3FQ4A

Crystal structure of the calx-beta domain of integrin beta4
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
109
Chain Sequence
MRDVVSFEQPEFSVSRGDQVARIPVIRRVLDGGKSQVSYRTQDGTAQGNRDYIPVEGELLFQPGEAWKELQVKLLELRQVRRFHVQLSNPKFGAHLGQPHSTTIIIRDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin beta-4
publication title Structure of the Calx-beta domain of the integrin beta4 subunit: insights into function and cation-independent stability
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 25
structure length 109
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3fq4A00
2FWSA 2QVKA 3FQ4A 3EADA 3FSOA 2LT9A 2KLSA 3RB5A 2DPKA 3E9UA 3E9TA 2FWUA 3GINA 2KLTA 2QVMA 3H6AA 3RB7A 3US9A
chains in the Genus database with same CATH superfamily
4YHMH 3FUKA 4FZEL 2JKXA 3CXHK 1MQKL 1A47A 1CICD 3P0VL 3UG4A 1M1XA 1FDLL 2FEJA 3D2UD 4JY4B 3TIEB 4ENZA 4I5BA 1OLLA 4JREB 1PG7L 3ARFC 4WWKD 3RJQB 3T65B 3VCLA 3ZJAA 1QFWH 2NUPA 1J8HB 1KBBA 1LK2B 2PTVA 2KI6A 3EBIA 3G6JE 3KYNB 4KV5E 3DX8B 3N2JA 1UOLA 3QZBA 3L5WA 1BOGB 3I85A 3UBXG 3UPRA 2H8PA 3F7KA 1JYWA 3QYNA 1KXHA 4NCC2 5D71L 3O3BB 1JGVL 5AUMB 2VDLL 4MRBA 3V6OC 3WNMA 1DCEA 2AW2A 5PAZA 3HS8A 5GZOD 4PGCB 1T3FA 4R0LB 2R9HD 4FG6C 4MWFB 2BPBA 7FABH 5CGTA 2EADA 2YZ1A 1RJZA 2ESVB 4Y2DB 5FGSA 3KBHE 4K3HA 1VGKA 3UAEA 3HOGA 5HVWA 1BM3H 2XQYG 3WKPA 4KMTL 5I6NA 3FCTB 1DLHA 2BNQD 4LCIL 2WPGA 2E9JA 1KBPA 4B9JA 4Y8AA 3IS1X 4KNTA 1TYJA 5DEFA 4H40A 2WTPA 4E9RA 2PPEA 2Q10A 3MV8B 2DQEL 1SUHA 2AKRB 2H2SD 1TTAA 3VGDA 4JZNB 3DIVA 1DVFB 3L4WA 2YPLA 1RZIB 3VMPA 4ABWA 1A1OA 5D7EA 1S7VA 4M48H 3VWJD 4NZRL 1EHLH 3G5ZB 2F6AA 4XO3A 3Q3GA 2CRYA 2ICWI 2D03L 1A4KA 3U7YL 2CO7B 1NBYA 2GK0A 3P3UA 1JXDA 2EYRB 3ZGHA 4UYPA 4PLJD 4IGBC 5AVQB 1N2RB 2DIBA 4HJJH 4NQCE 4XHQA 4HEPA 1RCYA 5E03A 1AGFB 3US0A 3PL6B 3PV7A 2WXJA 5FYKE 5E6SB 5FYKU 1N12A 2W81C 4L1HA 1FCCA 1KF9B 2WKLA 2BJML 2FWUA 3QA3A 1MRFL 4OCRH 2XWRA 4OFPA 4PWIA 1WISA 1MSPA 2ZYRA 2F7QA 1HYSD 3NSJA 5FYLD 3VFMB 3FUMA 3CHSA 3RL2A 1E9QA 5J9PA 3V10A 3EYFA 3LKSB 4LL9A 4MNGA 1T0MB 3T8MA 3CLFL 4XP4L 3MU3A 2JTYA 3MLRH 4HS6B 4LQ1A 3JTTB 4HISA 4OGQC 1MHHA 2L7JA 4NKDB 3MGTB 4DP7X 4GPVA 2UZYB 2JCCF 3LHPH 2QGEA 2WHVA 1MWAH 3EO9H 4H88L 5IFAL 4Y19E 3U7WH 5A6LA 4OVUA 1DSFH 1QLRA 3E8UL 4KUCF 1E8YA 2V2TA 3D85D 3DBSA 3KHQA 1OP3K 4WVRA 5L4JA 1MHPL 3A3YB 4G6ML 1T2QH 1ID5I 2YSTA 3SDXF 2CKBB 1BD2D 5ESAA 5KSVB 3PJSB 4S1SH 3DWTA 2DQGL 2P43B 1G4MA 4YGVB 3NN8B 3EJSA 1BVNP 2WBJD 2BS8A 3BUTA 4Y88A 2Y24A 3D52A 3Q2VA 3ZRFC 1X6NA 3S2CA 3F12B 4XBGA 1JGUH 2YMOA 1MCOH 4P4KA 5EO9B 4LE8A 3CFTA 3BD3A 1JPTL 2X2YA 4GRWF 4YPGA 5EWIL 4LEXL 1P4LB 1QR1B 2Q7AA 4J5VA 1G9NH 1OAKH 1YNTA 4X8XA 2Q8AL 5K59E 2VDKB 8FABB 4N0CD 1HEJC 4X5WB 1PZSA 5LQBH 2VXTL 3VMNA 3ZKND 4WW2A 2DM2A 5DS1A 5E99L 3E9TA 1IAII 4K2UH 1TQWA 3IVKB 2F15A 3OKEA 3ZKXC 1L0QA 4X6DF 4HKBB 2D0FA 1EMTH 2OL3A 1KTCA 3ZOAA 5KYNA 4PJIF 2VLRD 1ORQB 3FOLB 2YBRA 4LP5A 4PG2C 5I30H 3TBSB 2F8VA 3ZIMA 4K71C 3MGOA 1FGNL 4LP8A 1JVLA 5DVPA 4U3SA 4YSPA 5TE6L 4E41B 1AP2A 2CJ3A 1QQDB 3S5ZA 5E8NB 2JE8A 5DHVH 4GP4B 2HAZA 3TBYB 3FB6A 1TJGL 3MBED 4Y9FA 4ZUWB 1OZTG 5GS0D 2YD4A 3SE8L 5CFHA 1M2VB 3LRSB 4NRYA 4F7PA 4YHKL 1AKJD 1JK8A 3EGXB 4QRPE 4Z3GA 3G3LA 4GI8A 5DRZA 3THMH 1D6VL 1MF2L 3WN5A 1H8OA 2FCBA 4L4VA 2GJ6D 4NAQA 4NPJA 2Q7YB 5BUAA 1RZKL 4Z3TA 4WU7A 1IIKA 1L7TL 2DKUA 3OKNB 3QUZD 3NEEA 4GSXA 4U6HA 1R3JA 3O45B 1IM9D 2LLLA 4GRWH 5EIIA 1OAQL 3OLEA 2IALB 3R06B 1GSKA 1XEUA 5ID1B 5BV7L 2XN9D 3PWUA 2YOAA 3GHBH 4Z18A 1FJ1A 3NTCL 2W9LA 3DNKA 3B43A 4DP9X 1IM3A 5GSRB 2B5IB 4LLDA 3QH3A 1JERA 2C4XA 5E8OA 2W0PA 3I3EA 2F0CA 3I75B 4NQDD 4IHOB 4PRHB 2X1OA 2PCPA 4YIQA 3EJCA 2BP5M 4PM1A 2CDGA 1J5OH 2BM3A 5B8CB 3LD8B 1T1YA 3KCPA 2UX6A 1DZ0A 5JYMA 2C3WA 2OMTB 1GGCH 3H2PA 2HH0L 2J44A 2HJLB 1CDYA 3WUWA 4NNYB 5HY9B 4X80H 1IEAB 4TUJB 2DH3A 2VDPB 4E9TA 2P47B 1CXIA 3LKQA 1I3UA 2OL3L 2NMSA 3O3EA 4FHBD 1E7UA 5C0CB 2H5UA 2CBQA 2BIQA 3PV6A 4PJGA 3RVTD 2ZX8A 5ACZB 5KN5A 6TAAA 5EF3A 3DTXB 5AW7B 3FF8A 2AERT 4P2QD 4LSRH 1S5HA 2P52A 2AGJL 4LPYA 4J6RL 2X53A 4R7NA 5BXFA 1UWEL 4X5XA 5D7JD 1M57B 4WWID 1U58A 4NHCH 2JLPA 2NXYC 1JRHH 4OB5L 4WENB 4DERA 4WHCA 2CXGA 4K3EL 4MMXB 2V0AA 4HBCL 3PFQA 3HCVB 2D7QA 4G9FE 3II3A 2EXWC 4GSDL 2FLBT 1AQDB 1JGLH 3PUUA 1ZS2A 2AI0H 2OW7A 1SRDA 5JXEC 4FLSA 1EH9A 1C5BH 1A3LH 4JO2H 1SXAA 4Y5VA 1AKPA 4IW4C 3HR5B 2VJ8A 4OF5A 1P5UC 4DGVH 4DEUA 2WYHA 5ID0A 5FFLA 4P3DB 2WINA 2OR9H 4R5XA 5LAPA 1FIGL 1F56A 1MXGA 2ZX6A 3ZE1E 5E0FA 3D9AL 4J8QA 3T6WA 1TFPA 2WCSA 3QJZA 3X17A 4RBPH 1QZ1A 2IV8A 4H2AA 5KBMA 1J1OH 1WWWX 3EDEA 1OLZA 2YKKA 2LU3A 3VB9A 3UTQB 3AWEA 3DPBA 3ISYA 4JB9H 3MRQB 4D8OA 3HLKA 1BQHB 4ONHA 2EEXA 5EHFA 3KCWA 1FE8H 4OCSH 1FPTL 4J8RA 3RUGB 1XGTA 4HSQA 1KOAA 4Z7VB 3V5HA 3ZO0A 2GTWB 5EZJB 5D4HA 1G7LA 2MJWA 5H8DA 2GFBB 2BC4B 1UD4A 1CLYH 1EVUA 4M48L 3S9DB 1Y1UA 4BXVA 5I74C 2HTKC 4OZHB 3B9KC 3WNIA 5E2VL 4ZMOA 4JQIA 4L3EA 5DCCA 3GMNB 3UTPD 3KPRB 3GBML 2FYVA 2CJUL 3UZVB 4GXFA 3SGEH 5BVJB 3OKMB 4TRPH 2WIIA 2VRKA 3QEGH 1JZ8A 1P69B 3BZ5A 3W0WB 4JPIB 5E08H 5H37G 3M45A 2WXNA 1Q38A 4M5TA 4JG1L 2V9TA 1QRNB 5F72S 2B0SL 3VXNB 1C1EH 4HLJA 3H9SA 3QC6X 3BWAA 3ARGC 1PQZB 3IJHA 4F7TA 3G6JB 4KK8D 4LHQB 3C6LD 5AAMA 4Q4EA 1F18A 3RNKB 3RVXC 4A2MA 1MLCB 2NW2A 2TAAA 3TM6A 1HI6A 2N56A 3CFKA 3IDGB 2BIMA 3BP5B 2FYYB 2J2ZA 1EZUA 3WXWH 5JOEA 1BX2A 3MJ6A 3MLRL 3DO7B 2QSCL 4Q0XL 3RHWF 5IOPA 2VDQB 3T4AB 4PTTB 3SDXA 3WFDH 2QQKH 3AGWA 2ORBL 2DH2A 2FL5B 2L7UA 4JJOA 3KW8A 2IPTH 3WYRA 1KMGA 1QBLH 1V3LA 2JQAA 4XNZB 2BP0A 5E9AA 2BHFA 1MRCH 4Y5YC 2OYPA 1ASQA 2WXMA 2AV7B 4PUBH 5E8PB 2XIBA 2GVYA 3HFMH 4FULA 1O7DC 1E4WH 3M7FB 3VXTA 2FBOJ 2EVFA 1BVZA 3ZE0F 1IEBA 3LEXA 4JO3L 4MJ6B 3WJMB 4GAJL 4AUUA 5IEKB 5JIPA 5ERWB 1D5IH 1I3RB 2OMYB 3PWNB 4TVPH 3ZBMA 3MBWB 2QZ5A 5EFIA 1QSZA 3IF1A 4ZTPL 4X6BA 4C83B 2BVOA 5I76A 4WWNA 4OD3H 2Z91B 1ZDQA 4AIZA 3AACA 2MCPL 5K1VA 5KSAC 4ALAH 1BBJA 1JGUL 1A1NA 1XCXA 2XX1A 3N41F 4YVNA 2FGWL 5TFSL 2X2IA 3NJVA 3WIFB 1X5HA 1FVCA 2P48B 3W37A 3UEZA 5IB1B 1U30A 4JQIL 3MA9L 1KSRA 2A6IA 2NY0B 1G9NL 3VWKC 1K8IA 2VMCA 4RMQA 1YEFL 4PJIA 1UUNA 3GSRB 5CMAA 2MMXA 4JGJA 5DZOA 2GTZB 5BMFH 1T1WA 3BGFB 3DVIA 3NPZB 4IU2B 4N2KA 4OZFB 4EN2A 1E5CA 4K5MA 3IFNH 4PGZA 5MP6L 2VSCA 4J6IA 1BECA 3KPQA 3VXSD 4TTDD 3QORA 4QHUB 8PAZA 2ZCKH 3FQRB 4HS8H 3NGBB 4P4RA 4GRLB 1OTSC 3NRPA 3ZE2F 3EG9B 1Q0YL 1I9IH 5DMYA 2NUTB 2WTOA 3BVNB 4YHIA 2CK0L 5E6ZA 3SY6A 5LGJB 3RB7A 3RVUD 3NQKA 3MMEB 5FOBB 1F86A 1UWFA 3AQDA 5ALCH 4G8GA 2DQTH 4YFLF 1U92A 2VWEC 2NY5C 2X4OB 2Z31B 3AAZB 3MUJA 2QPFA 2UY7B 4W4OA 3SDDC 2AHIA 3MYJB 1K4CB 1MFCH 5FWRA 3LV3A 4MCZA 1AZVA 3D4GA 5I18H 2ZOOA 3CLEH 3GZKA 1IAOB 1NQBA 2A7BA 3ALXA 4RAUB 3EJZC 1OZUA 2VR9A 3S96B 3QIUA 1OK0A 1XCWA 5AAWA 1UGNA 1MFDH 3WEBA 1KGIA 5AB0A 1JGEA 1R5WA 1UB6A 3SCMB 1JTTA 3K6OA 2KHAA 1CFNA 2PYFA 2OK0L 2FWLB 3GMQB 4X4XA 2PW1B 2VN7A 2X4RB 1AGBB 1HSAB 2J6EA 1VEOA 4JZJC 4LLUA 4DTGH 1YEHH 3AB0C 5IMKB 2ZJSH 3FZUD 4WK0B 4XVUC 4CJ0A 2HWZL 4XMZA 4G3YH 2YRLA 2JB6B 2R0ZL 1VA9A 2CRMA 4ZUSA 3SKOA 3ECVA 4P8QA 3UDWA 2ITFA 4MNQD 5MERB 3MRKB 1OW0C 2EKSA 5DLLA 5HI5D 5CHNA 1LO4L 3BP6B 3MNZA 1UJ3B 3FU5A 1IKNC 3EBAA 3ARBB 3BQUD 2IDSA 5B3JE 5CLWA 3GUFA 5IV2A 1N6UA 1OALA 3NJFA 3QXTA 1U8IB 4I0PD 2WWOA 1B2WH 4U4BA 2ZNWA 4NT6B 1G5AA 4QR7A 2UWEF 3V0VA 1D9KC 5D1XD 3ZL4L 3BISA 4NZJA 4EN3C 1A21A 3S2AA 4GBXD 3BQVA 3R7QA 1JFQL 4L4TE 5F9OH 3VXRD 3MDJA 2IAMB 3GMRA 4UDTB 4K94C 4ACTA 2K6WA 1R3KA 4GAFB 5AB9A 5DHYB 2YD5A 2WXQA 1YPZE 4U1IA 2ZUQB 5D7IE 1NBVH 4QRUA 2QADC 1DBKL 5EIQA 5EZOH 4P49A 1H6UA 1INEL 1RAMA 4LNRB 5DS8B 4PJ8B 5KEZA 5LGHH 2LLGA 3VXUB 3LPFA 4QXVA 3KGRA 1QUNB 5KVFE 3AY2A 1KENH 1S7UB 2HLAA 3U30C 2ATAA 2LOEA 4KVNL 3JV6B 1XB8A 1F4AA 3FT4A 3U9PH 4PJ9A 1BW8A 4P05A 4NWTL 4JY6B 3OAZK 1C5BL 1WBXA 2GW5A 1K85A 3D09A 5DMIL 1WPCA 2ZKMX 3EJPA 3QDMA 4KWUA 3IKCA 1MJJB 3VTMA 5F93C 3HE6D 4KTEH 1RPQA 1TEYA 5DJYA 5AOMA 4L3CA 2ZUXA 4N6QA 2BXYA 4NJAH 3U83A 2EE9A 2J6EL 4OR1A 4PR5B 4WNQB 1G1YA 1CFSA 2XA8H 4YR6A 2OMZA 3D08A 3GSNA 4FYTA 4QT5A 1WYJA 4H26B 2IFGA 3CTTA 2G3ZA 1XH1A 2XTJE 3DXAB 1OPGL 1Z6JT 2QQQA 4A1RA 5BOPA 2XI9A 2ZG2A 3BH9B 2YD9A 4MAYC 1T21B 3SYCA 4S2SA 4W9KC 3K6SB 4LBEB 4PD4K 4JUTA 4LXFA 3IDNB 3C08H 4AQ1C 2NY2B 2CUHA 1RUQH 1CLYL 3CVHH 1LNUA 2IPUK 5DEZA 3VE0A 1JWSB 4ZO8A 2AQ2A 2UXVA 3CBRA 4JO1H 3H4FA 4FQHA 4FZ8H 1XF1A 3S4SA 1NFIB 4RGNE 5EOTB 2W38A 1DQIA 5IVZB 3GI8H 4UQAA 4WI2A 4Q52A 5C0NC 3SODB 4D9RD 3QJFB 1BZQK 3VUAA 3HHSA 3DSNB 4OM1L 2ZAHA 3CSYA 3IRPX 4KXZH 4L8DB 2E5EA 1TO5A 3U79A 1TJHH 4ZFOA 4KITB 2VW4A 4EZMA 5LO7A 1AXSA 2C1OB 4LCUB 3G6AB 5EBLA 1CR9H 4BA0A 4QNPE 3WTUA 4K55A 4IGBB 3F7LA 4P2OA 5GIRB 4ZFGL 1ED3B 5IQ9B 3NEXA 2YPLD 3CE1A 3RGHA 4G9FB 1E5UI 3RIFF 5T1KA 4FJYA 4LOUD 4WTWA 3D34A 3KVQA 2D9QB 1FZMA 4DESA 4CMMA 3X13B 5SX5K 3ABMB 4KROC 4X42A 5ISZA 5IQ7L 1R0AL 1TFHA 2L0DA 2QQKL 3U0WH 1I1AB 3MJGX 1KXVA 2F53E 4JDTH 4LOVA 4G2AA 5ELIA 1UWXH 3O41B 3ZE1B 2YEVB 3B3BA 4JFDE 4PUBL 1JE6A 1CVSC 1YECH 3LN4A 4BFNA 1OCZB 2HRLA 1E4WL 4U3HA 3D50A 1BQSA 3GSNL 4HWZA 1EEZA 1NMAL 3SJVE 3KYOB 4WZ9A 1HQ4B 1QBMH 3B4NA 4IIQA 2N0MA 2VMJA 5TQ2L 4J3UA 4TUOA 4OD3L 1G7MB 4PY7B 1WAAE 4LLVA 1VZIA 4O2EB 4NQEB 1Y0LB 1YYMH 3C5JB 2A74C 3DX4A 3T0XA 1THCA 4A55A 3UAJC 3F58H 2MH4A 5K39B 3FTXA 5A7EA 2VH5L 4S0SD 3RURA 2OJZH 4JL1A 5IJVB 1KLFB 5D1ZI 1EXUA 3LPWA 4PCTA 2FBJH 2K78A 1NL0L 4FXKA 4YX2H 1GGIL 1JN6B 3QI9B 3RFZA 1YDPA 2G3NA 4FCAA 1WBZA 4PGEB 5F7NC 5HHMD 1FN4B 1NSNL 2YXMA 3W2DH 2CCLA 2O61A 5HHVH 4KK9C 4FXGA 3IFNL 3ZHDA 1N0LB 4OZFG 3UTZB 4HUWB 4HA1A 3W9EB 3UJIH 4ZFOL 4ELKA 1JAEA 2W9EH 3V0HA 3P40A 1VCBC 4GW1A 1KCVH 1KDJA 4FMVA 1FG2A 3ULVF 5IFJB 3IRZA 3HMWL 4I2XA 5HI4C 2MRYA 2EIJB 2C26A 1XO8A 3GSWA 2BNRD 2VM9A 4P4KD 4TLUA 3EJYC 1I3VA 8CGTA 2DQTL 4W6XB 3ZKXB 5IP4A 3QG6A 4JQXC 1H5BC 3ARRA 4HKXA 4PS4H 1KELH 3H56A 1WIPA 4ETQB 4PRIA 5HHXH 2ED6A 3CZFA 4HKZB 3GXFA 5F7BA 1QR4A 2C7UA 5ITFB 3UCQA 4GEIA 4X5QA 4N8UA 3ROLB 3RGVA 1E0OB 2DAVA 1X5ZA 3QEHB 5ETUA 5G5DA 4XOCA 4Q9RL 1BF2A 1N8ZB 1Q9LA 3BUIA 1ET8A 2AXFB 3DV4A 3X1NA 5CJXA 2IOOA 4GRMB 4F33B 1NEUA 4G9DB 2NW3A 4P46A 1A7BA 2NSXA 3E7JA 3N42F 1V8HA 3TPUB 5TH2A 1LEIA 1ZGLM 1KBVA 1XEDA 2GSIB 4X4YA 1NEPA 2FAUA 4YXLH 2DEXX 5K93A 4UTAH 1JPFB 2KZWA 2UWEA 4AOFA 2XWTA 2EP6A 3UYRL 2CJSA 3DJTA 3CCHB 3VH8A 1EEYB 5JUEL 1JZ6A 2HP4A 3IMBA 3D4YA 5GISH 5D72H 5CUSL 2DI8A 3C8DA 4LF3B 4J4PD 1Q1JH 4L4VD 1OCWH 1WFJA 5D2NA 5GRZA 3ULVH 4LARL 5KVGH 3PJNA 1ZT4B 3CVHA 1BV8A 4DO5A 1M05A 5C9KA 5HYJE 3B6SB 1WVZA 1Y18B 3DGCR 3L3KA 5JIQA 1PL3A 4FFYH 4FKEA 4Y1TA 2GI7A 3BVVA 4WSKA 2RQEA 3VX1A 5I73B 2XETA 3CZNA 4IYKA 4AM0A 5L7XL 1U6AH 3N50A 1ROWA 2CM6A 1ZLSL 3ZT5A 4PJHE 2OYMA 3V52H 5C0RH 3JWOH 1IM3D 4AGQA 3I02A 3UTTE 4X7TA 4B3EA 4RIRB 1UACH 4PV1C 1Q9KB 1IGJA 4GQPH 3M17B 3CBKB 1OWRM 2YGVA 4ZD3L 1QASA 4ANVA 3WS3B 1Y7VA 1TVDA 1WG3A 1ZT7A 4KKCD 4UF7C 1DO5A 5DVMA 5F7HA 4R4NC 1OB1A 1J5DA 3O4LE 4LLAA 3H7LA 4P0DA 2EDYA 4MD4A 2BIPA 1P7BA 1XTLA 4O5LL 4N28A 2A73A 4QCIA 3VO0A 4KK6C 1G9EA 2FD6H 4R7DA 3DDGA 4TNEA 2QT6A 1ZVSB 2ITDB 5DT1L 5EEVA 3ILQD 4XNYH 4IMKA 4HSAC 4Y7OC 5DA4A 2ADIB 4RX4A 5LXGH 1EK3A 3MVSA 3CC1A 3GHEH 3MCLL 3S5LA 4PGDB 2AITA 1A6ZB 2XA8L 4Z7UE 4JPKL 4YO0A 3FQTA 4FTVE 3MZTA 1JZ5A 2FIRT 3KG5A 4IDJH 5HDOA 5I1LB 1I9JL 5L9DL 1NLDL 4XCEA 3GPSA 3FUDA 4Z7AA 3DV6A 4NKIH 4ODUA 5E56A 1KIQB 3CFEB 3KNBB 4KKNA 2TSBA 5MEQA 1AHKA 4AQ8A 3GS7A 4YC2C 1TVBB 4XNQA 5J7CC 4Y16C 5ILTH 5JXAH 3S8WA 2KC0A 4YSEA 2B4CL 1NGYB 3SKJH 1P0SE 3PWJA 3QCVH 4L4TB 4JO1L 1SEBB 4LEBA 4PJ5A 2CGYA 1U0QA 3HA0A 1YPZB 5J56B 3TZVA 5IMMA 4A68A 4YK4C 2CR6A 5DSCA 5EU4A 5D7IB 4GLRH 1OAXL 4DF9A 2XKSA 5IB3A 3NDYE 2J1XA 2W9DH 4E68A 3NJLA 3TVMA 1TJIH 1ACYH 4BSVA 3FAWA 2WN3A 1XGQB 3HPLB 2V5TA 3CDGA 5I74B 5I6KA 3AXLB 4OU3A 2NX5B 4RQQB 1D7DA 1O9VA 5GS3A 3MRNB 3BZDA 4OFYA 1A7OL 3AWGA 3CN4A 1UZ6E 4ZZKA 3D39A 3MRCB 3OMZA 1IFHH 2V2WA 3B3IB 4M1CC 4GI6A 4DCQB 2UZIL 4H8WC 4P59L 2HMIC 4LIQL 1U33A 3ZT6A 2HKAA 4BQ6A 2Z93B 2PR4L 2Y5QA 4DQAA 2DDQL 4XVOA 4K23H 3TEWA 4E0RA 3CVDA 2EH8H 5IZ7A 3QYMA 4KRPC 2CLVB 2FLRT 1MCEA 2COQA 4HALA 4F9PA 3K71A 3C60B 2L8AA 2OMWA 4U2YA 3TH4T 3V4PB 4XP6L 2VAAA 1J9QA 4N2AA 1KXTA 5KVMC 5JLZA 2W0FB 5FFOA 1XR9B 4ZQKA 1QACA 4S1RH 1LE5A 4BH8B 1DJGA 5JW4M 1MRDL 3PDOA 3H0TA 3QJUB 2XTJB 3TYGH 5AKRA 4M9OA 5HGAB 3UBHA 1FZKB 4GP5B 4P9HL 4WJG3 4KUCD 3RHWK 3B8SA 4L18A 3PNWA 1P84K 2QZQA 1UXWA 2F61A 3F84A 2AF2A 4K94H 1NM4A 4YE4L 2CO2A 2X09A 3T08A 2HT3D 2FWOB 2AC0A 3CMOL 2H26A 3QXDB 2RJMA 3TU6A 1U8NA 25C8L 5KVDL 2R23B 2J73A 5CP7B 4RGNB 3SPGA 5E2TL 2J20A 4N4YB 3VM5A 2Z35B 4N5ED 5I8KH 2VQ4A 3QCUH 3UBXA 1LQSR 5E1GA 3IPBA 1I7UA 4WY7L 2NTFA 4BFOA 2Z4QA 5KSAB 4NP4L 1DVYA 1XF5A 3C9NA 3STLB 4PB0H 3T0EC 1W15A 3TYFB 3ZSSA 4XZUB 2YAQA 1JNNH 3LRKA 3SB3A 1FYTD 4PJ7E 1L5GA 4LVHC 5JORA 2ZTBA 4A2DA 3WNLA 3GSQB 1E3FA 1PDKB 1MDTA 1O7SA 4ONFH 2QVIA 2XQYA 2GT9A 3RTQA 2Z7UA 4U31A 5EOQL 5TDOA 3OMAB 2JJTA 3OTTA 3VXMB 3MUGB 4LPUA 5EBMB 5EDXA 4Q9QL 2X4PA 4OAWA 4HK0A 1JF5A 5CINL 3IMSA 1KB5B 2NY6B 5GGRY 4DKEL 2CUMA 4YHNA 4GSQA 1P4BL 3A5VA 1DQQB 4PRPB 1RHHB 3HZKB 4F24A 5CCHE 5EO1A 2NNRA 2HT2D 5DK2A 3QORD 2VW6A 3N1FC 1Y6MR 1W72B 4EI6B 1QVOB 1GAFL 1ZHLB 4FABL 1S6NA 5H4YA 4N0UE 2AXGB 2E59A 3QSKB 3KXFD 1QEXA 1S4IA 5KYXB 4D0DA 4F1ZA 2YRZA 1OQOA 1TZ8A 4IRZA 1N9PA 3GXTA 5KOMC 5KBKA 2O30A 2O72A 2HKFH 1RVFL 3GJFB 4G8GD 4X2UA 3M1OA 2VGLM 3BRDA 5BS0D 1RUAH 1AHWC 3MLYL 1ZOXA 1BYPA 4F37F 4OLZH 3RIKA 5GISL 4AVKA 3KYKH 5J1AB 1MI5E 5CEZH 3HMXA 1WJ3A 3MRJB 3QIUD 1OCWL 3AB0B 3L7EA 2DTMH 5CLYA 1UURA 4M7JL 4N0YL 3N1MC 5EG6C 3V7AG 1CTMA 3WFEH 1CD1A 2HN7B 3U0TB 3QC5X 4UIMB 3EYSL 4RFEA 5KSUB 1D5ZA 3PAUA 1CQKA 1FG9C 3ULUL 3FF7A 5KTEH 5IIEA 3KPMB 2ZCLL 4BFRA 1S7RB 4NQSB 3V52L 1EAJA 2BMKA 5C0RL 1BREA 2A9DA 1XDTT 1A4BA 3KPOB 4Q14A 1EJOH 3ATBA 4XBMA 3ML9A 3V5DB 3L3JA 2FR4B 1NWPA 4C8XA 1TKWB 2VLMD 2XXMB 5A1AA 2V4LA 3T0BA 3EADA 1JBJA 1PNCA 5C07D 4YSDA 3CFBB 1B9KA 3I6GA 4DZBB 3A6BL 1CGVA 3WO4C 2VW7A 3BOVA 3DUSA 2AXWA 2G2PA 1IT9H 4FLOA 4UU9A 2XN2A 3INOA 5A16B 2JIXD 3TBTB 2CDFB 3BPNB 1K4DB 1X9RA 5HXMA 1SYVB 1VFAA 2CPUA 4NBZB 3T1FA 2FD6L 3F3HA 4WTQA 3FU3A 3TN0A 4XP9L 3CN3A 2DD8H 2X4UA 3SPVA 2JJUA 4NIKB 1NFDE 5DRWB 4DN3L 3NAAH 4XNAA 2A77L 3L5XL 2VITB 1XH0A 4PYHA 3WS6C 3OPZL 4IRZL 4UTBH 5JDSB 1SEQL 2NR6A 1KYDA 2EZ0D 4OI9A 2XPYA 5IW3A 3PY9A 2V5RA 2YD1A 5H37H 4CMHC 2WWKO 43CAA 2NYZA 4ACPA 3BD5A 1KJ3H 3UXFA 4MJIE 4PJ9D 4R2GC 1CFVL 1JDDA 3NYKA 4MX7A 3W5MA 3HMXL 3OSVA 1IGCH 3VGGA 2W95A 3TNNB 3BVXA 5T5FA 1QI5A 1CF8L 4NRZA 3JWDH 5HYJB 3M88A 5L0QC 4OCYH 2MHAB 3NFNB 2SEBA 2JKIS 3A4DA 1BMGA 4P57B 2X4QB 5IQLA 4QHNA 3EH5B 1BFOB 1R24B 2DYPB 3SE3A 4H1LH 4PJHB 5EC2B 5AW3B 2C1PB 3L1EA 4XC1L 4AEHL 3HBPA 3P9LA 1YHPA 3UTTB 4HIHA 3R1GH 5SX4I 4MCYA 1JNHA 3US9A 3VD9A 3T8XB 1WZAA 1E42A 1UHVA 1X5AA 4MZRA 2R4SH 1DP0A 1FNEA 1MW0A 3ZTNH 1YJDH 5CLXA 2KZ1B 4JLRB 3BW9A 3UABA 1IFHL 4CKVX 1CGWA 4UANA 3KPPA 4YNYB 4U1KB 1UOVA 1IBZA 2NRDA 4F7CB 2HG5A 3O4LB 1SJHA 3O2WL 3D18A 3SE4A 1F4XH 2LABA 3CG8A 5BZWA 4MHHG 5GGSA 5GRVL 3TL5A 1LE9A 4ANKA 5HHNA 3KJ4B 1KGJA 4DWHA 2KMWA 2WXRA 4Z77B 1KN4L 2QQLL 2XFXA 4NFCA 4I1NB 5CLZA 1I9RH 1KULA 4TQEH 5DURB 4WUUE 5E94A 4JRYE 1TETL 1HHJA 3V0FA 2X89A 4TNGA 1J0KA 5ECGA 1ZMYA 4Z7UB 4EIZC 1FL6A 4FTVB 1YEEH 2Y7SA 4YWGH 3HHRB 2DLIA 2QDVA 2YEQA 4I9WD 4IJ3C 4OCXH 4Q2ZB 5DHEA 4F7EB 5HVHC 4M8VA 2CHNA 3FO1A 3RWJB 4K7PH 4QTHB 1G6RB 1JYXA 2NCEA 4NB7A 1Z3RA 2VXUL 3CDYA 5T1KD 4QRRA 2R8SH 1H3TA 3D4CA 1SN2A 2JK5B 4CDHA 1MCKA 4GUPA 5FUCE 2E86A 5GJTH 5GSVA 4IMLA 5T5FL 1IQDB 3POHA 2P8PB 4L48A 1ZLUH 5CCKL 1DEEB 5ISZD 3FOMB 4YGAB 5CJ8A 4FYQA 2Y69B 1HCFX 1OM3H 2EDXA 4JY4A 3TIEA 2I27N 4DP0X 3EFOB 4M4PA 5TPWL 3T65A 6CGTA 2QR0B 2VL5B 2B1OA 2P80A 1RKRA 3PHAA 1J8HA 1LK2A 1NCJA 2ATKB 3FS9A 3KYNA 3LNEA 4G5ZL 4APQC 2E7MA 3DX8A 4PWJA 1QFHA 1BOGA 4W81A 2H9GB 5D2LE 3O3BA 1MCWW 5AUMA 3Q5YA 3G5YB 3RVVC 4DKFL 3V0AC 4HG4J 5JHMA 4K5LA 4PGCA 4R0LA 4AQZA 1B6UA 4TSCH 3J2PA 3HC4H 2NQCA 3QEQE 4G8FB 2CUIA 2ESVA 4OJAA 1NCNA 4XN1A 3DJZA 4PRNB 4Y2DA 3UBXI 3BRFA 4KZEH 1Z9SB 1OPOA 2BIHA 1IGFH 3CD4A 4E9LA 4JFXB 1TYRA 1DCLA 3FCTA 3MJ9L 3QNFA 5TDPB 3EJJX 3WLWD 3VYOA 5LWYL 4KHXH 5ACMA 4I4WB 5F0PB 4MB3A 3UACA 4ADJA 2GJZB 3ET9F 2JKLA 4U2ZA 4IBUA 1OSEA 1COBA 3CSPA 2O6DA 3QHTC 2YHGA 5FA3B 2XWJB 3MV8A 1YN7B 1M7IB 4ODVL 4UNTA 1BXAA 2AKRA 3BDBA 2NXZB 4JFHE 4JZNA 5FPIA 1DVFA 3GLDA 1RZIA 3RKDC 1R4XA 1PX4A 4ATTA 4PTUB 1HILB 1RULH 1SXBA 3G5ZA 2VAJA 5D7KD 1XAUA 4TLTA 5T3ZL 3WDJA 1SVCP 2P45B 4NI6A 2P46B 4Y2NA 2CO7A 1MOEA 4HJTA 1PD6A 3RUGF 2EYRA 1V27A 1EEUA 1E9OB 4XN7A 4Z7VF 2DLHA 5HGDB 4DP4X 2WV3A 5HI3D 1N2RA 1AR1B 1GW0A 3E3QE 1UEYA 1PX8A 5CFAA 2J4WH 1AGFA 4NLHA 4Y2LA 4IKNA 3PL6A 4KNUA 3DHJA 4PRID 3WE1A 2XQYK 5IHZB 4OZHF 4U0RB 5A3ID 3P2DA 2R69A 1Q90A 4KRNA 2OQJB 2OA9A 4TUKL 4HF5H 1MCJA 3RGVD 4BQ8A 5E4EB 4KJPC 3VFMA 2QELA 4U1GC 4G7YL 4MS6A 4ZK8A 2NY4C 5EORL 1HKLH 4XNMB 3FQ1A 3CIAA 4LLWB 1CLOL 1NCUA 1XGZA 3LKSA 1T0MA 4WGVB 3N0AA 2EDWA 4P46D 3RWGB 3IJEB 4HS6A 3JTTA 4H8WH 1G4RA 1MCNA 4N9GB 1Y1DA 4NKDA 4PJ7B 3MGTA 3G6JF 4KV5F 4EXKA 3CV5A 5MENE 4NFDA 3ESMA 4WV1C 1WFTA 1X44A 5AAPA 5BUPA 3D4ZA 4MS8D 5E1HB 4KO9A 2F58H 3FPXA 3ESUF 3ZDWA 1A9VA 3PGCB 4BFGA 5L6YH 5I1IH 4AJYV 1EPFA 3AG3B 1E5ZA 2CKBA 3V4LA 5KSVA 2OW6A 3OKKB 1KIPB 3PJSA 1FH5L 4GI9A 4ODSH 5E6YA 3N1PC 4DP8X 5C3LD 5L8JB 5T3XH 4DVRH 3V9FA 1J8KA 2LVCA 4NC0B 4YGVA 4UNUA 1B90A 3NN8A 2I5YL 2ZCHL 2Z65C 4LDCA 5E6IA 1VRSA 1ZGLB 4ONGL 1U3HC 4ORGB 4HMEA 2L4OA 1ML0A 1H0DB 1NAMH 2FSEB 3F12A 5HDQH 4N0UB 1GIGH 3GD1C 2I32A 3QUXC 4Y4KC 5EO9A 1NCGA 1MJ7L 4JY5H 5DLMH 4C56D 2MKLC 5HBBA 1GTNA 1KCSL 1P4LA 5J89A 5BPPA 1QR1A 4XVTH 4TXVB 5I6XB 5FAAA 1G9MC 5D7SH 1A7RL 8FABA 2OSLB 1A4AA 2W0KA 3I3DA 4X5WA 2K6YA 1OE1A 3TC9A 4OIIH 4FA6A 4J3VA 5B22A 1JVKA 2J57A 3E6FB 3L3OC 4RMUA 4EKXA 3FRPB 5FLVA 1WCQA 4K9EH 1M7UA 3IVKA 1UVQB 3I3BA 4YSAA 2WLYA 4HKBA 2R69L 4TSBL 1IGCL 2ZF8A 4H0HB 4G72B 4X50A 1IMHC 3DHPA 1ORQA 3BCDA 3FOLA 3KH4A 5JHLH 3JWDL 3TBSA 1FFNB 1UC6A 2PTUA 3MAWA 3EBGA 4G6FD 3SEPA 4K7FA 4EKJA 5GRWA 4E41A 4EIBA 1J12A 4RX4D 4CKQA 5JNYB 1YEGH 1A7NH 2G75B 4M1DH 4HEMA 4KK5D 1VFOA 1QQDA 1IBDA 3HS0C 3V0EA 2XVLA 4WGWB 5E8NA 5GRVK 2EVGA 2VDQH 5J1TC 3TBYA 1EO8L 4ZUWA 4KVPA 2E0PA 4NN6B 3ZL1A 4JGNA 4D7BA 2G5BB 1YYLL 3K2UH 1TR7A 1M2VA 3LRSA 5E5MB 2VR7A 2GAZB 3G5XB 2BX5A 3EGXA 4F8QA 1AHMA 4WKZB 3Q1SL 3EDKA 4YVUA 1A2YA 5L88L 2NLJB 2DY2A 2Q6WB 2DTSA 4YHYB 1RUML 2Q7YA 4NWUL 4M61B 3P54A 2K45A 3QR1A 4YK4B 5H4ZA 1DQJB 4GB9A 2CKBL 3OKNA 3S3CB 1MHCB 1AY1L 3O45A 3AG2B 1U8HB 2IALA 3R06A 1ILSA 1UM6H 4OTXL 4XO4A 5AOJA 5ID1A 4PJ5D 1MCCA 4FFZH 4TL5A 3DECA 4BE6A 1B4LA 3TZVD 1RU9L 2XVBA 1JNLL 5GSRA 4KNSA 1EZVX 1NFDB 1J0JA 3BN9D 4M6ML 3QQDB 1S78D 4PS7A 4OCWH 2E9WA 1TQCB 1WT5C 3I75A 3TTSA 4IHOA 4PRHA 2DQFB 2F8OA 3I9GH 3SBQA 3TVMD 1KTKE 1P7KB 2AAAA 1F3DH 5B8CA 1YEEL 3IN2A 5AYUH 2VDKL 2O5ZH 4YWGL 1LYQA 1HWWA 4OFYD 2OMTA 4WEBL 3QO0B 5ECJE 3APFA 4KRPB 2QSVA 3D39D 1YQVL 5GZNA 2HJLA 3V2AR 4MJIB 4NNYA 5HY9A 2R8SL 1IEAA 2R59A 5FYKH 4TUJA 1MELA 4LQFL 4IBVA 4NKOB 5GRXG 5K59F 4WEMB 5AALA 5C0CA 4G6KL 1LDPH 2FJGB 1OM3L 5ACZA 1XWVA 3DTXA 1QOKA 4JN1L 5IEHB 3PXHA 3EO1B 1BEYL 1A0QH 3UX9B 1J1XH 5F9DC 3S88H 2WYIA 1OY3B 1N5YL 1Z32X 3O3AB 4LDLB 3L1OH 2LTQB 3DOHA 1OAZL 5FUOH 4MMXA 2GBTA 3HCVA 3JWNC 3MRIB 2IBZX 4DGYL 4H25B 1CWVA 2YGQA 3EIFA 4ZDHB 3ZVVA 5AVSB 4TQIA 3AMLA 4MMZC 2MPAL 5IM7B 2JKTM 4KTDL 3HR5A 1JD7A 4LGRB 5M7QA 3SOBH 5FHBL 1AE6L 4O4YH 4P3DA 4GYBA 2H1XA 1PZ3A 1KFGA 3T0EB 2E46A 3LH2H 5GJSH 5I0YA 2ICES 1MNUL 4FERA 4J3OG 1WZMA 3VDBA 3QFGA 1JP5A 4KI5C 3MLZH 3C6EA 3UTQA 3ULVD 2X6AA 4WUUB 4ETYA 4JVWA 3MRQA 4FQXC 4JRYB 1BQHA 1TTGA 4TL4A 3WJJA 4NJ9H 1U9KA 4ERSL 1RMFL 4IBWA 3RUGA 1XGYH 1RURH 5EU6E 4Z7VA 2GTWA 2FB4H 4QYOB 5EZJA 3BCFA 3BKCL 5CIPH 1G87A 3TCLB 2VB5A 2GFBA 2BC4A 4N87A 1LO0L 3BESR 5EBWB 1GZHA 1PD0A 4Y4HD 4Y1AE 5F96H 3BPOC 3OB0H 4J3BA 5AW6B 2WOBA 2ERJC 4OZHA 2LE9A 2OCJA 2VDPL 3GMNA 1A25A 1OCOB 2JCWA 3KPRA 4LSVH 4BINA 4LPWA 3RTQD 3UZVA 5BVJA 3OKMA 4WI4A 2VDOB 2NY3D 5D93C 3LNDA 2KLRA 3W0WA 4JPIA 3V95A 4CA4A 5DD3L 4XXCC 4YLBA 1YVLA 4M62L 5HHPB 5I5IA 2OMBA 2P5WE 2HLEB 1QRNA 3VXNA 2ZXEB 1Z1WA 4AIXA 1MH5B 3K5RA 4PLKC 4Y2OB 1PQZA 1K5NB 4X9HA 1AZRA 1XGUB 3G6JA 4ZPVB 1QTSA 1HE8A 5LLIC 3TURA 4UILL 1GZQB 2HT4D 4K5NA 1A9BB 2NZ9D 4JPSA 3RNKA 2EUXA 1MLCA 3HZYB 1IEHA 3BPLC 4P5MB 3IDGA 1F6AB 1USQA 2FYYA 3BP5A 3QUYD 3L3HB 1WHPA 5DFVC 5ITBH 4GO6B 4WLCA 2E9GA 4XN4A 4XPTH 4WK4B 4AH2B 4DNLA 3DO7A 1QLEH 2F08A 1AMYA 1DVSA 2ID5A 2Q3AA 3T4AA 4PVLA 4X6CB 2J5LC 3HVNA 4PTTA 3MNMA 4UOZA 4UQDA 1YLBB 3MRRB 5E5LA 4N24A 2ZYHA 2FL5A 4JG0H 1MDAA 3K0WA 3VDCA 4F37K 2HX9A 2V3EA 1QKZL 3DX6B 2AV7A 5IHLB 5E8PA 3QGVA 2ZXAA 4FC3E 3Q13A 2VR4A 4ZQTA 1SOSA 5SWSE 5EEXA 3GBLA 3FT2B 2VXSL 4MJ6A 3WJMA 2GITB 5IEKA 5ERWA 3GEWB 1I3RA 2OMYA 3PWNA 5T3XL 4DVRL 5FO8B 3MBWA 2ZKXA 3K72B 1YEKH 3REVB 3ZE1F 4C83A 3UERA 1NLBH 1SJVA 3EH3B 2Z91A 4XMKH 1VEPA 3LOWA 4K73A 5A2JH 1XIWB 2P5PA 3L9BA 1D5BB 4OQTH 1GIGL 1NCIA 3ARUA 3IJSB 1MCQA 4ZMYA 4LCCC 3MJWA 2HLFC 2PTTB 3WIFA 3WO4B 2WLIB 3OKYA 4ZX3A 5IB1A 4NNPH 4MB5A 1GKOA 3Q8EA 2XBDA 1NCAL 5D7SL 1U8JB 3E1ZA 3GSRA 3DIFB 1PZDA 1FHNA 2L7EA 2GTZA 4TOYL 4XVJH 3P0YH 2FQEA 3LSOB 1A65A 4IU2A 4OZFA 3AUWB 1I8AA 4LPCA 3HE7C 3UP1A 1K9TA 4HMCA 4PJGE 3FRPG 3EJUA 4LP4A 3BUQA 4F91B 3VFOB 4DSYA 5F7YC 4QHUA 1UWGH 3FQRA 4GRLA 3SDYL 2Y36L 1DANT 4FNUA 3MJ8B 3EG9A 2VC2H 3IDYB 2NUTA 4CMHB 1RUKL 3BVNA 2WO3B 5LGJA 4NO3B 2C8NA 4NENB 1HCVA 2BZ7A 3MMEA 2C3VB 1T6BX 2IAAC 3AUVA 3MJ7B 3QJSB 5FOBA 3SO3C 3CX5K 2ZOTA 3SN6N 2VDLB 4UQ3B 2NR6D 1NBCA 1PMYA 5FDWB 1W6WA 5SWZE 2X4OA 3MRBB 2JQZA 2Z31A 3AAZA 5MENB 2Y2WA 2UY7A 2XG5B 4K7PX 1AD9B 3JYBA 4ZXBC 3MYJA 3OR6B 2Z8SA 1K4CA 1QAWA 3M07A 3EO0B 3QWNA 5L0QB 1D7FA 4XWOC 3MODL 1IAOA 2MTAA 3RILA 2FK9A 3PHQB 4RAUA 5F1IB 4XWGH 2NQDA 4H7VA 1OEZW 3S96A 5LNGA 4JE0A 2ZKWA 5I82A 2Z92B 1KYAA 4AX3A 5BNXD 3TJEL 5JIIA 1DJSA 4FA7B 2R29A 2WLLB 3FN3A 3WNNA 3SCMA 1R3LB 3AGVA 3QFDB 5BV7C 1DQDL 1H3VA 5LBSH 4IK7A 3GMQA 4AQEB 2PW1A 1N6QH 1HEZB 4HJ0C 3O9WB 4HU8A 2X4RA 1AGBA 1HSAA 5IMKA 3ARDD 3CZEA 5C3TA 4OI8A 1IU1A 4DIXA 4OF8A 2JB6A 4NQVB 4OCWL 5MERA 3MRKA 3SZ6A 1BFVL 3BP6A 1UJ3A 3AT9A 3ARBA 1IIIA 3L1FA 4XODA 3BP4B 1U8IA 1V55B 2I60L 4L3EE 2X1XR 2FEDD 3GZPA 4JEGB 4U4IA 1WITA 3S37L 4NT6A 4QPEA 3BAEL 3STZB 2YEZB 3QPQD 3ECWA 4KQ4L 2Y23A 1WD9A 1CJYA 2WQVA 3P30H 5I1JL 1NZRA 3B7TA 4TPRH 4UDTA 4ES9A 4QHKJ 3WKQA 3EFDL 5DHYA 1TZGL 4BA8A 3H9SE 1E5AA 2FZ3B 4HETA 5HVHB 2EIEA 2WGXA 3LEVH 4BCZA 1J7VR 1V7MH 1ACCA 2EIDA 4LNRA 4OW6A 5DS8A 4OZIB 4PJ8A 3S88L 3K3QA 1FF5A 4Q7DA 5ICXB 1BVKB 2WAHA 4FG4A 2QVMA 2X89D 4LDOB 3VXUA 3H9YA 1SFHA 1QUNA 3WHE0 3MBXH 5GGQH 1S7UA 3ECQA 1WD8A 4S0HA 1FLTX 1TZAA 1J5CA 2UXGA 1GY2A 4P5TC 3JV6A 2Q8BL 4R5TA 5CR1A 1JJUA 2CALA 5I19L 5DD6B 3DUUB 1N7MH 4QRFA 2BP8B 2H1PH 4JY6A 5C09D 5AG9A 3QT2A 1KPRB 3VD0A 4APXB 3CDZB 4QRRD 5T3ZD 5AKTA 2PPCA 4G11A 1PZBA 3BKJH 1CXFA 1MJJA 1CICC 2WD0A 2G2NA 2R29L 1KUMA 3PJLA 3KWWB 1KYOK 4M3HA 4JL2A 3LH2L 4WWKC 3EZ8A 1YNKL 2ZUYA 3FHQA 3VM7A 5FECB 2PYEE 3EDFA 3FFCE 4MDIB 1DFBL 3GC3A 1U91B 4PR5A 2G60L 2O5XH 4WNQA 3IXTB 2XLLA 5CEZD 1NCWH 2P80D 3GNMH 1J8HD 1BXUA 1CN4A 3IMRA 5FEBA 5CD3B 2CHWA 4H26A 4NKMB 4WFHE 3U25A 5IK3B 3RDJA 3DXAA 2ENSA 2OBGA 4YE0A 2A2QT 5AFAA 4NO0D 5GZOC 5DZVA 1S9WB 2R9HC 1MJUH 3BH9A 3KGSA 1T21A 3K6SA 3FN0H 4LBEA 4G6JH 1E28B 3GRWA 3IDNA 3STBA 4Z0BH 1ZSDB 1TSRA 1PLCA 1JWSA 3L9RB 2ESVD 2CO3A 3L3DB 4NQUA 1C12B 4ZOEA 2IH8A 4CSZA 4HWBH 1SDDB 1OAJA 3W39B 1NFIA 2QSTA 3WTWA 5EOTA 5B3JF 5IVZA 1F5WA 5TK4A 4FNSA 2J43A 4AJ0A 2BVYA 1UCBH 3QJFA 5IJKA 1RK0B 4UOJA 3DSNA 1IQWH 2AJVH 2M83A 2B9BA 3VG0H 4YUEL 2H2SC 4L8DA 2IDCA 2WBXA 5FCSH 3H42L 3OKLB 4L8BB 2C1OA 4LCUA 3G6AA 1YPZF 1ZXQA 3CBJB 4IGBA 1D3CA 5GIRA 5HJ3B 3SGDH 3VWJC 1DVFD 1ED3A 5D7IF 5IQ9A 3KPNB 4G9FA 5ITBL 1CPUA 3T2NH 4ICXA 1NGWB 3F62A 5G4OA 1X5JA 2EC8A 4PLJC 3X13A 3OV6A 1U3YA 2DQUL 4ICWA 5IHBA 3C09B 1QZNA 4BQBA 1KJ2B 1I1AA 1DL7L 2A1WL 2JVUA 3MRHB 5ESQB 3FMGL 1W8NA 3O41A 4XNUL 4PJAB 1P4IH 1A6TB 4JDZB 4AYFB 2EO7A 3PL6D 3VSVA 4ELDA 3QK0A 4JM0A 2TSAA 1HYSC 1X5XA 5DJXB 3DX7B 3KE0A 3OAWA 5CILH 3ORJA 1JPSH 1HDMB 1F02I 4FI6A 3JZYA 3KYOA 4HUKB 3ZR5A 1HQ4A 4XN2A 4UZUA 4B7LA 2PLTA 1RK7A 4M56A 4WV1B 5G2NA 4XMKL 4F93B 1G7MA 4PMEA 4PY7A 3ESOA 4O2EA 3H2QA 5EU6B 4NQEA 2EC9U 3VDAA 1Y0LA 3GRWL 1EBPA 3C5JA 3P2TA 1NCCH 3K74B 4XPGL 4B9IA 1GOHA 4HFUL 3SY0B 3WJLA 3VFRB 3X3FL 1F1DA 5K39A 3H2WA 5HDRA 4Y1AB 4UM8B 3WLBB 4XPBH 5IJVA 1KLFA 3MXVH 4OCLC 3DKHA 1MNNA 2JJSA 4HAKA 2Y5TB 1JN6A 3QI9A 2CBPA 3UADA 2WCGA 4DUWA 4PGEA 1FN4A 3Q9PA 2VJXA 2DQHL 1RPUA 3ATAA 3HZMB 1UYWH 5DJ2B 4ELME 1CDIA 2P5WB 4OLVL 2YAEA 4FL4B 2WBJC 3ZXAC 1N0LA 4N0FA 3ZUCA 3UTZA 5A40E 1XCTB 4HUWA 1GS6X 3W9EA 5GRUL 4M93B 4XP5L 1LK3H 5I6MA 2YGOA 3S35L 1BLIA 4WW1B 3OAUL 5CZRA 1VAHA 3TV3H 5IFJA 5IESH 2CBTA 3FTUA 2DQIH 5BRPA 1IFGA 4ZTEA 3MRPB 3L3OB 3NJXA 1CGUA 4DN4H 2WXGA 5EN2B 4N0CC 4Z78B 1AMXA 1GMEA 3U9WA 3TONA 3ZKMD 2KPNA 1X4XA 1KIUB 2GJRA 3RX8A 1VENA 1C9SA 3ZKNC 1U2CA 4QNPF 1F1GA 4HT1H 3VI4E 4D8PB 5LXVA 2EEBA 4OVVA 3QDME 4X8CA 1UWYA 4ETQA 1U8OB 2VLJE 4HKZA 4PY8J 4XWGL 2XIDA 1JXKA 5DQDH 2OI9C 4M7LL 2EYSB 3SDCB 5ITFA 1OAUL 3NCFB 4YMPA 2YRPA 5SWSB 3ROLA 2QKSA 3HS0B 2ZOLB 3QEHA 4OFKA 1VF5C 1T5KA 1WCBB 2NY7L 2BOBB 4HJUA 1YY9D 2YXVA 4HJEA 1DQTA 2BS71 1N8ZA 4M3KB 3WFHB 4M43L 2AXFA 5E5UB 2OXHB 3L4ZA 4Y5XB 4GRMA 3V8CA 4F33A 1OARH 3NCYS 4DPBX 4F58H 2XWZA 2J5WA 3TPUA 1U8KB 1T7YA 1E43A 5KANI 3I2CH 3PAYA 2GSIA 2XTLA 3MBEC 1LM8V 1IBYA 5GS0C 4ONOA 4F8NA 1NCTA 1VGEH 2VN3A 4PB9L 1JPFA 3GRBA 2J25A 4LASH 5D6CB 1OWWA 4EF3A 4FADA 3BP7B 4KQ3H 3FT0A 3CGTA 2DLEA 4BUGA 5A2IH 3WEXB 3CCHA 5JIDA 1EEYA 2W5PA 4C55A 3TBBA 3U4BH 3FUEA 1DVQA 2FECL 5KJ4A 1XSJA 3R8BB 4LF3A 3QUZC 5JPNC 2QFRA 1UD6A 3EFFB 1U8PB 4LCWD 1HH9B 1JPEA 2CDEB 2IVFC 1WIOA 3J8F7 5DVOA 1ZT4A 5GGVL 5LKNA 2M26A 3FFDB 4LMQI 1E50A 4G7VH 4MLIA 3B6SA 1Y18A 4PJGB 3K6DA 5C0AB 3VXQB 4PJDE 4HWBA 5KN5B 1EHAA 1CYWA 2ADJB 3KEDA 5F7EH 4P2RE 1CXHA 2EE0A 3LZFL 2WQRA 5AVRB 2WNGA 3DVGB 1KB3A 3BKYH 4MQXD 4OUUB 4L5FL 5J0BA 1JXGA 4RDBA 2P1YA 4N1EA 1BFTA 1VB9A 4FLHA 5B3SB 1UJTA 3LH8A 2IMMA 2RHEA 4ABUA 4RIRA 5DI8B 1GGBL 3TT1L 1Q9KA 3DK0A 4PRHD 5SWZB 3M17A 4Z3JA 2A9NH 4L8SB 4A38A 1SPDA 1RIHH 3T3MB 4WFGE 3UYPB 2PPFA 3LJ3A 3WS3A 1KB5H 2R15A 4S1DC 4I87A 3R4DA 3DSFH 5GZND 1F42A 4AK1A 5K1NA 3I6LD 3GB7B 2ZXGA 4M8UA 4PHXA 1OP5K 3RY6C 3CDFA 2Z7YA 2XZCH 2OX5B 2HRPL 3RVTC 2DQCL 1NAKL 3QG7L 3W81A 1ZVSA 2ITDA 4EZKA 2NTSP 4JANB 2DBJA 5C0CD 2O6FA 2I9LB 3K6FA 4R9HA 4U6TA 3W11D 2ADIA 4K15A 4I18B 3PYCA 3BDYH 4JFZH 4ZX6A 5KBLA 5D7JC 4FRWA 2YPVH 4PGDA 1A6ZA 4BK8A 4E9WA 5JXEA 4RWYL 3DI2B 5F1NB 4MMZB 4HAFA 1GSMA 1F00I 1S5IL 3NZ8B 5E9DE 2PWDA 3CU1A 5I1LA 2BDNH 2XXGA 3GBEA 3WO3B 4K8RL 4GINA 1KCKA 3QHZH 3MLUL 2ZOUA 5DZPA 2B59B 4RCAA 1KIQA 3CFEA 3KNBA 1AC0A 4K07A 3FHAA 4AYDC 3UO8B 3RZCD 1NCDH 3F5WB 1TVBA 3KWXA 4RFNB 4WHYH 3CXDL 5DK3A 5KUKA 3W5NA 4LAJH 1C8QA 2BERA 4LGSB 4HPHA 5JOFB 2IDFA 4MXVE 1A6AB 4F3FB 1NGYA 2RD0A 1MN4A 3ZIYA 4L4TA 1SEBA 1YNLH 1OAYH 2Y07L 5FW8A 1E3ZA 2PO6B 4UBDD 3H9SB 4OSUH 1YPZA 3K1KC 2FJSA 5CEXB 2AJ3B 1EGJH 4LCVA 5I1AB 2YLKA 5D7IA 4DGIH 3WFZA 5LB1A 4TSAL 2J7LA 1AZNA 1CFBA 1WBYB 4YSQA 2PUQT 3TLRA 3IYLW 1OVZA 1JD9A 1XGQA 3HPLA 5T3XD 3WSQL 3WTSA 3AXLA 2WB1A 2NX5A 3ZT7A 4RQQA 3D1MC 3MRNA 4FDWA 2FDBP 1QWHA 1B0RB 3HN3A 1A5FL 3LNFA 1MQ8A 3LRLA 4PJHF 3MRCA 5FYJE 5D93B 3R0NA 3IXAB 3B3IA 1U36A 4ODTL 4DCQA 4FQJH 4MVBD 4EBQH 4GMSH 1PNDA 4W70A 1CTOA 3U4EB 5J4MA 4YEFA 5C2BL 3MACH 2Z93A 2VRAA 4NZUH 3CIQA 5IROA 4I3SL 2EILB 2CLVA 3NP4A 4A7UA 4OCNC 3C60A 1Q9WB 1GHFH 1NC4D 2VZ1A 4FQLH 5D1ZB 1BBDH 3V4PA 1CXEA 2PYEB 4XCYB 3FFCB 4KK8C 3C6LC 1AQMA 1Z9LA 4WI0B 1U93A 5CILL 2W0FA 4QTIH 3QRGL 1XR9A 4FEIA 2Y7MA 5BUGA 4RA0C 2EDMA 4BH8A 4YQXL 1JWUB 5JR1H 2UWEE 3IU4L 4XMLH 4XZ4A 5HGAA 5T5NG 1CLCA 1FZKA 3P11L 3O6KH 4N2NA 3BFOA 3DX2A 4X5LA 3KVDD 3IKKA 5FS5A 4XOAA 4Z7UF 3MFGB 4AMWA 1CD0A 3FNKA 2Z7ZA 1N64L 5E4IA 2FWOA 5J6GB 5KVEE 3CFUA 2F5AL 1XV8A 3QXDA 5D2NE 3NCJL 1Z9PA 1WZKA 1NPUA 2WQ8A 2R23A 4Q89A 2BW5A 4FQ1H 3ZTCC 1GS8A 5CP7A 2EECA 2ARWA 1KTDB 4UOQA 2Z35A 1KBGL 3A67H 4D9LH 1VHPA 1PGRB 4EDXB 1Z5YD 3FUJA 5KSAA 2CNZA 4TQPA 2XPZA 3STLA 3TYFA 1ZTXH 2VLKB 4O2FB 1JG9A 3I74A 4KC3B 4XZUA 5AZUA 1MW2A 1DN0B 3O6LL 4NAMA 5KVFL 4UIKL 1A64A 1CYGA 3OL2A 3UC2A 4EQ3A 2FECI 3VA2C 3N43B 2V5YA 3CFCH 3IK2A 2E47A 3GSQA 1BPVA 3AS2A 2IBBA 3HE7B 5I8OL 3FT9A 4WJ5B 2HVJB 2NY0D 3VYPA 3VXMA 3MUGA 5EBMA 4HT1L 5CJQL 1T2XA 1UZ6F 4GQ9H 1KG0B 4HG4K 1KB5A 1RFDH 5I1HH 2R56H 2O5YH 4NQCD 4BZ1H 1I75A 5IB5B 3V4PL 5E24E 3CSTA 4TTDC 4ZSOB 3UJTH 1QSEE 5DQDL 1XX9C 1DQQA 4PRPA 1RHHA 3B9AA 3HZKA 3SO3B 3Q05A 1EV2E 5EU7E 2YK1L 4J3OF 2Y06H 5E2WL 2VUKA 1W72A 4FE9A 1R5IB 4EI6A 4ZXBB 3RVUC 1QVOA 1ZHLA 2NZIA 1M9SA 2WWMD 3PDGA 4XXDB 1EDYA 3WXVL 1OARL 4P2CG 3U9UB 3SGKC 4ZMPA 5KYXA 4M5YL 1T89A 1C16B 1S9KC 2FX7L 1MAJA 3FTZA 1NANI 2YPVA 3GGWB 4NN7C 2CM5A 5CHNB 2OP4H 2HB0A 5D7LE 1VGEL 3GJFA 4KVCH 3VFTB 4KKBD 2R1WB 4HSCX 2TRHA 3BFWA 3MA7B 3L4YA 4Y19D 4XO8A 5FM5M 2IWFA 1AI1H 5J1AA 3RG1C 4FXLA 4PGBB 4H5SB 2Y3AA 2MNWA 2YJLA 3MRJA 4TYUA 1A6WL 3PQYE 3O4OB 4MA7H 5F88B 4ELMB 2GEQA 4KDWA 4NS0A 2HN7A 4KRMB 3U0TA 4UIMA 5HPMB 3V79C 5JIHA 5HJBA 3FZUC 4HK3N 3DUHA 4FYRA 5F7EL 1EGJA 2Y25A 4FP8H 1JOIA 1JV5B 3KPMA 5E4OA 2CCVA 5HVGB 1NGQH 1S7RA 2F1BA 4NQSA 4OLXL 5CXPA 4ZOCA 5C86A 5HP5A 2VDRH 3PP3K 2OTUB 3OQ3B 5B38B 5HI5C 5I71B 2UVFA 2XCMC 3KPOA 2XRAH 2Z1KA 4QXGL 4RESB 3BQUC 4A6YB 2E27L 2IPUG 2IJ0C 5CGYD 1R47A 2B1HL 2C9QA 4I0PC 3BAWA 4J3OH 2FR4A 2O26U 2PPDA 1TKWA 2ED7A 3FONB 3ARBD 1ITCA 3VI4B 4WO0A 5D1XC 2EUVA 3CFBA 4DZBA 4PJ7F 1KB5L 1T6VN 3G5VB 3J27A 3LCYA 2K70A 4GBXC 3DSFL 2VLJB 1II4E 2AAVA 4ZFQA 1AOZA 2XZAH 4Z76B 4HPYH 3T2QA 1HWHB 2F7IA 3TBTA 2IFFL 5A16A 2CDFA 2IAMD 1K4DA 2K3HA 2YSSB 1N4XH 1SYVA 4OLUL 4BJLA 4YHLH 5ABAA 2AK4B 1A66A 3QIWB 4QJ4B 1W72L 3WTXA 4UDUB 4X8JB 4TULH 1MG3C 5DRWA 3PGFL 5IT2H 4LSQL 2VITA 4IRSB 4NI3A 5JDSA 2AJSL 2BO0A 3QE5A 1OTUD 5IQNA 3S8GB 2WQSA 5F7KC 3MUUA 4JPWH 3PWPE 3C75A 3L48A 1E8ZA 1M7DB 4DKDC 3BKML 1UASA 3CU7A 1T03H 4WUKH 4V2CB 4RGOH 5DC0A 4QXWA 4CU7A 3T71A 5F7WC 1I3GL 3NFSH 4ZX5A 4QRPD 1A1MB 4YSCA 2VZ3A 3WCYA 3N06B 4I0KA 3HE6C 1BQLL 3DJ9A 4KAQH 3TNNA 1GC1L 2JELH 4XMTA 5HYJA 3GINA 2MHAA 3NFNA 4QXUH 1ZGLP 4PJCE 4PJDB 3QULB 4LRNL 4P57A 2B08A 3VU1A 3RY5A 2X4QA 5BJTB 1BFOA 5TE7L 1R24A 2DYPA 2XACC 2V7NB 4MSWB 4P2RB 4PJHA 4XC3H 5EC2A 3LS5L 3LRHA 2C1PA 4OFQA 4FTDA 1FBIL 3ULUE 3HNSL 1PIFA 2FE0A 2AV1B 3CN1A 3GSXB 3UTTA 4P2OB 5DRXB 2X05A 4BCYA 1H8LA 3MLXL 4FG0A 4LSPH 1L3WA 2ROYA 1X4ZA 5E2UH 4ZUUB 5HDBE 2VXVH 1J0IA 4JLRA 4AGOA 3LVTA 3O8XB 3LZNA 1DBAL 1DLFH 2CMRL 4YNYA 5F9WC 5B7FA 4U1KA 3GXMA 4FQJL 4YHZL 2OM5A 2NY2D 3PAVA 1RXLA 4G1EB 1N68A 4EOWH 4F7CA 5J3HD 1ZCRA 1B4JL 2H3NB 2PCXA 4MMYB 3RU8L 1VFBB 4JX0A 5JO5B 2BRQA 5AVVB 3UJJL 2GJJA 5A2CA 2XN1A 2WQAA 1Q0EA 3LDBB 4OGYL 4Z77A 4FMFA 4AGMA 1BHGA 1MIML 1L6XA 5GS0H 3RAJH 3T9WA 1GHFL 2ZPKH 3OX8B 1BBDL 3LPGA 3L5HA 4A7GA 4EI0A 4U1MB 3KH3A 3SE6A 4MHHI 1LO5A 4Z7UA 4CC4A 2C7FA 2ZKHL 4FTVA 4HOZA 4WCYL 4LSTL 5E9DB 2WVVA 1PZ5B 1SMOA 4JO4H 2WZAA 4Q2ZA 4AC2A 2BSCA 4F7EA 5ADPL 2F8XC 2DM7A 4IBZA 1OSPL 2HYMA 4LOUC 2UY6B 1NFDF 4XMLL 3RWJA 1W16A 4QTHA 1G6RA 3N55A 4G9FD 4BBWA 5DUBB 3FU8A 5DO2D 1TENA 3JV5A 4R84A 2JK5A 4YHPB 3FUHA 3D87B 1TNNA 3G7TA 4YBLB 1IQDA 1XH3B 2P8PA 4P5RA 1DEEA 4LAQH 4O9HH 3MO1B 3FOMA 1I1AD 4FGMA 3QHFH 2IPKB 1J5IA 4J3XA 1RZ7L 3DC0A 3OKOB 1SFDA 4QWWD 1D5RA 1J87A 2VMEA 3EFOA 2F19H 4MZ2A 2QR0A 3CFDB 2VL5A 1Y6KR 4MXWL 5JW3H 2A6KB 2ATKA 2Z4TA 4F5CE 4XMWA 1BJ8A 4HWEH 3UAAA 5CBAB 1N3NB 3LH9A 2H9GA 1AIFB 4HD9A 4OZ4B 4U1JB 1BQKA 3D30A 2APBA 3G5YA 1MVYA 3TA3B 1B3JA 4C57C 2XQBL 3L13A 1BD2B 2NYKA 4NQED 3QG6B 1JF6A 4G8FA 2QV4A 3HKFA 1WEJL 4G80B 4L3FA 2WSDA 4HKXB 4PRNA 4AYEC 1Z9SA 2XV3A 4FS0A 4PS3A 5CP3A 4AG4H 2AJYL 1KY6A 1Y6NR 1QG3A 3LQAH 4N2FA 4PQXA 1SLVA 2P24B 1PCSA 3GXPA 3OKDB 4JFXA 3DYMA 3HC3H 4PRAB 1RZKC 5TDPA 3W57A 4GQ9L 3QI9D 4I4WA 5I1HL 1IC1A 5J11C 4GSRA 2YD6A 3GDBA 2GJZA 4NUPA 2J8UE 3BYYA 5IBLD 2WW8A 4Z7WE 4GW5B 3WD5H 3I9IA 1TVHB 2CHDA 4HH9B 1QFWM 2XWJA 4OM0H 1YN7A 1M7IA 4KGJA 4POZD 5FA3A 5IQOA 1QATA 5CZXD 5EEUA 1ZT1B 1WA1X 1WWAX 1MVFA 3GTNA 3Q5OA 1JHKH 2VN6A 5F97E 4P4KC 2X5PA 5JW4Q 3QAZB 1G6RL 4PTUA 5DJ6B 1HILA 2JTDA 2X6UA 1AO7E 5F44A 3U0PB 4K3JH 3QS2A 4XAKE 3IJYB 1RIVH 1E9OA 2ZP0T 5HGDA 4BDVB 4P3WA 1HK6A 3T8VA 2DI7A 1ICTA 2N01B 2FHFA 3DTUB 3Q2CA 4ILDA 5FGCE 5IBTH 1TO4A 3V6BR 5IHZA 3AT0A 2PN5A 4UV7L 2X9ZA 1INDH 2OQJA 3DO4A 2N1TE 5D1QE 4R90H 2FUTA 3KPSE 3IDJB 1CE1L 2EXYD 3ATEA 3K81A 3L4TA 4XNMA 4IRJB 3OC5A 4LB8A 4LLWA 4TKWA 2E9BA 2IBGA 4NRXB 3ESVF 4MJHA 3RWGA 1W0YT 2J3SA 3IJEA 4HIIB 3INUH 1HESA 3FQNB 4N9GA 3G08B 4PJ7A 2FATL 3H55A 3VXPB 5E00B 1KC5H 1N0XL 3CFIC 3FFOA 2P5EE 4QAMB 2XRAL 3NJGA 2X1QA 3CVIL 5B38G 2ZSWB 1B4TA 3BLKA 2XN9B 4K8RD 1JK9B 5D9SB 3WN5C 4J4PC 3X1EA 3CHOA 2E75C 5DEGB 2BFGA 2A73B 1IC5L 3GJFK 4JBSA 4XPHL 3LMJL 3OKKA 1KIPA 2M8XA 1V7NL 1QSEB 4LO9A 2YD8A 4R3SB 4W9JC 2D3LA 4L1LA 4LSDA 3K8MA 2IADB 1ZGLA 5EOCH 4DPAX 3ROOB 4ORGA 1OP3H 3KS0J 3VFNB 3NFPA 1H0DA 1WFIA 2FSEA 4KDTA 4N0UA 2X88A 2ZXCA 3LQZB 1AYOA 4J7RA 4M3JA 4PW9A 4AYMC 3SDAB 1MFBL 3OJDB 4MZIA 5I6PA 4R97C 4V33A 3KLLA 5D7LB 1CK0L 5CN2A 1JF1B 1GOGA 2OSLA 2AEPH 1ADQH 2VL4A 5DK0B 1YEIL 1X5LA 1V05A 3X3GL 1QD0A 1MLBA 4TVUA 4XNQB 1PLGL 1YMME 1TCRB 3RX9A 2W92A 1XBDA 2UZPA 3E6FA 4P2QB 5FA4B 2DBLL 1GGUA 2J1WA 3FRPA 5D8JH 3V6FB 4X99B 4N8CH 1UVQA 3MV01 2IGTA 4IOFD 5E8DH 3BD4A 3C5ZB 2X2JA 4QHPA 3NRQA 2MKWA 2OYKA 2QQNH 4U1SA 2VLLB 3PQYB 4KAQL 1XCQB 1FRGH 1EZVY 5CJOH 4J27A 5BW7C 1FFNA 1FSKC 2NNCA 2ZWZA 4FQQB 4QHMB 1M4KA 2R39A 1RK1B 2YPKB 5JNYA 1HSBB 3PPEA 4DKAA 2G75A 4L0ZA 1Z3GH 3B56A 4AE0A 2YKLH 4LBAA 4EUPB 5JXED 2D3JA 2G5BA 3M1CA 2MFNA 1XF2B 1E67A 5E5MA 3BH8B 5LCVA 4AC4A 2GAZA 4JPQA 1FYHB 3G5XA 3KD4A 1JCVA 3BVWA 4GNKB 4WKZA 2ESVE 3BUDA 2E7LA 2NLJA 3ETBJ 5I8EB 1AGDB 1MIEH 3MC0A 4KOBA 2Q6WA 4Y5VC 1PYWB 5DJ0B 3MOAH 4JHWH 7PAZA 2IG2H 1FL3B 4M61A 3IFLH 1F3JB 2X9WA 4R8WL 2IQ9L 1DQJA 1U8LB 1IC4H 1MHCA 3ALPA 4HXBH 1IAIH 2GYSA 4QRQB 3QEUB 1U8HA 1QNZH 4NM8H 1LQBC 4L4TD 5IBUB 3FCSB 2PR9A 3GSVB 3NESA 1QEWB 2B1AH 1O75A 3MV8E 1TITA 1NFDA 3BXNB 1ZE3H 3QQDA 3NZSA 1I8UA 4LT7A 1UM5H 2IBZY 4XMVA 1MPAH 5D70L 5I75C 2DQFA 5F7LB 1ZV5A 3SBWA 1P7KA 1CD8A 3PWPB 5C6TL 1XBRA 5FW6A 1T0OA 2KDYA 4JHAH 4YBQD 3RRQA 4JO4L 3IGKA 1Y07A 1E2ZA 3QO0A 3X1GA 3K4DA 4BHUA 4MBOA 4QHKI 2H4EA 4MJIA 3OZ9L 1M71B 3GI9H 3RWHB 1MQKH 1G9NC 3P0VH 4NHUB 5DQJB 1FDLH 4AQOA 4G6AD 4NKOA 2F5BL 4FN0A 2MIZA 1RV6X 3FJTA 5K69A 4MB4A 3H4HA 3UC0L 1WZLA 1E8WA 1PG7H 4JFPB 4MD5A 4O9HL 4YDLC 5IROD 4ZFZB 2FJGA 2YN3A 1LJMA 4DEWA 2H6UA 4PJCB 3C60D 4I48B 3R4RA 5IEHA 3EO1A 1T04B 3LS4L 1AGEB 3GO1L 4UAOB 1CDJA 5D71H 1JGVH 4L8CB 3O3AA 3N04A 2VDLH 4Q6IB 4WQOA 4MDRA 1WA2X 3C12A 3IAQA 3U2SB 5FV1L 3VD3A 2AJUL 5TE4L 4A7VA 3KHOA 1MJ8L 3BAXA 2YRBA 3FYEB 5LCVL 2WK2A 3EF7A 1MCFA 1SY6L 3BSZL 3MRIA 5EZIH 4H25A 2XTJD 4I0CC 2V8LA 4ZDHA 5HDBB 5TGBB 3ZDYE 1GA2A 3ZQWA 2HT3C 1NEZB 5IM7A 2BWDA 4KMTH 5DC2A 3OBAA 5DXWA 4LCIH 1B0WA 1QNIA 1IAMA 5ICUA 1O7VA 1JHLL 1VFMA 4FNPA 3T0EA 4N5EC 3ABLB 5I1EL 5CZKA 2CR3A 1ITBB 4RGND 3PS6A 3OHXB 2DQEH 4L2YA 2WBWB 2WVTA 2LU4A 4FFVD 1RZ8B 4WUUA 2BY0A 4IEFB 1BJ1H 1LMIA 2XY1A 4JRYA 3ZHKA 5KSAD 3HEIB 5EU3B 3WD5L 1L0XA 4PW3A 2VUYA 2H32B 4NZRH 1E2VA 3N40F 2D03H 4QYOA 3U7YH 1P4UA 2G5UA 2V7HB 3TCLA 4LZKA 4QGYA 2ZG3A 2IQAB 5EBWA 3GIZL 3GLAA 1G43A 4O58H 2WLKA 3CMGA 1NGPL 3RNQB 2VDNB 3VXSB 3K4ZA 1SDAB 3VRLE 5IFHL 2XPGB 5JIMA 3DO3A 4H8VA 5E6RB 2NNAB 3WEOA 3F6LA 4JFWA 2BJMH 2FEEL 3BLBA 1MRFH 4UMGA 2F53D 3N40P 4RMBA 5HHPA 2NY6D 2ZOKB 3UPCA 4L1TA 1HL9A 3B7UX 4JFDD 4CSSA 4N2DA 2HT2C 1MH5A 2OMNA 3C8KB 3QORC 4LNVA 4XMPL 4Y2OA 1FAKT 1K5NA 3L3GB 3OGCB 1WUNT 1INDL 3D3VE 1XGUA 4HUMB 4PRPD 4ZPVA 4E41E 2FX8H 1GZQA 3APMA 4BV1A 1A9BA 4XP4H 4R90L 2WMPB 3HZYA 2DIJA 4P5MA 3GM8A 4XPFL 3SJVD 1F6AA 1HL5A 3L3HA 3HAEB 4PP1D 3BI9X 3ZHLA 1XMEB 4MBRA 2EDDA 1XXFC 3A4AA 3D12B 4H88H 3UGUA 1GXEA 4AH2A 5IFAH 3IDIB 4Z8FL 1U8MB 3E8UH 4X6CA 1XHHA 1PAMA 4W4OC 3KLKA 1YRKA 3CH1B 3MRRA 1MHPH 2A9ML 4G6MH 1X4YA 3GMMB 4LOEA 2VDMB 3TT3H 2E7BA 3DX6A 4BE5A 3QIUC 4OV5B 1QBAA 2DQGH 1FI8C 2LR4A 5AAWC 3PP4L 3FT2A 2IWKA 4Q74A 5ABZA 2GITA 3RI5K 2V17L 1AJ7L 5LHDA 4XI5D 1PEWA 2J8UB 5BRQA 4HK3J 3S3SA 1IGML 2WUBL 4RDQG 5FO8A 3ZY7A 3K72A 3IDXL 3JV4B 1L4IA 2X6MA 4Z7WB 2LU5A 3N6YA 4PJAF 4I0PB 1JPTH 3D69B 5EOCL 2XT1B 5EWIH 2XOTA 3RP1A 4PRHE 4LEXH 2Z8WC 1XIWA 4K7PY 3BH4A 1D5BA 1OKEA 1SBSL 1U42A 4ZAKB 2Q8AH 3IJSA 2QMKA 3UDWC 4Y4FB 2PTTA 3VXRB 2WLIA 1IC7L 2ZE0A 5T5NF 5C08E 1AO7B 5E99H 5DJCB 1N6VA 1ZHNB 1I7ZB 2PP7A 3IDMB 1U8JA 3MFFB 3BUBA 2VDOL 2I85A 2WLZA 1SJEB 4LSSH 1E4XL 3DRTB 5HTSA 1BYOA 3LSOA 1FL5B 2PCFB 4B9CA 5D8JL 3SQBB 4XB3A 2XVKA 3MROB 3O6FB 1BG9A 4N8CL 5FGCB 4WW2F 3B2VL 1FGNH 1RI8A 3CZGA 3VFOA 4KXDA 1ZA3B 2YN5A 5TE6H 5D1QB 4PG9B 3RX7A 4JCMA 4NSKB 2L04A 3MJ8A 5AKSA 1R34A 1HQRB 5CJOL 1NUNB 4NC1C 4URKA 3KPSB 2IEPA 1NDGB 1TJGH 2YD0A 1ZANL 3FB7B 4NO3A 4NENA 4DZ8B 2A38A 3SE8H 2EZ0C 4ZNCD 2C3VA 3MJ7A 4YSSA 3GSUB 4YHKH 1S7SB 1UD3A 2H45A 5I5MA 1EZLA 3JVGC 4UQ3A 2FWSA 2VUOA 1AAJA 1D6VH 5AG8A 4HIJB 3AG1B 1MF2H 3MRBA 1FNHA 3OC8A 5FDWA 5MENA 3WFBH 4TTGA 2Y2YA 2XG5A 4EUPG 2P5EB 1HINL 1AD9A 1PSKL 3NA4A 3OR6A 4PY8I 1RZKH 1VEMA 4PJ9C 1WA0X 5F7UA 1XL6A 2ITEA 3EO0A 4ZW6A 1L7TH 3COOA 4BYHA 3EJRA 1HH6B 2D0GA 3EH2A 3PHQA 5F1IA 1X5IA 1DE4B 3IGFA 2GBUA 2WLHA 4JHWL 5DVLA 1LE9B 5B1AB 3D25B 2Z92A 1CDHA 5BV7H 1NBQA 3HNTL 1EDQA 3QR0A 5FM4A 3SKNB 2WLLA 3NTCH 3UPAA 1R3LA 3BDXA 3QFDA 3BN3B 5HYJD 1KBKA 2NSQA 4JJ5B 3S36L 3QXWA 2MQ3A 4AQEA 3W1ZA 2G2RB 1HEZA 4QRBA 3O9WA 5IBUG 3G9AB 2DYPD 3KLHC 2R0WL 4L9LC 4JM2B 2VXQL 3HBGA 3NACL 4NQVA 5LAXB 2ENQA 4G8IB 3UTTD 2HH0H 3Q06A 2X2UA 4JE4B 1I8LA 4HCIA 4ADGA 3BP4A 4OZHE 2VR5A 4AK2A 1FO0B 3KPRE 4LLQA 1UEMA 4ALAC 2OL3H 1YMMB 4PJFE 4TNFA 3STZA 1ECZA 2YEZA 4OIFA 1THAA 3F85A 2WN2A 3W0WE 3GI9L 4M5ZL 3BWSA 3EGDB 4K5PA 3O4LD 4HLZG 3EOAB 2QFPA 4JO8A 1FC2D 4OFDA 3U6XA 1QRNE 3QZLA 5FCUL 2H0FA 2WTRB 2AGJH 4J6RH 4R96B 2FZ3A 1UWEH 3JSSA 1JZGA 2RGSA 2ZYIA 4JN2B 4BHUI 1B0GA 4OB5H 5DURD 1IL1B 3A0OA 4K3EH 4OZIA 3AQYA 4HBCH 1FVEA 4PJGF 5ICXA 2Q86B 1BVKA 1O5PA 4GSDH 1UZ8B 2P3YA 3QRLA 2K4WA 4QD2E 3WMQA 4FTVD 1KACB 2DMGA 4FD0A 1WDAA 1MZZA 4L0YA 2WCPA 5DD6A 3DUUA 5EZIL 1F11B 2FEEI 4JFUA 1T7XA 2BP8A 4P07A 2RACA 3QIBD 1KPRA 2D31B 3WTTA 1GY1A 3F64A 1FIGH 3CDZA 4APXA 2IDTA 3WFCL 4RAVB 3WENA 3BEWB 4FX5A 3D9AH 3US1A 4GFXA 4XCFL 3TO4B 3UBFA 1KXVC 1NEZG 1K8DB 4APQA 5F3FA 2G30A 3T3MF 5JQIB 5CZVL 2FJHB 3KWWA 4R4BB 1BOYA 1BMWA 5EB9A 4JRXA 5FECA 4WGKA 1SOQA 1VIWA 4MDIA 4MGXA 3SQOL 1E5YA 3VD1A 1U91A 1BLNB 3OAZH 2PXYB 2R4RL 3IXTA 1XF4A 2KS0A 3U6RB 4AEIL 1FPTH 4L23A 4L29B 3IU3B 2FNWA 4IIQC 5CD3A 2B3IA 1P6FA 2JB5H 1CFTB 1EAOA 4NKMA 2AJZB 4OH2A 5C7XL 5JTWA 4R83A 1ADWA 1FFOB 4P3CL 5IK3A 4CAGA 2FQFA 1S9WA 1ZVNA 3I50H 1NH6A 5HHMB 2WM0A 1NA8A 1E90A 5E2VH 1L0PA 4OGAD 1FFQA 2MPVA 4ZW8A 2GPZA 1E28A 3GBMH 4HFWB 4O02B 2CJUH 1ZSDA 3LZPA 3UOAB 4J2XA 5J11B 4O58L 4RZKA 3L9RA 2UX7A 3L3DA 5C8JB 1IARB 4WO4B 1C12A 1U95B 4HAGA 2MTPA 4FXKC 3WLWC 4JG1H 2K8QA 1SDDA 1CU4H 1NPNA 1NC2B 1C5DB 2B0SH 4J3OD 3W39A 3RFZC 1TTCA 4PWHA 2DJMA 3ETBF 1NFKA 1P2CB 5TF1L 1RK0A 2ZZUT 4CADB 2BNRB 1QI3A 3TEZA 1CBVL 3I9PA 4YLQT 4ZW7A 4KPHL 2CD0A 4HUUB 5DJDB 2O5NA 2FX8L 2LAGB 3EJYD 3OKLA 4L8BA 1CLVA 3MSPA 1FNAA 2NXZD 3FPYA 5CJBA 2QSCH 4Q0XH 3ZZQA 2OKMA 5F0JB 5HJ3A 4KXAA 4W1TA 3KPNA 3SD5A 3Q44A 3RJDA 2FJUB 1TOXA 1MW1A 1E4XI 2ORBH 4ZBJA 2JJWA 3HAEG 3KM2A 1NGWA 5AYQA 4F80A 3ZDYB 5F8QC 5HI3C 2MCMA 4HULB 4RGMC 1KJ2A 1WV7T 1MUJB 3ZDXE 1FWXA 3MRHA 4M7ZB 4PJEE 3RFRA 2G9HB 5ESQA 1AR1D 1JPST 3TT3L 4JO3H 3IN0A 4B9YA 4GAJH 4PJAA 4AYFA 1A6TA 4JDZA 3WY3A 5A3IC 2V9QA 2B14A 4AUYA 2OCCB 1A8JH 2DJSA 3EKCA 2BCMA 4TNWK 1TCMA 3RGVC 2WXPA 1U8QB 5DJXA 5L2JB 4ZTPH 3DX7A 5E6IB 2CRIA 5SX5H 5E95B 1HDMA 5A2AA 4P23C 4KTYA 4HHAB 3WTVA 3Q2WA 1JCKA 1NMBH 2MCPH 4LMQE 4P46C 1YAIA 3FTWA 4WV1A 2FGWH 5TFSH 1F8TL 5EU6A 3DURB 2V5MA 1SVBA 3IM1A 2WVUA 4JFOB 3MLVL 2WYTA 4JQIH 3MA9H 3LZOA 1DTUA 3EXJA 1YEFH 4CU8A 3PIQB 1UA7A 3SY0A 1W0WB 3VFRA 5BCAA 4MS8C 1S7XB 2MSPA 4Y1AA 4UM8A 1DQML 3WLBA 3H7BB 2G4GA 3E38A 1FGVL 1EFQA 4XCCL 1LD9B 4TUUA 5MP6H 1KTLB 2DB8A 2Y5TA 4FI7A 3TWYA 4B9KC 3P73A 4KJQC 4LSSL 1YUHB 3QZMA 1F4WL 1FNSL 5AOZA 3HZMA 5DJ2A 2P5WA 1Q0XL 4B5ZA 1Q0YH 4TVPE 5KBDA 1MFNA 1XCTA 2CK0H 2DLTA 4HOMA 1N8OE 4K7FB 5C9JB 3D3VB 2LT9A 4HV8B 2XFGB 4JW3A 4WW1A 3WN6A 4BH7B 4ANWA 3VXUE 5DHMC 5DZJA 1RY7B 1TEFA 2A6JB 2FRGP 3E2HC 3VFSB 4YXKL 4U6VL 4KXCA 3MRPA 3IGAB 5MEOB 3L3OA 4F8TA 1Q4NX 2ADGB 5EN2A 4Z78A 2R2EB 1A2YB 2X4SB 1KIUA 1KDIA 3WFBL 1KJ2L 3MNWB 1OSYA 4NIYE 4D8PA 2F18A 4KK6D 3QPXH 3FCGA 4DO4A 1U8OA 4AYSA 1M6UA 3SDCA 2Z6FA 2EYSA 5J12C 3HI5L 3ILPB 1TQUA 1PG7X 1ANUA 1E6JL 3DK2A 5SWSA 3T6XA 3HS0A 1MI5D 2ZOLA 2OK0H 3V6OE 2X6CA 3FU7B 5AW8B 1WCBA 3MUZ1 4XR8C 2BOBA 5BO1L 1OXYA 4IMKC 1F1AA 1YSOA 4W9EC 1DBBH 3WFHA 4R5VA 2HWZH 2OXHA 4Y5XA 4HCFA 2R0ZH 4KK5C 4F7KA 3CN2A 1H6FA 1U8KA 3G5WA 2GEEA 1RP9A 1R5VB 1QO3B 3C2AL 1FNFA 1IBHA 3HG1E 5I8CB 3DXAE 2F8IA 3TGXA 1LO4H 3OB8A 5AVWB 4FA8A 1QYGL 2DV6A 5D6CA 1MWAB 3BP7A 4ZOBA 4X4KA 4XB8A 5GGUB 3WEXA 5C08B 1Z9NA