6L 1RFDL 1CGUA 4P4RB 1FHGA 3BKCL 3MROA 4R5XA 3IWUA 3BPNB 2HX8A 4HWBH 1UB5A 5D93B 5BS0B 1G9HA 5B21A 3SN6N 5KVFL 2QKIB 3HZVA 3MBEC 3O6MH 2BP3A 1D7DA 2OXHB 3PP3K 3MV9B 5IWLA 4PY8J 2ORBL 4IRJD 3B9DA 3G5ZB 4UTBH 3TIEA 1GIGL 3RNQB 1DLHB 5D9SB 2TRYA 3CFEB 3V4UH 2VDPH 4UYPA 4ABUA 3RKPA 2QQKH 3GBML 4NO5B 1CFMA 5BS0D 4HIQA 2BX5A 3IFNL 2JSFA 1JK9A 3TJEL