3FQ6A

The crystal structure of a methyltransferase domain from bacteroides thetaiotaomicron vpi
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
NATAFVPALVASGLPNEKFCFEGFLPQKKGRQTRLKALAEEHRTMVFYESPHRLLKTLTQFAEYFGTERQATVSREISKLHEETVRGSLAELIEHFTATEPRGEIVIVLAGIDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of a methyltransferase domain from Bacteroides thetaiotaomicron VPI
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase
molecule keywords Methyltransferase
total genus 26
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 3fq6A00
2PCKA 4E16A 2PB5A 2PCIA 2P6DA 2YBQA 2DV7A 2EHLA 2EKAA 2E0NA 1PJTA 2EGBA 2ED5A 2OWVA 2DV4A 2PCHA 2ED3A 2CBFA 2EMUA 2EL1A 2DV5A 2OWUA 2EL0A 2P9DA 2PCMA 2QBUA 2HUXA 3NEIA 2PB6A 1PJQA 2E15A 2EHCA 3I4TA 1WYZA 2HR8A 3FQ6A 2ELDA 2E4NA 2ELEA 2EJZA 2DSIA 2ZVCA 2DXWA 1VA0A 2ENIA 3NDCA 2PCGA 1PJSA 5HW4A 2DEKA 1VHVA 2EMRA 2E7RA 2P6IA 2EJJA 2OWFA 2E8HA 2P2XA 2E17A 2EN5A 2EL2A 2OWGA 2HUQA 3FFYA 1WNGA 2EJKA 2ZVBA 2PCAA 2DSHA 2Z6RA 1V9AA 2E4RA 2EK2A 2E8RA 2EK7A 2E07A 1WDEA 3KWPA 2DXXA 2P5CA 2E0KA 1CBFA 2EL3A 2EK4A 2EH5A 2HUVA 2DXVA 2E08A 2HUTA 2P5FA 2EEQA 2P6KA 1VCEA 2EK3A 2DV3A 2E8QA 2EGLA 2PB4A 3ND1A 3NUTA 1VE2A 2BB3A 2EH2A 2EH4A 2DSGA 2YBOA 2OWKA 2E16A 2NPNA 2EGSA 1S4DA 2P6LA 2E8SA
chains in the Genus database with same CATH superfamily
2PCKA 4E16A 2PB5A 2PCIA 2P6DA 2YBQA 2DV7A 2EHLA 2EKAA 2E0NA 1PJTA 2EGBA 2ED5A 2OWVA 2DV4A 2PCHA 2ED3A 2CBFA 2EMUA 2EL1A 2DV5A 2OWUA 2EL0A 2P9DA 2PCMA 2QBUA 2HUXA 3NEIA 2PB6A 1PJQA 2E15A 2EHCA 3I4TA 1WYZA 2HR8A 3FQ6A 2ELDA 2E4NA 2ELEA 2EJZA 2DSIA 2ZVCA 2DXWA 1VA0A 2ENIA 3NDCA 2PCGA 1PJSA 5HW4A 2DEKA 1VHVA 2EMRA 2E7RA 2P6IA 2EJJA 2OWFA 2E8HA 2P2XA 2KYYA 2E17A 2EN5A 2EL2A 2OWGA 2HUQA 3FFYA 1WNGA 2EJKA 2ZVBA 2PCAA 2DSHA 2Z6RA 1V9AA 2E4RA 2EK2A 2E8RA 2EK7A 2E07A 1WDEA 3KWPA 2DXXA 2P5CA 2E0KA 1CBFA 2EL3A 2EK4A 2EH5A 2HUVA 2DXVA 2E08A 2HUTA 2P5FA 2EEQA 2P6KA 1VCEA 2EK3A 2DV3A 2E8QA 2EGLA 2PB4A 3ND1A 3NUTA 1VE2A 2BB3A 3LMMA 2EH2A 2EH4A 2DSGA 2YBOA 2OWKA 2E16A 2NPNA 2EGSA 1S4DA 2P6LA 2E8SA
chains in the Genus database with same CATH topology
2PCKA 4E16A 2PB5A 2PCIA 2P6DA 2YBQA 2DV7A 2EHLA 2EKAA 2E0NA 1PJTA 2EGBA 2ED5A 2OWVA 2DV4A 2PCHA 2ED3A 2CBFA 2EMUA 2EL1A 2DV5A 2OWUA 2EL0A 2P9DA 2PCMA 2QBUA 2HUXA 3NEIA 2PB6A 1PJQA 2E15A 2EHCA 3I4TA 1WYZA 2HR8A 3FQ6A 2ELDA 2E4NA 2ELEA 2EJZA 2DSIA 2ZVCA 2DXWA 1VA0A 2ENIA 3NDCA 2PCGA 1PJSA 5HW4A 2DEKA 1VHVA 2EMRA 2E7RA 2P6IA 2EJJA 2OWFA 2E8HA 2P2XA 2KYYA 2E17A 2EN5A 2EL2A 2OWGA 2HUQA 3FFYA 1WNGA 2EJKA 2ZVBA 2PCAA 2DSHA 2Z6RA 1V9AA 2E4RA 2EK2A 2E8RA 2EK7A 2E07A 1WDEA 3KWPA 2DXXA 2P5CA 2E0KA 1CBFA 2EL3A 2EK4A 2EH5A 2HUVA 2DXVA 2E08A 2HUTA 2P5FA 2EEQA 2P6KA 1VCEA 2EK3A 2DV3A 2E8QA 2EGLA 2PB4A 3ND1A 3NUTA 1VE2A 2BB3A 3LMMA 2EH2A 2EH4A 2DSGA 2YBOA 2OWKA 2E16A 2NPNA 2EGSA 1S4DA 2P6LA 2E8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PCK A;  4E16 A;  2PB5 A;  2PCI A;  2P6D A;  2YBQ A;  2DV7 A;  2EHL A;  2EKA A;  2E0N A;  1PJT A;  2EGB A;  2ED5 A;  2OWV A;  2DV4 A;  2PCH A;  2ED3 A;  2CBF A;  2EMU A;  2EL1 A;  2DV5 A;  2OWU A;  2EL0 A;  2P9D A;  2PCM A;  2QBU A;  2HUX A;  3NEI A;  2PB6 A;  1PJQ A;  2E15 A;  2EHC A;  3I4T A;  1WYZ A;  2HR8 A;  3FQ6 A;  2ELD A;  2E4N A;  2ELE A;  2EJZ A;  2DSI A;  2ZVC A;  2DXW A;  1VA0 A;  2ENI A;  3NDC A;  2PCG A;  1PJS A;  5HW4 A;  2DEK A;  1VHV A;  2EMR A;  2E7R A;  2P6I A;  2EJJ A;  2OWF A;  2E8H A;  2P2X A;  2E17 A;  2EN5 A;  2EL2 A;  2OWG A;  2HUQ A;  3FFY A;  1WNG A;  2EJK A;  2ZVB A;  2PCA A;  2DSH A;  2Z6R A;  1V9A A;  2E4R A;  2EK2 A;  2E8R A;  2EK7 A;  2E07 A;  1WDE A;  3KWP A;  2DXX A;  2P5C A;  2E0K A;  1CBF A;  2EL3 A;  2EK4 A;  2EH5 A;  2HUV A;  2DXV A;  2E08 A;  2HUT A;  2P5F A;  2EEQ A;  2P6K A;  1VCE A;  2EK3 A;  2DV3 A;  2E8Q A;  2EGL A;  2PB4 A;  3ND1 A;  3NUT A;  1VE2 A;  2BB3 A;  2EH2 A;  2EH4 A;  2DSG A;  2YBO A;  2OWK A;  2E16 A;  2NPN A;  2EGS A;  1S4D A;  2P6L A;  2E8S A; 
#chains in the Genus database with same CATH topology
 2PCK A;  4E16 A;  2PB5 A;  2PCI A;  2P6D A;  2YBQ A;  2DV7 A;  2EHL A;  2EKA A;  2E0N A;  1PJT A;  2EGB A;  2ED5 A;  2OWV A;  2DV4 A;  2PCH A;  2ED3 A;  2CBF A;  2EMU A;  2EL1 A;  2DV5 A;  2OWU A;  2EL0 A;  2P9D A;  2PCM A;  2QBU A;  2HUX A;  3NEI A;  2PB6 A;  1PJQ A;  2E15 A;  2EHC A;  3I4T A;  1WYZ A;  2HR8 A;  3FQ6 A;  2ELD A;  2E4N A;  2ELE A;  2EJZ A;  2DSI A;  2ZVC A;  2DXW A;  1VA0 A;  2ENI A;  3NDC A;  2PCG A;  1PJS A;  5HW4 A;  2DEK A;  1VHV A;  2EMR A;  2E7R A;  2P6I A;  2EJJ A;  2OWF A;  2E8H A;  2P2X A;  2KYY A;  2E17 A;  2EN5 A;  2EL2 A;  2OWG A;  2HUQ A;  3FFY A;  1WNG A;  2EJK A;  2ZVB A;  2PCA A;  2DSH A;  2Z6R A;  1V9A A;  2E4R A;  2EK2 A;  2E8R A;  2EK7 A;  2E07 A;  1WDE A;  3KWP A;  2DXX A;  2P5C A;  2E0K A;  1CBF A;  2EL3 A;  2EK4 A;  2EH5 A;  2HUV A;  2DXV A;  2E08 A;  2HUT A;  2P5F A;  2EEQ A;  2P6K A;  1VCE A;  2EK3 A;  2DV3 A;  2E8Q A;  2EGL A;  2PB4 A;  3ND1 A;  3NUT A;  1VE2 A;  2BB3 A;  3LMM A;  2EH2 A;  2EH4 A;  2DSG A;  2YBO A;  2OWK A;  2E16 A;  2NPN A;  2EGS A;  1S4D A;  2P6L A;  2E8S A; 
#chains in the Genus database with same CATH homology
 2PCK A;  4E16 A;  2PB5 A;  2PCI A;  2P6D A;  2YBQ A;  2DV7 A;  2EHL A;  2EKA A;  2E0N A;  1PJT A;  2EGB A;  2ED5 A;  2OWV A;  2DV4 A;  2PCH A;  2ED3 A;  2CBF A;  2EMU A;  2EL1 A;  2DV5 A;  2OWU A;  2EL0 A;  2P9D A;  2PCM A;  2QBU A;  2HUX A;  3NEI A;  2PB6 A;  1PJQ A;  2E15 A;  2EHC A;  3I4T A;  1WYZ A;  2HR8 A;  3FQ6 A;  2ELD A;  2E4N A;  2ELE A;  2EJZ A;  2DSI A;  2ZVC A;  2DXW A;  1VA0 A;  2ENI A;  3NDC A;  2PCG A;  1PJS A;  5HW4 A;  2DEK A;  1VHV A;  2EMR A;  2E7R A;  2P6I A;  2EJJ A;  2OWF A;  2E8H A;  2P2X A;  2KYY A;  2E17 A;  2EN5 A;  2EL2 A;  2OWG A;  2HUQ A;  3FFY A;  1WNG A;  2EJK A;  2ZVB A;  2PCA A;  2DSH A;  2Z6R A;  1V9A A;  2E4R A;  2EK2 A;  2E8R A;  2EK7 A;  2E07 A;  1WDE A;  3KWP A;  2DXX A;  2P5C A;  2E0K A;  1CBF A;  2EL3 A;  2EK4 A;  2EH5 A;  2HUV A;  2DXV A;  2E08 A;  2HUT A;  2P5F A;  2EEQ A;  2P6K A;  1VCE A;  2EK3 A;  2DV3 A;  2E8Q A;  2EGL A;  2PB4 A;  3ND1 A;  3NUT A;  1VE2 A;  2BB3 A;  3LMM A;  2EH2 A;  2EH4 A;  2DSG A;  2YBO A;  2OWK A;  2E16 A;  2NPN A;  2EGS A;  1S4D A;  2P6L A;  2E8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...