3FQ4A

Crystal structure of the calx-beta domain of integrin beta4
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
109
Chain Sequence
b'MRDVVSFEQPEFSVSRGDQVARIPVIRRVLDGGKSQVSYRTQDGTAQGNRDYIPVEGELLFQPGEAWKELQVKLLELRQVRRFHVQLSNPKFGAHLGQPHSTTIIIRDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin beta-4
publication title Structure of the Calx-beta domain of the integrin beta4 subunit: insights into function and cation-independent stability
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 25
structure length 109
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3fq4A00
3US9A 3FQ4A 2FWUA 3RB7A 2FWSA 2KLSA 2QVKA 3E9TA 3H6AA 3RB5A 2KLTA 3GINA 3FSOA 3E9UA 3EADA 2DPKA 2QVMA 2LT9A
chains in the Genus database with same CATH superfamily
3LEXA 3PGCB 4KKPA 4S1QL 1N68A 2CJSA 2MH4A 5A7EA 5LGHL 2R0ZH 5ISZE 1XFPA 3O41B 3QJVB 3LSOA 1QEXA 1BQLH 3A67L 2P46B 1E6JH 3GIZL 5GS0D 5J13C 3ME0B 4FL4B 4OF0A 3BP4A 3FPXA 4BFKA 2DH2A 4L1DA 4Y4HD 5FYKE 2DYRB 3D87B 3MKKA 4DP1X 4ANWA 5KUKA 1OT1A 2BPBA 2AITA 3DLQR 3QXAB 1HOEA 2EUVA 4DGYH 1ZPLA 4TVPE 5FUZL 4FQCH 4JO4H 43CAB 4URKA 5K9QG 1P7HL 3MLSL 4N2FA 5F88B 1GZHA 3U36A 2N01B 3L6FB 4D9QE 1W80A 2WVSA 1XF4A 4ZTPL 1RUPH 1NGZA 5JHDD 2D4DA 2IFFH 4XAKD 1GIGH 5GRJL 3Q43A 1FH5L 4M6NH 3UCRA 4WI2A 4OD3H 4XMLH 4AJVA 3HUJE 3OMNB 4AYFA 5CSZA 4MNGB 1AD0B 2R2HA 3ABMB 5I0DA 5JMRA 1E50A 1W0WB 3LKSB 3MMEB 5EC1B 2PR4L 5BMFL 3UDWA 1NGYA 5IMOA 5ILTH 4GSRA 5EC2A 1OF2B 1FBIL 4UTCA 2E27H 1RP9A 3LH8A 3WEXA 3O45A 3V0VA 4RLDA 4X2UA 3NCMA 1P0SE 3VDCA 5I6NA 4QRFA 2IQAA 2ZWNA 1D7CA 3B7YA 2VDOL 1MRCL 3BZ4A 4WTXA 3RUGE 4NUJA 3JXAA 4KKCD 5EIQA 2LE9A 2G0LA 2H5UA 3BQUC 4CVZB 4YHIB 2VMCA 4LLVA 4PJGE 1JK8A 5TD4A 1XAUA 5LQBL 5E9DE 3UTTD 1MPAH 3VYPA 4ETQA 3T8XB 5FR3A 4G6FD 4R2GC 2RA1A 3U7WL 2DICA 1OAKH 2YFOA 5KZCD 4ZD3L 1QSEA 4KWUA 1KEMH 4YSOA 4JRYB 5TE6L 2BSED 3VXUD 5AQ0A 3T2NL 2A74A 1NEZA 3VDAA 3WSQL 4QRTB 3G7TA 4RGMB 2EDJA 2HFGH 3AWEA 1X5MA 4R97B 1Z3GH 4Y4FB 4IGBB 4H1LH 3FRPG 5KSUB 4LIQL 4JDTH 4BSWB 1RZJC 1TTAA 1JXGA 2E3VA 4QTHB 4NQEE 1BQHG 4FG4A 4N6RB 5MI0C 1CMOA 5EU5A 5FM8A 1MWAL 3QDJB 4GPVA 5D96B 1EQWA 1R19A 3FTXA 4P3CL 1FRGH 5EF0A 3FZUC 1A7BA 5AAPA 4Z0BL 3RZWA 3GI9H 1Y6NR 2VDKL 3GLEA 3FSVA 3MRJB 1MEXH 3LRSA 3GYRA 2V8MA 2VLJA 2VXSH 1VLXA 3X3FL 2MFNA 4IU3B 3TBCA 4DZBB 2BIHA 4LVEA 3U0TB 1WBZB 2OMXB 1TJIL 3BZFA 4WW1B 3RAJH 3RWFA 4JK0D 3WNLA 1YG9A 1SVCP 2APWA 2HFTA 5D7HA 1FGVL 1JHKL 4JY5L 3L7EB 5BRZE 2ZOOA 3P2TA 1CLOL 3B8YA 3LZRA 1JWMB 3QIUD 5AWNH 4UAOB 2RFXA 3AQYA 2VQUA 1NIBA 3MNWA 3EFFB 3R4DA 4P2AA 3NJXA 5DR5H 5LJYH 3TV3H 1KB9J 4YXHH 4NAMA 3TM6A 4FABH 3WNOA 3MI6A 4HD5A 2F74B 3FQTB 2EIJB 4JZOB 4TXVB 4YPGA 3NA9H 4YHYC 5KJRH 3OGOE 3L5WA 4H5SA 1YLBB 3EJTA 4Z0XA 4E5XG 2ZJSL 3H0TA 1ECZA 4PJDE 4KXZI 1B4JL 2UZXB 5D2LE 2Z31A 1WH0A 4KV5F 4A7VA 1GC1L 5F1NA 4RGMC 1YEHL 4EI5C 4NGHL 2DD8L 5EMYA 1I7ZA 5F1IB 4LARH 1DBJH 1UWGL 1ZT4B 2BK8A 1ZXKA 2YUZA 1GJUA 1W8OA 3DX0A 3FCGA 4OBRA 1WWCA 2XV3A 5INCB 4WWKA 4G59C 1F8TH 1TOXA 3EGXA 4A55A 2DEWX 5F72S 4R90L 1RMFL 4OI9A 4ZRGA 1FG2B 4APXB 4NHCL 4AEHH 4NXKA 4K5NA 1BJ1J 4MQ7B 5J3HC 4JFVA 2VR5A 4LSVH 4KFMA 4CW1A 5ACZA 4P2YA 3GZKA 4IW4C 3BUTA 1NGPH 2E59A 3ARZA 3D06A 4OLUH 4JQIH 4HFUL 1BBJA 1HE8A 1I85A 5E7BA 2KQNA 3LV3B 3QO1A 4ATTA 3B3IA 2ED8A 3GSRB 1IC5L 3MV9A 4U1GC 5GSVA 1GGIL 2YOCA 5CCKL 2Y2WA 1CGVA 2QPDB 5PCYA 4RMBA 2IQ9H 4N2GA 3I50H 1JPTH 3LZNA 3OAUH 4G9FA 3EO9H 4LSTH 3GZQA 3RY5A 5CJXA 4QHKJ 5IWLA 1BM7A 3JWDC 2K4AA 1T7WA 4HAKA 2PKDA 5DJZB 1Z5YD 3N40F 1NCBL 4FEIA 1Q0YL 2QT6A 3FH7A 4P2QD 5DEGA 4L4TA 3TYFA 4GIAA 1MCPH 2YA0A 4W6WB 3WIIL 1RK0A 3GJFB 3QRGL 3WXWH 4IBWA 4E9SA 1QFWI 1AZBA 3DVGA 4AH2B 2X6BA 4K71C 3B9KD 2Y7MA 4JO2L 3OHMB 3V4VH 4PJAE 2XJLA 5EU6B 2VMJA 5K39A 1OXYA 3BP6A 3MTXA 4G43B 4XN2A 4TNWK 15C8L 1FDLL 4LDCA 5AW9B 3NIDF 4YAQA 4A04A 4FZ8H 2J3SA 1FYTE 3QAZC 2DLIA 2Y2YA 4IOFC 1IEBB 2OX5A 3TA3A 4P4RB 2XVGA 1Z66A 3VXMB 5EH1A 1C9SA 3KCWA 2YD5A 3EYSL 2NY3D 4LESA 4X0KB 4P2RB 2P8PA 4BCXA 1MZYA 2NZ1A 4FXTA 3GDCA 2JKLA 3CH8A 1VFBB 2Y7QA 1BZ9A 4P5KB 2NZ9D 4XNXL 3QDGE 5DUPH 1O6TA 4Y5YC 4MTMA 1JV5A 4GUPA 1S7VB 3CPLA 1A7NL 3KEDA 5HGBB 2HSIA 1ZANH 4KZCA 4KNTA 3IGUA 4HVBA 2DKMA 4I2XE 1ITCA 4NYLA 5J9PB 2R1XB 2XPYA 3SDAA 4XXDB 2QADB 4JVWA 4OFVA 3CZLA 2FR4A 1JBJA 3GKZA 2CIKB 1WAAA 4PRIB 1BD2E 1ZRUA 2QBWA 4NM4L 1HAUA 1T3FA 2GEQA 2WXGA 3ZZLA 5E6UB 1N6QH 3ARFB 5BOZG 2GC4C 1IV8A 5AYTA 4XN1A 3JVGA 4WAFA 3M17A 2EACA 2O61A 4PV8A 1KCVL 3OLGA 1Q9WA 1A7OL 1SYVA 2DYPA 4C4BA 1FGNL 1XBRA 5HHVH 4BRJA 3MKGA 2ZKMX 3SQBA 1FO0B 3UL4A 5JW4M 5IW6A 4RCAA 3OHXC 3S36H 2OTWB 4FNPA 4EXKA 2NOYA 2VDPH 5E1GA 1CE6A 1YNLH 1TVBB 2FL5B 1INEH 2HX9A 4L3EA 1E2WA 4KRPC 1U42A 4WUUB 3RZCC 3U30B 2V37A 2ESVB 5KSBB 4OCRH 2HVBA 4A63A 3EHBC 2AFNA 2FJHB 1SVZA 2H32A 3QZNA 3OJDB 4QYAA 1MKFA 2YZ1A 3JWNH 4J6RL 2DMHA 4NKIL 2HVKA 4X9HA 3I6SA 2Z7UA 1DBBL 4JREB 5A6MA 1DUZA 3EO1B 3PWJB 4QOKE 2BXYA 2AMUA 3GSNH 1A1MB 5TTRA 5D6CA 4Z78B 3MFGB 4Q14A 1IT9H 1CZ8L 1N0XH 3QQNA 4YGVA 4XNDA 5MEOA 2EC9U 3EOTL 2R0LH 4OI8A 1A4KA 2JJSA 1YEWA 4YN3A 3U6XA 2XYBA 1MIMH 2MPVA 4XE5B 1Y6KR 5E8EB 3ZXAC 5LNDA 2G60H 4MA3B 4XCYA 3WJLC 2FH8A 4ABVA 4PRPE 2NW2B 2DL9A 2AJUL 5I8OL 2YD1A 3BW9A 5F7AA 1DQDH 4FQPA 1T89A 1LNUB 3DX7B 1SF3A 4OF7A 1URIA 2Q6WB 1DVFB 3GS7A 3U2SA 1NM4A 2F58L 1ZLVH 4NQXB 4F1ZA 1Q0EA 1LO0L 1EGJA 2MNWA 1R3IL 1SZNA 3EBAA 4YLCA 3NSJA 4XP9H 1R4XA 5HYJA 5DQDH 1KOAA 5TF1L 1U3HC 5ICYB 4RESB 3HRZA 1SXCA 2E9GA 1R24A 2CUMA 3HVNA 4XAWH 5DZLA 4AYGA 4QO1B 2VL5A 3OLEA 2OJ1A 1PVHA 1CFBA 4JHAH 1KC5H 3QDMD 4NZRL 2B16A 1CFSA 4WK4B 4WEUD 4BUGA 3BAXA 4NRYA 3KLDA 4AYEC 2G9HA 4P5MA 5IV2A 1QA9A 1E5AA 5L0QB 1XF3A 3LKNA 4EZMA 1Z7JA 4LP8A 2V3FA 2G4EA 4JREC 2X4TA 5ADOL 5IB4B 5E08L 2OMWB 4N1HB 4HW6A 2E47A 4MCNA 3RWHA 5DA4A 3APMA 2DJUA 2H9GB 4KRMB 2E9WA 3M45A 3V7MA 4OLYH 5FYLE 2GTZA 3MOBL 5D5ME 3ZT7A 4IEFA 1P84K 1MFEH 2FX9L 2C9VA 3IBOA 1JPFB 2EXWD 4AZ8A 5CD3B 2I5YH 3JT0A 3PUCA 2IAND 3QCTL 3REVB 1BZ7B 3APFA 4GRMA 2K4WA 4F2EA 2OM5A 3APNA 5BO1H 2VN4A 3DRQA 1VFMA 3O3DB 4ODWA 1N0LB 1U8CB 3TWCL 1MY7A 4JFEB 4HZLA 3HZYA 4J27A 4EI5D 4M5YH 2AZUA 5IEHA 2E7BA 2JSFA 4K5LA 2GIMA 2ZSVB 3F00A 2VSKB 4KZ0A 3IMTA 3RVUC 2CKBA 5DRWB 3VVVA 5HGDB 1I75A 2ISDA 2JCWA 1I4FB 1MCWW 4G72B 3QEHA 4PTTB 1N5YH 4EN3B 1W9XA 3BQVA 2X9WA 3MLTB 3MXVH 1SOXA 3VI3A 5DZPA 5J3HD 4HUUB 4RAVB 2RCSH 2GSGA 4LKCA 2P26A 4XCNB 2H26B 5DTFB 3W38A 2BSSA 3QQ3B 1CD9B 3PF2A 1WUZA 2Z0BA 4G3YH 5E2UL 2ALAA 4KKNA 3ZZSA 1DQKA 3EIFA 4PRBA 2PP9A 3IDUA 4Q6IA 5I1JH 5AB1A 4UM9D 2J12B 3QH3A 3QUHA 2HKHL 3VB9A 4BD4A 1RZQA 1PDKA 2XN9B 4CN1A 2WQXA 3QXDA 4KQ0A 1JTPA 5F6IB 3DHPA 4GBXD 1WFTA 1PZ5A 5DD6B 2XNAB 4L5FH 4DAGH 5E00A 3IXAB 4Q4EA 3DO4A 2HUEA 5GISH 5LCVH 2X53A 3MLUL 1IGML 3KH3A 4PGJA 4PJ6A 4ZTOH 2ZKXA 3PWUB 2IPKB 2KYIA 3RUGF 4JFXA 5F7DA 1X5GA 2HWZH 1OZUA 5AVSB 2GVYA 1HI6A 2Z93A 3LRKA 3H9HB 1RL1A 3G6JB 5BOJA 5JA9A 3FU7A 1T6WA 1NGQH 1XV8A 1KIRA 1ZHNB 2ITDB 1ZT1B 4O58H 4NQVB 4PP1C 2J4WL 2PUQT 4B97A 1AGEB 4UINL 2X4RA 1W15A 3WD5L 1TJXA 1DQVA 2IFGA 2XTJC 1UM6H 3NBNA 4LLYB 2FSEA 4UANA 2AXHA 4GQPH 4W6XB 1MVYA 2FLMA 2BP8A 1BVKB 5DQ9A 3NRPA 4ZSOB 4B9FA 2L7EA 4TUOA 1HOCA 3VFOB 2A3TA 3FOLA 4RGOH 4OZFH 3P11L 3D3VB 1YMMA 4EN3C 2VLLB 2Z7YA 3SYPA 1CI5A 1ANUA 1RIVL 4ONGH 4W81A 1WZLA 4PS3A 3TH2T 3UBXG 1RHHB 1HHKA 1NCTA 3H8NA 2EC8A 4WY7H 1EEYA 2VISA 3ROLA 1MAJA 2YPKB 2FLBT 1MFBH 3SDDC 3QNZA 1FFNB 5I24A 1W6WA 4L3CA 4HUMB 4Y4HA 5I8CA 5T1JA 3BH4A 1X9UA 1MJ7L 2CLRB 3V0GA 3JWDH 4DVRL 3D25B 1RLBA 1P4UA 4FQ2L 4XPBH 4CDGC 3HJEA 1LK2A 2QQNL 2XDHA 2Y06H 4JM2F 3ZGIA 3HE7D 2NQ3A 1WFUA 2WQVA 4J1UA 2Q8BL 1CT8B 3PXHA 5DRNB 4A7GA 1QBMH 3ZKNC 5K9JL 4FFYH 1CGTA 1UJ3C 4N2HA 5JHDA 1SRDA 1XR9B 1KIUA 2YD3A 2J1XA 3SKOB 1IKFH 5IB5B 3V7AE 4GAJL 1PQZA 3OKLA 2VIRB 1T4KB 4HEPG 4X6EA 2CO4A 1F11A 4GAGH 4X99A 5ISZB 3WTWA 1HHHB 3D2UD 2CKBL 3N1MC 4HJEA 1ND0A 1M9SA 1Y0LB 4H1LG 1VGEH 1JL8A 1UM5H 1ILSA 1AR2A 3V0AC 1X4ZA 3VFNA 2SEBB 4BE6A 4P5TD 4ZDHB 3WFHB 3FF8A 1HDMA 3FSOA 4R7XA 1TZOA 4YHZL 3FHAA 4OIAA 3UTTA 1CDJA 4XXWC 2ZX8A 1OOAA 2Z4QB 2OSWA 1CLZH 4J2XA 4DEWA 4G1EA 1CF8L 4DK6A 1NGXB 4N5EC 1ZVSB 3D39D 1KV3A 2BSEA 3VXUA 1KIQA 5I17B 2V2WA 4FQCL 2CBQA 3HUJB 5CCHE 2CDGB 2VO8A 2A9AA 3KVDD 2K6YA 2ZKHH 4TLSA 5C0AE 1IAOB 4PJBE 2BW4A 4N0YL 1T0MA 2OA9A 2V0AA 1NC4B 1XZWA 3CCHA 1GY1A 1GIGL 4M6NL 4OAWB 2IG2H 4HMCA 4OD3L 3IN2A 3RG1C 3TURA 2EUXA 5C0ND 3GSVB 3ILPA 3MACH 3TVMB 2ICWB 1SYSB 3C09B 2ATAA 4JZNB 4S2SA 4NC2B 3RGVA 1AR1C 3LRHA 1U3HD 1OF0A 2WUBH 4PJGB 5IW1B 3S88H 4Y9EA 2Z8SA 2R1WA 1JZ3A 4NKMB 1OCZB 1OHZA 3FNKA 1R3KB 2B7DT 3ZKXB 3EZ8A 3I6LD 4APQB 2QZQA 1OK8A 1KXHA 1EHLH 3V0WH 2CU9A 4JUSA 1F1AA 3AACA 5EUOE 2V9TA 3QIUA 5EO9B 4FFZA 3FBQA 1KT2B 3GRWA 1MPAL 3MQIA 2ZUQB 3L5IA 5FOJA 5KYYB 2DQTL 4WU5A 5AW5B 5GS0L 5K9OA 1BMGA 2FZ3B 4JFFE 5IMLB 5HSFA 5FUCE 4M8UA 3PIQB 4NQEB 3JVFC 5C08E 1B4TA 3GEWB 4IRSA 1G6RA 4WFHE 2V9RA 1BV8A 5HVFB 3OPUA 4PY8J 2EYRB 1PZUB 2HFGL 1DBAH 1Z3GL 4RFNB 3IXTA 5GRUH 4Y5VB 3POHA 5DUBB 4X9BA 1NCUA 1JSYA 1NCWH 4FFVC 1TTCA 2IPTH 3GUTB 2UYLA 3O8XA 3DX6A 5FWRA 2EO9A 2X1PA 2DQDH 2Q1EA 2X70B 1GOFA 3KYOB 2GJ6D 2YLKA 3N85H 1U91A 2R1YB 2CHNA 3WGUB 4ZMOA 1VFAA 1DBKH 1PIFA 2DBLH 4D0CA 5BRZB 3QQ4A 5FDWB 3PWPE 1PPIA 4HZAA 4ZUTA 2GBVA 3UG4A 1CICB 2NSMA 4ISVB 2BDNL 3DIFB 3TVMC 3IF1A 3WNNA 3C09C 5JNYA 4HALA 1C16A 1X5JA 2NT1A 1IGIL 4QJ5B 2ZF9A 3VRLF 2X4SA 4CL7A 3S8WA 3RAJL 4MHHI 5C9KA 1U8LA 2F53D 1DQJB 1MVFA 2AQNA 4OFPA 4W9GC 2MMXA 3NGBB 3V0HA 1UD3A 2RJMA 3JT2A 5CGMA 4BIKA 4I4WA 4JGJA 4PJDB 5CGTA 3RWJA 3MJ9A 4U1IA 3DPBB 1I1AB 3K8MA 3KPOB 1QLFA 2PXYD 4OH2A 5D2LB 5DR5L 4YXHL 1RERA 3TV3L 4FABL 1OKEA 3OAZH 2V33A 1G1KA 3HI5H 3HS9A 1IUZA 2WSKA 4FCAA 5G5DB 1JVKA 2ZUQC 5KSVA 5D4JA 3HNSH 1LP9E 3GDBA 4YE4H 2WN3A 3ECUA 5CAYB 7PCYA 3NIFE 4PJFB 3MROA 4HPHA 3B9KA 4PJ5E 1UWXH 2YPLA 3BAYA 3BMVA 4NKDA 3W39B 4RFNC 1S7QB 4Y5VC 1P7QB 4OFDA 1ACYH 1UUSA 5EEXA 4X5XB 1QLRB 3CLEH 1HS6A 1XVSA 3L1OL 3P0GB 1D7FA 3G04A 1F8TL 3EYVA 5J11B 1AZZC 1I3VA 5H37H 3ZDYF 1GZQA 3MLPA 3U2JA 1OQXA 3V0DA 3BDXA 5HHMD 3WCYA 5TDPB 4IK6A 4MCMA 5GZNC 1J05A 1CUOA 1EEZA 4LSVL 2JV6A 4JM2C 3OAZK 4DQOH 1NGPL 4OLUL 4JQIL 3ARBA 3DX9B 4MZ3A 3B83A 3MRIB 4M5ZH 3ZTJG 2D3VA 4IMKC 1JXDA 3GSUB 2UXGA 3UPAA 3QS2A 1A6ZB 4JHVA 5HYQA 3ZKQD 3EYFB 3HG2A 4BINA 1MI5D 3FN3A 3VXOA 3KPSB 4X4YA 3OAUL 4DGIL 2WTRB 3ZUNC 1UWXK 4XODA 1XH3A 4KK6C 3V52L 4OBSA 5IESH 1SJVA 3NGBC 4P4KC 1BMZA 1HHIA 3GRWL 3SDDD 4PJAB 2GITB 3CN1A 4PHXA 5SX4I 1JWSA 3P30H 1X4YA 2G5UA 5L8LB 1EZSA 3JWNG 1WF5A 1NKGA 1ZA3A 4RNRB 4X7TA 1MCPL 4JKKA 1FYTB 4FQHB 4DP9X 4LRNH 1KUMA 3O3BA 3VFGH 1JN6A 3RI5F 2AQRA 1FNEB 1RJYB 5EDSA 3RHWF 3IE4A 5B8CA 1SUJA 4FYQA 5EIIG 3VD9A 3DGGA 2I85A 2C8NA 1I53A 3H3PL 3SN6N 2DYSB 2EKSB 2CH8A 3STLA 2YAQA 4RRPG 2ITCA 3QDGB 4NM8H 2CIIB 5HGAA 4ALAL 4LP5A 5D5MF 3W9DB 2K1MA 2MCMA 1RAMA 4L0ZA 1XF5A 1LWRA 5FLVA 3DPDA 5J11C 2MOGA 5EBMA 4F8LA 2GJZA 4JFUA 2NYKA 2HP4A 1OSYA 2CQVA 2F8OA 2R2BA 2VSMB 3LKOB 2OMTA 4WO4C 3ZDZF 4AYMC 1BD2B 4L48A 4HKZA 3OAYH 1D6EB 4UT6A 5DSCB 3PGFH 1IAIH 3GNMH 5DUPL 2Y7OA 2WSPA 2Q7NA 4KK8C 4U1KB 3ML9A 1ZVYA 3PAVA 2H2PC 4L1TA 4P23A 1DQQB 3KLAA 3WNMA 5G55A 2CO6B 4QD2E 1DANT 3MJ9L 4W9JC 1YQ2A 5CCJA 2DJ4A 3SKJH 4XMKL 1CFVH 4X9IA 5DVMA 5EF1A 5C8JB 3FXIC 2E7LA 3S34H 2WKGA 4LO9A 4XNAA 3VWKC 1SLUA 1N6QL 1MIEH 3DX4A 1VACB 2HTLC 3ARGB 2JFCA 1HQ4A 3QK0A 2WXRA 3HI1A 5DVLA 3U82B 1A1OA 4BUHA 1YECH 4MD4B 2Y9RT 5GIRB 1J5DA 1OGSA 1CFNA 2AVGA 4N0RA 1UGNA 4MZRA 3FPYA 3OAYK 4N90E 4WDIA 1U6AH 4UM8B 3WUWA 2DQFB 3CFDA 2VDPL 3IVKA 4ECNA 1F58H 1TQCC 4N2KA 1JCKA 4QOKB 4OV6F 4F58H 1FVDA 3VFMB 4OCRL 4Z7UE 1H3XA 3KL5A 5D1QD 4FG6C 3SKNA 5CLZA 1R46A 2JELH 3ELAT 4EKJA 3GMQA 3X11B 1U30A 2GI7A 4A67A 3VRIA 1PX4A 4WK0B 1LILA 2DB8A 2GW5A 4KO6A 1JFHA 4XNQA 4IJ3C 2GHZA 2WVTA 1DVYA 4BDVA 2J88H 4PWKA 2J71A 1E9OA 1QBAA 4IQHA 3WN5B 3VD5A 2CGZA 2EYSA 5FO2A 4LDOB 3BWAA 5CR8A 2VN3A 4PJEF 3IU3A 4KX8A 4PRPB 1EAPA 1H5BB 1IT9L 1N64L 4KKRA 4R6UA 1AY1H 3ALWA 1UGKA 4KKQA 4PUBH 1NAMH 3QSKB 4I0PB 2LV4A 3VGEA 4K7PH 5C97A 3K46A 3HG1A 1FSKC 2G60L 1Z1WA 1NMCB 3OB0H 2BVYA 2IANA 4N9GA 4OLWH 5EZOH 3VJ6A 1JNNL 4N1EA 4Y16B 3X13A 3ZRFC 3FCTA 3PE9A 1DQDL 4MJ6B 4ZFFA 4PU2A 2WHVA 1CBVH 2JK5B 4ZZKA 4OIIH 4IIZA 1EUUA 2BHUA 3GO1L 4QRUB 1VRSA 1PLGH 4V11A 5C0RH 5IUSA 5I23A 3BJLA 3RIFF 1FHGA 4PVNA 1U8QA 2BH0A 1KB5A 5DMGC 3KLLA 3THMH 3T0EC 1MFAL 3DOSB 3W37A 4WI4A 1MCLA 5B38G 4DPAX 4NBZB 4RIRB 1FIGH 4QDGA 1BVNT 1N12A 2X5PA 4XAWL 3QWRD 4OCMC 5JORB 2JCCE 3T0DA 4JLRA 5MEPB 1ZGLP 4LMQI 1QTPA 4YSPA 4RZCB 1O7DE 4H26B 4MAYC 5DD3L 2DEXX 1OAZL 4UT6L 1IBFA 3OB0K 3DV6A 4GT0A 4WFED 3BVWA 1R3HA 4LBEB 4UM9A 3TFKC 1S8DB 2UWEE 1ETZA 3OKOB 1KTRL 3UP6A 1KBGL 1ECYA 1D9KB 5F6HI 3WN5C 3D0VA 1GJWA 4Z5RB 4OZFG 3NAAL 1FLRL 3EO0B 4NNYB 3JV4A 1IBGH 4HKBA 1ZLWH 2LTQB 4OLYL 1S3KL 5B3JE 4I3GA 4M6AA 4JFTA 4C56D 3B9EA 1H5BC 1IKNA 4LCCA 5B1CA 4PRHE 2EILB 4EO5A 5FO8A 1S7XB 1OW0A 2I5YL 3P02A 4KXAA 5I8EB 4TNFA 3MGOB 3BESR 4TLUA 4W4OA 5F1SA 3MLRL 1JDDA 3KH4A 1YEEL 5BO1L 3CFBB 3IDMB 2W92A 5T1KB 2AJVH 5FFOA 3V6FA 4M9PA 2FBJH 4AYSA 3CSBA 3G6AA 3TIDB 4KUZH 2VJXA 4GKSA 3FF7A 5IB3B 2CO1A 5MHSE 3A4DA 1YEDA 3BP7A 1A3LL 1G9MC 2VN5A 4LLWB 4AQ1B 3OTTA 3O6ML 1JUFA 1U3NA 5L9DH 1FNGB 1EAJA 5H35B 2ZX9A 2RCSL 1KNOA 4JM2D 5J56B 5LG6A 2FCBA 4L0PB 4QXVA 1B4RA 1O9WA 3QIBB 4JFOB 5D72L 5FOBA 1ZLWK 1BX2B 3SOTA 1F3JA 4WJ5B 3I2CL 4QHMB 2D31B 2CHXA 2HJKB 3ZKMD 2Q5BA 4IBZA 1EMTL 5GSRA 4BK8A 2HZHA 2G75A 1IAKB 4Q6KA 4G8IB 4WKXA 1DJGA 2WYIA 4KK6D 4CSSA 2XPGB 2X1OA 4AG4L 2E86A 1ITBB 1AMXA 5DRXA 4DAGL 4PJIE 4U4BA 3U79A 2YXFA 5LCVL 5GISL 2F7IA 1KGCD 3QNYB 1E28B 4WENB 5DK0A 1SHWA 2PO6D 3N1PC 4L8CB 4FQXB 4G8GE 5F7BA 4C57C 1LJMA 3HE7A 2VABA 5AKVA 3ZMRA 1J8SA 1RY7B 1A6UH 4MBOA 3F5WB 1JPST 1NGQL 1J88A 2HB0A 4X4XB 4F7CA 3O3EA 4O58L 5BV7C 4M3HA 1JXFA 1PFCA 3L4YA 2O5YL 2XV6B 3S8GB 3GIVA 4WNQB 5ABDE 3VH8A 5ALCH 1SLXA 3KYNB 4NWUH 1A14H 1T2JA 4R9HA 1KB5L 3TBWA 1JOIA 3D2UA 2GG1A 2OCCB 4IK7A 3PL6B 2XZAL 3GKWH 4RGOL 3GMOB 3K7UA 5D7KE 2ZUTA 1CR9H 4WO4D 2IAMC 5T1DL 4Z7IA 4OD2B 3WMSA 4P5TA 1U8OA 5DO8A 5E8PB 4ONGL 3GUFA 3ZUCA 5DFVD 3QIBC 4K4KA 2QGEA 4M1CC 2O5XH 4OF8A 4WY7L 1BLIA 1S4IA 4E41D 3T8VA 2B3IA 4Y2DD 5C09E 4L4VD 4HK0A 5FW6A 4P9MH 1Z9OA 4R7NA 1JRHI 1QP1A 2B8OT 2BWDA 3RDTD 4YHNB 1CBJA 2HT4C 1GGUA 1KZYA 2GCYB 4JFZL 1F13A 1HYRC 1FFOA 2ICCA 5AB2A 1IEAA 2R23B 3BKCH 3TTYA 2J8UA 3HPLA 3IDIB 3LH9A 1ZHLB 2IWFA 1U92B 2HTLD 4JFYB 4LPVA 2ENPA 3WFEH 1A64A 1TVHB 4KJWC 3PHQB 4XNYH 3O6FB 5J6HA 1FP5A 5B7EA 5AVQB 2WYHA 4XVUC 5A3IC 2A6JA 2VWEE 1XSKA 4U1JA 3VX0A 4YNYA 4MD0B 2W65A 4NFCA 5FYJD 1MUJA 3KNBA 1MLBB 1KFGA 1EZUA 1OE1A 1QUNA 2AERT 3VWJC 2MKLC 2DKSA 3IJHB 1BEYH 1WWBX 1WP6A 2FEEL 2IDTA 1NAKH 4YDIH 3N50A 3QDHA 3ZZQA 5IFJB 1KCSH 4BFFA 3PS6A 1Q9KB 4LCIH 1M2VA 4FHBD 4HGMA 2OMBA 3KPNA 3UMTA 3FS9A 3PL6C 4ZAKB 1EXHA 4LEOA 3U83A 2EKJA 2CKNA 2GIXA 1G0XA 2VLME 2CO3A 5CHNA 4XMTA 4JPWL 3PNWA 1KXQA 1EZLA 2VQ4A 4BRVA 4LFHD 2W8CA 2GHWB 1AKJB 2VMFA 4G8FB 1CLZL 4NUGH 1EHKB 1ERNA 4W9HC 5C0AB 4MD5B 4HIQA 3FRUA 1VPOL 4PJBB 4CC0A 1GCYA 2VTFA 4OKDA 1TXKA 3BAKA 4MNHB 1CG9A 3FQYA 4OZGE 1S9VA 2Q87A 1G7QA 2LOEA 3V8CA 1S7TA 3GHBH 5GJTH 3AQZA 1XMWA 1UXSB 4MA7H 5FXCH 2BSRA 1JAEA 5IHUH 5T3ZE 1ZVHA 3DJZA 3GBEA 4NENB 4TPRH 3UYPA 1ZMYA 1LD9A 3BWUF 1NL0H 1AHKA 5AG8A 1NCOA 2OSXA 2GJ6A 3QXVA 4FLQA 4LQFH 2IG2L 2PCXA 1NBYB 3KR3H 2VLRD 5DMGD 3MACL 1AE6H 1XH2A 1MQKL 3T0ED 2JKSA 2NX5D 4HJGA 2HN7A 5EUOB 3S88L 4PVBA 5GZOD 1P9MC 4HF5H 3CHOA 3F7KA 5L4FA 1QWUA 3TO4B 5JOFB 3N41B 2CLZA 3AG4B 5CP7B 5EU4A 3WKYA 5C0CA 3PWLB 5BXFA 3H9SB 4AM0Q 3SDCC 5DJCB 1B0WA 1DN2A 1E3ZA 3D85B 4X5WB 2ZOKB 4GQ9L 1MJUL 5C08B 1EHLL 4YBQC 4AIOA 5H37G 5F0LB 5BQDA 3AXLB 4PS4H 3PJNA 3OC5A 1SF5A 3OKDB 3UAAA 1RJZA 4Y9FA 5DC0A 1RLWA 3ULSA 1XR8A 3BPCA 3S37H 3FB6A 4ZJ9A 3EKCA 5I26A 2PXYA 3QORB 1VIWA 3E1ZA 3T3PE 3C5ZD 3HPJB 4KPHL 4I18B 3FUJA 5SWZE 5JIQA 2EEBA 3GSQA 4KHTL 3DX8B 1HHJA 4PG9A 1FG9C 3BKYL 5C9JB 5CBAB 1JE6A 4OZHE 5I19H 1DVZA 1LO2H 1FFRA 5I5IA 1X5FA 5C0BD 1QFHA 2FX8H 3EFDL 1V7MH 2B4CL 3PWPB 4CGUB 1BP3B 2BO0A 2JH2A 5FA4B 3NCFB 4YSDA 1ICTA 4POYA 2ZSWB 1J7VR 1G7MB 2NYZA 2X88A 3A6CL 3LXAA 1XXFC 4BFIA 4AK2A 4AQ8A 1Z9SA 1AO7B 5HDBE 2CXKA 3ZVVA 2A6KB 4BFRA 2KI6A 4D0BB 1DBKL 2ARJQ 4NO5A 2DBLL 3ECBB 4GLRH 4Y8DC 5E8DH 3ZMEA 5MEQB 4DVBB 1ZSDB 4S1RL 3DO7A 4QRQB 4ZS7H 5DJAA 2NY4B 4K2UL 4QY8B 1ZHBB 3K81A 3P54A 3DHJA 1FIEA 3NFSH 1JD7A 3K8KA 3N42F 3EDJA 3MRCA 2PYED 5E2TL 2X3CA 3RWEA 1N5AA 4MRBA 1ZY9A 4Y5XB 1FA4A 1T4WA 2FQGA 3CUPA 4GAFB 3TO4C 3FU3A 3QGVA 3SJVB 5LN4A 3WKMH 1LP9B 3CXHK 2OKMA 3LS4H 4EDXB 4L8BA 1WGOA 3GLZA 4Q89A 1U8KA 3WIAA 1PNDA 3BEVA 3NIFB 4XH2A 5G2NA 3TXAA 2ZXDA 4AGOA 3BSZA 3D9AH 1HQRA 4PJ5B 4N87A 4LCVA 1S5IH 1PZAA 1M1SA 1AXSA 2H0JA 5C70A 3VAEA 4UQIM 1FVCA 1BZOA 4RISH 5D7JB 2QHRH 3KYMA 5JOPD 4UT9A 5L8JB 3LJ3A 3BN3B 5MENE 1NDGB 4Y19D 5HXMA 2NY7H 1BIIA 4MAUL 3ULVE 4LASL 1AQDB 1A2YB 1U33A 4AKPA 4NKOB 2CWRA 1MDAA 5B39G 3BT2H 1QQDA 3TC9A 2C34A 4G7YH 1ACYL 5CZXC 2DJSA 3BAWA 2ADGB 1FQ9C 3T65B 1JZFA 4RSVA 4GKNB 4RFOH 4UMSA 4I5BA 4ZOEA 1UATA 5AOMA 3MRPA 2YSSB 3MFFB 1AANA 1HN1A 1DJZA 3X3GH 1UKQA 2XG4B 4WFFE 2XG5B 1G9MH 2V7NB 3QIWB 4E42A 1DBML 1LEIA 4M3KB 2IAMD 4M5ZL 1I3RB 2ZWSA 3A6BL 4GRWF 1OD9A 3MNZA 3I9GH 4JFHE 1E9PB 4LAQL 1B4LA 1MWOA 3RJOA 4UQBA 2H2SC 4NZUH 2ZUYA 2NW3B 2ED7A 3C5JB 1NIAA 2O6FA 1AP2B 3EOYG 1KCUL 3SZ6A 4AQOA 3NSYA 4BH8B 5IESL 5L88L 1Z5HA 2FD6H 5E4OA 4LCYA 1C7SA 3UPRB 2XZZA 5FYLH 2PP7A 4NEHB 3RNKB 3WEOA 2JCCF 5EULV 4HKXA 2J25A 3B2XA 1ONQB 3CZJA 3Q5TA 1S3RA 3IJ8A 1QFWL 3LIZH 4LRNL 1CFQB 1QD0A 4JX0A 5FA3B 3VFGL 2YGNA 1UD4A 4JCMA 2F61A 1W0YT 3BRDA 4CN6A 4Y1AA 4O9HH 1YMHB 1ZA6B 4LSRH 1KACB 2YKKA 5A3ID 1DJXA 1DO5A 1TCRB 2DL2A 3RI5K 5I18H 1V55B 5HI5D 1R5VA 3VXRA 4YX2L 5I73B 5BV7H 1TSHA 3RHWK 2F08A 3KPPA 3LN4A 4NM8L 5DHVH 1CDUA 5JYLA 4E2OA 5AVTB 1KZQA 1NEUA 2WNXA 1YAZA 3PLYA 2DWTA 2R29A 4OQTA 5DUJA 5D1QA 1AHWC 1FL6A 2FYYA 1IQDB 5DGRA 3D69A 3BWUC 1T0OA 1IAIL 3PGFL 3QIWC 4GQQA 1JPGB 2FJFB 3NIGF 5TH2B 3K4ZA 3ZRCC 1N59B 3MRMA 5D70H 1S78D 2KH2B 3IJ7A 3J27A 2HT2D 5DEFB 2Z7ZA 4ZS6C 1TUPA 3W0WA 5KVGL 3U1PA 2XN2A 5BZZA 1W0VA 1PG7H 3S96A 5E9AA 2XI9A 3Q6GH 1KTDA 4HG4K 2CA4A 2CBPA 4LKXA 2JKTM 3PABB 4YVUA 5JIDA 5KBNC 4JFDB 3HLAA 5JUEL 1G5AA 1KIPB 1MIEL 2PPDA 2JKNA 3GXDA 4TSAL 5DZVA 4M93C 1WTGT 1MFNA 2BCKA 2ZX5A 3RVVC 1MFVA 3ATFA 4KI5F 1JVOA 4NI3A 1E3XA 1U95A 3NCBB 5T3XD 4AXWA 5EEWA 4Z7UB 1K5NB 1VEMA 3N9GH 5LKNA 4WW2A 2BNRB 3QJRB 1UTDA 1RSYA 1DANU 2I24N 2MCPH 1DUYA 4F3FB 4CSPA 4PJIF 4K55A 4L1BA 1F58L 3UIYA 5D1ZC 3TN0D 4PGZA 1QSFE 2AJZB 1P4IH 5JLZB 1R3LA 3QS3A 3Q06A 1F56A 4F58L 4HIIA 3TONA 3OL2A 4NRXA 4OFIA 2VOTA 3UBGA 1G1YA 1GGCH 1RP8A 1KJ2B 4JANB 4HS3A 4PRDA 5KSAD 3GBNL 3NP3A 3WHE0 1AD9A 4XI5C 5F7WC 4DSYA 1N6UA 4JFPA 1J5OH 2J88L 3SDCD 3OKEA 3MYZA 2OW7A 3H9ZA 3Q05A 1BYNA 1FZMB 4YDVA 5DJ0A 1CLYL 3TYGL 5C0FB 4NQUA 3QHFL 3IDJB 2N7AA 4NZFA 4TV3A 5I1KL 2E76C 1BFOB 5DS8A 5K9KA 1L0PA 4NPYA 5GGVL 2R8SL 3HBGA 1NAML 4GG6A 3ULUE 3PHAA 4BFGA 1E8ZA 2VDNH 1AZRA 2JTDA 1KPVA 2EIZA 4C56A 1I8AA 1F42A 1A65A 5EZOL 2OK0L 1Y6MR 4RMSA 4WIQA 1TO4A 3TBVA 3QUZB 1H3VA 1CBVL 2DMCA 4RH4A 3ESMA 4ONOA 1YPZA 5FKPB 2EE2A 4YEEA 3RWGA 1P84J 3KEHA 5IMMB 4JG0H 4WZ9A 5B1AB 2UZYA 2X4NB 1CXKA 2FT8A 4KTYA 3VXQB 2HVJA 4G8EB 5ANMA 4QLWA 4P2OB 4WI3A 2DQJL 2EE9A 4PCYA 5IJVB 2HA1A 5D8JL 2UWEB 1J1OH 2ZYRA 1FIGL 4MXVE 3RIFK 3RB5A 5KN5B 4XC3L 3P3RA 3FTVA 2XOTA 3ZE0B 3WJJC 2R29L 5DZAA 5K1VA 2ED9A 1K8IA 4OQTL 2ATPB 4KDTA 2VDLH 3L4TA 2X0VA 5EPMA 1XWVA 4IU2A 5AAWC 2E7DA 4JE4B 4ZFZA 4E68A 3TEWA 1N18A 3BVTA 4TMPA 3IGLA 3US0A 5G4MA 1DLHA 1G1CA 2GBAA 3MRQA 5D2NA 1QZNA 3MBEB 3E3QC 1IM9B 5IVZA 2BIIA 1JCVA 3AY2A 3B56A 2GAZB 4L3AA 5DK3A 4LB8A 1N2RB 5D7SH 3WS3A 2YRZA 4PJHE 1O75A 3HG4A 1NBZB 4X6CF 4KZDH 3CVIH 1OGAE 2P5EE 4OCYL 4P57B 4FFTA 4XBGB 3CSYA 3GSWB 2XWZA 3K0WA 5HPMA 4Q4IA 2H0EA 2Y1YA 1DP0A 3EYOA 1FFPA 4CSZA 3KGSA 3KL3A 3CDFA 1MXDA 2PO6A 3P3YA 1RJLB 3L48A 3MODL 5LAPA 1BQUA 1WCBB 3FK3A 3A4FA 4AIZB 4YDNA 3AGVA 1HWWA 3P77A 4B7IA 2VR6A 3LS5H 2DWXA 3MRFA 3MUUA 2JQZA 5JTWA 1U2YA 4D94A 3P4NA 1VEOA 1F90H 1SQ2N 4DGVH 3FDWA 4U3SA 1LEGB 3WS6C 3I6GA 3GHEL 4NQTA 1DDHB 5B3SB 1NUFA 3RFZA 2QR0A 2HRHA 5DJ8A 4KROB 1OWWA 1UYWH 4P2OC 1PEWA 3VGFA 3FH8A 4Z7QE 3VXSA 3IFOB 1PD6A 4CMMB 4IDJH 5CEXA 2W80C 3PPSA 3AB0B 5B1JA 4PW3A 4GW1A 5CBEA 2F54D 5MERA 2K8QA 4KTGA 1JZ5A 3MCYA 1ID5I 1BOGA 1UZ8B 2NY6B 1OM3H 4E41A 3A4EA 3B2VL 2DM4A 3GMRA 4Y2DA 4OV5A 2YGVA 3WMPA 1UOKA 4LIQE 2B77A 3GMMA 3QRBA 3RDTA 3I02A 2R0WL 1I7RA 4AJ0A 2JXMA 3IFNH 4OB5H 3MRNB 4Y4FD 5IFAL 1BSIA 1J48A 5F7HA 1EO5A 3VXTA 2XXCB 2VLKD 5EHFA 3UYRH 4UT7H 1T1WA 2WGNB 2HG5A 3BCDA 3L9RA 1YN6A 2BNQE 2ZUVA 1Z6JT 5DRZA 3CDYA 1T04A 3PFQA 3D48R 1ZPUA 3CZNA 3M8OL 1MCEA 1BYPA 1VFOA 2Y24A 1RZGA 2BZDA 2F1AA 3NYKA 4J12A 1REIA 4YFLF 4ABUA 1DLFH 4J3OF 4JN1H 2A9DA 5ALCL 4NWUL 4ZW8A 5J12C 4NN7B 2ICWI 3VXNB 4DZ8A 4GRLC 1PIGA 4RA0C 2OP4H 4OZHF 1FI8C 5CD5C 2X4OA 3ZMNA 2CBOA 3QFDB 2XWRA 3LPFA 5DK2A 4RAUA 5C09B 5F21B 5GJSH 3HAEB 1CR9L 2CRIA 4KI5C 4PJCA 2BX5A 3R18A 3U9UB 2ARJB 4NAJA 1GTFA 4KROC 1H6TA 2K9UA 4WKZA 3DBSA 4A2FA 3DWTA 1HFUA 5C7ZA 4XP6H 1CL7I 4PGDA 3K3QA 4Z7VA 3CE1A 2HPTA 2OSLB 2XTSA 3CSFA 4TSBH 4UDUA 5HDBF 3UH8A 2EINB 2GQHA 4FMKA 2CJ3A 3DETD 4EI6B 2AXWA 2HKFL 5A16A 3B9DA 3ILQD 3QT2A 1AIZA 1NJ9B 3P0VH 4JQXA 1SHSA 1A6WH 2JKIS 2BVPA 4JPSA 2A1WL 3RVTD 1IIKA 1AZNA 1FL3A 3BD5A 2AK4E 2OR8A 2AJYH 3FO9B 3NPZB 3QJQB 5E4AA 2W9DL 1HL4A 1I8KA 2OMUA 5ESAB 2BOBA 4QCIB 3IDNB 3H7BB 4G6MH 4LCWE 3WFEL 4MMYB 2LW3A 3F7VB 3MCG1 3FULA 3D12B 4UB0H 4XNYL 5KS9A 4CA4A 1SJEB 2OMZB 3MRKA 5TDNA 4FNUA 4ZYKB 3UGXA 2WLIB 4LFHG 4NNXB 1EXUB 1I8LC 3LPGA 1OB1B 1PY0A 2R7EA 5LXVA 4IRJB 3QCUH 4X6BB 1AI1H 1OPGH 2W38A 1HNGA 2VLRA 3V55A 2AHIA 2APXA 1U3ZA 2L8AA 2YGQA 5IVXE 2NX5A 2PPCA 2PW2B 5D1ZD 5AKRA 5DEZA 1JYXA 3I9IA 4G7VL 3RA7H 5GZOA 3QG7L 1S9XB 4X7FC 1UURA 3EYQC 3I9AA 5FK9B 2KBGA 3QDAA 5E1AA 4NN7C 3ZE1E 3CTTA 2VDMB 4HS6B 4PLKC 3ARQA 3BGMB 3J7HA 5EU3A 1IBBA 2Q8AL 4POZD 3BKMH 2BINA 1S6NA 1NFAA 2FHBA 2P5WB 4KNUA 1O5DT 4X6DA 4FXGC 1YN7B 2QFRA 4OZGB 5C86A 3PJSB 5K59E 2YGOA 4R84A 4K9EC 1KJVA 3DRTB 4M7LL 4A7QA 1X5AA 1JK9B 1PZBA 1JERA 4GFTB 1N4XL 3C5ZA 1A1NA 3ECVA 1KENH 5BVPL 5D9SB 4GUQA 3ARYA 1EJOH 4BJLA 3CHQA 3PDDA 2F7RA 4JPVH 1IARB 4JO1H 3O9WC 2WAQA 3UC0H 1OTTD 4YEFA 1COBA 3L08A 5C0BA 4ENED 3DV4A 4S0TD 5IHUL 4U7SA 4U1HB 4ZUSA 5IR1A 1F4AA 3B2DC 3HC3H 4HQQL 4TPRL 4KBPA 4P48A 3TBSB 5EZLA 5DMKA 3T08A 1DQLL 1A7RH 1D5ZB 2CR3A 5TPWH 3RILA 3FQXB 4PGBB 2CBMA 1ZLSH 3VXMD 2Z8RA 4X8XA 4OCXL 1MN4A 1IGFL 5FYJL 3AU1A 4P2RD 4DN4H 5J1AA 2QDVA 1NCJA 4I0CC 1A8ZA 2NUPB 5GRYA 2YEQA 4HF5L 4E0RA 3TZVC 3B8SA 4I48B 4EI0A 2FYVA 1OK0A 1XB8A 3DECA 4NQDE 1Q1JH 4PP2B 2R4RL 3T3PB 1ZLEA 2PYEA 3G5YA 1JGEB 3LKRB 1E4KA 3O4OB 1I7TA 1W6LA 2EDNA 3JSSA 3F64A 3QQ9D 4PJ7A 4PYGA 5SWZB 3O3UN 3Q44A 1IC7L 2LAAA 2V7HB 2YAHA 3R8BB 1JTTA 4LOUC 1E5UI 3G6DL 4K23H 4PBWD 5I1AA 5FHBH 1YUHA 4H13C 4TRPL 1IL1B 3FMGH 3S37L 3DJRA 4PRID 3QWQB 3VYNA 5IHBA 2AEIT 2C9PA 1V3KA 1N8ZA 1TZGL 3BXNB 3CHPA 2XKNB 3L5XH 3NQKA 3S7GA 1ETA1 1WWWX 2XWXA 1ZT7B 4FTVD 4HV8A 3ARFD 3C8DA 1CXHA 3IE9A 4AUUA 2OJEB 4QXUH 4Y19A 5I19L 4DKAA 4Z7WF 1HCVA 3NACL 1KTBA 2H4EA 2BRRH 5CMAB 5J7CC 5ACLA 3CMOL 4LGRB 3N06B 2FX8L 4MRCA 1MFUA 2EEFA 3VM7A 2GI0A 1WT5A 3FT3A 3GSXB 4FQIL 3HHMA 3QPQC 2J2ZA 1SBBA 3BHBA 3ARTA 4L37A 4F9LA 1Z5LA 1Z9LA 2K0RA 3ARWA 1OCWH 3UGUA 5K5YA 3X1BA 2OL3B 3MC0A 4OFQA 4WUUD 5FECB 4N9OB 5KVFE 1UH3A 1AJ7H 3IMSA 3S5LB 4BUQA 4IIQC 4OGQC 4N2NA 4O02H 4OF6A 3DROB 4BQCA 3DVNB 4ODTL 3RTQD 1GXEA 4JHBA 3UX9B 3HE6C 2BZ7A 1I9EA 5CS7A 2P1YA 4DUXA 4UI2A 5IBLD 4BHUI 3ZHKA 3GBLA 1J0JA 2J20A 4J3OC 3RTLA 3O4OC 2R56L 3I3DA 3SOBH 1U41A 1YJDC 4ADJA 4H8WC 4ZW6A 2N3JA 3QPKA 2X4PB 2EO7A 3T9WA 4OU3A 3D9AL 5I6KA 1D5MB 3U0PA 1PYWB 3HB3C 2Y1AA 3ZIYA 3VMPA 4RFEA 2WXFA 1FAIH 2QHRL 3I6KA 3VFUB 2VR8A 3MBWB 2LU4A 5D6DC 5AVXB 3C8KA 4HJJL 1MFDL 4TQEH 5ICXB 3U7YH 3SYAA 4GSDH 3UZQA 5CIPB 2HFEB 4GRWH 3BT2L 1FYHB 1ZK9A 2FO4A 1GAFH 4F8NA 5DJDA 3CVHB 3SCMB 5TDOA 3AG3B 5IBUG 2YLHA 1T5WB 2CJUH 4M29A 3RGHA 1UD6A 3PV6A 2A4CA 3BH9A 4F15C 4B9PA 1BG1A 1PZ3A 2C1PA 2Z92B 1B3IA 5IQ7H 4HIPA 1AXTH 4LLDB 3X3GL 4TTDC 5CD5D 2VXVH 1JZHA 1NFDA 4CDHA 1IX2A 1BGXH 1C5BH 1PW3A 1E4WL 1TFHA 1YNTB 3QEQE 4JM4L 5J1TC 4A6YH 4I9WE 2WINA 3AG2B 4KI5D 1WAAE 2OMYA 3VFVA 3Q8EA 3KPQA 1DDTA 4PGCB 4BKLB 1U8HB 2NR6C 5I8KH 1G4MA 3LEVH 4NZUL 2ICEA 2ZNWA 4KK9C 3CDZB 4L9LA 4CADA 4G9DB 4OCSH 5EEVA 4XC1H 1VF5C 4E9LA 5F9OL 3MV8D 3SE6A 3OWEA 4GNKB 1OM9A 3SDXF 3VE0B 3ULVC 2NTSP 2L4OA 1WFOA 4EOWH 2NY2B 4NKQB 2JI2A 1CIUA 3VXPA 4KKAD 3SGDH 3BUYB 2WXLA 3EH4B 1J0YA 3LIZL 3MUZ1 2VC2L 2KERA 3DHMA 3FFCE 4PBDA 2DQUH 2W07B 4PJ8C 3IAGC 4Z7NF 3KPLA 4QTIL 1A9EA 2FVNA 4U0RC 2EH7L 4WTQA 1JNHA 2FJSA 4L3EE 5A6LA 2IOOA 4KMLB 1L5GB 4XPHH 5DJYA 4DW2H 4NJAH 2PCFA 3DTXA 1AG6A 3Q3GA 3UJTH 2AK1H 5DT1H 5CUSH 3P40A 3ZL4H 2DDQH 3SBPA 3QA3B 3LB6C 3QR0A 4KJYA 1J8HA 2H8PB 4URTB 2EVFA 3SKMB 5KTEH 5EOTB 3S5ZA 3CAFA 5HDWA 1FZOB 4JFQA 5DYFA 4PLKD 3QQXA 5KSAA 3UC2A 2XPZA 3D51A 2QL1A 3VD2A 3EJZC 1GSMA 3TIEB 1JZJA 4LGPB 4EXPX 4JB9H 1JTOA 2XN9D 2JJTC 5GS1C 3B2PA 4YMPA 1IGJA 4GOSA 1P5UC 2Y36L 2MKWA 2AJ3A 5INDA 3EOBB 4UTBA 3FQRB 5E8OB 3TCLB 2KZBA 2ZXEB 1L9RA 1PG7L 1A6TB 4U7MA 3Q6GL 2E7HA 3MYJA 1PNCA 1LEKB 3VRJB 2PYFB 4RMVA 5BJTA 5HYIA 5JO5A 4LU5L 4DP8X 3F7RA 4Z7QF 2APFA 4ZUVB 2XXGA 1QAWA 3IKCA 2NY2C 5CJQL 3O9WD 2ETWA 3FJTA 3FONB 3WFZA 3RWIA 5FDYA 5I1LA 2QKIA 1QSFB 3D09A 1IGCH 2OULB 5DO2C 5FKAA 1PZ2A 4ZUWB 2FB4H 3N5AA 5I6OA 3P73A 4ONHB 5DFTA 2CHDA 3BN9C 3N9GL 3U6XS 1W2KT 2LLNA 3H54A 4PR5A 1LGVA 1T1XA 1A3RH 2GK0A 3D30A 1WO2A 4MMZA 1U9KA 2B39A 4LNVA 5I9QC 3U48A 4XWOC 2OYKA 1UG9A 3O2DH 3FQNB 2BJMH 4PRAB 3V9EA 4GSXA 3D3VD 3MNMA 1DFXA 1GGCL 3L3DB 5E6RB 4IKNA 3T4YA 1HC1A 3PGCA 3KW7A 3QUKB 1J8RA 2IBBA 1KV7A 3O41A 3K4AA 4XVTL 1A5FH 5F9WC 5F44A 5GS2D 1G7HB 3VG0H 3ME0A 4XVJL 1X5IA 3CHSA 3HS0B 1WVZA 3COOA 1UH4A 3FOMB 5BW7C 1NFIB 3MOQA 4ODBD 5HYEA 1E9QB 1LE5B 1N70A 4YZFE 5JPMB 2W9EH 4WHYH 5A2FA 4K9EH 1OWRM 4AENB 4FDWA 2JB6B 5CR1A 43CAA 4EKXA 3O0RL 4NO2A 4XB7A 4JHWL 2YWYA 1E4XH 5F88A 5SWQB 1IBZA 3H9YA 4BZ2H 1CD1B 4X80H 3L6FA 5DZ9A 1RUAL 3NDYE 1BVOA 4DOHE 2F2HA 1WA1X 4NBYB 2J7LA 4I3RH 1BXUA 2IADB 4YXKH 3VI3E 4FNQA 2K70A 4K3GA 3ZDXF 1E8YA 1NPUA 1DEEB 4MNGA 1AD0A 1X5ZA 2CK0H 4HSQA 4JJ5A 3FHEA 5T3XL 1CDBA 1W0WA 3KHQA 3LKSA 1OLZA 3MMEA 5EC1A 4LVNB 4HIXH 3P3SA 2Q86B 1OF2A 1KJ3H 3HKZA 1J1OL 3L1EA 1RQ5A 3ZQXA 2XZQL 5GGSY 3CFJB 4BZ1A 2RBLA 4PJHB 5BS0E 5E0FA 4WUKH 2VDLL 1OGAB 1S7WB 2P5EB 3FSWA 4KVNH 2P44B 1E7VA 5HHOE 2GUOB 4BSVB 1ZXQA 4CVZA 4Z8FH 3L17A 4WV1B 3OV6A 6FABH 1ZD6A 1UA3A 1T1YB 1IFGA 4TL5A 3T8XA 5C3TA 5GS2H 5F0PB 3T6QC 3V6OE 2FIKB 2OTUB 2XQYA 3D2TA 4JRYA 4QRPB 5D7SL 4EUPB 5IQOA 1QATA 3HS0C 4FYSA 5BQ7B 2QMJA 5MP6H 4UTBL 1MAMH 4FRWA 4QRTA 3SE9L 3MN8A 3OR6B 1MVUB 3FUMA 4JCLA 3ZE1F 1I8UA 4AGMA 5EORH 4Y4FA 1C12B 3GXUB 4IGBA 2DWEB 3EBHA 5IG7B 4HDIB 2VDOB 3BD4A 1M6OB 4RGNC 1JFQL 3EOAB 4Z9KB 1CTNA 4DH2A 4P49A 2N1KA 5KSUA 3KE0A 4BSWA 4BYHA 1MF2H 4QRAA 5K1JA 4KKBC 4QTHA 4ES8A 1NC4D 4N6RA 5FCUL 4AQAB 2HMIC 2DLGA 1T7YA 4HA1A 5DWPA 3QDJA 3Q7JA 3VW3H 3P9WB 4QWWC 4AJYV 4YSCA 1RU9H 1YMME 4PJXE 5KVDL 4HH9B 1F90L 3MRJA 2GT9B 3AC0A 1BFVL 5JW4R 3MO1B 4FF9A 2XWTB 2QKSA 3DMMB 2VXQH 2X2IA 2BVOB 4FKKA 4IU3A 4DZBA 4C58B 1UWYA 1WBZA 2OMXA 1UYWL 4M7ZB 4QYOB 3FQUB 3ZTDC 4APQD 4Q2ZB 4DO5A 3CK0H 2A6IB 3ZL2A 3HBQA 3L7EA 1EHAA 4JFSA 1JWMA 2WPGA 1JZ6A 1MWAB 1MW2A 1Z9PA 1CXLA 2IGLA 3MRGB 3EFFA 2J57A 3OXRB 4N0UE 2CBTA 3VGGA 3FW6A 3QRFM 2CGRL 3FTGB 3ERXA 1MRFH 4J3OH 3FQTA 4JZOA 1YJDH 2VDKB 3T2PA 3B6SB 2BNQB 4ZXBC 4H8WH 1D7BA 1J87A 3C60B 4TKWA 2ZPKH 1CPUA 2EEDA 3IFNL 1WFJA 3EYUL 1MHCB 5DUMH 1GGYA 3DXAD 5JHDE 2UZXA 4XAKE 3LZLA 2EIBA 3ISWA 1M3IA 5IJKA 4HBQA 2DIEA 1LDPH 3NP4A 5C2BL 3WDHA 5IGXH 1M1XB 2O6EA 2VCOA 1CK0L 1ZT4A 2NXYB 5INCA 1NBQA 1F3RB 2ZX6A 4Y1TA 3S35L 3NH7H 4GKZA 1FG2A 4NO0B 5A2AA 4APXA 4JN1L 3E8VA 2WOYA 4MQ7A 1QR1B 3ZYIA 2UY6B 4PJ9C 3JV5A 1YNKH 2OP4L 4F7KA 1BFSA 3MX0B 2C9XA 2VXUL 2BLFA 3LV3A 1GHFH 4YIQB 5GJSL 4Z18A 3GSRA 4K5PA 1M7IB 1R1CA 5F3FA 5JQ6H 1SY6A 1P1ZB 5E2JA 4I7ZC 3L3GB 3PWVB 4MLSA 3BPNC 4XP6L 3WFDH 3VXUE 3E6FA 4RMUA 2CRYA 2IF7A 4UILL 2AK4B 1I1AD 2WYTA 4AGQA 4BKTC 4Z7AA 4TSBL 3F01A 4HPYL 2KZ1B 1WS8A 1QRKA 3EJJX 2ADIB 1JRHL 2B1AH 2GTWB 4LCWB 4MA1B 1V27A 4D0DB 1SVBA 1WZMA 1TTFA 3P0VL 2X40A 1AQMA 4G6AC 3NSDA 2CCWA 3TT1H 4AVHA 2LAGB 5IMOB 4JPKH 4OZ4B 3GJFA 5T8IA 3IGFA 1EXGA 2KLSA 4AYDC 4DF9A 4B9JA 4PTUB 4AH2A 3KS0J 4FJZA 1UFUA 3ULVH 3O45B 1LHZA 2AJYL 3IRPX 5DJXB 1ZV2A 2OPCA 3IU4L 4ES9A 2HTKD 3FCSA 3GMPB 5AL8A 5EU6A 1GMIA 5IVXB 1P7QD 4M56A 4UB0L 4G43A 3F58H 3CFCH 1TEYA 3FRPB 3VMOA 2GYSA 4B60A 4PD4K 2EE3A 3QG6B 3T2QA 1S7UB 5IFHH 1IEBA 2F7PA 5D1XD 4P4RA 4PB9L 3VI4F 4HT1L 1BQHB 3VXMA 2IAAC 5AKTA 4BXVA 3QCUL 2MCAA 1AI1L 1YY8B 4M4PA 1JHLL 3CDCA 5FCSH 4X0KA 4P2RA 5CZRA 4K3EL 2HFFB 1U8MB 3S4SG 1YEKH 1RCYA 5EZJB 2DH3A 1VFBA 1CXEA 3SQOL 4BWTA 4HBCL 4IMLB 4P5KA 3SO3B 5KYXA 1JDCA 2VUKA 4W93A 2C9UA 2WXMA 2YAOA 1HEJC 1S7VA 4Q74A 4KZEH 2AABH 5HGBA 4GW5B 3KPSD 4DP5X 1A22B 1AGCB 3ETTA 1GC1C 4MNQB 2LQRA 5J9PA 2R1XA 3ZTCC 4ZMLA 4XXDA 5TK2A 1GZHC 5EU5B 2YUXA 1WIOA 2CIKA 1Q0XH 4PRIA 5AVRB 5G4OA 2XBZA 2BY3A 5C07B 4J3WA 3WELA 4FJ6A 5DVNA 2ERJB 4N22A 1KENL 5E6IB 3D52A 4HWBH 3POCA 2AV7B 1O6VA 4TF4A 1RPUA 5KWYC 4LPTA 4ZNCD 3C6LB 4P46D 3ARFA 1EJOL 4MA1C 3QUMB 4JPVL 4P07A 4NP4H 1V5JA 4JO1L 3CFTA 3UC0L 1EFXB 4L2YA 4WHCA 3UDWC 4E5XB 1WAAF 3CFQA 2CDFB 2P4AB 2OSYA 3TS8A 1MH5B 2YQBA 4W70A 1J5HA 4F5CA 4ABWA 1TQSA 3V9FA 1FO0A 2XVLA 1BDYA 3ZTNL 4LHUG 4NQDB 5HDLA 5TPWL 4OLXL 2OTWA 4BQ8A 1T03H 1TVBA 2FL5A 2MEJB 1P1VA 3UTQB 4WUUA 5E56A 4DN4L 4HUWB 2ESVA 3ZT6A 5I71B 5KSBA 5D7LD 2CLVA 4DO4A 2VNCA 1IE5A 2FJHA 1F00I 2F1EA 3OJDA 3GBMH 3HIZA 3NT0A 5ID1B 3LIUA 2G2PA 3F2LA 1XIWB 2A74C 3K74B 3AUWB 2NY1B 3EO1A 3Q2NA 3PWJA 1KBVA 1P7BA 1U21A 2C3XA 3QUYB 4K23L 5A2IH 5FHBL 1A1MA 1RUQH 4HFWA 4ETYA 4Z78A 3FQ1A 3QXTA 4HCRA 4P2QE 2GY5A 3ETBF 4FZEH 5LAXB 2DWDB 4JL1A 4XTRD 4LL9A 2FQEA 1RPKA 1XD0A 3ARXA 1K4DB 3K6FA 4QXGL 5E8EA 2QQKL 1IFRA 5CKAA 3CXHJ 4YHMH 4MA3A 1VERA 2C3WA 3ARGD 4XPGH 5GGTA 1CU4L 5LN8A 2NW2A 3TFBA 4P99A 3KBEA 2WXKA 3OR7A 4RGND 2HLAA 1LNUA 3VVWA 3MRHA 3DX7A 3N2JA 4ORZC 2Q6WA 1DVFA 3D18B 4JN2B 4D8PB 5CEZD 4NQXA 1EHXA 2AQ2A 4RVBA 2A5UA 3OSVA 5CO1A 2HMID 1XDTT 3G9AB 2AJSH 4V1DD 3JWNE 4PQXA 2Q9OA 4AUJA 3QNXB 1TZ8A 2AGJH 2DMKA 3A21A 5ICYA 4AGPA 3FU5A 4UBDC 3RLSA 2KC0A 2F7QA 1AACA 2K45A 1AJ7L 2ZCKL 2XZCL 4PLJC 4QO1A 3VNZA 5HDQL 2Q2LA 1Q38A 1Q8MA 1AGFB 1IKOP 1P4LB 3ARDB 5E23A 1EAQA 1TNNA 2N59A 4MJ5B 4OJFL 3V4PA 5I71C 4Z23A 2ZZUT 2C5DC 3FT2B 2O6PA 3MLXH 2LU5A 1SJXA 2EJ1A 5DWUH 3HCVA 1JXKA 3QFJD 2IV8A 3SOBL 4OKVB 3ZHFA 4CN4A 1MW1A 4ODUB 1YY9C 5IB4A 3QI9D 2OMWA 2NY1C 6PAZA 4DFIA 3RL1B 3NG5A 5DGQA 1OE3A 2H9GA 2OLDA 1E3FA 3QJUB 4ZOBA 4I0PD 1SBSL 4OM0H 4OD1L 4WWKC 3MBXH 5DJ6B 1C5DB 1JPFA 1FWXA 5CD3A 3B4NA 2DF3A 2HKAA 3REVA 1C1EL 1BZ7A 2WM0A 2B1OA 3WOVA 2EZ0C 1WZ1L 5HGGS 1YEIL 2WJ7A 3T0WA 1O0VA 3O3DA 3RWDB 3U7YL 1U8CA 3TEYA 4JFEA 4QNPF 3DDGA 4ZBJA 3ETSA 5JIIA 1I85C 4PN6A 3N44F 4PWEA 2ZSVA 2OJZL 4HU8A 3MCLL 3KXFD 5I76B 1WFMA 3KDPB 3WIFB 5CEZH 2OYMA 4LOFA 3QEQB 5DRWA 4S1QH 3DUUA 3GB7B 1I4FA 1ED3B 1JNLH 3LQZB 1NKRA 1HIML 4PTTA 2PNDA 5CJXC 4EN3A 1S7RB 3MLTA 4H2CA 4HWZB 1IIIA 4HUUA 4RAVA 5HYSG 4WI5A 3A47A 4ABQA 4PJ9D 4HMEA 4XCNA 5DTFA 2W60B 4U0QB 2VXVL 2Y5TB 3QQ3A 4N0FA 4OVUA 3QJHB 4WQOA 1UACL 4LSSL 4PM1A 5E0QA 4A6YL 4M5SA 5SV4A 4PGEB 4X8JB 3IFPB 4FN0A 4J5VA 2J1YA 1B0IA 4N20A 5FUZH 4NT6B 5EBGA 1ID2A 5D93B 5I8KL 2XN9A 1PD0A 1XGUB 1D9KD 4UOZA 4FERA 3MLSH 3MNDA 2PN5A 5FX3A 1R5WB 2H3NB 2FECI 3FFCB 3ZYOA 5DD6A 4MX7B 2XNAA 1Z9NA 4HCRL 4M1GH 2D4FA 2HRLA 3HVDA 3DNKA 3BLKA 1HKFA 3UBHA 2ZG2A 2VZUA 1KPRB 4HOMA 3MV7B 1E8WA 1FH5H 4G6AD 3LX9A 1R47A 3TA3C 4BFBD 4EIZC 4FX5A 3PWUA 2VRAA 2IPKA 1ZVNA 1PCSA 1WG3A 3W5MA 1MCDA 4JKNA 1NOAA 1S5HB 1Y7VA 2PR4H 2Z1KA 5GGTL 3H9HA 3G6JA 2DQUL 2HVKB 4OLEA 4H8PA 1ZHNA 2ITDA 5E24E 1ZT1A 4NQVA 4HG4J 1M05A 1MJ8H 5KYWA 1VDGA 1AGEA 2W9LA 1FVEA 3BISA 5IQ9B 1DJIA 2VDOH 1MRCH 4OVVA 4LLYA 4NZ8A 4DW2L 4NJAL 3EW3B 1F6AB 1UOWA 4F7TB 3QDME 1BVKA 2NPLX 4ZSOA 5CUSL 3SDAC 3ZL4L 2DDQL 3VFOA 1KGUA 2FATL 2Y07H 1UWEH 4KOCA 3D3VA 3U7WH 3MGAA 1TZAA 2VLLA 4E9QA 3FCBA 2D7OA 2DS4A 4XT1C 4ZD3H 1GYCA 2JB5H 3KWWB 4X9GA 1PLAA 4XOAA 3CIAA 2NY0C 3LNGA 3T2NH 3IMBA 3LXBA 3V4PL 25C8L 1LWHA 1RHHA 4GP5B 3FB5B 3WSQH 2BP5M 1KLUB 2VDQB 1KN2H 3JVGC 2V5YA 3ILEA 1TQVA 4JB9L 4QTFA 2YPKA 1KSRA 1YYLL 3EJCA 4L2LA 32C2B 2XWBB 1FFNA 1ZKAA 2FNBA 4PAZA 2CLRA 3T0AA 2R59A 2VZ1A 3D25A 3KJ4C 4JO5A 3NVQA 7TAAA 4DETA 1GTNA 1R24B 4P3CH 5KYNA 4NLAA 4FQXD 2G5BB 1VJSA 4Z0BH 5HVGB 1CT8A 4XNZC 5DRNA 4QHPA 1KELL 2X1XR 4N2BA 1J9QA 3CZFB 2J6EA 1KG0B 2AMGA 2O1AA 1RZ7H 5DYOB 1XR9A 5A2BA 1XF3B 5CN1A 2X6UA 3SKOA 1TJIH 5IB5A 5IY5B 4OIBA 4LL4A 2VIRA 1T4KA 4JMNA 1AOHA 1FGVH 1DVSA 4ZOCA 5TE7L 3CG8A 1L9PA 4A7GF 5AFAA 2BWIA 4ZO7A 1Y0LA 2WLJA 2K7PA 3Q2CA 4W9LC 1NBVL 3L4WA 4N2DA 3VGHA 1YC7A 4AY0A 5I16B 1OSPL 2SEBA 1PLBA 3BDBA 1BXXA 4OT1L 2O93L 3WFHA 2DQGL 1NTDA 4MMXB 1PAMA 3HHRB 3M7OA 4R5XA 4Z7OE 2ZJSH 3LOWA 1UD2A 4R5TA 1LL1A 1ZLUH 4YSUA 1B4JH 4Q6YA 3CHRA 2Z4QA 4XCEB 1T89C 5EFIB 1GH7A 3L3JB 2YUVA 1GC1H 1OTUD 3BZEB 1YEHH 1FZKB 1NGXA 5EOCL 1ZVSA 2DD8H 2F9BT 1WAPA 2FWOB 3OGCB 1UWGH 4PG2A 3HN3A 2UX7A 5AVWB 4EVNB 4EZLA 1XGQB 4U33A 1X7QB 3VI3B 3FTSA 1EV2E 1DJSA 1RMFH 4R90H 3VU1A 4LKCB 1QLEL 2CDGA 4NHCH 3WFBH 3HRZC 1RUML 3F6IA 4F9PA 1IAOA 3O6FD 1YQVH 3IN0A 1MHPH 2VLJD 3NCYP 4FP8H 2WP3T 4J3OG 1IU1A 1NC4A 5ICZB 4Q6IB 5CEYB 4OAWA 2HYMA 1IC5H 2ZWYA 5BS0B 3IRZA 1GGIH 3GSVA 3TVMA 5C6WH 2ICWA 5CCKH 1SYSA 5DD1H 4JZNA 4ODVL 4A1RA 2GSMB 2CG9X 1ZLUK 1LO3L 4P8QA 5HHOB 4P59H 4PJGA 5IW1A 4UBDD 2G0KA 1MCSA 1BAFL 1II4E 1R3KA 4YDMA 1PKOA 5JW3L 2JJWA 4APQA 4ZAKD 2K9FB 1NM9A 3WTVA 2VZOA 3QC5X 3HI6H 4WUKL 4WHTB 4KVNL 4D7BA 1Q0YH 3WIIH 1P5VB 1SXZA 3KBPA 3QRGH 5EO9A 6FABL 4PWGA 1KT2A 3LYRA 1AKJD 2Z31D 5E6SB 3UBXB 5KYYA 2P8LA 1Q94B 2E7MA 5CGYC 5F97E 5KG9B 2BVEA 3N43F 1OP3H 1CDCA 2FZ3A 2DW5A 5C2UB 3QP3A 5IMLA 3LHPH 1SN0A 1EX0A 2DBJA 3PIQA 4NQEA 3R7QA 2P43B 4OFYD 1QABA 4FFWC 3ZOAA 2ZUSA 2D73A 3IDYB 3QUXB 1MAML 4N8CL 4WWKD 1EZVX 1QTSA 3WKPA 1HOCB 2EYRA 2C4XA 2MHAB 3FOLB 5IKCA 1YHPA 3DXAA 2XKUA 3II2A 5DUBA 4PJXB 3SPJA 3DA0A 4AQZA 3EYSH 3GUTA 2P7TB 5AG9A 2PWDA 3E0GA 1I9RL 4QRRB 3KYOA 3PQYE 4Z95L 2OYPA 2W91A 2EH8H 3EZJB 4QT5B 1NC2D 1ZIAA 2BMKB 1JF6A 2R1YA 4XNXH 3MV9D 5EF2A 4HIEB 3SD5A 3ES6B 2YJLA 5D7IF 5A2JH 4Q6IC 5BRZA 3SYCA 1RU9L 2X2UA 1A7NH 2Z4TA 3LXCA 1TPXC 4Y4HB 5AW0B 5FDWA 5I8CB 5IHLB 4G9FD 1HJBC 1CICA 3GGWB 4ISVA 5AVUB 3DIFA 1OP3K 4N0UB 2YN3A 3TGXA 2ADFH 1JPEA 1V7NL 1N10A 3H9SD 4H1LB 4NM4H 1KY7A 5DZOA 3D85D 5JZ7C 1DQJA 2AAVA 4NOFA 1DL7H 4LVOB 1K9TA 4WFHD 3BEWB 4PJDA 3D39E 2BOCB 3S48A 2EADA 3DPBA 1I1AA 3KPOA 5D2LA 4JBSA 3UACA 2QVIA 1A7OH 3ZHDA 2ZTBA 5G5DA 2VQTA 4H8WL 5HJBA 5I1CL 3M46A 1ILUA 4ORGB 5E4IA 4X4ZA 4MJ2A 4YDLC 1V3JA 4JQVA 2FAUA 2XWCA 3V95A 3TA3D 5DUML 1PJ9A 4L8DB 4PJFA 4U3XA 1QI4A 3W1ZA 4XR8C 1TR7A 3W39A 4LXFA 1LDPL 3QZWG 1U8PB 1B90A 3V0IA 1S7QA 1P7QA 3WDJA 2AQ3A 4X5XA 1QLRA 4B53A 1E2VA 2P9RA 1AO7D 3T1WA 3DIDA 4J6RH 4NKIH 1ETB1 4N8VG 5D1XA 4G1MB 1DBBH 1UB6A 3CFEB 4N68A 4G6FB 3L3OB 5FM4A 4QRBA 5KZCB 3F04A 3QO0B 3OLDA 5TDPA 3WG7B 1NA8A 3I6LE 5GS0C 2NY4D 5AB9A 4I77L 4YDJA 3SDAD 3NFPB 4Y4HC 2B5IB 2WWOA 3DX9A 3TT3H 1GHFL 2QPEB 3LN5B 3MRIA 1HZHH 3EOTH 3GSUA 5HJ3B 1JIBA 1A6ZA 3SJVD 5JQ6L 1XZ0B 2NY0D 3EYFA 4XCFL 5FW8A 3RFRA 2ADJB 1J18A 1CL7L 3KPSA 4MS8D 2WTRA 3C87A 4J7RA 2ZD0A 3CSPA 4LF3B 2B9BA 4PJ5D 5I8OH 3K2UH 1CURA 4PJAA 2B1AL 2GITA 5DFWH 2IH3B 5D7JD 1XX9C 4S2SB 5CJOL 2Z34A 4PHZA 2F58H 4RNRA 4JPKL 1UM4L 2W0KA 4P46A 4WU7B 1R3IH 1FYTA 1XL6A 4MWFB 1HINH 1N67A 2GJ6E 2X4QA 4OZIA 1VB9A 1BXVA 1XF1A 1K4CB 1FNEA 2IWEA 2BIMA 1RJYA 3TPUA 1GPOL 3TASA 1ACXA 1IBYA 3KL0A 1GGTA 2ZONA 3IS1X 3MJ8A 2EKSA 1XH0A 1NWOA 2XIBA 1RV6X 3B1UA 3QDGA 2CIIA 5JW5A 4PLNC 2XQ0A 1UD5A 4WNSA 3W9DA 2F53E 5IJCC 3OJVC 4AL8C 3S36X 5D7LA 3LKOA 1YEKL 2ITFA 2P80D 4YS4A 1BD2A 3QZLA 2AEQL 4GP4B 3V4VB 1D6EA 4BHUA 5DSCA 4X5PA 1GVIA 5DA0B 3ZPDA 3MOBH 4KZEL 1HILB 3TNNB 3EG9B 4U1KA 1UENA 3H3KA 1NDTA 2F18A 2NXZB 5CWSA 1DQQA 3GHPA 3WHE1 5EU7C 1IVTA 2CO6A 2D7TH 3UPCA 1Q0XL 4J3TA 4MBRA 3AT8A 4UZGA 3TWCH 4JEGB 1VFAB 2TAAA 4GS7C 4D0CB 4QHLB 4R8WH 5C8JA 1U58B 1ORQB 3DI3B 3MUY1 4ZUTB 5HTSA 3UTSE 5KANI 1LLAA 3O3AB 1VACA 1K85A 1QW8A 3ARGA 5HYJD 3RGVC 3MOAL 3L95A 2Z7WA 2Y5QA 4BK4A 4OY9A 5FEBA 4MD4A 5GIRA 1AZVA 1GZPB 43C9B 4F7EB 5HHME 2JKXA 2AJXL 4EEEA 4UM8A 4F33B 1F6FB 4V1DA 2DQFA 2H32H 4XNMB 4XE0A 4ZMXA 1SXBA 2ZUUA 3QIUC 4QOKA 2X10A 4LAJH 2BVQB 3GZOA 3L9BA 2HKHH 1RPQA 2XRAL 4LLMB 1P4BL 3VFMA 4P2QB 1MI5E 1FNSL 3X11A 2X44D 1HYSC 1ASOA 5CU5A 3E9UA 4JRWA 3F84A 3WN5A 2ORBL 5AALA 1DSFH 1IGMH 2VXTH 5L4IA 1O9ZA 1RUQL 1SXNA 5I74C 3DJSA 3GXIA 4PRPA 3T6WA 1C08B 5E9NA 3QI9A 1H5BA 2VDPB 5E1IA 3L54A 3O8XC 2W1NA 5LVEA 2R69A 3F83A 3C9NB 2I27N 4I0PA 5JHAA 4JFDD 4JZJB 4ALAC 1RZ8B 3NCJL 2NY3B 5AOJA 4CVXB 4CU7A 2D0FA 4YC2C 2ENQA 4YHLH 1EH9A 4NN6C 4XPGL 1MFCH 1EGJH 4Y16A 3S2AA 2KHAA 1WBYB 3RWCB 4MJ6A 1SM3H 4DERA 2FLRT 4RQQB 3OQRA 35C8L 3QXWA 4XPTL 3TNMB 4AX3A 2BNRD 4E9XA 1A6AB 1QPXA 3OZKA 3P11H 3SBQA 2YAMA 3HMXA 3GJEB 3KXFA 3FO1B 5EIIB 2AJSL 5L7XL 1RIVH 1HL8A 1NICA 3DOSA 3BGFC 2AGJL 1HHIB 3T2LA 1UADC 4H44C 1WRFA 4RIRA 3UAJA 2EEAA 4CBPA 5JORA 1QWNA 3MRRB 5MEPA 3V2AR 4GFXA 4RZCA 1S9KC 4KY1L 2XU9A 1MJ7H 4H26A 1JN6B 1YYCA 2K78A 1A6PA 2BERA 4DVRH 2QFPA 5M95B 1Q1PA 4FQ2H 1P53A 3V5HB 4X6FB 4LBEA 5DHXB 1YSOA 3C12A 2WZ5A 2QQNH 2Z65C 3ZLQC 2A83B 3DGGB 3OKOA 3B9KC 5FAAA 3D1MC 3KAAA 1D9KA 1MZZA 5E6YA 5LGJB 4Z5RA 2XV0A 3JV6B 4KAQH 3EO0A 4NNYA 4BFEA 5HGAB 2CUAA 5FYKU 5K9JH 5JDSB 1VZIA 1Y18B 3MBXL 1M53A 1GMEA 1XF5B 2C3VB 4LCUB 1S7XA 4NHUB 1CDYA 2YSTA 4ZQKA 4GAJH 5I8EA 1UCBH 4FHKA 3QUZD 4JZJC 1IJNA 3CFBA 4NX0A 5J4MA 2CKBH 2F0CA 3IDMA 5IHWA 5T1KA 4DP4X 3G08B 2FQFA 1UJTA 4XZUB 3SE4A 4CVUA 1HNYA 3ARBC 4XOBA 4I89A 3TIDA 3TP4A 4C8XA 3BQUB 4HWEL 2NZ9C 3OWRA 4HIHB 5CEZL 1KGJA 5IB3A 1QRNB 4H8UA 4UOJA 5D1QE 4AUYA 4EN2A 1RFDH 4LLWA 1JNLL 4AQ1A 4R2GB 3OKNB 4YHZH 5D71L 1FNGA 5JHLA 5H35A 12E8L 1FC2D 3RPIB 4F27A 5HVHB 3R19A 3Q0HA 5HDRA 1B0RB 1B3JA 4IOIB 2OXGB 3NMEA 1U36A 4HGWA 3AWGA 1W72A 4JFOA 1CF8H 1BX2A 2IMNA 4JDVB 4WJ5A 2GSIB 5BVJB 5IB1B 3SGEH 4QHMA 3M7FB 1AAJA 1TU2B 3HHSB 4FG0A 1NKOA 2HJKA 3W2DH 4BWWA 3HI1B 1E42A 4K7PY 3T6XA 3F05A 4DEPB 2X0WA 1IAKA 4G8IA 1J8KA 3HOGA 2DWYA 5MI0B 3WTTA 2XPGA 4QEGA 5B8CC 4M1GL 4I85A 2OAAA 4PIBA 4N0YH 3VG9C 1CTOA 3IVKB 2B9AA 3A4AA 1BREA 4G5ZH 4JKPL 1E28A 1BF8A 5EB9A 5TE4L 4FQXA 1WITA 3ESUF 3G9VA 1LO4H 3VRIB 2KS0A 3QDMB 2Z8VC 3MPCA 4XNQB 3DSNB 3F5WA 1WEJH 4HUCA 3ARPA 4X4XA 1UKSA 1MJ8L 3GQFA 2CE6A 2RQEA 2UX6A 1YCSA 5IROD 4WNQA 4Z3TA 3F7PC 3OG6B 5SV3A 1XTLA 3KYNA 5GRWA 4MYWB 1RSFA 2OQJA 4P23C 1NIEA 3A6OA 2V17L 3K0YA 4YHYB 2Y07L 3GMOA 2IOIA 2L7JA 1QFUL 1UWEL 1CF1A 1HH9B 2DQTH 3MSPA 3R0MA 4WFEE 1ETJA 5B38B 5GS0H 4OD2A 1BIHA 4ANXA 2J1WA 4GYBA 4NZTH 3VUAA 5E8PA 5D4QA 4HLEA 2JB5L 1KBBA 5HVHC 1CLVA 3L81A 2BWQA 4Y8AA 5CLTA 4AIEA 2E7LC 2JWYA 3JZYA 5AYQA 1JZ2A 1Q9LB 2JJUA 2NY6D 1KN2L 4JO3H 1OVZA 4EI5B 4EZJA 4BH7B 1T21B 4GG6E 1NINA 1KGIA 2C3HA 4C56E 4BFNA 1ZS8B 3UJIL 5BNXD 1YAIA 4YHNA 4DEPC 1F4XL 4EQ2A 2GCYA 5GGRB 4FQQA 4H25B 5I5RA 4OZFB 2R23A 2X42A 5CLWA 5ESQA 5CFAA 3IAPA 3CVDA 3IDIA 1ZHLA 1U92A 4JFYA 2QV2A 1NEZG 3RGVD 1TVHA 3PHQA 3O6FA 2WZPD 6TAAA 2AAAA 2BDNH 2MIZA 4U1GB 5DDHB 5CP3A 4Y88A 5I1EL 1RZ7L 3H55A 1IGIH 1LE9B 1EBPA 3IPFA 2X4UB 1MLBA 4KQ4L 2O5ZL 4YDZA 3TA4D 4Y9GA 3D08A 2J8UF 5TQ2L 4F57L 4UV4H 3IJHA 4Z7OB 4GBXB 2XICA 5BZXA 3TEUA 1HU8A 1WD9A 3HZ3A 5F70A 1X9QA 2WO3B 2ZCLL 1Q9KA 4PY7B 5JHLL 4J4PD 4XNUH 2WMPB 3CXFA 4AL8H 3NJFA 2XC8A 5JXED 4PY8I 3U6RB 4ZAKA 2C9QA 1HYSD 3OVUB 1W72L 1NCGA 2RH0A 4IRSD 4K71B 4PSRA 1DQIA 2EXWC 1CIDA 2ENJA 4R4ND 3VGBA 1TTGA 4HSCX 1R3JB 3A3YB 3NJHA 1JS4A 4BFJA 5EOCJ 1AKJA 1NMAL 1KGCE 4G8FA 1VADA 5C0AA 4MD5A 3KZ8A 4PJBA 3QAZB 3O8XD 2ZXAA 2P48B 1LMIA 4MNHA 4OFYA 4W9IC 4PREB 3L1OH 5EN2B 4KKZA 2AQTA 3WJMB 4U2ZA 1FHNA 3WFBL 1UXSA 1DYZA 2Z3FA 1E27B 2WO4A 4NENA 3CFIC 3GLAA 1YQVL 2FHFA 3X1NA 1MHPL 3OF6D 4FP8L 1SPDA 4Y5YB 5K9QI 3K71B 3CLFL 4QAWA 1NC2A 1E6OL 4IRJD 1NBYA 3MR9B 2ZWKA 5DD1L 3ULAB 1KLGB 4B9CA 5T5FA 2K8MA 5EUOA 3ORJA 4P59L 1DQML 4DGIH 1H8LA 3EBGA 2LT9A 3SE8L 4R4BB 2EIKB 3NZHH 4ONFH 5JXAL 2WV3A 3TO4A 3V52H 4F7MB 5JOFA 1IGYB 4KNQA 4GBXC 4FFZH 2Z91B 5CP7A 1KTJA 2EDKA 2IEPA 2XJKA 3PWLA 3GRWH 3F7YA 3H9SA 1K3IA 2P5WD 5DJCA 4Y4KD 3D85A 4L4VE 1IKNC 2ZOKA 3BLBA 3HI6L 4X5WA 4LCCC 5C08A 4DP7X 5FM5O 3LRGA 1OW0C 3OKDA 3W56A 1G6RH 3GRBA 3O3EB 4B50A 1BHGA 1W16A 3VI4A 4MXQC 1I9JL 3QORA 2DLEA 2YPLD 3HPJA 4I18A 3N0AA 2YAEA 2BS9A 1OY3B 3WDIA 3LHPL 3FUDA 3DX8A 3VD7A 3OHXB 1RK1A 1CQKA 2AXGB 3PQYB 2YXMA 2Y72A 5CBAA 2NNCA 3H3PH 3BPOC 2X28A 2X3BA 4GMTH 4HS8H 3HNVH 1RIUH 4N2CA 1UEMA 4KRPB 4UQAA 3RZCB 5JOEA 5L6YH 4PS7A 1ADWA 3NA4A 4ALAH 4UNUA 5FYJE 3RY4A 3U0WL 3EHBB 3FQWB 2VN7A 4GB9A 2ZICA 3E38A 5C92A 4GI6A 2PWEA 5FA4A 5B21A 1XD1A 3EDEA 3ARBD 2OMVB 2Y3AA 1G7MA 2EH8L 5JYMA 5LNEA 2PW1B 1AO7A 2R4SL 3ASOB 4KKLD 4KX7A