3FQ6A

The crystal structure of a methyltransferase domain from bacteroides thetaiotaomicron vpi
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
b'NATAFVPALVASGLPNEKFCFEGFLPQKKGRQTRLKALAEEHRTMVFYESPHRLLKTLTQFAEYFGTERQATVSREISKLHEETVRGSLAELIEHFTATEPRGEIVIVLAGIDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Methyltransferase
publication title The crystal structure of a methyltransferase domain from Bacteroides thetaiotaomicron VPI
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase
total genus 26
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 3fq6A00
2EHLA 1VHVA 2DV3A 2P6IA 2EJKA 2E8HA 2DV4A 2PCMA 1PJSA 2HUVA 2PCGA 2ED5A 2EGSA 2DXVA 2EKAA 1VCEA 2E15A 2EL1A 2EL3A 1CBFA 2Z6RA 2DSGA 2ELDA 2OWKA 2P5FA 2EGLA 3KWPA 1VA0A 1S4DA 2PCHA 2ZVCA 2DXXA 2ED3A 2P9DA 2E8RA 2E0KA 2E16A 2P2XA 2E7RA 2DV5A 2QBUA 2EK4A 2ZVBA 2EL0A 2P6LA 2EH5A 2E8QA 2PB6A 2E4NA 1VE2A 1WDEA 3FQ6A 3NEIA 2EH2A 1V9AA 2E0NA 2DV7A 2EMUA 2P6KA 2ENIA 2E07A 2E4RA 2OWGA 2EH4A 2CBFA 2DEKA 1WYZA 2E08A 5HW4A 2PB4A 2EK7A 2HUQA 2HR8A 2EGBA 2E8SA 2E17A 2EL2A 2OWVA 2BB3A 3FFYA 2P5CA 2DXWA 2HUXA 1PJTA 2PCAA 3ND1A 2EMRA 2EHCA 2EN5A 2EJZA 2PB5A 4E16A 2P6DA 2OWFA 1PJQA 2OWUA 2EJJA 2YBQA 2DSIA 2EK2A 2PCIA 2DSHA 3NUTA 2HUTA 3NDCA 2EK3A 3I4TA 2PCKA 2YBOA 2EEQA 2ELEA 2NPNA 1WNGA
chains in the Genus database with same CATH superfamily
2EHLA 1VHVA 2DV3A 2P6IA 2EJKA 2E8HA 2DV4A 2PCMA 1PJSA 2HUVA 2PCGA 2ED5A 2EGSA 2DXVA 2EKAA 1VCEA 2E15A 2EL1A 2EL3A 1CBFA 2Z6RA 2DSGA 2ELDA 2OWKA 2P5FA 2EGLA 3KWPA 1VA0A 1S4DA 2PCHA 2ZVCA 2DXXA 2ED3A 2P9DA 2E8RA 2E0KA 2E16A 2P2XA 2E7RA 2DV5A 2QBUA 2EK4A 2ZVBA 2EL0A 2P6LA 2EH5A 3LMMA 2E8QA 2PB6A 2E4NA 1VE2A 1WDEA 3FQ6A 3NEIA 2EH2A 1V9AA 2E0NA 2DV7A 2EMUA 2P6KA 2ENIA 2E07A 2E4RA 2OWGA 2EH4A 2CBFA 2DEKA 1WYZA 2E08A 5HW4A 2PB4A 2EK7A 2HUQA 2HR8A 2EGBA 2E8SA 2E17A 2EL2A 2OWVA 2BB3A 3FFYA 2P5CA 2DXWA 2HUXA 1PJTA 2PCAA 3ND1A 2EMRA 2EHCA 2EN5A 2EJZA 2PB5A 4E16A 2P6DA 2OWFA 1PJQA 2OWUA 2EJJA 2YBQA 2DSIA 2EK2A 2PCIA 2DSHA 3NUTA 2HUTA 2KYYA 3NDCA 2EK3A 3I4TA 2PCKA 2YBOA 2EEQA 2ELEA 2NPNA 1WNGA
chains in the Genus database with same CATH topology
2EHLA 1VHVA 2DV3A 2P6IA 2EJKA 2E8HA 2DV4A 2PCMA 1PJSA 2HUVA 2PCGA 2ED5A 2EGSA 2DXVA 2EKAA 1VCEA 2E15A 2EL1A 2EL3A 1CBFA 2Z6RA 2DSGA 2ELDA 2OWKA 2P5FA 2EGLA 3KWPA 1VA0A 1S4DA 2PCHA 2ZVCA 2DXXA 2ED3A 2P9DA 2E8RA 2E0KA 2E16A 2P2XA 2E7RA 2DV5A 2QBUA 2EK4A 2ZVBA 2EL0A 2P6LA 2EH5A 3LMMA 2E8QA 2PB6A 2E4NA 1VE2A 1WDEA 3FQ6A 3NEIA 2EH2A 1V9AA 2E0NA 2DV7A 2EMUA 2P6KA 2ENIA 2E07A 2E4RA 2OWGA 2EH4A 2CBFA 2DEKA 1WYZA 2E08A 5HW4A 2PB4A 2EK7A 2HUQA 2HR8A 2EGBA 2E8SA 2E17A 2EL2A 2OWVA 2BB3A 3FFYA 2P5CA 2DXWA 2HUXA 1PJTA 2PCAA 3ND1A 2EMRA 2EHCA 2EN5A 2EJZA 2PB5A 4E16A 2P6DA 2OWFA 1PJQA 2OWUA 2EJJA 2YBQA 2DSIA 2EK2A 2PCIA 2DSHA 3NUTA 2HUTA 2KYYA 3NDCA 2EK3A 3I4TA 2PCKA 2YBOA 2EEQA 2ELEA 2NPNA 1WNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EHL A;  1VHV A;  2DV3 A;  2P6I A;  2EJK A;  2E8H A;  2DV4 A;  2PCM A;  1PJS A;  2HUV A;  2PCG A;  2ED5 A;  2EGS A;  2DXV A;  2EKA A;  1VCE A;  2E15 A;  2EL1 A;  2EL3 A;  1CBF A;  2Z6R A;  2DSG A;  2ELD A;  2OWK A;  2P5F A;  2EGL A;  3KWP A;  1VA0 A;  1S4D A;  2PCH A;  2ZVC A;  2DXX A;  2ED3 A;  2P9D A;  2E8R A;  2E0K A;  2E16 A;  2P2X A;  2E7R A;  2DV5 A;  2QBU A;  2EK4 A;  2ZVB A;  2EL0 A;  2P6L A;  2EH5 A;  2E8Q A;  2PB6 A;  2E4N A;  1VE2 A;  1WDE A;  3FQ6 A;  3NEI A;  2EH2 A;  1V9A A;  2E0N A;  2DV7 A;  2EMU A;  2P6K A;  2ENI A;  2E07 A;  2E4R A;  2OWG A;  2EH4 A;  2CBF A;  2DEK A;  1WYZ A;  2E08 A;  5HW4 A;  2PB4 A;  2EK7 A;  2HUQ A;  2HR8 A;  2EGB A;  2E8S A;  2E17 A;  2EL2 A;  2OWV A;  2BB3 A;  3FFY A;  2P5C A;  2DXW A;  2HUX A;  1PJT A;  2PCA A;  3ND1 A;  2EMR A;  2EHC A;  2EN5 A;  2EJZ A;  2PB5 A;  4E16 A;  2P6D A;  2OWF A;  1PJQ A;  2OWU A;  2EJJ A;  2YBQ A;  2DSI A;  2EK2 A;  2PCI A;  2DSH A;  3NUT A;  2HUT A;  3NDC A;  2EK3 A;  3I4T A;  2PCK A;  2YBO A;  2EEQ A;  2ELE A;  2NPN A;  1WNG A; 
#chains in the Genus database with same CATH topology
 2EHL A;  1VHV A;  2DV3 A;  2P6I A;  2EJK A;  2E8H A;  2DV4 A;  2PCM A;  1PJS A;  2HUV A;  2PCG A;  2ED5 A;  2EGS A;  2DXV A;  2EKA A;  1VCE A;  2E15 A;  2EL1 A;  2EL3 A;  1CBF A;  2Z6R A;  2DSG A;  2ELD A;  2OWK A;  2P5F A;  2EGL A;  3KWP A;  1VA0 A;  1S4D A;  2PCH A;  2ZVC A;  2DXX A;  2ED3 A;  2P9D A;  2E8R A;  2E0K A;  2E16 A;  2P2X A;  2E7R A;  2DV5 A;  2QBU A;  2EK4 A;  2ZVB A;  2EL0 A;  2P6L A;  2EH5 A;  3LMM A;  2E8Q A;  2PB6 A;  2E4N A;  1VE2 A;  1WDE A;  3FQ6 A;  3NEI A;  2EH2 A;  1V9A A;  2E0N A;  2DV7 A;  2EMU A;  2P6K A;  2ENI A;  2E07 A;  2E4R A;  2OWG A;  2EH4 A;  2CBF A;  2DEK A;  1WYZ A;  2E08 A;  5HW4 A;  2PB4 A;  2EK7 A;  2HUQ A;  2HR8 A;  2EGB A;  2E8S A;  2E17 A;  2EL2 A;  2OWV A;  2BB3 A;  3FFY A;  2P5C A;  2DXW A;  2HUX A;  1PJT A;  2PCA A;  3ND1 A;  2EMR A;  2EHC A;  2EN5 A;  2EJZ A;  2PB5 A;  4E16 A;  2P6D A;  2OWF A;  1PJQ A;  2OWU A;  2EJJ A;  2YBQ A;  2DSI A;  2EK2 A;  2PCI A;  2DSH A;  3NUT A;  2HUT A;  2KYY A;  3NDC A;  2EK3 A;  3I4T A;  2PCK A;  2YBO A;  2EEQ A;  2ELE A;  2NPN A;  1WNG A; 
#chains in the Genus database with same CATH homology
 2EHL A;  1VHV A;  2DV3 A;  2P6I A;  2EJK A;  2E8H A;  2DV4 A;  2PCM A;  1PJS A;  2HUV A;  2PCG A;  2ED5 A;  2EGS A;  2DXV A;  2EKA A;  1VCE A;  2E15 A;  2EL1 A;  2EL3 A;  1CBF A;  2Z6R A;  2DSG A;  2ELD A;  2OWK A;  2P5F A;  2EGL A;  3KWP A;  1VA0 A;  1S4D A;  2PCH A;  2ZVC A;  2DXX A;  2ED3 A;  2P9D A;  2E8R A;  2E0K A;  2E16 A;  2P2X A;  2E7R A;  2DV5 A;  2QBU A;  2EK4 A;  2ZVB A;  2EL0 A;  2P6L A;  2EH5 A;  3LMM A;  2E8Q A;  2PB6 A;  2E4N A;  1VE2 A;  1WDE A;  3FQ6 A;  3NEI A;  2EH2 A;  1V9A A;  2E0N A;  2DV7 A;  2EMU A;  2P6K A;  2ENI A;  2E07 A;  2E4R A;  2OWG A;  2EH4 A;  2CBF A;  2DEK A;  1WYZ A;  2E08 A;  5HW4 A;  2PB4 A;  2EK7 A;  2HUQ A;  2HR8 A;  2EGB A;  2E8S A;  2E17 A;  2EL2 A;  2OWV A;  2BB3 A;  3FFY A;  2P5C A;  2DXW A;  2HUX A;  1PJT A;  2PCA A;  3ND1 A;  2EMR A;  2EHC A;  2EN5 A;  2EJZ A;  2PB5 A;  4E16 A;  2P6D A;  2OWF A;  1PJQ A;  2OWU A;  2EJJ A;  2YBQ A;  2DSI A;  2EK2 A;  2PCI A;  2DSH A;  3NUT A;  2HUT A;  2KYY A;  3NDC A;  2EK3 A;  3I4T A;  2PCK A;  2YBO A;  2EEQ A;  2ELE A;  2NPN A;  1WNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...