3FQ6A

The crystal structure of a methyltransferase domain from bacteroides thetaiotaomicron vpi
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
NATAFVPALVASGLPNEKFCFEGFLPQKKGRQTRLKALAEEHRTMVFYESPHRLLKTLTQFAEYFGTERQATVSREISKLHEETVRGSLAELIEHFTATEPRGEIVIVLAGIDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of a methyltransferase domain from Bacteroides thetaiotaomicron VPI
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase
molecule keywords Methyltransferase
total genus 26
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 3fq6A00
2E07A 2DV3A 2YBOA 2E8QA 2E17A 2PB5A 2E0NA 2EGBA 2EL1A 2P6KA 2HUXA 2DSIA 2DSHA 2E15A 5HW4A 2EEQA 2PCIA 2NPNA 2E8HA 2DXXA 2EMUA 2P6IA 2EL0A 4E16A 2ELDA 2P2XA 1WDEA 3I4TA 1CBFA 2Z6RA 2EGSA 2DV7A 1PJTA 3KWPA 2P6LA 1VCEA 1VHVA 2BB3A 3FFYA 2ELEA 1WNGA 2PCMA 2PB6A 2PCGA 2P9DA 3ND1A 2EH2A 2EL3A 1S4DA 2DSGA 1WYZA 2E4RA 2EJJA 2E16A 2HUVA 2PB4A 2EK4A 2OWUA 2EH5A 2E08A 2HUQA 1VE2A 2YBQA 2P5CA 2OWFA 3NUTA 2E0KA 2E8SA 1VA0A 2ED5A 2DXWA 2EL2A 2HUTA 2HR8A 2EHLA 2ZVBA 2ENIA 2E4NA 2EK2A 1PJSA 2ED3A 2OWKA 2DXVA 2E7RA 2CBFA 3NEIA 2ZVCA 2EGLA 2EK3A 2DEKA 2PCHA 3FQ6A 2OWGA 2EH4A 2DV5A 1PJQA 2QBUA 2P6DA 2EJKA 2EKAA 2EN5A 2P5FA 1V9AA 2OWVA 2EJZA 2EHCA 2EMRA 2PCKA 3NDCA 2E8RA 2EK7A 2PCAA 2DV4A
chains in the Genus database with same CATH superfamily
2E07A 2DV3A 2YBOA 2E8QA 2E17A 2PB5A 2KYYA 2E0NA 2EGBA 2EL1A 2P6KA 2HUXA 2DSIA 2DSHA 2E15A 5HW4A 2EEQA 2PCIA 2NPNA 2E8HA 2DXXA 2EMUA 2P6IA 2EL0A 4E16A 2ELDA 2P2XA 1WDEA 3I4TA 1CBFA 2Z6RA 2EGSA 2DV7A 1PJTA 3KWPA 2P6LA 1VCEA 1VHVA 2BB3A 3FFYA 2ELEA 1WNGA 2PCMA 2PB6A 2PCGA 2P9DA 3LMMA 3ND1A 2EH2A 2EL3A 1S4DA 2DSGA 1WYZA 2E4RA 2EJJA 2E16A 2HUVA 2PB4A 2EK4A 2OWUA 2EH5A 2E08A 2HUQA 1VE2A 2YBQA 2P5CA 2OWFA 3NUTA 2E0KA 2E8SA 1VA0A 2ED5A 2DXWA 2EL2A 2HUTA 2HR8A 2EHLA 2ZVBA 2ENIA 2E4NA 2EK2A 1PJSA 2ED3A 2OWKA 2DXVA 2E7RA 2CBFA 3NEIA 2ZVCA 2EGLA 2EK3A 2DEKA 2PCHA 3FQ6A 2OWGA 2EH4A 2DV5A 1PJQA 2QBUA 2P6DA 2EJKA 2EKAA 2EN5A 2P5FA 1V9AA 2OWVA 2EJZA 2EHCA 2EMRA 2PCKA 3NDCA 2E8RA 2EK7A 2PCAA 2DV4A
chains in the Genus database with same CATH topology
2E07A 2DV3A 2YBOA 2E8QA 2E17A 2PB5A 2KYYA 2E0NA 2EGBA 2EL1A 2P6KA 2HUXA 2DSIA 2DSHA 2E15A 5HW4A 2EEQA 2PCIA 2NPNA 2E8HA 2DXXA 2EMUA 2P6IA 2EL0A 4E16A 2ELDA 2P2XA 1WDEA 3I4TA 1CBFA 2Z6RA 2EGSA 2DV7A 1PJTA 3KWPA 2P6LA 1VCEA 1VHVA 2BB3A 3FFYA 2ELEA 1WNGA 2PCMA 2PB6A 2PCGA 2P9DA 3LMMA 3ND1A 2EH2A 2EL3A 1S4DA 2DSGA 1WYZA 2E4RA 2EJJA 2E16A 2HUVA 2PB4A 2EK4A 2OWUA 2EH5A 2E08A 2HUQA 1VE2A 2YBQA 2P5CA 2OWFA 3NUTA 2E0KA 2E8SA 1VA0A 2ED5A 2DXWA 2EL2A 2HUTA 2HR8A 2EHLA 2ZVBA 2ENIA 2E4NA 2EK2A 1PJSA 2ED3A 2OWKA 2DXVA 2E7RA 2CBFA 3NEIA 2ZVCA 2EGLA 2EK3A 2DEKA 2PCHA 3FQ6A 2OWGA 2EH4A 2DV5A 1PJQA 2QBUA 2P6DA 2EJKA 2EKAA 2EN5A 2P5FA 1V9AA 2OWVA 2EJZA 2EHCA 2EMRA 2PCKA 3NDCA 2E8RA 2EK7A 2PCAA 2DV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E07 A;  2DV3 A;  2YBO A;  2E8Q A;  2E17 A;  2PB5 A;  2E0N A;  2EGB A;  2EL1 A;  2P6K A;  2HUX A;  2DSI A;  2DSH A;  2E15 A;  5HW4 A;  2EEQ A;  2PCI A;  2NPN A;  2E8H A;  2DXX A;  2EMU A;  2P6I A;  2EL0 A;  4E16 A;  2ELD A;  2P2X A;  1WDE A;  3I4T A;  1CBF A;  2Z6R A;  2EGS A;  2DV7 A;  1PJT A;  3KWP A;  2P6L A;  1VCE A;  1VHV A;  2BB3 A;  3FFY A;  2ELE A;  1WNG A;  2PCM A;  2PB6 A;  2PCG A;  2P9D A;  3ND1 A;  2EH2 A;  2EL3 A;  1S4D A;  2DSG A;  1WYZ A;  2E4R A;  2EJJ A;  2E16 A;  2HUV A;  2PB4 A;  2EK4 A;  2OWU A;  2EH5 A;  2E08 A;  2HUQ A;  1VE2 A;  2YBQ A;  2P5C A;  2OWF A;  3NUT A;  2E0K A;  2E8S A;  1VA0 A;  2ED5 A;  2DXW A;  2EL2 A;  2HUT A;  2HR8 A;  2EHL A;  2ZVB A;  2ENI A;  2E4N A;  2EK2 A;  1PJS A;  2ED3 A;  2OWK A;  2DXV A;  2E7R A;  2CBF A;  3NEI A;  2ZVC A;  2EGL A;  2EK3 A;  2DEK A;  2PCH A;  3FQ6 A;  2OWG A;  2EH4 A;  2DV5 A;  1PJQ A;  2QBU A;  2P6D A;  2EJK A;  2EKA A;  2EN5 A;  2P5F A;  1V9A A;  2OWV A;  2EJZ A;  2EHC A;  2EMR A;  2PCK A;  3NDC A;  2E8R A;  2EK7 A;  2PCA A;  2DV4 A; 
#chains in the Genus database with same CATH topology
 2E07 A;  2DV3 A;  2YBO A;  2E8Q A;  2E17 A;  2PB5 A;  2KYY A;  2E0N A;  2EGB A;  2EL1 A;  2P6K A;  2HUX A;  2DSI A;  2DSH A;  2E15 A;  5HW4 A;  2EEQ A;  2PCI A;  2NPN A;  2E8H A;  2DXX A;  2EMU A;  2P6I A;  2EL0 A;  4E16 A;  2ELD A;  2P2X A;  1WDE A;  3I4T A;  1CBF A;  2Z6R A;  2EGS A;  2DV7 A;  1PJT A;  3KWP A;  2P6L A;  1VCE A;  1VHV A;  2BB3 A;  3FFY A;  2ELE A;  1WNG A;  2PCM A;  2PB6 A;  2PCG A;  2P9D A;  3LMM A;  3ND1 A;  2EH2 A;  2EL3 A;  1S4D A;  2DSG A;  1WYZ A;  2E4R A;  2EJJ A;  2E16 A;  2HUV A;  2PB4 A;  2EK4 A;  2OWU A;  2EH5 A;  2E08 A;  2HUQ A;  1VE2 A;  2YBQ A;  2P5C A;  2OWF A;  3NUT A;  2E0K A;  2E8S A;  1VA0 A;  2ED5 A;  2DXW A;  2EL2 A;  2HUT A;  2HR8 A;  2EHL A;  2ZVB A;  2ENI A;  2E4N A;  2EK2 A;  1PJS A;  2ED3 A;  2OWK A;  2DXV A;  2E7R A;  2CBF A;  3NEI A;  2ZVC A;  2EGL A;  2EK3 A;  2DEK A;  2PCH A;  3FQ6 A;  2OWG A;  2EH4 A;  2DV5 A;  1PJQ A;  2QBU A;  2P6D A;  2EJK A;  2EKA A;  2EN5 A;  2P5F A;  1V9A A;  2OWV A;  2EJZ A;  2EHC A;  2EMR A;  2PCK A;  3NDC A;  2E8R A;  2EK7 A;  2PCA A;  2DV4 A; 
#chains in the Genus database with same CATH homology
 2E07 A;  2DV3 A;  2YBO A;  2E8Q A;  2E17 A;  2PB5 A;  2KYY A;  2E0N A;  2EGB A;  2EL1 A;  2P6K A;  2HUX A;  2DSI A;  2DSH A;  2E15 A;  5HW4 A;  2EEQ A;  2PCI A;  2NPN A;  2E8H A;  2DXX A;  2EMU A;  2P6I A;  2EL0 A;  4E16 A;  2ELD A;  2P2X A;  1WDE A;  3I4T A;  1CBF A;  2Z6R A;  2EGS A;  2DV7 A;  1PJT A;  3KWP A;  2P6L A;  1VCE A;  1VHV A;  2BB3 A;  3FFY A;  2ELE A;  1WNG A;  2PCM A;  2PB6 A;  2PCG A;  2P9D A;  3LMM A;  3ND1 A;  2EH2 A;  2EL3 A;  1S4D A;  2DSG A;  1WYZ A;  2E4R A;  2EJJ A;  2E16 A;  2HUV A;  2PB4 A;  2EK4 A;  2OWU A;  2EH5 A;  2E08 A;  2HUQ A;  1VE2 A;  2YBQ A;  2P5C A;  2OWF A;  3NUT A;  2E0K A;  2E8S A;  1VA0 A;  2ED5 A;  2DXW A;  2EL2 A;  2HUT A;  2HR8 A;  2EHL A;  2ZVB A;  2ENI A;  2E4N A;  2EK2 A;  1PJS A;  2ED3 A;  2OWK A;  2DXV A;  2E7R A;  2CBF A;  3NEI A;  2ZVC A;  2EGL A;  2EK3 A;  2DEK A;  2PCH A;  3FQ6 A;  2OWG A;  2EH4 A;  2DV5 A;  1PJQ A;  2QBU A;  2P6D A;  2EJK A;  2EKA A;  2EN5 A;  2P5F A;  1V9A A;  2OWV A;  2EJZ A;  2EHC A;  2EMR A;  2PCK A;  3NDC A;  2E8R A;  2EK7 A;  2PCA A;  2DV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...