3FR6A

Tetramerization and cooperativity in plasmodium falciparum glutathione transferase are mediated by the atypic loop 113-118
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
205
structure length
201
Chain Sequence
GDNIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKANETTFLNEDLPKWSGYFEKLLKKNHTDKYYFVGNNLTYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Tetramerization and Cooperativity in Plasmodium falciparum glutathione transferase are mediated by the atypic loop 113-118
rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 67
structure length 201
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3fr6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3fr6A01
3LQ7A 2H0IA 1TK8B 1K3LA 3LXZA 4HZ2A 4WR5A 2M46A 4BVXB 2L6DA 2OA7A 3KD0A 4HDEA 4ZXGA 4MH3A 4AJ8A 1ZZYA 3EE2A 3DRNA 3N9JA 2VOCA 2YJ7A 2OADA 2VUPA 2KP2A 3C1RA 4MF5A 2VL9A 1Y6EA 1MD4A 2EIOA 2DJ0A 4BL7A 5DALB 3TRPA 4POBA 1HD2A 3CYNA 1VF2A 5D96A 4Q5FA 4OFNA 3CSJA 4WEYA 5C00A 1KNGA 3UARA 3EC3A 3H1NA 5ECKB 2KOKA 5HQPA 4N0ZA 2HSHA 4KF9A 1ON4A 2LSTA 4L8EA 2D2ZA 1DSBA 4JEDA 5GZZB 1F2EA 4ZB6A 2H19A 4L5LA 3I43A 3HYPA 4MZBA 1YEPA 2O89A 1SJZA 3D22A 6GSWA 14GSA 4K7IA 4XRAA 2HQTA 2VM1A 4KDYA 3OR5A 3PPUA 2LS5A 3HJMA 3GKXA 1JZRA 1ZL9A 1KEBA 1XCCA 2EC4A 3WGDA 4F9ZA 2FA4A 5EL8A 1SKRB 2PBJA 17GSA 2VCVA 2HRFA 3ZVJA 4LMVA 1PSQA 2GT5A 1TI1A 4EUYA 5G1KA 3EVIA 2RUFA 5G1LA 2WJUA 3M8NA 3TGZA 5CREA 3KZQA 4HJMA 3QAGA 2WGRA 5JWOB 4KSMA 4JRRA 3VWUA 5KN3A 3GTUA 1V9WA 2DJJA 3GL5A 3TJBA 5FWGA 4HU9A 3UL3A 4GSSA 1MD3A 2K18A 2C0FA 2LUSA 1PQNA 2P5QA 4NHWA 2KP1A 2JSZA 1EOHA 4FQUA 1ZYQB 2DMMA 1HNAA 1A2JA 3FZ5A 5CRGA 1H4OA 1GUHA 4ZBAA 4IQAA 3RPNA 3UVTA 2R5GA 2YWNA 4MH2A 1PX7A 2QGVA 2B3SA 3QCPA 4V1Ag 3ISOA 5EPFA 4ULXA 3ERGA 1JZWA 2HSYA 1SK2A 4BWQA 2YCDA 1W4VA 1PMTA 4IS0A 4TVEA 2RUEA 3FY7A 2L4QA 4EDYA 2YOIA 3TJFA 5J9BA 3IBHA 5IOXA 1BG5A 1R5AA 1A8YA 1CQHA 2Z9SA 4HQZA 1QXHA 3IAS2 4AJ6A 4ML6A 4O32A 3CRTA 4IJIA 6GSYA 4G19A 2LRTA 5KEJA 5AGYA 3R2QA 3O6TA 3WGEA 2E2GA 2FWFA 2TRCP 2F9SA 2C0EA 3H79A 4PQIA 2R37A 4PUAA 4Q5QA 2H0HA 5KN0A 4IW9A 3VLNA 1A24A 3F3RA 1B48A 1XW9A 1TU7A 5DAKA 3FZ4A 1SKSB 3W8SA 5FHIA 1R5PA 4EKZA 2DLXA 3TKQA 3IDVA 4GXZA 3CXGA 3HVXA 1YY7A 3DXBA 2HXKA 4ML1A 5ABRA 1GSEA 3EINA 3VK9A 3KH9A 2MBTA 2B7JA 1J08A 2ZNMA 2PWJA 5AISA 4MJCA 4X1UA 1WOUA 1X5EA 2GZZA 5HFKA 4KAEA 1GUMA 2G0FA 1AAZA 5DVBA 2IFQB 2YANA 2AHEA 3ZIVA 1G7EA 3L9UA 3JCML 1GLQA 4NV5A 1TKDB 3L4NA 2IL3A 1YKAA 4KDUA 2QC7A 3CSIA 4ACSA 3A2XA 3HVVA 3TKPA 4KCAA 3ZYWA 2VCXA 1TP9A 1Z7RA 1Z7PA 1XOBA 1EGRA 4HQSA 3S9FA 3H8QA 4TKYA 2JZRA 3TKSA 2LQQA 4TR1B 2X99A 5F05A 5F0GA 4Q5NA 1TTZA 2P31A 2OBIA 2EIRA 3KH7A 3DKSA 1EV9A 3HD5A 2A4VA 16GSA 2O7KA 4OCFA 4ZBBA 2CVKA 2K6VA 2DIYA 1BYEA 3EU3A 3ME7A 4TR0A 3IPZA 4KCEA 4YQMA 4ZIJA 1GTUA 2H6XA 1NHYA 1MDKA 1ERWA 3BJ5A 2V6OA 2E2MA 3QMXA 3TB2A 5GAND 3GV1A 1SJIA 1OE7A 3D5JA 4TRXA 3UIWA 5J41A 1KTEA 2B1KA 2K8SA 3ZLPA 2E7PA 5ENUA 1FW1A 3VPQA 3FKFA 2H73A 3KP8A 3KMNA 4G0KA 3E0UA 5B6NA 1O8WA 1U87A 5CP1A 1TW9A 1KBNA 1JZOA 3KTLA 1B9XC 3FW2A 4ECJA 2K8VA 2HSMB 1B4QA 1X9WB 5ID2A 1F6MC 3L9VA 1Z6MA 3GH9A 1OC9B 4FYBA 2LEGA 1EV4A 4G0IA 1R7HA 2P0GA 1JLWA 2GTUA 3HCZA 3ZMKA 3F9UA 3GX8A 1N2AA 1WIKA 2H72A 1EEJA 4NV2A 3F8UA 4XS4B 3LORA 2C3TA 1XVQA 4FYCA 3IAM2 2H1AA 3A5WA 2H75A 1B8XA 3GKKA 3IR4A 3APQA 2ON5A 1OKDA 1X5DA 2VAFA 3C71A 3GSTA 1K0DA 1M2AA 1S3AA 3F6DA 2JL4A 4Q5RA 4GLTA 1GNWA 4TOPA 1EEMA 5HR2A 1JLVA 2O87A 1YF0A 3HZ4A 1FB0A 1OC3A 3DGQA 4LA1A 3GKMA 3IHQA 3TKSE 2PU9C 3TOTA 3QD9A 4ZB9A 1HNBA 4EF0A 3Q19A 2HZEA 2GSRA 4KGIA 3QOUA 2X8HA 2PUKC 5A4VA 1VGLA 1GLPA 2ZUPA 3HDCA 3ZMLA 4DEJA 3IXRA 5IMDA 3KCMA 2YV9A 3GL3A 5ECIB 1MDJA 3O3TA 1R26A 1AW9A 3GUSA 3QAVA 1NW2A 4MF7A 3C8EA 1TRVA 3KGKA 4KX4A 5DJMA 4NPBA 2B5EA 3IK7A 4CHSA 3CSHA 1XBSA 4IKHA 3F4SA 4YH2A 3RHBA 4OD7A 2HRKA 4XHMA 5ECMB 3CTGA 2H6ZA 4BL7B 5HR0A 2DJ1A 4PGTA 1T4ZA 2YN1A 1XOAA 1GTIA 2IN3A 4G2EA 1HQOA 5AN1A 2VO4A 2L6CA 2YWMA 4HEA2 3UOMA 4J57E 3IK9A 3ZFLA 2F3MA 4WKWA 1GSSA 3GN3A 2I4AA 3MWHA 1F37A 2JZSA 1FB6A 2FWHA 2IMFA 3IOSA 2KLXA 5DQYA 2N5FA 4LL1B 4F0CA 4NWYA 4H86A 3QFBC 2DMLA 3PH9A 5DBQA 3LXTA 1PL1A 5JCWA 1ERVA 4IVFA 3LYKA 2FNOA 3R3EA 2JZTA 1WWJA 3E9JB 2H8LA 3F4RA 2B6MA 2OBKA 3LFLA 1FG4A 1M9AA 1N8JA 1X9MB 2ES7A 2C3QA 4AF2A 3UBKA 4XRDA 2LJRA 1PN9A 5H5SA 4O7HA 1W89A 1T1VA 2YZUA 1PD21 3M1GA 2XPDA 4F03A 3FK8A 4NMUA 3TJGA 2H1BA 9GSSA 4J56E 7GSSA 3CMIA 3BCIA 4CDOA 3G7JA 2DIZA 3HA9A 1F3AA 2XBQA 1UC7A 2CA8A 3ZITA 4F82A 5A4UA 4NHZA 1DUGA 2OE0A 4ZL8A 5F8BA 2V1MA 1I9DA 3L78A 4I97A 3QPMA 2VLTA 3H93A 4XTSA 1J0FA 5GSSA 2GQMA 4RI6A 3C73A 2DSAA 5J4UA 1V57A 2PVOC 5IIZA 3FZ9A 1XPVA 3UAPA 3ME8A 3IA1A 3I69A 2AJQB 5HR1A 3LSZA 1M0UA 5ELAA 2C3NA 5DQSA 2MYGA 1O85A 1LBKA 1K0AA 2CX4A 1NSWA 2GS3A 5KN1A 1BEDA 4BA7A 1M2DA 1TOFA 1WP0A 1O7UA 1TRWA 2O85A 3D4MA 4DSSB 3RBTA 1YZXA 4OO4A 2N5AA 4JZQA 4QL7A 2J9HA 2H01A 3GHAA 3VWVA 2LNTA 4GWRA 4HS1A 3AY8A 5ELGA 1K3OA 4LL4B 4MPFA 2ZCTA 4WETA 4D73B 1GTBA 4I5QA 4YQVA 5JWRB 2YZHA 1FAAA 3VFIA 5E59A 1OKTA 2UZ8A 1DBYA 1U3IA 3UJ1A 5IQYA 13GSA 2YV7A 3TUEA 3ZFBA 2HFDA 5IMZA 1YEXA 1QUWA 3KEBA 1JZDA 12GSA 5GAPD 8GSSA 2IIYA 3M9KA 1GUKA 1A2MA 2GDRA 1ST9A 2QKEA 3HJOA 3F4TA 2VCZA 4JE1A 4OO5A 5D73A 4ECIA 2WZ9A 1EOGA 3RPPA 4X43A 4WXTA 2H71A 6GSXA 1PX6A 3ZL5A 2C4JA 2N5BA 1K0MA 2H6YA 2FLSA 4BVYB 3D0ZA 4CW9A 2DJ3A 4I2TA 4MA9A 1SJ6A 2L5LA 3DVWA 4OFMA 2DJ2A 2FCHA 3CRUA 1T4YA 3A2VA 2NBSA 4RI7A 3WT2A 5LD0A 4FO5A 3P90A 1HNCA 3LWAA 1NHOA 5G2ZA 3L9SA 1YDKA 2MMOA 3U5RE 4HUAA 2H74A 4XS6A 4IN0A 3TRQA 4MK3A 2HI7A 3D21A 3KIJA 2VIMA 3F3QA 5KN2A 5IMAA 1SENA 1T00A 2WRTA 1TJDA 2VD0A 3U6VA 4O5RA 2V32A 4KE3A 5J5NA 4HI7A 4ILFA 4WR4A 4KH7A 2MBSA 4IP1A 1XWKA 3C7MA 4GQFA 2YPMA 3VI7A 1A8LA 2WFCA 1MTCA 4AJ7A 1G7OA 5L71A 2K9FA 4JBBA 1LJRA 1ZMAA 3M9JA 3E3EA 4K1FA 2LQOA 5DCHA 3PR8A 4EE0A 3HY2A 4KNDA 2O8VB 2PERA 1YQ1A 5IMCA 1VRSD 1SU9A 4BPYA 2P5RA 2C80A 3QFAC 2GZPA 1RQMA 4FIWA 1CQGA 3CBUA 1V2AA 2C8UA 2HYXA 1F9MA 3GRXA 4Z7XA 1XVWA 2YJHA 2HE3A 1R4WA 2GQLA 1M99A 5ID2B 3LJRA 1PKWA 1QGVA 1JFUA 4AGSA 3I6AA 4NAXA 1AQWA 1GSDA 4KSOA 4POKA 2GT6A 3LEFA 3MDKA 2R4VA 2L5OA 4V2NA 1Z9HA 1LU4A 20GSA 1TK5B 2RIIA 2FGXA 3M3MA 5ECOB 3GKNA 2AAWA 3NOFA 1FO5A 1X9SB 5JWQB 1MDIA 2NTOA 2V6KA 2CVDA 5CAXA 5COHA 3A3TA 1K0NA 2M72A 1U6TA 4TW5A 3GA4A 2CT6A 4TXOA 1YF1A 3ZRDA 3HVSA 4OWYA 3DWVA 4TR1A 1RK4A 1GRXA 4PQ1A 1XW6A 1G6WA 4DSRA 4KDXA 1GH2A 6GSVA 1SD9A 3APSA 4L0WA 2I81A 6GSSA 3EMPA 3KP9A 1UA5A 1A23A 2HZFA 1SK1A 1Z6NA 2AUVA 1V40A 4G9HA 2LTKA 4EDZA 2CZ2A 2QSIA 2IMDA 2WS2A 1G6YA 4ECCA 1ML6A 1WPIA 3SBCA 4LMWA 3FR9A 2PPTA 2LJKA 3Q6OA 2CVBA 5HFIA 3US3A 2F8AA 1SL0B 4EO3A 1AQVA 4FH8A 2MMNA 4LLRA 3APOA 1IYHA 2A2SA 2CAQA 22GSA 4X0XA 4RQRA 5BMUA 2CAIA 3IRAA 4WF4A 2HSMA 2GLRA 4IQ1A 4ZB8A 5G31A 4GCIA 1Y25A 4K9ZA 4RQXA 4IJ3A 2MMZA 1UVZA 4J2FA 3DD3A 2I1UA 4KW6A 1XFLA 3WYWA 4YAVA 1MEKA 3EWLA 3IV4A 1K0BA 3C1SA 5J9CA 2CQ9A 1ZOFA 3EYTA 4XS4A 1EP7A 3BOAA 5CRDA 4OMVA 5EVOA 2MMAA 4V2MA 1DE2A 2GGTA 4MMMA 2R2JA 3PINA 2HSNB 4TXVA 5EY6A 2C0GA 1WMJA 1U3AA 2XC2A 4TN8A 10GSA 5B8AA 3ZREA 3UVHA 2VL3A 2H0GA 2DC5A 5DCGA 5D9TA 4N10A 1U88A 2I3YA 2GSQA 4KA0A 4MABA 4YQUA 4MJEA 4O92A 5G5FA 1FVKA 5CYYA 1WRYA 3G9BA 4MJAA 5ECLB 4E8EA 2VL2A 2VL2C 5INYA 1SYXA 2C0DA 3UMAA 2ALBA 4PNFA 5IMFA 2YWOA 2VD1A 3P7XA 4XCSA 5IOWA 2X8CA 1PRXA 4ZILA 2GQKA 1GULA 1A2LA 1O81A 2BMXA 2F51A 2IWTA 3NIVA 1AQXA 1SL2B 4USSA 3KMOA 1Q4JA 2NPBA 3ZTLA 4WBJA 2R6KA 2HRAA 2DBCA 2JSYA 18GSA 5ECHB 3V1WA 1OE8A 4PNGA 1ZYEA 4IELA 1ILOA 5AIXA 4JR4A 3FHKA 1K3YA 2HT9A 3VWXA 4F0BA 2V41A 4L0UA 1J9BA 2IMEA 2AB6A 3EMXA 3F63A 3DIEA 2JACA 1T8EB 4YAPA 3GFKA 1SD8A 4IGJA 3GTUB 2GVPA 4BVXA 5H5RA 4MP4A 5ECRB 4GF0A 19GSA 3HHVA 1B9YC 2NVLA 4MLYA 3D4TA 2PGTA 2XPEA 5DALA 3HKRA 2V2GA 5CO3A 2L57A 2C1YA 4FYUA 3GSSA 2CV4A 5D9VA 5GSTA 1ERTA 4JR6A 4JU5A 2H76A 3MSZA 2KHPA 4PQHA 4GSTA 5G5EA 4GSNA 2AV4A 1A0RP 4GQCA 2DJKA 2OACA 4QL9A 1EZKA 4N0VA 3BBYA 4KUNA 3RAZA 4GRFA 3I9V2 4EL1A 1OC8A 1FOVA 2TRXA 4N11A 1TRSA 2YWIA 1M2BA 4TR3A 4K8MA 5ECSA 2VLUA 1T3BA 1G0TA 3F6FA 1I5GA 2L4CA 2RM5A 3ERFA 1XWAA 3TOUA 4V1Ap 4K6XA 2RLIA 3VI5A 3FEUA 2H30A 4EVMA 1XWGA 4ECBA 1SK0A 5DAKB 3WGXA 3D6IA 3LGCA 1URMA 3O76A 4IHUA 3LYPA 5B7CA 4IP6A 2CX3A 2LNSA 11GSA 1GSQA 1PKZA 3GURA 5DDLA 4OCEA 4DSSA 4HZ4A 1DE1A 3IC4A 3GX0A 1K0OA 4D73A 2TIRA 5IO2A 3HJPA 3FR3A 3G7YA 3HZ8A 4DSQA 4F2IA 2MZCA 4G10A 5HFGA 1H75A 4WF5A 3W8JA 4ISDA 1QMVA 1WJKA 3DMLA 1F3BA 2FA8A 4PTSA 1E6BA 6GSUA 1VF4A 2WB9A 2GSTA 3GMFA 1FVJA 3LG6A 1USBA 1Z5YE 1EP8A 1ABAA 1X0RA 2JU5A 2BTOT 1AIUA 5DJLA 2OE3A 2HRNA 2FD3A 2WULA 3N5OA 2VCTA 2F8FA 2G2QA 3GIXA 4EXJA 1E2YA 4MPGA 4WBRD 3HXSA 1V58A 2NDOA 5CNWA 1S3CA 4BVYA 4ID0A 3VPTA 2IMKA 3TRXA 1AC1A 1GSUA 1OYJA 2R3XA 5E4WA 1XZOA 2JADA 3P2AA 1QK8A 1SL1B 1GSYA 2OKAA 4MJBA 3FYGA 1GSFA 1A0FA 5F06A 1HYUA 1OVNA 1VF3A 2X64A 4ZL7A 4XS1A 4PXOA 3IC8A 3TJJA 1PL2A 1NM3A 5ECNB 1SKWB 3GNJA 4I2UA 3Q18A 3W6GA 4ZBDA 5IM9A 2RM6A 4K2DA 3IE3A 5FT3A 1AUCA 4K7OA 1JHBA 3WT1A 4ZL9A 1WE0A 5AIVA 5D9WA 1PA3A 3KTBA 3F0IA 1PGTA 4K7NA 3H4KA 4KB3A 4DVCA 2EIQA 4TXOB 2LV3A 4GTUA 4QQ7A 1GL8A 4RUVA 3TKSC 2IJYA 3QR6A 3MNGA 3WD6A 3ZZXA 2E0QA 5LCZA 4PX1A 2H1DA 3GH6A 2IFQA 1QFNA 5JCUA 2GSSA 1Q98A 1RW1A 2PN8A 1XWBA 1XXUA 3KM6A 3TDGA 4G0LA 4V2LA 2FY6A 3M0FA 5CRWA 1GNEA 4L5OA 5JCGA 1K0CA 3FZAA 2FHEA 3Q74A 3DEXA 4PUFC 5CRHA 4K0GA 4BWSA 4MZCA 1M7TA 5D9XA 1ZGNA 3RHCA 1TDIA 4I6XA 3ZVJD 5J3RA 4E8HA 1BQ7A 2GZYA 2FWEA 5D8IA 2REMA 2H1GA 5B6MA 5B8BA 4HJ2A 5F07A 2PMTA 2XHFA 2XBIA 4TR4A 2OJLA 2X8GA 3KXOA 1AXDA 1YKCA 1TK0B 3J7Yk 2FWGA 1GP1A 3VWWA 4I8BA 1YJ6A 2ON7A 4K0NA 3VURA 3FR6A 5G30A 1THOA 1C72A 4N30A 4PURA 1X5CA 4IBPA 4POLA 1THXA 2HZEB 1ACVA 2IMIA 5A4WA 1VF1A 2H66A 1ZCPA 4MZWA 1M9BA 3QAWA 5D93A 3EU4A 3BCKA 3EURA 5C04A 4EC0A 2IPAA 2B1LA 1IYIA 4P3YB 2LRNA 2WDUA 1Z3EA 3BD2A 2YNXA 3G7IA 1TXXA 3ED3A 3CTFA 3ERWA 1O8XA 2B7KA 3KJYA 2LKUA 1FHEA 1T7PB 1SYRA 3DYRA 2HLSA 2CZ3A 5IO0A 2HRKB 1TU8A 1OC9A 2KUCA 1QQ2A 3NZNA 4HU7A 2BJXA 1BX9A 2I9HA 4MF6A 2LRCA 3SWLA 3RDWA 2AYTA 6GSTA 2VM2A 5IPHA 3ZIJA 1S3DA 3FRCA 2PVQA 2A2RA 5HR3A 1GWCA 2B5XA 1EGOA 3P8WA 2J23A 5H5QA 3A2WA 2VCQA 2L59A 1XIYA 1XW5A 3TCOA 1TRUA 3MAKA 1O6JA 3PGTA 1V98A 5IPGA 1O73A 3TKRA 2M80A 2FUG2 1GTAA 1B4PA 4MDCA 1UN2A 1XWCA 2OE1A 2WCIA 5ECQB 3J7Yb 1TI3A 2B5YA 2VLVA 2YP6A 4MCUA 2VCWA 2HNLA 1EWXA 5ECPB 4NXIA 3DVXA 4XIHA 3QDNA 4OFTA 5IMVA 3UBLA 4HOJA 1ERUA 3TJKA 3UEMA 4POMA 3GYKA 3K8NA 2LJAA 1BJXA 1OAZA 5LNKe 5A5KA 1BAYA 3L0HA 2H70A
chains in the Genus database with same CATH superfamily
3LQ7A 2H0IA 1TK8B 1K3LA 5J4VA 3LXZA 4HZ2A 4WR5A 2M46A 4BVXB 2L6DA 2OA7A 3KD0A 4HDEA 4ZXGA 4MH3A 4AJ8A 1ZZYA 3EE2A 3DRNA 3N9JA 2VOCA 2YJ7A 2OADA 2VUPA 2KP2A 3C1RA 4MF5A 4K5SA 2VL9A 1Y6EA 1MD4A 2EIOA 2DJ0A 4BL7A 5DALB 3TRPA 4POBA 1HD2A 3CYNA 2WW2A 3LW9A 1VF2A 5D96A 4Q5FA 4Z2RA 4OFNA 3CSJA 4WEYA 5C00A 1KNGA 3UARA 3EC3A 3H1NA 5ECKB 2KOKA 5HQPA 4N0ZA 2HSHA 4KF9A 1ON4A 2LSTA 4L8EA 2D2ZA 1DSBA 4JEDA 5GZZB 1F2EA 4ZB6A 2H19A 4L5LA 3I43A 3HYPA 4MZBA 1YEPA 2O89A 1SJZA 3D22A 6GSWA 14GSA 4K7IA 4XRAA 2HQTA 2VM1A 4KDYA 3OR5A 3PPUA 2LS5A 3HJMA 3GKXA 2X4AA 1JZRA 1ZL9A 1KEBA 1XCCA 2EC4A 3WGDA 4F9ZA 2FA4A 1PN0A 3HMJG 5EL8A 1SKRB 2PBJA 17GSA 2VCVA 1XG8A 2HRFA 3ZVJA 4LMVA 1PSQA 2GT5A 1TI1A 4EUYA 5G1KA 3EVIA 2RUFA 5G1LA 2WJUA 3M8NA 3TGZA 5CREA 3KZQA 4HJMA 3QAGA 2WGRA 1S4BP 5JWOB 4KSMA 4JRRA 3VWUA 5KN3A 3GTUA 1V9WA 2DJJA 3GL5A 3TJBA 5FWGA 4HU9A 3UL3A 4GSSA 5J4YA 1MD3A 2K18A 2WW0A 2C0FA 2LUSA 1PQNA 2P5QA 4NHWA 2KP1A 2JSZA 1EOHA 4FQUA 1ZYQB 2DMMA 1HNAA 1A2JA 3FZ5A 5CRGA 1H4OA 1GUHA 4ZBAA 4IQAA 3RPNA 3UVTA 2R5GA 2YWNA 4MH2A 1PX7A 2QGVA 2B3SA 3QCPA 4G01A 4V1Ag 3ISOA 5EPFA 4ULXA 3ERGA 1JZWA 2HSYA 1SK2A 4BWQA 2YCDA 1W4VA 1PMTA 4IS0A 4TVEA 2RUEA 3FY7A 1M3JA 2L4QA 4EDYA 2YOIA 3TJFA 5J9BA 3IBHA 5IOXA 1BG5A 1R5AA 1A8YA 1CQHA 2OT3A 2Z9SA 4HQZA 1QXHA 3IAS2 4AJ6A 4ML6A 4O32A 3CRTA 4IJIA 6GSYA 4G19A 2LRTA 5KEJA 5AGYA 3R2QA 3O6TA 3WGEA 2E2GA 2FWFA 4PI0C 2F9SA 2C0EA 2TRCP 3H79A 4PQIA 2R37A 4PUAA 4Q5QA 2H0HA 5KN0A 4IW9A 3VLNA 1A24A 3F3RA 1B48A 1XW9A 1TU7A 5DAKA 3FZ4A 1SKSB 3W8SA 5FHIA 1R5PA 4EKZA 2DLXA 3TKQA 3IDVA 4GXZA 3CXGA 3HVXA 3CWGA 1YY7A 3DXBA 2HXKA 4ML1A 5ABRA 1GSEA 3EINA 3VK9A 3KH9A 2MBTA 2B7JA 1J08A 2ZNMA 2PWJA 5AISA 4MJCA 4X1UA 1WOUA 1X5EA 2GZZA 5HFKA 4KAEA 1GUMA 2G0FA 1AAZA 5DVBA 2IFQB 2YANA 2AHEA 1FOHA 3ZIVA 1G7EA 3L9UA 3JCML 1GLQA 4NV5A 1TKDB 3L4NA 2IL3A 1N25A 1YKAA 4KDUA 2VKZG 2QC7A 3CSIA 4ACSA 3A2XA 3HVVA 3TKPA 4KCAA 3ZYWA 2VCXA 1TP9A 1Z7RA 1Z7PA 1XOBA 1EGRA 4HQSA 3S9FA 3H8QA 5KOXA 4TKYA 2JZRA 3TKSA 2LQQA 3IHGA 4TR1B 2X99A 5F05A 5F0GA 4Q5NA 1TTZA 2P31A 2OBIA 2EIRA 3KH7A 3DKSA 1EV9A 3HD5A 2A4VA 16GSA 2O7KA 4OCFA 4ZBBA 2CVKA 2K6VA 2DIYA 1BYEA 3EU3A 3ME7A 4TR0A 3IPZA 4KCEA 4YQMA 4ZIJA 1GTUA 2H6XA 1NHYA 1MDKA 4X4JA 1ERWA 3BJ5A 2V6OA 2E2MA 3QMXA 3TB2A 5GAND 3GV1A 1SJIA 1OE7A 5A34A 3D5JA 2WVXA 4TRXA 3UIWA 5J41A 1KTEA 2B1KA 2K8SA 3ZLPA 2E7PA 5ENUA 1FW1A 3VPQA 3FKFA 2H73A 3KP8A 3KMNA 4G0KA 3E0UA 4FXYP 5B6NA 1O8WA 1U87A 5CP1A 1TW9A 1KBNA 2WVZA 1JZOA 3KTLA 1B9XC 3FW2A 4ECJA 2K8VA 2HSMB 1B4QA 1X9WB 5ID2A 1F6MC 3L9VA 1Z6MA 3GH9A 1OC9B 4FYBA 2LEGA 1EV4A 4G0IA 1R7HA 2P0GA 1JLWA 2GTUA 3HCZA 3ZMKA 3F9UA 3GX8A 1N2AA 1WIKA 2H72A 1EEJA 4NV2A 2WW1A 3F8UA 4XS4B 3LORA 2C3TA 1XVQA 4FYCA 3IAM2 2H1AA 3A5WA 2H75A 1B8XA 3GKKA 3IR4A 3APQA 2ON5A 1OKDA 1X5DA 2VAFA 3C71A 3GSTA 1K0DA 1M2AA 1S3AA 3F6DA 2JL4A 4Q5RA 4GLTA 1GNWA 4TOPA 1EEMA 1I1IP 5HR2A 1JLVA 2O87A 1YF0A 3HZ4A 1FB0A 1OC3A 3DGQA 4LA1A 3GKMA 3IHQA 3TKSE 2PU9C 3TOTA 3QD9A 4ZB9A 1HNBA 5A5HA 4EF0A 3Q19A 2HZEA 2GSRA 4KGIA 3QOUA 2X8HA 4MNNA 2PUKC 5A4VA 1VGLA 1GLPA 2ZUPA 3HDCA 3ZMLA 4DEJA 3IXRA 5IMDA 3KCMA 2YV9A 3GL3A 5ECIB 1MDJA 3O3TA 1R26A 1AW9A 2A2PA 3GUSA 3QAVA 1NW2A 4MF7A 3C8EA 1TRVA 3KGKA 4KX4A 5DJMA 4NPBA 2B5EA 3IK7A 4CHSA 3CSHA 1XBSA 4IKHA 3F4SA 4YH2A 3RHBA 4OD7A 2HRKA 4XHMA 5ECMB 3CTGA 2H6ZA 4BL7B 5HR0A 2DJ1A 4PGTA 1T4ZA 2YN1A 1XOAA 1GTIA 2IN3A 1ZYNA 4G2EA 1HQOA 5AN1A 2VO4A 2L6CA 2YWMA 4HEA2 4PHZC 3UOMA 4J57E 3IK9A 3ZFLA 2F3MA 4WKWA 1GSSA 3GN3A 2I4AA 3MWHA 1F37A 2JZSA 1FB6A 2FWHA 2IMFA 3IOSA 2KLXA 5DQYA 2N5FA 4LL1B 4F0CA 4NWYA 4H86A 4QMKA 3QFBC 2DMLA 3PH9A 5DBQA 3LXTA 1PL1A 5JCWA 1ERVA 1YEWC 4IVFA 3LYKA 4K5RA 2FNOA 3R3EA 2JZTA 1WWJA 3E9JB 2H8LA 3F4RA 2B6MA 2OBKA 1TXUA 3LFLA 1FG4A 1M9AA 1N8JA 1X9MB 2ES7A 2C3QA 4AF2A 3UBKA 4XRDA 2LJRA 1PN9A 5H5SA 4O7HA 1W89A 1T1VA 2O36A 5A1NA 2YZUA 1PD21 3M1GA 2XPDA 4F03A 3FK8A 4NMUA 3TJGA 2H1BA 9GSSA 4J56E 7GSSA 3CMIA 3BCIA 4CDOA 3G7JA 2DIZA 3HA9A 1F3AA 2XBQA 1UC7A 2CA8A 3ZITA 4F82A 5A4UA 3MIXA 4NHZA 1DUGA 2OE0A 4ZL8A 5F8BA 2V1MA 1I9DA 3L78A 5J40A 4I97A 3QPMA 2VLTA 3H93A 4K2XA 4XTSA 1J0FA 5J47A 5GSSA 2GQMA 4RI6A 3C73A 2DSAA 5J4UA 1V57A 2PVOC 5IIZA 3FZ9A 1XPVA 3UAPA 3ME8A 3IA1A 3I69A 2AJQB 5HR1A 3LSZA 1M0UA 4AKXB 5ELAA 2C3NA 5DQSA 2MYGA 1O85A 1LBKA 1K0AA 2CX4A 1NSWA 2GS3A 5KN1A 1BEDA 4BA7A 1M2DA 1TOFA 1WP0A 1O7UA 1TRWA 2O85A 3D4MA 4DSSB 3RBTA 1YZXA 4OO4A 2N5AA 4JZQA 4QL7A 2J9HA 2H01A 3GHAA 3VWVA 2LNTA 4GWRA 4HS1A 3AY8A 5ELGA 1K3OA 4LL4B 4MPFA 2ZCTA 4WETA 4D73B 1GTBA 4I5QA 4YQVA 5JWRB 2YZHA 1FAAA 3VFIA 5E59A 1OKTA 3FMWA 2UZ8A 1DBYA 1U3IA 3UJ1A 5IQYA 3CQFA 13GSA 2YV7A 3TUEA 3ZFBA 2H1LA 2HFDA 5IMZA 1YEXA 1QUWA 3KEBA 1JZDA 12GSA 5GAPD 8GSSA 2IIYA 3M9KA 1GUKA 1A2MA 2GDRA 1ST9A 2QKEA 3HJOA 3F4TA 2VCZA 4JE1A 3EPTA 4OO5A 5D73A 4ECIA 2WW3A 2WZ9A 1EOGA 3RPPA 4X43A 4WXTA 2H71A 6GSXA 1PX6A 3ZL5A 2C4JA 2N5BA 1K0MA 2H6YA 2FLSA 4BVYB 3D0ZA 4CW9A 2DJ3A 4I2TA 4MA9A 1SJ6A 2L5LA 3DVWA 4OFMA 2DJ2A 2FCHA 3CRUA 1T4YA 3A2VA 2NBSA 4RI7A 3WT2A 5LD0A 4FO5A 3P90A 1HNCA 3LWAA 1NHOA 4AI6A 5G2ZA 3TU3B 3L9SA 1YDKA 2MMOA 3U5RE 4HUAA 2H74A 4XS6A 4IN0A 3TRQA 4MK3A 2HI7A 3D21A 3KIJA 2VIMA 3F3QA 2QA2A 5KN2A 5IMAA 1SENA 5BRTA 1T00A 2WRTA 1TJDA 2VD0A 3U6VA 4O5RA 2V32A 4KE3A 5J5NA 4HI7A 4ILFA 4WR4A 4KH7A 2MBSA 4IP1A 1XWKA 3C7MA 4GQFA 2YPMA 3VI7A 1A8LA 2WFCA 1MTCA 4AJ7A 1G7OA 5L71A 4EIPA 2K9FA 4JBBA 1LJRA 1ZMAA 3M9JA 3E3EA 4K1FA 2LQOA 5DCHA 3PR8A 4EE0A 3HY2A 2EFDA 4KNDA 2O8VB 2PERA 1YQ1A 5IMCA 3RFRC 1VRSD 1SU9A 5KOWA 4BPYA 2P5RA 2C80A 3QFAC 2GZPA 1RQMA 4FIWA 1CQGA 3CBUA 1V2AA 4O5UA 2C8UA 2HYXA 1F9MA 3GRXA 4ICYA 4Z7XA 1XVWA 2YJHA 2HE3A 1R4WA 2GQLA 1M99A 5ID2B 3LJRA 1PKWA 1QGVA 1JFUA 4AGSA 3I6AA 4NAXA 1AQWA 1GSDA 4KSOA 4POKA 2GT6A 3LEFA 3MDKA 2R4VA 2L5OA 4V2NA 1Z9HA 1LU4A 20GSA 1ZYPA 1TK5B 2RIIA 2FGXA 3M3MA 5ECOB 3GKNA 2AAWA 3NOFA 1FO5A 1X9SB 5JWQB 1MDIA 4AKHA 2NTOA 2V6KA 2CVDA 5CAXA 5COHA 3A3TA 1K0NA 2M72A 1U6TA 4TW5A 3GA4A 2CT6A 4TXOA 1YF1A 3ZRDA 4E68A 3HVSA 4OWYA 3DWVA 4TR1A 1RK4A 1GRXA 4PQ1A 1XW6A 1G6WA 4DSRA 1PFOA 4KDXA 1GH2A 6GSVA 1SD9A 3APSA 4L0WA 2I81A 6GSSA 3EMPA 3KP9A 1UA5A 1A23A 2HZFA 1SK1A 1Z6NA 2AUVA 1V40A 4G9HA 2LTKA 4EDZA 4CY6A 2CZ2A 2QSIA 5A5HB 2IMDA 2WS2A 1G6YA 4ECCA 1ML6A 1WPIA 3SBCA 4LMWA 3FR9A 2PPTA 2LJKA 2X49A 3Q6OA 2CVBA 4W66A 5HFIA 3US3A 2F8AA 1SL0B 4EO3A 1AQVA 4GDFA 4FH8A 2MMNA 4LLRA 3APOA 1IYHA 3MYDA 2A2SA 2CAQA 22GSA 2UV8G 4X0XA 4RQRA 4ZB7A 5BMUA 2CAIA 3IRAA 4WF4A 2HSMA 2GLRA 4IQ1A 4ZB8A 5G31A 2R0GA 4GCIA 1Y25A 4K9ZA 4RQXA 4IJ3A 4N3ZA 2MMZA 1UVZA 4J2FA 3DD3A 2I1UA 1SVLA 4KW6A 1XFLA 3WYWA 4YAVA 1MEKA 3EWLA 3IV4A 1K0BA 3C1SA 5J9CA 2CQ9A 1ZOFA 3EYTA 4XS4A 1EP7A 3BOAA 5CRDA 4OMVA 5EVOA 2MMAA 2EFEA 4V2MA 1DE2A 2GGTA 4MMMA 2EFCA 2R2JA 3PINA 2HSNB 4TXVA 5EY6A 2C0GA 1WMJA 1U3AA 2XC2A 1YVLA 4TN8A 10GSA 5B8AA 3ZREA 3UVHA 2VL3A 2H0GA 2DC5A 5DCGA 3HVNA 5D9TA 4N10A 1U88A 4A5PA 2I3YA 2GSQA 4KA0A 4MABA 4YQUA 4MJEA 4AKIA 4O92A 5G5FA 1FVKA 5CYYA 1WRYA 3G9BA 4MJAA 5ECLB 2O3EA 4E8EA 2VL2A 2VL2C 5INYA 1SYXA 2C0DA 3UMAA 2ALBA 4PNFA 5IMFA 2YWOA 2VD1A 3P7XA 2R0CA 4XCSA 5IOWA 2X8CA 1PRXA 4ZILA 2GQKA 1GULA 1A2LA 1O81A 2BMXA 2F51A 2IWTA 3NIVA 1AQXA 1SL2B 4USSA 3KMOA 1Q4JA 2NPBA 3ZTLA 4WBJA 2R6KA 4O5QA 2WZSA 2HRAA 2DBCA 2JSYA 18GSA 5ECHB 3V1WA 1OE8A 4PNGA 1ZYEA 4IELA 1ILOA 5AIXA 4JR4A 3FHKA 1K3YA 2HT9A 3VWXA 4F0BA 2V41A 4L0UA 1J9BA 2IMEA 2AB6A 3EMXA 3F63A 3DIEA 2JACA 1T8EB 4YAPA 3A5IA 3GFKA 1SD8A 4IGJA 3GTUB 2GVPA 4BVXA 5H5RA 4MP4A 5ECRB 4GF0A 19GSA 3HHVA 1SVOA 2A4HA 1B9YC 2NVLA 4MLYA 3D4TA 2PGTA 2XPEA 5DALA 3HKRA 2V2GA 5CO3A 2L57A 2C1YA 4FYUA 3GSSA 2CV4A 5D9VA 5GSTA 1ERTA 4JR6A 4JU5A 2H76A 3MSZA 2KHPA 4PQHA 4GSTA 5G5EA 4GSNA 2AV4A 1A0RP 4GQCA 2DJKA 2OACA 4QL9A 1EZKA 4Z2TA 4N0VA 3BBYA 4KUNA 3RAZA 4GRFA 3I9V2 4EL1A 1OC8A 1FOVA 2TRXA 1S3RA 4N11A 1TRSA 2YWIA 1M2BA 4TR3A 4K8MA 5ECSA 2VLUA 1T3BA 1BG1A 1G0TA 3F6FA 1I5GA 2L4CA 2RM5A 3ERFA 1XWAA 3TOUA 4V1Ap 4K6XA 2RLIA 3VI5A 3FEUA 2H30A 4EVMA 1XWGA 4ECBA 1SK0A 5DAKB 3WGXA 4Z2UA 3D6IA 3LGCA 1URMA 3O76A 4IHUA 3LYPA 5B7CA 4IP6A 2CX3A 2LNSA 11GSA 1GSQA 1PKZA 3GURA 5DDLA 4OCEA 4DSSA 4AKGA 4HZ4A 3CHXC 1DE1A 3IC4A 3GX0A 1K0OA 4D73A 2TIRA 2QA1A 5IO2A 3HJPA 3FR3A 3G7YA 3HZ8A 4DSQA 4F2IA 2MZCA 4G10A 5HFGA 1H75A 4WF5A 3W8JA 4ISDA 1QMVA 1WJKA 3DMLA 1F3BA 2FA8A 4PTSA 1E6BA 6GSUA 1VF4A 2WB9A 2GSTA 3GMFA 1FVJA 3LG6A 1USBA 1Z5YE 2DKIA 1EP8A 1ABAA 1X0RA 2JU5A 2BTOT 1AIUA 5DJLA 2OE3A 2HRNA 2FD3A 2WULA 3N5OA 2VCTA 2F8FA 2G2QA 3GIXA 4EXJA 1E2YA 4MPGA 4WBRD 3HXSA 1V58A 2NDOA 5CNWA 1S3CA 4BVYA 4ID0A 3VPTA 2IMKA 3TRXA 1AC1A 1GSUA 1OYJA 2R3XA 5E4WA 1XZOA 2JADA 3P2AA 1QK8A 1SL1B 1GSYA 2OKAA 4MJBA 3FYGA 1GSFA 1A0FA 5F06A 1HYUA 1OVNA 1VF3A 2X64A 4ZL7A 4XS1A 4PXOA 3IC8A 3TJJA 1PL2A 1NM3A 5ECNB 1SKWB 3GNJA 4I2UA 3Q18A 3W6GA 4ZBDA 5IM9A 2RM6A 4K2DA 3IE3A 5FT3A 1AUCA 4K7OA 1JHBA 3WT1A 5A34B 2WVXB 4ZL9A 1WE0A 5AIVA 5D9WA 1PA3A 3KTBA 3F0IA 1PGTA 4K7NA 3H4KA 4KB3A 4DVCA 2EIQA 4TXOB 2LV3A 4GTUA 4QQ7A 1GL8A 4RUVA 3TKSC 2IJYA 3QR6A 4BIKA 3MNGA 3WD6A 3ZZXA 2E0QA 5LCZA 4PX1A 2H1DA 3GH6A 2IFQA 1QFNA 5JCUA 2GSSA 1Q98A 1RW1A 2PN8A 1XWBA 1XXUA 3KM6A 3TDGA 4G0LA 4V2LA 2FY6A 4PI2C 3M0FA 5CRWA 1GNEA 4EIQA 4L5OA 5JCGA 1K0CA 3FZAA 2FHEA 3Q74A 3DEXA 4PUFC 5CRHA 4K0GA 4BWSA 4MZCA 1M7TA 5D9XA 1ZGNA 3RHCA 1TDIA 4I6XA 3ZVJD 5J3RA 4E8HA 1BQ7A 2GZYA 2FWEA 5D8IA 2REMA 2H1GA 5B6MA 5B8BA 4HJ2A 5F07A 2PMTA 2XHFA 2XBIA 4TR4A 2OJLA 2X8GA 3KXOA 1AXDA 1YKCA 1TK0B 3J7Yk 2FWGA 1GP1A 3VWWA 4I8BA 1YJ6A 2ON7A 4K0NA 3VURA 5BMUB 3FR6A 2WVYA 5G30A 1THOA 1C72A 4N30A 4PURA 1X5CA 4IBPA 4POLA 1THXA 1BF5A 2HZEB 1Y1UA 1ACVA 2IMIA 5A4WA 1VF1A 2H66A 1ZCPA 4MZWA 1M9BA 3QAWA 5D93A 3EU4A 3BCKA 3EURA 5C04A 4EC0A 2IPAA 2B1LA 1IYIA 1SVMA 4P3YB 2LRNA 2WDUA 1Z3EA 3BD2A 2YNXA 3G7IA 4YKGA 1TXXA 3ED3A 3CTFA 3ERWA 1O8XA 2B7KA 3KJYA 2LKUA 1FHEA 3RGBC 1T7PB 1SYRA 3DYRA 2HLSA 2CZ3A 5IO0A 2HRKB 1TU8A 1OC9A 2KUCA 1QQ2A 3NZNA 4HU7A 2BJXA 1BX9A 2I9HA 4MF6A 2LRCA 3SWLA 3RDWA 2AYTA 6GSTA 2VM2A 5IPHA 3ZIJA 1S3DA 3FRCA 2PVQA 2A2RA 5HR3A 1GWCA 2B5XA 1EGOA 3P8WA 2J23A 5H5QA 3A2WA 4YKFA 2VCQA 2L59A 1XIYA 1XW5A 3TCOA 1M3IA 1TRUA 3MAKA 1O6JA 3PGTA 1V98A 2EFHA 5IPGA 1O73A 3TKRA 2M80A 2FUG2 4CY8A 1GTAA 1B4PA 4MDCA 1UN2A 1XWCA 2OE1A 2WCIA 5ECQB 3J7Yb 2O5VA 1TI3A 2B5YA 2VLVA 2YP6A 4MCUA 2VCWA 2HNLA 1EWXA 5A1NB 5ECPB 4HSCX 4NXIA 3DVXA 4XIHA 3QDNA 4OFTA 5IMVA 3UBLA 2R0PA 4HOJA 1ERUA 3TJKA 3UEMA 4POMA 2DKHA 3GYKA 3K8NA 2LJAA 1BJXA 1OAZA 5LNKe 2HSNA 5A5KA 1BAYA 3L0HA 2H70A
chains in the Genus database with same CATH topology
3LQ7A 2H0IA 1TK8B 1K3LA 5J4VA 3LXZA 4HZ2A 4WR5A 2M46A 4BVXB 2L6DA 2OA7A 3KD0A 4HDEA 4ZXGA 4MH3A 4AJ8A 1ZZYA 3EE2A 3DRNA 3N9JA 2VOCA 2YJ7A 2OADA 2VUPA 2KP2A 3C1RA 4MF5A 4K5SA 2VL9A 1Y6EA 1MD4A 2EIOA 2DJ0A 4BL7A 5DALB 3TRPA 4POBA 1HD2A 3CYNA 3LW9A 1VF2A 5D96A 4Q5FA 4Z2RA 4OFNA 3CSJA 4WEYA 5C00A 1KNGA 3UARA 3EC3A 3H1NA 5ECKB 2KOKA 5HQPA 4N0ZA 2HSHA 4KF9A 1ON4A 2LSTA 4L8EA 2D2ZA 1DSBA 4JEDA 5GZZB 1F2EA 4ZB6A 2H19A 4L5LA 3I43A 3HYPA 4MZBA 1YEPA 2O89A 1SJZA 3D22A 6GSWA 14GSA 4K7IA 4XRAA 2HQTA 2VM1A 4KDYA 3OR5A 3PPUA 2LS5A 3HJMA 3GKXA 2X4AA 1JZRA 1ZL9A 1KEBA 1XCCA 2EC4A 3WGDA 4F9ZA 2FA4A 1PN0A 3HMJG 5EL8A 1SKRB 2PBJA 17GSA 2VCVA 2HRFA 3ZVJA 4LMVA 1PSQA 2GT5A 1TI1A 4EUYA 5G1KA 3EVIA 2RUFA 5G1LA 2WJUA 3M8NA 3TGZA 5CREA 3KZQA 4HJMA 3QAGA 2WGRA 5JWOB 4KSMA 4JRRA 3VWUA 5KN3A 3GTUA 1V9WA 2DJJA 3GL5A 3TJBA 5FWGA 4HU9A 3UL3A 4GSSA 5J4YA 1MD3A 2K18A 2C0FA 2LUSA 1PQNA 2P5QA 4NHWA 2KP1A 2JSZA 1EOHA 4FQUA 1ZYQB 2DMMA 1HNAA 1A2JA 3FZ5A 5CRGA 1H4OA 1GUHA 4ZBAA 4IQAA 3RPNA 3UVTA 2R5GA 2YWNA 4MH2A 1PX7A 2QGVA 2B3SA 3QCPA 4G01A 4V1Ag 3ISOA 5EPFA 4ULXA 3ERGA 1JZWA 2HSYA 1SK2A 4BWQA 2YCDA 1W4VA 1PMTA 4IS0A 4TVEA 2RUEA 3FY7A 2L4QA 4EDYA 2YOIA 3TJFA 5J9BA 3IBHA 5IOXA 1BG5A 1R5AA 1A8YA 1CQHA 2OT3A 2Z9SA 4HQZA 1QXHA 3IAS2 4AJ6A 4ML6A 4O32A 3CRTA 4IJIA 6GSYA 4G19A 2LRTA 5KEJA 5AGYA 3R2QA 3O6TA 3WGEA 2E2GA 2FWFA 2TRCP 2F9SA 2C0EA 3H79A 4PQIA 2R37A 4PUAA 4Q5QA 2H0HA 5KN0A 4IW9A 3VLNA 1A24A 3F3RA 1B48A 1XW9A 1TU7A 5DAKA 3FZ4A 1SKSB 3W8SA 5FHIA 1R5PA 4EKZA 2DLXA 3TKQA 3IDVA 4GXZA 3CXGA 3HVXA 3CWGA 1YY7A 3DXBA 2HXKA 4ML1A 5ABRA 1GSEA 3EINA 3VK9A 3KH9A 2MBTA 2B7JA 1J08A 2ZNMA 2PWJA 5AISA 4MJCA 4X1UA 1WOUA 1X5EA 2GZZA 5HFKA 4KAEA 1GUMA 2G0FA 1AAZA 5DVBA 2IFQB 2YANA 2AHEA 1FOHA 3ZIVA 1G7EA 3L9UA 3JCML 1GLQA 4NV5A 1TKDB 3L4NA 2IL3A 1N25A 1YKAA 4KDUA 2VKZG 2QC7A 3CSIA 4ACSA 3A2XA 3HVVA 3TKPA 4KCAA 3ZYWA 2VCXA 1TP9A 1Z7RA 1Z7PA 1XOBA 1EGRA 4HQSA 3S9FA 3H8QA 5KOXA 4TKYA 2JZRA 3TKSA 2LQQA 3IHGA 4TR1B 2X99A 5F05A 5F0GA 4Q5NA 1TTZA 2P31A 2OBIA 2EIRA 3KH7A 3DKSA 1EV9A 3HD5A 2A4VA 16GSA 2O7KA 4OCFA 4ZBBA 2CVKA 2K6VA 2DIYA 1BYEA 3EU3A 3ME7A 4TR0A 3IPZA 4KCEA 4YQMA 4ZIJA 1GTUA 2H6XA 1NHYA 1MDKA 4X4JA 1ERWA 3BJ5A 2V6OA 2E2MA 3QMXA 3TB2A 5GAND 3GV1A 1SJIA 1OE7A 5A34A 3D5JA 4TRXA 3UIWA 5J41A 1KTEA 2B1KA 2K8SA 3ZLPA 2E7PA 5ENUA 1FW1A 3VPQA 3FKFA 2H73A 3KP8A 3KMNA 4G0KA 3E0UA 5B6NA 1O8WA 1U87A 5CP1A 1TW9A 1KBNA 1JZOA 3KTLA 1B9XC 3FW2A 4ECJA 2K8VA 2HSMB 1B4QA 1X9WB 5ID2A 1F6MC 3L9VA 1Z6MA 3GH9A 1OC9B 4FYBA 2LEGA 1EV4A 4G0IA 1R7HA 2P0GA 1JLWA 2GTUA 3HCZA 3ZMKA 3F9UA 3GX8A 1N2AA 1WIKA 2H72A 1EEJA 4NV2A 3F8UA 4XS4B 3LORA 2C3TA 1XVQA 4FYCA 3IAM2 2H1AA 3A5WA 2H75A 1B8XA 3GKKA 3IR4A 3APQA 2ON5A 1OKDA 1X5DA 2VAFA 3C71A 3GSTA 1K0DA 1M2AA 1S3AA 3F6DA 2JL4A 4Q5RA 4GLTA 1GNWA 4TOPA 1EEMA 5HR2A 1JLVA 2O87A 1YF0A 3HZ4A 1FB0A 1OC3A 3DGQA 4LA1A 3GKMA 3IHQA 3TKSE 2PU9C 3TOTA 3QD9A 4ZB9A 1HNBA 5A5HA 4EF0A 3Q19A 2HZEA 2GSRA 4KGIA 3QOUA 2X8HA 4MNNA 2PUKC 5A4VA 1VGLA 1GLPA 2ZUPA 3HDCA 3ZMLA 4DEJA 3IXRA 5IMDA 3KCMA 2YV9A 3GL3A 5ECIB 1MDJA 3O3TA 1R26A 1AW9A 2A2PA 3GUSA 3QAVA 1NW2A 4MF7A 3C8EA 1TRVA 3KGKA 4KX4A 5DJMA 4NPBA 2B5EA 3IK7A 4CHSA 3CSHA 1XBSA 4IKHA 3F4SA 4YH2A 3RHBA 4OD7A 2HRKA 4XHMA 5ECMB 3CTGA 2H6ZA 4BL7B 5HR0A 2DJ1A 4PGTA 1T4ZA 2YN1A 1XOAA 1GTIA 2IN3A 1ZYNA 4G2EA 1HQOA 5AN1A 2VO4A 2L6CA 2YWMA 4HEA2 3UOMA 4J57E 3IK9A 3ZFLA 2F3MA 4WKWA 1GSSA 3GN3A 2I4AA 3MWHA 1F37A 2JZSA 1FB6A 2FWHA 2IMFA 3IOSA 2KLXA 5DQYA 2N5FA 4LL1B 4F0CA 4NWYA 4H86A 4QMKA 3QFBC 2DMLA 3PH9A 5DBQA 3LXTA 1PL1A 5JCWA 1ERVA 4IVFA 3LYKA 4K5RA 2FNOA 3R3EA 2JZTA 1WWJA 3E9JB 2H8LA 3F4RA 2B6MA 2OBKA 1TXUA 3LFLA 1FG4A 1M9AA 1N8JA 1X9MB 2ES7A 2C3QA 4AF2A 3UBKA 4XRDA 2LJRA 1PN9A 5H5SA 4O7HA 1W89A 1T1VA 5A1NA 2YZUA 1PD21 3M1GA 2XPDA 4F03A 3FK8A 4NMUA 3TJGA 2H1BA 9GSSA 4J56E 7GSSA 3CMIA 3BCIA 4CDOA 3G7JA 2DIZA 3HA9A 1F3AA 2XBQA 1UC7A 2CA8A 3ZITA 4F82A 5A4UA 3MIXA 4NHZA 1DUGA 2OE0A 4ZL8A 5F8BA 2V1MA 1I9DA 3L78A 5J40A 4I97A 3QPMA 2VLTA 3H93A 4K2XA 4XTSA 1J0FA 5J47A 5GSSA 2GQMA 4RI6A 3C73A 2DSAA 5J4UA 1V57A 2PVOC 5IIZA 3FZ9A 1XPVA 3UAPA 3ME8A 3IA1A 3I69A 2AJQB 5HR1A 3LSZA 1M0UA 4AKXB 5ELAA 2C3NA 5DQSA 2MYGA 1O85A 1LBKA 1K0AA 2CX4A 1NSWA 2GS3A 5KN1A 1BEDA 4BA7A 1M2DA 1TOFA 1WP0A 1O7UA 1TRWA 2O85A 3D4MA 4DSSB 3RBTA 1YZXA 4OO4A 2N5AA 4JZQA 4QL7A 2J9HA 2H01A 3GHAA 3VWVA 2LNTA 4GWRA 4HS1A 3AY8A 5ELGA 1K3OA 4LL4B 4MPFA 2ZCTA 4WETA 4D73B 1GTBA 4I5QA 4YQVA 5JWRB 2YZHA 1FAAA 3VFIA 5E59A 1OKTA 3FMWA 2UZ8A 1DBYA 1U3IA 3UJ1A 5IQYA 13GSA 2YV7A 3TUEA 3ZFBA 2H1LA 2HFDA 5IMZA 1YEXA 1QUWA 3KEBA 1JZDA 12GSA 5GAPD 8GSSA 2IIYA 3M9KA 1GUKA 1A2MA 2GDRA 1ST9A 2QKEA 3HJOA 3F4TA 2VCZA 4JE1A 3EPTA 4OO5A 5D73A 4ECIA 2WZ9A 1EOGA 3RPPA 4X43A 4WXTA 2H71A 6GSXA 1PX6A 3ZL5A 2C4JA 2N5BA 1K0MA 2H6YA 2FLSA 4BVYB 3D0ZA 4CW9A 2DJ3A 4I2TA 4MA9A 1SJ6A 2L5LA 3DVWA 4OFMA 2DJ2A 2FCHA 3CRUA 1T4YA 3A2VA 2NBSA 4RI7A 3WT2A 5LD0A 4FO5A 3P90A 1HNCA 3LWAA 1NHOA 4AI6A 5G2ZA 3TU3B 3L9SA 1YDKA 2MMOA 3U5RE 4HUAA 2H74A 4XS6A 4IN0A 3TRQA 4MK3A 2HI7A 3D21A 3KIJA 2VIMA 3F3QA 2QA2A 5KN2A 5IMAA 1SENA 5BRTA 1T00A 2WRTA 1TJDA 2VD0A 3U6VA 4O5RA 2V32A 4KE3A 5J5NA 4HI7A 4ILFA 4WR4A 4KH7A 2MBSA 4IP1A 1XWKA 3C7MA 4GQFA 2YPMA 3VI7A 1A8LA 2WFCA 1MTCA 4AJ7A 1G7OA 5L71A 4EIPA 2K9FA 4JBBA 1LJRA 1ZMAA 3M9JA 3E3EA 4K1FA 2LQOA 5DCHA 3PR8A 4EE0A 3HY2A 2EFDA 4KNDA 2O8VB 2PERA 1YQ1A 5IMCA 1VRSD 1SU9A 5KOWA 4BPYA 2P5RA 2C80A 3QFAC 2GZPA 1RQMA 4FIWA 1CQGA 3CBUA 1V2AA 4O5UA 2C8UA 2HYXA 1F9MA 3GRXA 4ICYA 4Z7XA 1XVWA 2YJHA 2HE3A 1R4WA 2GQLA 1M99A 5ID2B 3LJRA 1PKWA 1QGVA 1JFUA 4AGSA 3I6AA 4NAXA 1AQWA 1GSDA 4KSOA 4POKA 2GT6A 3LEFA 3MDKA 2R4VA 2L5OA 4V2NA 1Z9HA 1LU4A 20GSA 1ZYPA 1TK5B 2RIIA 2FGXA 3M3MA 5ECOB 3GKNA 2AAWA 3NOFA 1FO5A 1X9SB 5JWQB 1MDIA 4AKHA 2NTOA 2V6KA 2CVDA 5CAXA 5COHA 3A3TA 1K0NA 2M72A 1U6TA 4TW5A 3GA4A 2CT6A 4TXOA 1YF1A 3ZRDA 4E68A 3HVSA 4OWYA 3DWVA 4TR1A 1RK4A 1GRXA 4PQ1A 1XW6A 1G6WA 4DSRA 4KDXA 1GH2A 6GSVA 1SD9A 3APSA 4L0WA 2I81A 6GSSA 3EMPA 3KP9A 1UA5A 1A23A 2HZFA 1SK1A 1Z6NA 2AUVA 1V40A 4G9HA 2LTKA 4EDZA 4CY6A 2CZ2A 2QSIA 5A5HB 2IMDA 2WS2A 1G6YA 4ECCA 1ML6A 1WPIA 3SBCA 4LMWA 3FR9A 2PPTA 2LJKA 2X49A 3Q6OA 2CVBA 4W66A 5HFIA 3US3A 2F8AA 1SL0B 4EO3A 1AQVA 4GDFA 4FH8A 2MMNA 4LLRA 3APOA 1IYHA 3MYDA 2A2SA 2CAQA 22GSA 2UV8G 4X0XA 4RQRA 4ZB7A 5BMUA 2CAIA 3IRAA 4WF4A 2HSMA 2GLRA 4IQ1A 4ZB8A 5G31A 2R0GA 4GCIA 1Y25A 4K9ZA 4RQXA 4IJ3A 4N3ZA 2MMZA 1UVZA 4J2FA 3DD3A 2I1UA 1SVLA 4KW6A 1XFLA 3WYWA 4YAVA 1MEKA 3EWLA 3IV4A 1K0BA 3C1SA 5J9CA 2CQ9A 1ZOFA 3EYTA 4XS4A 1EP7A 3BOAA 5CRDA 4OMVA 5EVOA 2MMAA 2EFEA 4V2MA 1DE2A 2GGTA 4MMMA 2EFCA 2R2JA 3PINA 2HSNB 4TXVA 5EY6A 2C0GA 1WMJA 1U3AA 2XC2A 1YVLA 4TN8A 10GSA 5B8AA 3ZREA 3UVHA 2VL3A 2H0GA 2DC5A 5DCGA 5D9TA 4N10A 1U88A 4A5PA 2I3YA 2GSQA 4KA0A 4MABA 4YQUA 4MJEA 4AKIA 4O92A 5G5FA 1FVKA 5CYYA 1WRYA 3G9BA 4MJAA 5ECLB 4E8EA 2VL2A 2VL2C 5INYA 1SYXA 2C0DA 3UMAA 2ALBA 4PNFA 5IMFA 2YWOA 2VD1A 3P7XA 2R0CA 4XCSA 5IOWA 2X8CA 1PRXA 4ZILA 2GQKA 1GULA 1A2LA 1O81A 2BMXA 2F51A 2IWTA 3NIVA 1AQXA 1SL2B 4USSA 3KMOA 1Q4JA 2NPBA 3ZTLA 4WBJA 2R6KA 4O5QA 2HRAA 2DBCA 2JSYA 18GSA 5ECHB 3V1WA 1OE8A 4PNGA 1ZYEA 4IELA 1ILOA 5AIXA 4JR4A 3FHKA 1K3YA 2HT9A 3VWXA 4F0BA 2V41A 4L0UA 1J9BA 2IMEA 2AB6A 3EMXA 3F63A 3DIEA 2JACA 1T8EB 4YAPA 3A5IA 3GFKA 1SD8A 4IGJA 3GTUB 2GVPA 4BVXA 5H5RA 4MP4A 5ECRB 4GF0A 19GSA 3HHVA 1SVOA 2A4HA 1B9YC 2NVLA 4MLYA 3D4TA 2PGTA 2XPEA 5DALA 3HKRA 2V2GA 5CO3A 2L57A 2C1YA 4FYUA 3GSSA 2CV4A 5D9VA 5GSTA 1ERTA 4JR6A 4JU5A 2H76A 3MSZA 2KHPA 4PQHA 4GSTA 5G5EA 4GSNA 2AV4A 1A0RP 4GQCA 2DJKA 2OACA 4QL9A 1EZKA 4Z2TA 4N0VA 3BBYA 4KUNA 3RAZA 4GRFA 3I9V2 4EL1A 1OC8A 1FOVA 2TRXA 4N11A 1TRSA 2YWIA 1M2BA 4TR3A 4K8MA 5ECSA 2VLUA 1T3BA 1BG1A 1G0TA 3F6FA 1I5GA 2L4CA 2RM5A 3ERFA 1XWAA 3TOUA 4V1Ap 4K6XA 2RLIA 3VI5A 3FEUA 2H30A 4EVMA 1XWGA 4ECBA 1SK0A 5DAKB 3WGXA 4Z2UA 3D6IA 3LGCA 1URMA 3O76A 4IHUA 3LYPA 5B7CA 4IP6A 2CX3A 2LNSA 11GSA 1GSQA 1PKZA 3GURA 5DDLA 4OCEA 4DSSA 4AKGA 4HZ4A 1DE1A 3IC4A 3GX0A 1K0OA 4D73A 2TIRA 2QA1A 5IO2A 3HJPA 3FR3A 3G7YA 3HZ8A 4DSQA 4F2IA 2MZCA 4G10A 5HFGA 1H75A 4WF5A 3W8JA 4ISDA 1QMVA 1WJKA 3DMLA 1F3BA 2FA8A 4PTSA 1E6BA 6GSUA 1VF4A 2WB9A 2GSTA 3GMFA 1FVJA 3LG6A 1USBA 1Z5YE 2DKIA 1EP8A 1ABAA 1X0RA 2JU5A 2BTOT 1AIUA 5DJLA 2OE3A 2HRNA 2FD3A 2WULA 3N5OA 2VCTA 2F8FA 2G2QA 3GIXA 4EXJA 1E2YA 4MPGA 4WBRD 3HXSA 1V58A 2NDOA 5CNWA 1S3CA 4BVYA 4ID0A 3VPTA 2IMKA 3TRXA 1AC1A 1GSUA 1OYJA 2R3XA 5E4WA 1XZOA 2JADA 3P2AA 1QK8A 1SL1B 1GSYA 2OKAA 4MJBA 3FYGA 1GSFA 1A0FA 5F06A 1HYUA 1OVNA 1VF3A 2X64A 4ZL7A 4XS1A 4PXOA 3IC8A 3TJJA 1PL2A 1NM3A 5ECNB 1SKWB 3GNJA 4I2UA 3Q18A 3W6GA 4ZBDA 5IM9A 2RM6A 4K2DA 3IE3A 5FT3A 1AUCA 4K7OA 1JHBA 3WT1A 5A34B 4ZL9A 1WE0A 5AIVA 5D9WA 1PA3A 3KTBA 3F0IA 1PGTA 4K7NA 3H4KA 4KB3A 4DVCA 2EIQA 4TXOB 2LV3A 4GTUA 4QQ7A 1GL8A 4RUVA 3TKSC 2IJYA 3QR6A 3MNGA 3WD6A 3ZZXA 2E0QA 5LCZA 4PX1A 2H1DA 3GH6A 2IFQA 1QFNA 5JCUA 2GSSA 1Q98A 1RW1A 2PN8A 1XWBA 1XXUA 3KM6A 3TDGA 4G0LA 4V2LA 2FY6A 3M0FA 5CRWA 1GNEA 4EIQA 4L5OA 5JCGA 1K0CA 3FZAA 2FHEA 3Q74A 3DEXA 4PUFC 5CRHA 4K0GA 4BWSA 4MZCA 1M7TA 5D9XA 1ZGNA 3RHCA 1TDIA 4I6XA 3ZVJD 5J3RA 4E8HA 1BQ7A 2GZYA 2FWEA 5D8IA 2REMA 2H1GA 5B6MA 5B8BA 4HJ2A 5F07A 2PMTA 2XHFA 2XBIA 4TR4A 2OJLA 2X8GA 3KXOA 1AXDA 1YKCA 1TK0B 3J7Yk 2FWGA 1GP1A 3VWWA 4I8BA 1YJ6A 2ON7A 4K0NA 3VURA 5BMUB 3FR6A 5G30A 1THOA 1C72A 4N30A 4PURA 1X5CA 4IBPA 4POLA 1THXA 1BF5A 2HZEB 1Y1UA 1ACVA 2IMIA 5A4WA 1VF1A 2H66A 1ZCPA 4MZWA 1M9BA 3QAWA 5D93A 3EU4A 3BCKA 3EURA 5C04A 4EC0A 2IPAA 2B1LA 1IYIA 1SVMA 4P3YB 2LRNA 2WDUA 1Z3EA 3BD2A 2YNXA 3G7IA 4YKGA 1TXXA 3ED3A 3CTFA 3ERWA 1O8XA 2B7KA 3KJYA 2LKUA 1FHEA 1T7PB 1SYRA 3DYRA 2HLSA 2CZ3A 5IO0A 2HRKB 1TU8A 1OC9A 2KUCA 1QQ2A 3NZNA 4HU7A 2BJXA 1BX9A 2I9HA 4MF6A 2LRCA 3SWLA 3RDWA 2AYTA 6GSTA 2VM2A 5IPHA 3ZIJA 1S3DA 3FRCA 2PVQA 2A2RA 5HR3A 1GWCA 2B5XA 1EGOA 3P8WA 2J23A 5H5QA 3A2WA 4YKFA 2VCQA 2L59A 1XIYA 1XW5A 3TCOA 1TRUA 3MAKA 1O6JA 3PGTA 1V98A 2EFHA 5IPGA 1O73A 3TKRA 2M80A 2FUG2 4CY8A 1GTAA 1B4PA 4MDCA 1UN2A 1XWCA 2OE1A 2WCIA 5ECQB 3J7Yb 2O5VA 1TI3A 2B5YA 2VLVA 2YP6A 4MCUA 2VCWA 2HNLA 1EWXA 5A1NB 5ECPB 4NXIA 3DVXA 4XIHA 3QDNA 4OFTA 5IMVA 3UBLA 2R0PA 4HOJA 1ERUA 3TJKA 3UEMA 4POMA 2DKHA 3GYKA 3K8NA 2LJAA 1BJXA 1OAZA 5LNKe 2HSNA 5A5KA 1BAYA 3L0HA 2H70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LQ7 A;  2H0I A;  1TK8 B;  1K3L A;  3LXZ A;  4HZ2 A;  4WR5 A;  2M46 A;  4BVX B;  2L6D A;  2OA7 A;  3KD0 A;  4HDE A;  4ZXG A;  4MH3 A;  4AJ8 A;  1ZZY A;  3EE2 A;  3DRN A;  3N9J A;  2VOC A;  2YJ7 A;  2OAD A;  2VUP A;  2KP2 A;  3C1R A;  4MF5 A;  2VL9 A;  1Y6E A;  1MD4 A;  2EIO A;  2DJ0 A;  4BL7 A;  5DAL B;  3TRP A;  4POB A;  1HD2 A;  3CYN A;  1VF2 A;  5D96 A;  4Q5F A;  4OFN A;  3CSJ A;  4WEY A;  5C00 A;  1KNG A;  3UAR A;  3EC3 A;  3H1N A;  5ECK B;  2KOK A;  5HQP A;  4N0Z A;  2HSH A;  4KF9 A;  1ON4 A;  2LST A;  4L8E A;  2D2Z A;  1DSB A;  4JED A;  5GZZ B;  1F2E A;  4ZB6 A;  2H19 A;  4L5L A;  3I43 A;  3HYP A;  4MZB A;  1YEP A;  2O89 A;  1SJZ A;  3D22 A;  6GSW A;  14GS A;  4K7I A;  4XRA A;  2HQT A;  2VM1 A;  4KDY A;  3OR5 A;  3PPU A;  2LS5 A;  3HJM A;  3GKX A;  1JZR A;  1ZL9 A;  1KEB A;  1XCC A;  2EC4 A;  3WGD A;  4F9Z A;  2FA4 A;  5EL8 A;  1SKR B;  2PBJ A;  17GS A;  2VCV A;  2HRF A;  3ZVJ A;  4LMV A;  1PSQ A;  2GT5 A;  1TI1 A;  4EUY A;  5G1K A;  3EVI A;  2RUF A;  5G1L A;  2WJU A;  3M8N A;  3TGZ A;  5CRE A;  3KZQ A;  4HJM A;  3QAG A;  2WGR A;  5JWO B;  4KSM A;  4JRR A;  3VWU A;  5KN3 A;  3GTU A;  1V9W A;  2DJJ A;  3GL5 A;  3TJB A;  5FWG A;  4HU9 A;  3UL3 A;  4GSS A;  1MD3 A;  2K18 A;  2C0F A;  2LUS A;  1PQN A;  2P5Q A;  4NHW A;  2KP1 A;  2JSZ A;  1EOH A;  4FQU A;  1ZYQ B;  2DMM A;  1HNA A;  1A2J A;  3FZ5 A;  5CRG A;  1H4O A;  1GUH A;  4ZBA A;  4IQA A;  3RPN A;  3UVT A;  2R5G A;  2YWN A;  4MH2 A;  1PX7 A;  2QGV A;  2B3S A;  3QCP A;  4V1A g;  3ISO A;  5EPF A;  4ULX A;  3ERG A;  1JZW A;  2HSY A;  1SK2 A;  4BWQ A;  2YCD A;  1W4V A;  1PMT A;  4IS0 A;  4TVE A;  2RUE A;  3FY7 A;  2L4Q A;  4EDY A;  2YOI A;  3TJF A;  5J9B A;  3IBH A;  5IOX A;  1BG5 A;  1R5A A;  1A8Y A;  1CQH A;  2Z9S A;  4HQZ A;  1QXH A;  3IAS 2;  4AJ6 A;  4ML6 A;  4O32 A;  3CRT A;  4IJI A;  6GSY A;  4G19 A;  2LRT A;  5KEJ A;  5AGY A;  3R2Q A;  3O6T A;  3WGE A;  2E2G A;  2FWF A;  2TRC P;  2F9S A;  2C0E A;  3H79 A;  4PQI A;  2R37 A;  4PUA A;  4Q5Q A;  2H0H A;  5KN0 A;  4IW9 A;  3VLN A;  1A24 A;  3F3R A;  1B48 A;  1XW9 A;  1TU7 A;  5DAK A;  3FZ4 A;  1SKS B;  3W8S A;  5FHI A;  1R5P A;  4EKZ A;  2DLX A;  3TKQ A;  3IDV A;  4GXZ A;  3CXG A;  3HVX A;  1YY7 A;  3DXB A;  2HXK A;  4ML1 A;  5ABR A;  1GSE A;  3EIN A;  3VK9 A;  3KH9 A;  2MBT A;  2B7J A;  1J08 A;  2ZNM A;  2PWJ A;  5AIS A;  4MJC A;  4X1U A;  1WOU A;  1X5E A;  2GZZ A;  5HFK A;  4KAE A;  1GUM A;  2G0F A;  1AAZ A;  5DVB A;  2IFQ B;  2YAN A;  2AHE A;  3ZIV A;  1G7E A;  3L9U A;  3JCM L;  1GLQ A;  4NV5 A;  1TKD B;  3L4N A;  2IL3 A;  1YKA A;  4KDU A;  2QC7 A;  3CSI A;  4ACS A;  3A2X A;  3HVV A;  3TKP A;  4KCA A;  3ZYW A;  2VCX A;  1TP9 A;  1Z7R A;  1Z7P A;  1XOB A;  1EGR A;  4HQS A;  3S9F A;  3H8Q A;  4TKY A;  2JZR A;  3TKS A;  2LQQ A;  4TR1 B;  2X99 A;  5F05 A;  5F0G A;  4Q5N A;  1TTZ A;  2P31 A;  2OBI A;  2EIR A;  3KH7 A;  3DKS A;  1EV9 A;  3HD5 A;  2A4V A;  16GS A;  2O7K A;  4OCF A;  4ZBB A;  2CVK A;  2K6V A;  2DIY A;  1BYE A;  3EU3 A;  3ME7 A;  4TR0 A;  3IPZ A;  4KCE A;  4YQM A;  4ZIJ A;  1GTU A;  2H6X A;  1NHY A;  1MDK A;  1ERW A;  3BJ5 A;  2V6O A;  2E2M A;  3QMX A;  3TB2 A;  5GAN D;  3GV1 A;  1SJI A;  1OE7 A;  3D5J A;  4TRX A;  3UIW A;  5J41 A;  1KTE A;  2B1K A;  2K8S A;  3ZLP A;  2E7P A;  5ENU A;  1FW1 A;  3VPQ A;  3FKF A;  2H73 A;  3KP8 A;  3KMN A;  4G0K A;  3E0U A;  5B6N A;  1O8W A;  1U87 A;  5CP1 A;  1TW9 A;  1KBN A;  1JZO A;  3KTL A;  1B9X C;  3FW2 A;  4ECJ A;  2K8V A;  2HSM B;  1B4Q A;  1X9W B;  5ID2 A;  1F6M C;  3L9V A;  1Z6M A;  3GH9 A;  1OC9 B;  4FYB A;  2LEG A;  1EV4 A;  4G0I A;  1R7H A;  2P0G A;  1JLW A;  2GTU A;  3HCZ A;  3ZMK A;  3F9U A;  3GX8 A;  1N2A A;  1WIK A;  2H72 A;  1EEJ A;  4NV2 A;  3F8U A;  4XS4 B;  3LOR A;  2C3T A;  1XVQ A;  4FYC A;  3IAM 2;  2H1A A;  3A5W A;  2H75 A;  1B8X A;  3GKK A;  3IR4 A;  3APQ A;  2ON5 A;  1OKD A;  1X5D A;  2VAF A;  3C71 A;  3GST A;  1K0D A;  1M2A A;  1S3A A;  3F6D A;  2JL4 A;  4Q5R A;  4GLT A;  1GNW A;  4TOP A;  1EEM A;  5HR2 A;  1JLV A;  2O87 A;  1YF0 A;  3HZ4 A;  1FB0 A;  1OC3 A;  3DGQ A;  4LA1 A;  3GKM A;  3IHQ A;  3TKS E;  2PU9 C;  3TOT A;  3QD9 A;  4ZB9 A;  1HNB A;  4EF0 A;  3Q19 A;  2HZE A;  2GSR A;  4KGI A;  3QOU A;  2X8H A;  2PUK C;  5A4V A;  1VGL A;  1GLP A;  2ZUP A;  3HDC A;  3ZML A;  4DEJ A;  3IXR A;  5IMD A;  3KCM A;  2YV9 A;  3GL3 A;  5ECI B;  1MDJ A;  3O3T A;  1R26 A;  1AW9 A;  3GUS A;  3QAV A;  1NW2 A;  4MF7 A;  3C8E A;  1TRV A;  3KGK A;  4KX4 A;  5DJM A;  4NPB A;  2B5E A;  3IK7 A;  4CHS A;  3CSH A;  1XBS A;  4IKH A;  3F4S A;  4YH2 A;  3RHB A;  4OD7 A;  2HRK A;  4XHM A;  5ECM B;  3CTG A;  2H6Z A;  4BL7 B;  5HR0 A;  2DJ1 A;  4PGT A;  1T4Z A;  2YN1 A;  1XOA A;  1GTI A;  2IN3 A;  4G2E A;  1HQO A;  5AN1 A;  2VO4 A;  2L6C A;  2YWM A;  4HEA 2;  3UOM A;  4J57 E;  3IK9 A;  3ZFL A;  2F3M A;  4WKW A;  1GSS A;  3GN3 A;  2I4A A;  3MWH A;  1F37 A;  2JZS A;  1FB6 A;  2FWH A;  2IMF A;  3IOS A;  2KLX A;  5DQY A;  2N5F A;  4LL1 B;  4F0C A;  4NWY A;  4H86 A;  3QFB C;  2DML A;  3PH9 A;  5DBQ A;  3LXT A;  1PL1 A;  5JCW A;  1ERV A;  4IVF A;  3LYK A;  2FNO A;  3R3E A;  2JZT A;  1WWJ A;  3E9J B;  2H8L A;  3F4R A;  2B6M A;  2OBK A;  3LFL A;  1FG4 A;  1M9A A;  1N8J A;  1X9M B;  2ES7 A;  2C3Q A;  4AF2 A;  3UBK A;  4XRD A;  2LJR A;  1PN9 A;  5H5S A;  4O7H A;  1W89 A;  1T1V A;  2YZU A;  1PD2 1;  3M1G A;  2XPD A;  4F03 A;  3FK8 A;  4NMU A;  3TJG A;  2H1B A;  9GSS A;  4J56 E;  7GSS A;  3CMI A;  3BCI A;  4CDO A;  3G7J A;  2DIZ A;  3HA9 A;  1F3A A;  2XBQ A;  1UC7 A;  2CA8 A;  3ZIT A;  4F82 A;  5A4U A;  4NHZ A;  1DUG A;  2OE0 A;  4ZL8 A;  5F8B A;  2V1M A;  1I9D A;  3L78 A;  4I97 A;  3QPM A;  2VLT A;  3H93 A;  4XTS A;  1J0F A;  5GSS A;  2GQM A;  4RI6 A;  3C73 A;  2DSA A;  5J4U A;  1V57 A;  2PVO C;  5IIZ A;  3FZ9 A;  1XPV A;  3UAP A;  3ME8 A;  3IA1 A;  3I69 A;  2AJQ B;  5HR1 A;  3LSZ A;  1M0U A;  5ELA A;  2C3N A;  5DQS A;  2MYG A;  1O85 A;  1LBK A;  1K0A A;  2CX4 A;  1NSW A;  2GS3 A;  5KN1 A;  1BED A;  4BA7 A;  1M2D A;  1TOF A;  1WP0 A;  1O7U A;  1TRW A;  2O85 A;  3D4M A;  4DSS B;  3RBT A;  1YZX A;  4OO4 A;  2N5A A;  4JZQ A;  4QL7 A;  2J9H A;  2H01 A;  3GHA A;  3VWV A;  2LNT A;  4GWR A;  4HS1 A;  3AY8 A;  5ELG A;  1K3O A;  4LL4 B;  4MPF A;  2ZCT A;  4WET A;  4D73 B;  1GTB A;  4I5Q A;  4YQV A;  5JWR B;  2YZH A;  1FAA A;  3VFI A;  5E59 A;  1OKT A;  2UZ8 A;  1DBY A;  1U3I A;  3UJ1 A;  5IQY A;  13GS A;  2YV7 A;  3TUE A;  3ZFB A;  2HFD A;  5IMZ A;  1YEX A;  1QUW A;  3KEB A;  1JZD A;  12GS A;  5GAP D;  8GSS A;  2IIY A;  3M9K A;  1GUK A;  1A2M A;  2GDR A;  1ST9 A;  2QKE A;  3HJO A;  3F4T A;  2VCZ A;  4JE1 A;  4OO5 A;  5D73 A;  4ECI A;  2WZ9 A;  1EOG A;  3RPP A;  4X43 A;  4WXT A;  2H71 A;  6GSX A;  1PX6 A;  3ZL5 A;  2C4J A;  2N5B A;  1K0M A;  2H6Y A;  2FLS A;  4BVY B;  3D0Z A;  4CW9 A;  2DJ3 A;  4I2T A;  4MA9 A;  1SJ6 A;  2L5L A;  3DVW A;  4OFM A;  2DJ2 A;  2FCH A;  3CRU A;  1T4Y A;  3A2V A;  2NBS A;  4RI7 A;  3WT2 A;  5LD0 A;  4FO5 A;  3P90 A;  1HNC A;  3LWA A;  1NHO A;  5G2Z A;  3L9S A;  1YDK A;  2MMO A;  3U5R E;  4HUA A;  2H74 A;  4XS6 A;  4IN0 A;  3TRQ A;  4MK3 A;  2HI7 A;  3D21 A;  3KIJ A;  2VIM A;  3F3Q A;  5KN2 A;  5IMA A;  1SEN A;  1T00 A;  2WRT A;  1TJD A;  2VD0 A;  3U6V A;  4O5R A;  2V32 A;  4KE3 A;  5J5N A;  4HI7 A;  4ILF A;  4WR4 A;  4KH7 A;  2MBS A;  4IP1 A;  1XWK A;  3C7M A;  4GQF A;  2YPM A;  3VI7 A;  1A8L A;  2WFC A;  1MTC A;  4AJ7 A;  1G7O A;  5L71 A;  2K9F A;  4JBB A;  1LJR A;  1ZMA A;  3M9J A;  3E3E A;  4K1F A;  2LQO A;  5DCH A;  3PR8 A;  4EE0 A;  3HY2 A;  4KND A;  2O8V B;  2PER A;  1YQ1 A;  5IMC A;  1VRS D;  1SU9 A;  4BPY A;  2P5R A;  2C80 A;  3QFA C;  2GZP A;  1RQM A;  4FIW A;  1CQG A;  3CBU A;  1V2A A;  2C8U A;  2HYX A;  1F9M A;  3GRX A;  4Z7X A;  1XVW A;  2YJH A;  2HE3 A;  1R4W A;  2GQL A;  1M99 A;  5ID2 B;  3LJR A;  1PKW A;  1QGV A;  1JFU A;  4AGS A;  3I6A A;  4NAX A;  1AQW A;  1GSD A;  4KSO A;  4POK A;  2GT6 A;  3LEF A;  3MDK A;  2R4V A;  2L5O A;  4V2N A;  1Z9H A;  1LU4 A;  20GS A;  1TK5 B;  2RII A;  2FGX A;  3M3M A;  5ECO B;  3GKN A;  2AAW A;  3NOF A;  1FO5 A;  1X9S B;  5JWQ B;  1MDI A;  2NTO A;  2V6K A;  2CVD A;  5CAX A;  5COH A;  3A3T A;  1K0N A;  2M72 A;  1U6T A;  4TW5 A;  3GA4 A;  2CT6 A;  4TXO A;  1YF1 A;  3ZRD A;  3HVS A;  4OWY A;  3DWV A;  4TR1 A;  1RK4 A;  1GRX A;  4PQ1 A;  1XW6 A;  1G6W A;  4DSR A;  4KDX A;  1GH2 A;  6GSV A;  1SD9 A;  3APS A;  4L0W A;  2I81 A;  6GSS A;  3EMP A;  3KP9 A;  1UA5 A;  1A23 A;  2HZF A;  1SK1 A;  1Z6N A;  2AUV A;  1V40 A;  4G9H A;  2LTK A;  4EDZ A;  2CZ2 A;  2QSI A;  2IMD A;  2WS2 A;  1G6Y A;  4ECC A;  1ML6 A;  1WPI A;  3SBC A;  4LMW A;  3FR9 A;  2PPT A;  2LJK A;  3Q6O A;  2CVB A;  5HFI A;  3US3 A;  2F8A A;  1SL0 B;  4EO3 A;  1AQV A;  4FH8 A;  2MMN A;  4LLR A;  3APO A;  1IYH A;  2A2S A;  2CAQ A;  22GS A;  4X0X A;  4RQR A;  5BMU A;  2CAI A;  3IRA A;  4WF4 A;  2HSM A;  2GLR A;  4IQ1 A;  4ZB8 A;  5G31 A;  4GCI A;  1Y25 A;  4K9Z A;  4RQX A;  4IJ3 A;  2MMZ A;  1UVZ A;  4J2F A;  3DD3 A;  2I1U A;  4KW6 A;  1XFL A;  3WYW A;  4YAV A;  1MEK A;  3EWL A;  3IV4 A;  1K0B A;  3C1S A;  5J9C A;  2CQ9 A;  1ZOF A;  3EYT A;  4XS4 A;  1EP7 A;  3BOA A;  5CRD A;  4OMV A;  5EVO A;  2MMA A;  4V2M A;  1DE2 A;  2GGT A;  4MMM A;  2R2J A;  3PIN A;  2HSN B;  4TXV A;  5EY6 A;  2C0G A;  1WMJ A;  1U3A A;  2XC2 A;  4TN8 A;  10GS A;  5B8A A;  3ZRE A;  3UVH A;  2VL3 A;  2H0G A;  2DC5 A;  5DCG A;  5D9T A;  4N10 A;  1U88 A;  2I3Y A;  2GSQ A;  4KA0 A;  4MAB A;  4YQU A;  4MJE A;  4O92 A;  5G5F A;  1FVK A;  5CYY A;  1WRY A;  3G9B A;  4MJA A;  5ECL B;  4E8E A;  2VL2 A;  2VL2 C;  5INY A;  1SYX A;  2C0D A;  3UMA A;  2ALB A;  4PNF A;  5IMF A;  2YWO A;  2VD1 A;  3P7X A;  4XCS A;  5IOW A;  2X8C A;  1PRX A;  4ZIL A;  2GQK A;  1GUL A;  1A2L A;  1O81 A;  2BMX A;  2F51 A;  2IWT A;  3NIV A;  1AQX A;  1SL2 B;  4USS A;  3KMO A;  1Q4J A;  2NPB A;  3ZTL A;  4WBJ A;  2R6K A;  2HRA A;  2DBC A;  2JSY A;  18GS A;  5ECH B;  3V1W A;  1OE8 A;  4PNG A;  1ZYE A;  4IEL A;  1ILO A;  5AIX A;  4JR4 A;  3FHK A;  1K3Y A;  2HT9 A;  3VWX A;  4F0B A;  2V41 A;  4L0U A;  1J9B A;  2IME A;  2AB6 A;  3EMX A;  3F63 A;  3DIE A;  2JAC A;  1T8E B;  4YAP A;  3GFK A;  1SD8 A;  4IGJ A;  3GTU B;  2GVP A;  4BVX A;  5H5R A;  4MP4 A;  5ECR B;  4GF0 A;  19GS A;  3HHV A;  1B9Y C;  2NVL A;  4MLY A;  3D4T A;  2PGT A;  2XPE A;  5DAL A;  3HKR A;  2V2G A;  5CO3 A;  2L57 A;  2C1Y A;  4FYU A;  3GSS A;  2CV4 A;  5D9V A;  5GST A;  1ERT A;  4JR6 A;  4JU5 A;  2H76 A;  3MSZ A;  2KHP A;  4PQH A;  4GST A;  5G5E A;  4GSN A;  2AV4 A;  1A0R P;  4GQC A;  2DJK A;  2OAC A;  4QL9 A;  1EZK A;  4N0V A;  3BBY A;  4KUN A;  3RAZ A;  4GRF A;  3I9V 2;  4EL1 A;  1OC8 A;  1FOV A;  2TRX A;  4N11 A;  1TRS A;  2YWI A;  1M2B A;  4TR3 A;  4K8M A;  5ECS A;  2VLU A;  1T3B A;  1G0T A;  3F6F A;  1I5G A;  2L4C A;  2RM5 A;  3ERF A;  1XWA A;  3TOU A;  4V1A p;  4K6X A;  2RLI A;  3VI5 A;  3FEU A;  2H30 A;  4EVM A;  1XWG A;  4ECB A;  1SK0 A;  5DAK B;  3WGX A;  3D6I A;  3LGC A;  1URM A;  3O76 A;  4IHU A;  3LYP A;  5B7C A;  4IP6 A;  2CX3 A;  2LNS A;  11GS A;  1GSQ A;  1PKZ A;  3GUR A;  5DDL A;  4OCE A;  4DSS A;  4HZ4 A;  1DE1 A;  3IC4 A;  3GX0 A;  1K0O A;  4D73 A;  2TIR A;  5IO2 A;  3HJP A;  3FR3 A;  3G7Y A;  3HZ8 A;  4DSQ A;  4F2I A;  2MZC A;  4G10 A;  5HFG A;  1H75 A;  4WF5 A;  3W8J A;  4ISD A;  1QMV A;  1WJK A;  3DML A;  1F3B A;  2FA8 A;  4PTS A;  1E6B A;  6GSU A;  1VF4 A;  2WB9 A;  2GST A;  3GMF A;  1FVJ A;  3LG6 A;  1USB A;  1Z5Y E;  1EP8 A;  1ABA A;  1X0R A;  2JU5 A;  2BTO T;  1AIU A;  5DJL A;  2OE3 A;  2HRN A;  2FD3 A;  2WUL A;  3N5O A;  2VCT A;  2F8F A;  2G2Q A;  3GIX A;  4EXJ A;  1E2Y A;  4MPG A;  4WBR D;  3HXS A;  1V58 A;  2NDO A;  5CNW A;  1S3C A;  4BVY A;  4ID0 A;  3VPT A;  2IMK A;  3TRX A;  1AC1 A;  1GSU A;  1OYJ A;  2R3X A;  5E4W A;  1XZO A;  2JAD A;  3P2A A;  1QK8 A;  1SL1 B;  1GSY A;  2OKA A;  4MJB A;  3FYG A;  1GSF A;  1A0F A;  5F06 A;  1HYU A;  1OVN A;  1VF3 A;  2X64 A;  4ZL7 A;  4XS1 A;  4PXO A;  3IC8 A;  3TJJ A;  1PL2 A;  1NM3 A;  5ECN B;  1SKW B;  3GNJ A;  4I2U A;  3Q18 A;  3W6G A;  4ZBD A;  5IM9 A;  2RM6 A;  4K2D A;  3IE3 A;  5FT3 A;  1AUC A;  4K7O A;  1JHB A;  3WT1 A;  4ZL9 A;  1WE0 A;  5AIV A;  5D9W A;  1PA3 A;  3KTB A;  3F0I A;  1PGT A;  4K7N A;  3H4K A;  4KB3 A;  4DVC A;  2EIQ A;  4TXO B;  2LV3 A;  4GTU A;  4QQ7 A;  1GL8 A;  4RUV A;  3TKS C;  2IJY A;  3QR6 A;  3MNG A;  3WD6 A;  3ZZX A;  2E0Q A;  5LCZ A;  4PX1 A;  2H1D A;  3GH6 A;  2IFQ A;  1QFN A;  5JCU A;  2GSS A;  1Q98 A;  1RW1 A;  2PN8 A;  1XWB A;  1XXU A;  3KM6 A;  3TDG A;  4G0L A;  4V2L A;  2FY6 A;  3M0F A;  5CRW A;  1GNE A;  4L5O A;  5JCG A;  1K0C A;  3FZA A;  2FHE A;  3Q74 A;  3DEX A;  4PUF C;  5CRH A;  4K0G A;  4BWS A;  4MZC A;  1M7T A;  5D9X A;  1ZGN A;  3RHC A;  1TDI A;  4I6X A;  3ZVJ D;  5J3R A;  4E8H A;  1BQ7 A;  2GZY A;  2FWE A;  5D8I A;  2REM A;  2H1G A;  5B6M A;  5B8B A;  4HJ2 A;  5F07 A;  2PMT A;  2XHF A;  2XBI A;  4TR4 A;  2OJL A;  2X8G A;  3KXO A;  1AXD A;  1YKC A;  1TK0 B;  3J7Y k;  2FWG A;  1GP1 A;  3VWW A;  4I8B A;  1YJ6 A;  2ON7 A;  4K0N A;  3VUR A;  3FR6 A;  5G30 A;  1THO A;  1C72 A;  4N30 A;  4PUR A;  1X5C A;  4IBP A;  4POL A;  1THX A;  2HZE B;  1ACV A;  2IMI A;  5A4W A;  1VF1 A;  2H66 A;  1ZCP A;  4MZW A;  1M9B A;  3QAW A;  5D93 A;  3EU4 A;  3BCK A;  3EUR A;  5C04 A;  4EC0 A;  2IPA A;  2B1L A;  1IYI A;  4P3Y B;  2LRN A;  2WDU A;  1Z3E A;  3BD2 A;  2YNX A;  3G7I A;  1TXX A;  3ED3 A;  3CTF A;  3ERW A;  1O8X A;  2B7K A;  3KJY A;  2LKU A;  1FHE A;  1T7P B;  1SYR A;  3DYR A;  2HLS A;  2CZ3 A;  5IO0 A;  2HRK B;  1TU8 A;  1OC9 A;  2KUC A;  1QQ2 A;  3NZN A;  4HU7 A;  2BJX A;  1BX9 A;  2I9H A;  4MF6 A;  2LRC A;  3SWL A;  3RDW A;  2AYT A;  6GST A;  2VM2 A;  5IPH A;  3ZIJ A;  1S3D A;  3FRC A;  2PVQ A;  2A2R A;  5HR3 A;  1GWC A;  2B5X A;  1EGO A;  3P8W A;  2J23 A;  5H5Q A;  3A2W A;  2VCQ A;  2L59 A;  1XIY A;  1XW5 A;  3TCO A;  1TRU A;  3MAK A;  1O6J A;  3PGT A;  1V98 A;  5IPG A;  1O73 A;  3TKR A;  2M80 A;  2FUG 2;  1GTA A;  1B4P A;  4MDC A;  1UN2 A;  1XWC A;  2OE1 A;  2WCI A;  5ECQ B;  3J7Y b;  1TI3 A;  2B5Y A;  2VLV A;  2YP6 A;  4MCU A;  2VCW A;  2HNL A;  1EWX A;  5ECP B;  4NXI A;  3DVX A;  4XIH A;  3QDN A;  4OFT A;  5IMV A;  3UBL A;  4HOJ A;  1ERU A;  3TJK A;  3UEM A;  4POM A;  3GYK A;  3K8N A;  2LJA A;  1BJX A;  1OAZ A;  5LNK e;  5A5K A;  1BAY A;  3L0H A;  2H70 A; 
#chains in the Genus database with same CATH topology
 3LQ7 A;  2H0I A;  1TK8 B;  1K3L A;  5J4V A;  3LXZ A;  4HZ2 A;  4WR5 A;  2M46 A;  4BVX B;  2L6D A;  2OA7 A;  3KD0 A;  4HDE A;  4ZXG A;  4MH3 A;  4AJ8 A;  1ZZY A;  3EE2 A;  3DRN A;  3N9J A;  2VOC A;  2YJ7 A;  2OAD A;  2VUP A;  2KP2 A;  3C1R A;  4MF5 A;  4K5S A;  2VL9 A;  1Y6E A;  1MD4 A;  2EIO A;  2DJ0 A;  4BL7 A;  5DAL B;  3TRP A;  4POB A;  1HD2 A;  3CYN A;  2WW2 A;  3LW9 A;  1VF2 A;  5D96 A;  4Q5F A;  4Z2R A;  4OFN A;  3CSJ A;  4WEY A;  5C00 A;  1KNG A;  3UAR A;  3EC3 A;  3H1N A;  5ECK B;  2KOK A;  5HQP A;  4N0Z A;  2HSH A;  4KF9 A;  1ON4 A;  2LST A;  4L8E A;  2D2Z A;  1DSB A;  4JED A;  5GZZ B;  1F2E A;  4ZB6 A;  2H19 A;  4L5L A;  3I43 A;  3HYP A;  4MZB A;  1YEP A;  2O89 A;  1SJZ A;  3D22 A;  6GSW A;  14GS A;  4K7I A;  4XRA A;  2HQT A;  2VM1 A;  4KDY A;  3OR5 A;  3PPU A;  2LS5 A;  3HJM A;  3GKX A;  2X4A A;  1JZR A;  1ZL9 A;  1KEB A;  1XCC A;  2EC4 A;  3WGD A;  4F9Z A;  2FA4 A;  1PN0 A;  3HMJ G;  5EL8 A;  1SKR B;  2PBJ A;  17GS A;  2VCV A;  1XG8 A;  2HRF A;  3ZVJ A;  4LMV A;  1PSQ A;  2GT5 A;  1TI1 A;  4EUY A;  5G1K A;  3EVI A;  2RUF A;  5G1L A;  2WJU A;  3M8N A;  3TGZ A;  5CRE A;  3KZQ A;  4HJM A;  3QAG A;  2WGR A;  1S4B P;  5JWO B;  4KSM A;  4JRR A;  3VWU A;  5KN3 A;  3GTU A;  1V9W A;  2DJJ A;  3GL5 A;  3TJB A;  5FWG A;  4HU9 A;  3UL3 A;  4GSS A;  5J4Y A;  1MD3 A;  2K18 A;  2WW0 A;  2C0F A;  2LUS A;  1PQN A;  2P5Q A;  4NHW A;  2KP1 A;  2JSZ A;  1EOH A;  4FQU A;  1ZYQ B;  2DMM A;  1HNA A;  1A2J A;  3FZ5 A;  5CRG A;  1H4O A;  1GUH A;  4ZBA A;  4IQA A;  3RPN A;  3UVT A;  2R5G A;  2YWN A;  4MH2 A;  1PX7 A;  2QGV A;  2B3S A;  3QCP A;  4G01 A;  4V1A g;  3ISO A;  5EPF A;  4ULX A;  3ERG A;  1JZW A;  2HSY A;  1SK2 A;  4BWQ A;  2YCD A;  1W4V A;  1PMT A;  4IS0 A;  4TVE A;  2RUE A;  3FY7 A;  1M3J A;  2L4Q A;  4EDY A;  2YOI A;  3TJF A;  5J9B A;  3IBH A;  5IOX A;  1BG5 A;  1R5A A;  1A8Y A;  1CQH A;  2OT3 A;  2Z9S A;  4HQZ A;  1QXH A;  3IAS 2;  4AJ6 A;  4ML6 A;  4O32 A;  3CRT A;  4IJI A;  6GSY A;  4G19 A;  2LRT A;  5KEJ A;  5AGY A;  3R2Q A;  3O6T A;  3WGE A;  2E2G A;  2FWF A;  4PI0 C;  2F9S A;  2C0E A;  2TRC P;  3H79 A;  4PQI A;  2R37 A;  4PUA A;  4Q5Q A;  2H0H A;  5KN0 A;  4IW9 A;  3VLN A;  1A24 A;  3F3R A;  1B48 A;  1XW9 A;  1TU7 A;  5DAK A;  3FZ4 A;  1SKS B;  3W8S A;  5FHI A;  1R5P A;  4EKZ A;  2DLX A;  3TKQ A;  3IDV A;  4GXZ A;  3CXG A;  3HVX A;  3CWG A;  1YY7 A;  3DXB A;  2HXK A;  4ML1 A;  5ABR A;  1GSE A;  3EIN A;  3VK9 A;  3KH9 A;  2MBT A;  2B7J A;  1J08 A;  2ZNM A;  2PWJ A;  5AIS A;  4MJC A;  4X1U A;  1WOU A;  1X5E A;  2GZZ A;  5HFK A;  4KAE A;  1GUM A;  2G0F A;  1AAZ A;  5DVB A;  2IFQ B;  2YAN A;  2AHE A;  1FOH A;  3ZIV A;  1G7E A;  3L9U A;  3JCM L;  1GLQ A;  4NV5 A;  1TKD B;  3L4N A;  2IL3 A;  1N25 A;  1YKA A;  4KDU A;  2VKZ G;  2QC7 A;  3CSI A;  4ACS A;  3A2X A;  3HVV A;  3TKP A;  4KCA A;  3ZYW A;  2VCX A;  1TP9 A;  1Z7R A;  1Z7P A;  1XOB A;  1EGR A;  4HQS A;  3S9F A;  3H8Q A;  5KOX A;  4TKY A;  2JZR A;  3TKS A;  2LQQ A;  3IHG A;  4TR1 B;  2X99 A;  5F05 A;  5F0G A;  4Q5N A;  1TTZ A;  2P31 A;  2OBI A;  2EIR A;  3KH7 A;  3DKS A;  1EV9 A;  3HD5 A;  2A4V A;  16GS A;  2O7K A;  4OCF A;  4ZBB A;  2CVK A;  2K6V A;  2DIY A;  1BYE A;  3EU3 A;  3ME7 A;  4TR0 A;  3IPZ A;  4KCE A;  4YQM A;  4ZIJ A;  1GTU A;  2H6X A;  1NHY A;  1MDK A;  4X4J A;  1ERW A;  3BJ5 A;  2V6O A;  2E2M A;  3QMX A;  3TB2 A;  5GAN D;  3GV1 A;  1SJI A;  1OE7 A;  5A34 A;  3D5J A;  2WVX A;  4TRX A;  3UIW A;  5J41 A;  1KTE A;  2B1K A;  2K8S A;  3ZLP A;  2E7P A;  5ENU A;  1FW1 A;  3VPQ A;  3FKF A;  2H73 A;  3KP8 A;  3KMN A;  4G0K A;  3E0U A;  4FXY P;  5B6N A;  1O8W A;  1U87 A;  5CP1 A;  1TW9 A;  1KBN A;  2WVZ A;  1JZO A;  3KTL A;  1B9X C;  3FW2 A;  4ECJ A;  2K8V A;  2HSM B;  1B4Q A;  1X9W B;  5ID2 A;  1F6M C;  3L9V A;  1Z6M A;  3GH9 A;  1OC9 B;  4FYB A;  2LEG A;  1EV4 A;  4G0I A;  1R7H A;  2P0G A;  1JLW A;  2GTU A;  3HCZ A;  3ZMK A;  3F9U A;  3GX8 A;  1N2A A;  1WIK A;  2H72 A;  1EEJ A;  4NV2 A;  2WW1 A;  3F8U A;  4XS4 B;  3LOR A;  2C3T A;  1XVQ A;  4FYC A;  3IAM 2;  2H1A A;  3A5W A;  2H75 A;  1B8X A;  3GKK A;  3IR4 A;  3APQ A;  2ON5 A;  1OKD A;  1X5D A;  2VAF A;  3C71 A;  3GST A;  1K0D A;  1M2A A;  1S3A A;  3F6D A;  2JL4 A;  4Q5R A;  4GLT A;  1GNW A;  4TOP A;  1EEM A;  1I1I P;  5HR2 A;  1JLV A;  2O87 A;  1YF0 A;  3HZ4 A;  1FB0 A;  1OC3 A;  3DGQ A;  4LA1 A;  3GKM A;  3IHQ A;  3TKS E;  2PU9 C;  3TOT A;  3QD9 A;  4ZB9 A;  1HNB A;  5A5H A;  4EF0 A;  3Q19 A;  2HZE A;  2GSR A;  4KGI A;  3QOU A;  2X8H A;  4MNN A;  2PUK C;  5A4V A;  1VGL A;  1GLP A;  2ZUP A;  3HDC A;  3ZML A;  4DEJ A;  3IXR A;  5IMD A;  3KCM A;  2YV9 A;  3GL3 A;  5ECI B;  1MDJ A;  3O3T A;  1R26 A;  1AW9 A;  2A2P A;  3GUS A;  3QAV A;  1NW2 A;  4MF7 A;  3C8E A;  1TRV A;  3KGK A;  4KX4 A;  5DJM A;  4NPB A;  2B5E A;  3IK7 A;  4CHS A;  3CSH A;  1XBS A;  4IKH A;  3F4S A;  4YH2 A;  3RHB A;  4OD7 A;  2HRK A;  4XHM A;  5ECM B;  3CTG A;  2H6Z A;  4BL7 B;  5HR0 A;  2DJ1 A;  4PGT A;  1T4Z A;  2YN1 A;  1XOA A;  1GTI A;  2IN3 A;  1ZYN A;  4G2E A;  1HQO A;  5AN1 A;  2VO4 A;  2L6C A;  2YWM A;  4HEA 2;  4PHZ C;  3UOM A;  4J57 E;  3IK9 A;  3ZFL A;  2F3M A;  4WKW A;  1GSS A;  3GN3 A;  2I4A A;  3MWH A;  1F37 A;  2JZS A;  1FB6 A;  2FWH A;  2IMF A;  3IOS A;  2KLX A;  5DQY A;  2N5F A;  4LL1 B;  4F0C A;  4NWY A;  4H86 A;  4QMK A;  3QFB C;  2DML A;  3PH9 A;  5DBQ A;  3LXT A;  1PL1 A;  5JCW A;  1ERV A;  1YEW C;  4IVF A;  3LYK A;  4K5R A;  2FNO A;  3R3E A;  2JZT A;  1WWJ A;  3E9J B;  2H8L A;  3F4R A;  2B6M A;  2OBK A;  1TXU A;  3LFL A;  1FG4 A;  1M9A A;  1N8J A;  1X9M B;  2ES7 A;  2C3Q A;  4AF2 A;  3UBK A;  4XRD A;  2LJR A;  1PN9 A;  5H5S A;  4O7H A;  1W89 A;  1T1V A;  2O36 A;  5A1N A;  2YZU A;  1PD2 1;  3M1G A;  2XPD A;  4F03 A;  3FK8 A;  4NMU A;  3TJG A;  2H1B A;  9GSS A;  4J56 E;  7GSS A;  3CMI A;  3BCI A;  4CDO A;  3G7J A;  2DIZ A;  3HA9 A;  1F3A A;  2XBQ A;  1UC7 A;  2CA8 A;  3ZIT A;  4F82 A;  5A4U A;  3MIX A;  4NHZ A;  1DUG A;  2OE0 A;  4ZL8 A;  5F8B A;  2V1M A;  1I9D A;  3L78 A;  5J40 A;  4I97 A;  3QPM A;  2VLT A;  3H93 A;  4K2X A;  4XTS A;  1J0F A;  5J47 A;  5GSS A;  2GQM A;  4RI6 A;  3C73 A;  2DSA A;  5J4U A;  1V57 A;  2PVO C;  5IIZ A;  3FZ9 A;  1XPV A;  3UAP A;  3ME8 A;  3IA1 A;  3I69 A;  2AJQ B;  5HR1 A;  3LSZ A;  1M0U A;  4AKX B;  5ELA A;  2C3N A;  5DQS A;  2MYG A;  1O85 A;  1LBK A;  1K0A A;  2CX4 A;  1NSW A;  2GS3 A;  5KN1 A;  1BED A;  4BA7 A;  1M2D A;  1TOF A;  1WP0 A;  1O7U A;  1TRW A;  2O85 A;  3D4M A;  4DSS B;  3RBT A;  1YZX A;  4OO4 A;  2N5A A;  4JZQ A;  4QL7 A;  2J9H A;  2H01 A;  3GHA A;  3VWV A;  2LNT A;  4GWR A;  4HS1 A;  3AY8 A;  5ELG A;  1K3O A;  4LL4 B;  4MPF A;  2ZCT A;  4WET A;  4D73 B;  1GTB A;  4I5Q A;  4YQV A;  5JWR B;  2YZH A;  1FAA A;  3VFI A;  5E59 A;  1OKT A;  3FMW A;  2UZ8 A;  1DBY A;  1U3I A;  3UJ1 A;  5IQY A;  3CQF A;  13GS A;  2YV7 A;  3TUE A;  3ZFB A;  2H1L A;  2HFD A;  5IMZ A;  1YEX A;  1QUW A;  3KEB A;  1JZD A;  12GS A;  5GAP D;  8GSS A;  2IIY A;  3M9K A;  1GUK A;  1A2M A;  2GDR A;  1ST9 A;  2QKE A;  3HJO A;  3F4T A;  2VCZ A;  4JE1 A;  3EPT A;  4OO5 A;  5D73 A;  4ECI A;  2WW3 A;  2WZ9 A;  1EOG A;  3RPP A;  4X43 A;  4WXT A;  2H71 A;  6GSX A;  1PX6 A;  3ZL5 A;  2C4J A;  2N5B A;  1K0M A;  2H6Y A;  2FLS A;  4BVY B;  3D0Z A;  4CW9 A;  2DJ3 A;  4I2T A;  4MA9 A;  1SJ6 A;  2L5L A;  3DVW A;  4OFM A;  2DJ2 A;  2FCH A;  3CRU A;  1T4Y A;  3A2V A;  2NBS A;  4RI7 A;  3WT2 A;  5LD0 A;  4FO5 A;  3P90 A;  1HNC A;  3LWA A;  1NHO A;  4AI6 A;  5G2Z A;  3TU3 B;  3L9S A;  1YDK A;  2MMO A;  3U5R E;  4HUA A;  2H74 A;  4XS6 A;  4IN0 A;  3TRQ A;  4MK3 A;  2HI7 A;  3D21 A;  3KIJ A;  2VIM A;  3F3Q A;  2QA2 A;  5KN2 A;  5IMA A;  1SEN A;  5BRT A;  1T00 A;  2WRT A;  1TJD A;  2VD0 A;  3U6V A;  4O5R A;  2V32 A;  4KE3 A;  5J5N A;  4HI7 A;  4ILF A;  4WR4 A;  4KH7 A;  2MBS A;  4IP1 A;  1XWK A;  3C7M A;  4GQF A;  2YPM A;  3VI7 A;  1A8L A;  2WFC A;  1MTC A;  4AJ7 A;  1G7O A;  5L71 A;  4EIP A;  2K9F A;  4JBB A;  1LJR A;  1ZMA A;  3M9J A;  3E3E A;  4K1F A;  2LQO A;  5DCH A;  3PR8 A;  4EE0 A;  3HY2 A;  2EFD A;  4KND A;  2O8V B;  2PER A;  1YQ1 A;  5IMC A;  3RFR C;  1VRS D;  1SU9 A;  5KOW A;  4BPY A;  2P5R A;  2C80 A;  3QFA C;  2GZP A;  1RQM A;  4FIW A;  1CQG A;  3CBU A;  1V2A A;  4O5U A;  2C8U A;  2HYX A;  1F9M A;  3GRX A;  4ICY A;  4Z7X A;  1XVW A;  2YJH A;  2HE3 A;  1R4W A;  2GQL A;  1M99 A;  5ID2 B;  3LJR A;  1PKW A;  1QGV A;  1JFU A;  4AGS A;  3I6A A;  4NAX A;  1AQW A;  1GSD A;  4KSO A;  4POK A;  2GT6 A;  3LEF A;  3MDK A;  2R4V A;  2L5O A;  4V2N A;  1Z9H A;  1LU4 A;  20GS A;  1ZYP A;  1TK5 B;  2RII A;  2FGX A;  3M3M A;  5ECO B;  3GKN A;  2AAW A;  3NOF A;  1FO5 A;  1X9S B;  5JWQ B;  1MDI A;  4AKH A;  2NTO A;  2V6K A;  2CVD A;  5CAX A;  5COH A;  3A3T A;  1K0N A;  2M72 A;  1U6T A;  4TW5 A;  3GA4 A;  2CT6 A;  4TXO A;  1YF1 A;  3ZRD A;  4E68 A;  3HVS A;  4OWY A;  3DWV A;  4TR1 A;  1RK4 A;  1GRX A;  4PQ1 A;  1XW6 A;  1G6W A;  4DSR A;  1PFO A;  4KDX A;  1GH2 A;  6GSV A;  1SD9 A;  3APS A;  4L0W A;  2I81 A;  6GSS A;  3EMP A;  3KP9 A;  1UA5 A;  1A23 A;  2HZF A;  1SK1 A;  1Z6N A;  2AUV A;  1V40 A;  4G9H A;  2LTK A;  4EDZ A;  4CY6 A;  2CZ2 A;  2QSI A;  5A5H B;  2IMD A;  2WS2 A;  1G6Y A;  4ECC A;  1ML6 A;  1WPI A;  3SBC A;  4LMW A;  3FR9 A;  2PPT A;  2LJK A;  2X49 A;  3Q6O A;  2CVB A;  4W66 A;  5HFI A;  3US3 A;  2F8A A;  1SL0 B;  4EO3 A;  1AQV A;  4GDF A;  4FH8 A;  2MMN A;  4LLR A;  3APO A;  1IYH A;  3MYD A;  2A2S A;  2CAQ A;  22GS A;  2UV8 G;  4X0X A;  4RQR A;  4ZB7 A;  5BMU A;  2CAI A;  3IRA A;  4WF4 A;  2HSM A;  2GLR A;  4IQ1 A;  4ZB8 A;  5G31 A;  2R0G A;  4GCI A;  1Y25 A;  4K9Z A;  4RQX A;  4IJ3 A;  4N3Z A;  2MMZ A;  1UVZ A;  4J2F A;  3DD3 A;  2I1U A;  1SVL A;  4KW6 A;  1XFL A;  3WYW A;  4YAV A;  1MEK A;  3EWL A;  3IV4 A;  1K0B A;  3C1S A;  5J9C A;  2CQ9 A;  1ZOF A;  3EYT A;  4XS4 A;  1EP7 A;  3BOA A;  5CRD A;  4OMV A;  5EVO A;  2MMA A;  2EFE A;  4V2M A;  1DE2 A;  2GGT A;  4MMM A;  2EFC A;  2R2J A;  3PIN A;  2HSN B;  4TXV A;  5EY6 A;  2C0G A;  1WMJ A;  1U3A A;  2XC2 A;  1YVL A;  4TN8 A;  10GS A;  5B8A A;  3ZRE A;  3UVH A;  2VL3 A;  2H0G A;  2DC5 A;  5DCG A;  3HVN A;  5D9T A;  4N10 A;  1U88 A;  4A5P A;  2I3Y A;  2GSQ A;  4KA0 A;  4MAB A;  4YQU A;  4MJE A;  4AKI A;  4O92 A;  5G5F A;  1FVK A;  5CYY A;  1WRY A;  3G9B A;  4MJA A;  5ECL B;  2O3E A;  4E8E A;  2VL2 A;  2VL2 C;  5INY A;  1SYX A;  2C0D A;  3UMA A;  2ALB A;  4PNF A;  5IMF A;  2YWO A;  2VD1 A;  3P7X A;  2R0C A;  4XCS A;  5IOW A;  2X8C A;  1PRX A;  4ZIL A;  2GQK A;  1GUL A;  1A2L A;  1O81 A;  2BMX A;  2F51 A;  2IWT A;  3NIV A;  1AQX A;  1SL2 B;  4USS A;  3KMO A;  1Q4J A;  2NPB A;  3ZTL A;  4WBJ A;  2R6K A;  4O5Q A;  2WZS A;  2HRA A;  2DBC A;  2JSY A;  18GS A;  5ECH B;  3V1W A;  1OE8 A;  4PNG A;  1ZYE A;  4IEL A;  1ILO A;  5AIX A;  4JR4 A;  3FHK A;  1K3Y A;  2HT9 A;  3VWX A;  4F0B A;  2V41 A;  4L0U A;  1J9B A;  2IME A;  2AB6 A;  3EMX A;  3F63 A;  3DIE A;  2JAC A;  1T8E B;  4YAP A;  3A5I A;  3GFK A;  1SD8 A;  4IGJ A;  3GTU B;  2GVP A;  4BVX A;  5H5R A;  4MP4 A;  5ECR B;  4GF0 A;  19GS A;  3HHV A;  1SVO A;  2A4H A;  1B9Y C;  2NVL A;  4MLY A;  3D4T A;  2PGT A;  2XPE A;  5DAL A;  3HKR A;  2V2G A;  5CO3 A;  2L57 A;  2C1Y A;  4FYU A;  3GSS A;  2CV4 A;  5D9V A;  5GST A;  1ERT A;  4JR6 A;  4JU5 A;  2H76 A;  3MSZ A;  2KHP A;  4PQH A;  4GST A;  5G5E A;  4GSN A;  2AV4 A;  1A0R P;  4GQC A;  2DJK A;  2OAC A;  4QL9 A;  1EZK A;  4Z2T A;  4N0V A;  3BBY A;  4KUN A;  3RAZ A;  4GRF A;  3I9V 2;  4EL1 A;  1OC8 A;  1FOV A;  2TRX A;  1S3R A;  4N11 A;  1TRS A;  2YWI A;  1M2B A;  4TR3 A;  4K8M A;  5ECS A;  2VLU A;  1T3B A;  1BG1 A;  1G0T A;  3F6F A;  1I5G A;  2L4C A;  2RM5 A;  3ERF A;  1XWA A;  3TOU A;  4V1A p;  4K6X A;  2RLI A;  3VI5 A;  3FEU A;  2H30 A;  4EVM A;  1XWG A;  4ECB A;  1SK0 A;  5DAK B;  3WGX A;  4Z2U A;  3D6I A;  3LGC A;  1URM A;  3O76 A;  4IHU A;  3LYP A;  5B7C A;  4IP6 A;  2CX3 A;  2LNS A;  11GS A;  1GSQ A;  1PKZ A;  3GUR A;  5DDL A;  4OCE A;  4DSS A;  4AKG A;  4HZ4 A;  3CHX C;  1DE1 A;  3IC4 A;  3GX0 A;  1K0O A;  4D73 A;  2TIR A;  2QA1 A;  5IO2 A;  3HJP A;  3FR3 A;  3G7Y A;  3HZ8 A;  4DSQ A;  4F2I A;  2MZC A;  4G10 A;  5HFG A;  1H75 A;  4WF5 A;  3W8J A;  4ISD A;  1QMV A;  1WJK A;  3DML A;  1F3B A;  2FA8 A;  4PTS A;  1E6B A;  6GSU A;  1VF4 A;  2WB9 A;  2GST A;  3GMF A;  1FVJ A;  3LG6 A;  1USB A;  1Z5Y E;  2DKI A;  1EP8 A;  1ABA A;  1X0R A;  2JU5 A;  2BTO T;  1AIU A;  5DJL A;  2OE3 A;  2HRN A;  2FD3 A;  2WUL A;  3N5O A;  2VCT A;  2F8F A;  2G2Q A;  3GIX A;  4EXJ A;  1E2Y A;  4MPG A;  4WBR D;  3HXS A;  1V58 A;  2NDO A;  5CNW A;  1S3C A;  4BVY A;  4ID0 A;  3VPT A;  2IMK A;  3TRX A;  1AC1 A;  1GSU A;  1OYJ A;  2R3X A;  5E4W A;  1XZO A;  2JAD A;  3P2A A;  1QK8 A;  1SL1 B;  1GSY A;  2OKA A;  4MJB A;  3FYG A;  1GSF A;  1A0F A;  5F06 A;  1HYU A;  1OVN A;  1VF3 A;  2X64 A;  4ZL7 A;  4XS1 A;  4PXO A;  3IC8 A;  3TJJ A;  1PL2 A;  1NM3 A;  5ECN B;  1SKW B;  3GNJ A;  4I2U A;  3Q18 A;  3W6G A;  4ZBD A;  5IM9 A;  2RM6 A;  4K2D A;  3IE3 A;  5FT3 A;  1AUC A;  4K7O A;  1JHB A;  3WT1 A;  5A34 B;  2WVX B;  4ZL9 A;  1WE0 A;  5AIV A;  5D9W A;  1PA3 A;  3KTB A;  3F0I A;  1PGT A;  4K7N A;  3H4K A;  4KB3 A;  4DVC A;  2EIQ A;  4TXO B;  2LV3 A;  4GTU A;  4QQ7 A;  1GL8 A;  4RUV A;  3TKS C;  2IJY A;  3QR6 A;  4BIK A;  3MNG A;  3WD6 A;  3ZZX A;  2E0Q A;  5LCZ A;  4PX1 A;  2H1D A;  3GH6 A;  2IFQ A;  1QFN A;  5JCU A;  2GSS A;  1Q98 A;  1RW1 A;  2PN8 A;  1XWB A;  1XXU A;  3KM6 A;  3TDG A;  4G0L A;  4V2L A;  2FY6 A;  4PI2 C;  3M0F A;  5CRW A;  1GNE A;  4EIQ A;  4L5O A;  5JCG A;  1K0C A;  3FZA A;  2FHE A;  3Q74 A;  3DEX A;  4PUF C;  5CRH A;  4K0G A;  4BWS A;  4MZC A;  1M7T A;  5D9X A;  1ZGN A;  3RHC A;  1TDI A;  4I6X A;  3ZVJ D;  5J3R A;  4E8H A;  1BQ7 A;  2GZY A;  2FWE A;  5D8I A;  2REM A;  2H1G A;  5B6M A;  5B8B A;  4HJ2 A;  5F07 A;  2PMT A;  2XHF A;  2XBI A;  4TR4 A;  2OJL A;  2X8G A;  3KXO A;  1AXD A;  1YKC A;  1TK0 B;  3J7Y k;  2FWG A;  1GP1 A;  3VWW A;  4I8B A;  1YJ6 A;  2ON7 A;  4K0N A;  3VUR A;  5BMU B;  3FR6 A;  2WVY A;  5G30 A;  1THO A;  1C72 A;  4N30 A;  4PUR A;  1X5C A;  4IBP A;  4POL A;  1THX A;  1BF5 A;  2HZE B;  1Y1U A;  1ACV A;  2IMI A;  5A4W A;  1VF1 A;  2H66 A;  1ZCP A;  4MZW A;  1M9B A;  3QAW A;  5D93 A;  3EU4 A;  3BCK A;  3EUR A;  5C04 A;  4EC0 A;  2IPA A;  2B1L A;  1IYI A;  1SVM A;  4P3Y B;  2LRN A;  2WDU A;  1Z3E A;  3BD2 A;  2YNX A;  3G7I A;  4YKG A;  1TXX A;  3ED3 A;  3CTF A;  3ERW A;  1O8X A;  2B7K A;  3KJY A;  2LKU A;  1FHE A;  3RGB C;  1T7P B;  1SYR A;  3DYR A;  2HLS A;  2CZ3 A;  5IO0 A;  2HRK B;  1TU8 A;  1OC9 A;  2KUC A;  1QQ2 A;  3NZN A;  4HU7 A;  2BJX A;  1BX9 A;  2I9H A;  4MF6 A;  2LRC A;  3SWL A;  3RDW A;  2AYT A;  6GST A;  2VM2 A;  5IPH A;  3ZIJ A;  1S3D A;  3FRC A;  2PVQ A;  2A2R A;  5HR3 A;  1GWC A;  2B5X A;  1EGO A;  3P8W A;  2J23 A;  5H5Q A;  3A2W A;  4YKF A;  2VCQ A;  2L59 A;  1XIY A;  1XW5 A;  3TCO A;  1M3I A;  1TRU A;  3MAK A;  1O6J A;  3PGT A;  1V98 A;  2EFH A;  5IPG A;  1O73 A;  3TKR A;  2M80 A;  2FUG 2;  4CY8 A;  1GTA A;  1B4P A;  4MDC A;  1UN2 A;  1XWC A;  2OE1 A;  2WCI A;  5ECQ B;  3J7Y b;  2O5V A;  1TI3 A;  2B5Y A;  2VLV A;  2YP6 A;  4MCU A;  2VCW A;  2HNL A;  1EWX A;  5A1N B;  5ECP B;  4HSC X;  4NXI A;  3DVX A;  4XIH A;  3QDN A;  4OFT A;  5IMV A;  3UBL A;  2R0P A;  4HOJ A;  1ERU A;  3TJK A;  3UEM A;  4POM A;  2DKH A;  3GYK A;  3K8N A;  2LJA A;  1BJX A;  1OAZ A;  5LNK e;  2HSN A;  5A5K A;  1BAY A;  3L0H A;  2H70 A; 
#chains in the Genus database with same CATH homology
 3LQ7 A;  2H0I A;  1TK8 B;  1K3L A;  5J4V A;  3LXZ A;  4HZ2 A;  4WR5 A;  2M46 A;  4BVX B;  2L6D A;  2OA7 A;  3KD0 A;  4HDE A;  4ZXG A;  4MH3 A;  4AJ8 A;  1ZZY A;  3EE2 A;  3DRN A;  3N9J A;  2VOC A;  2YJ7 A;  2OAD A;  2VUP A;  2KP2 A;  3C1R A;  4MF5 A;  4K5S A;  2VL9 A;  1Y6E A;  1MD4 A;  2EIO A;  2DJ0 A;  4BL7 A;  5DAL B;  3TRP A;  4POB A;  1HD2 A;  3CYN A;  3LW9 A;  1VF2 A;  5D96 A;  4Q5F A;  4Z2R A;  4OFN A;  3CSJ A;  4WEY A;  5C00 A;  1KNG A;  3UAR A;  3EC3 A;  3H1N A;  5ECK B;  2KOK A;  5HQP A;  4N0Z A;  2HSH A;  4KF9 A;  1ON4 A;  2LST A;  4L8E A;  2D2Z A;  1DSB A;  4JED A;  5GZZ B;  1F2E A;  4ZB6 A;  2H19 A;  4L5L A;  3I43 A;  3HYP A;  4MZB A;  1YEP A;  2O89 A;  1SJZ A;  3D22 A;  6GSW A;  14GS A;  4K7I A;  4XRA A;  2HQT A;  2VM1 A;  4KDY A;  3OR5 A;  3PPU A;  2LS5 A;  3HJM A;  3GKX A;  2X4A A;  1JZR A;  1ZL9 A;  1KEB A;  1XCC A;  2EC4 A;  3WGD A;  4F9Z A;  2FA4 A;  1PN0 A;  3HMJ G;  5EL8 A;  1SKR B;  2PBJ A;  17GS A;  2VCV A;  2HRF A;  3ZVJ A;  4LMV A;  1PSQ A;  2GT5 A;  1TI1 A;  4EUY A;  5G1K A;  3EVI A;  2RUF A;  5G1L A;  2WJU A;  3M8N A;  3TGZ A;  5CRE A;  3KZQ A;  4HJM A;  3QAG A;  2WGR A;  5JWO B;  4KSM A;  4JRR A;  3VWU A;  5KN3 A;  3GTU A;  1V9W A;  2DJJ A;  3GL5 A;  3TJB A;  5FWG A;  4HU9 A;  3UL3 A;  4GSS A;  5J4Y A;  1MD3 A;  2K18 A;  2C0F A;  2LUS A;  1PQN A;  2P5Q A;  4NHW A;  2KP1 A;  2JSZ A;  1EOH A;  4FQU A;  1ZYQ B;  2DMM A;  1HNA A;  1A2J A;  3FZ5 A;  5CRG A;  1H4O A;  1GUH A;  4ZBA A;  4IQA A;  3RPN A;  3UVT A;  2R5G A;  2YWN A;  4MH2 A;  1PX7 A;  2QGV A;  2B3S A;  3QCP A;  4G01 A;  4V1A g;  3ISO A;  5EPF A;  4ULX A;  3ERG A;  1JZW A;  2HSY A;  1SK2 A;  4BWQ A;  2YCD A;  1W4V A;  1PMT A;  4IS0 A;  4TVE A;  2RUE A;  3FY7 A;  2L4Q A;  4EDY A;  2YOI A;  3TJF A;  5J9B A;  3IBH A;  5IOX A;  1BG5 A;  1R5A A;  1A8Y A;  1CQH A;  2OT3 A;  2Z9S A;  4HQZ A;  1QXH A;  3IAS 2;  4AJ6 A;  4ML6 A;  4O32 A;  3CRT A;  4IJI A;  6GSY A;  4G19 A;  2LRT A;  5KEJ A;  5AGY A;  3R2Q A;  3O6T A;  3WGE A;  2E2G A;  2FWF A;  2TRC P;  2F9S A;  2C0E A;  3H79 A;  4PQI A;  2R37 A;  4PUA A;  4Q5Q A;  2H0H A;  5KN0 A;  4IW9 A;  3VLN A;  1A24 A;  3F3R A;  1B48 A;  1XW9 A;  1TU7 A;  5DAK A;  3FZ4 A;  1SKS B;  3W8S A;  5FHI A;  1R5P A;  4EKZ A;  2DLX A;  3TKQ A;  3IDV A;  4GXZ A;  3CXG A;  3HVX A;  3CWG A;  1YY7 A;  3DXB A;  2HXK A;  4ML1 A;  5ABR A;  1GSE A;  3EIN A;  3VK9 A;  3KH9 A;  2MBT A;  2B7J A;  1J08 A;  2ZNM A;  2PWJ A;  5AIS A;  4MJC A;  4X1U A;  1WOU A;  1X5E A;  2GZZ A;  5HFK A;  4KAE A;  1GUM A;  2G0F A;  1AAZ A;  5DVB A;  2IFQ B;  2YAN A;  2AHE A;  1FOH A;  3ZIV A;  1G7E A;  3L9U A;  3JCM L;  1GLQ A;  4NV5 A;  1TKD B;  3L4N A;  2IL3 A;  1N25 A;  1YKA A;  4KDU A;  2VKZ G;  2QC7 A;  3CSI A;  4ACS A;  3A2X A;  3HVV A;  3TKP A;  4KCA A;  3ZYW A;  2VCX A;  1TP9 A;  1Z7R A;  1Z7P A;  1XOB A;  1EGR A;  4HQS A;  3S9F A;  3H8Q A;  5KOX A;  4TKY A;  2JZR A;  3TKS A;  2LQQ A;  3IHG A;  4TR1 B;  2X99 A;  5F05 A;  5F0G A;  4Q5N A;  1TTZ A;  2P31 A;  2OBI A;  2EIR A;  3KH7 A;  3DKS A;  1EV9 A;  3HD5 A;  2A4V A;  16GS A;  2O7K A;  4OCF A;  4ZBB A;  2CVK A;  2K6V A;  2DIY A;  1BYE A;  3EU3 A;  3ME7 A;  4TR0 A;  3IPZ A;  4KCE A;  4YQM A;  4ZIJ A;  1GTU A;  2H6X A;  1NHY A;  1MDK A;  4X4J A;  1ERW A;  3BJ5 A;  2V6O A;  2E2M A;  3QMX A;  3TB2 A;  5GAN D;  3GV1 A;  1SJI A;  1OE7 A;  5A34 A;  3D5J A;  4TRX A;  3UIW A;  5J41 A;  1KTE A;  2B1K A;  2K8S A;  3ZLP A;  2E7P A;  5ENU A;  1FW1 A;  3VPQ A;  3FKF A;  2H73 A;  3KP8 A;  3KMN A;  4G0K A;  3E0U A;  5B6N A;  1O8W A;  1U87 A;  5CP1 A;  1TW9 A;  1KBN A;  1JZO A;  3KTL A;  1B9X C;  3FW2 A;  4ECJ A;  2K8V A;  2HSM B;  1B4Q A;  1X9W B;  5ID2 A;  1F6M C;  3L9V A;  1Z6M A;  3GH9 A;  1OC9 B;  4FYB A;  2LEG A;  1EV4 A;  4G0I A;  1R7H A;  2P0G A;  1JLW A;  2GTU A;  3HCZ A;  3ZMK A;  3F9U A;  3GX8 A;  1N2A A;  1WIK A;  2H72 A;  1EEJ A;  4NV2 A;  3F8U A;  4XS4 B;  3LOR A;  2C3T A;  1XVQ A;  4FYC A;  3IAM 2;  2H1A A;  3A5W A;  2H75 A;  1B8X A;  3GKK A;  3IR4 A;  3APQ A;  2ON5 A;  1OKD A;  1X5D A;  2VAF A;  3C71 A;  3GST A;  1K0D A;  1M2A A;  1S3A A;  3F6D A;  2JL4 A;  4Q5R A;  4GLT A;  1GNW A;  4TOP A;  1EEM A;  5HR2 A;  1JLV A;  2O87 A;  1YF0 A;  3HZ4 A;  1FB0 A;  1OC3 A;  3DGQ A;  4LA1 A;  3GKM A;  3IHQ A;  3TKS E;  2PU9 C;  3TOT A;  3QD9 A;  4ZB9 A;  1HNB A;  5A5H A;  4EF0 A;  3Q19 A;  2HZE A;  2GSR A;  4KGI A;  3QOU A;  2X8H A;  4MNN A;  2PUK C;  5A4V A;  1VGL A;  1GLP A;  2ZUP A;  3HDC A;  3ZML A;  4DEJ A;  3IXR A;  5IMD A;  3KCM A;  2YV9 A;  3GL3 A;  5ECI B;  1MDJ A;  3O3T A;  1R26 A;  1AW9 A;  2A2P A;  3GUS A;  3QAV A;  1NW2 A;  4MF7 A;  3C8E A;  1TRV A;  3KGK A;  4KX4 A;  5DJM A;  4NPB A;  2B5E A;  3IK7 A;  4CHS A;  3CSH A;  1XBS A;  4IKH A;  3F4S A;  4YH2 A;  3RHB A;  4OD7 A;  2HRK A;  4XHM A;  5ECM B;  3CTG A;  2H6Z A;  4BL7 B;  5HR0 A;  2DJ1 A;  4PGT A;  1T4Z A;  2YN1 A;  1XOA A;  1GTI A;  2IN3 A;  1ZYN A;  4G2E A;  1HQO A;  5AN1 A;  2VO4 A;  2L6C A;  2YWM A;  4HEA 2;  3UOM A;  4J57 E;  3IK9 A;  3ZFL A;  2F3M A;  4WKW A;  1GSS A;  3GN3 A;  2I4A A;  3MWH A;  1F37 A;  2JZS A;  1FB6 A;  2FWH A;  2IMF A;  3IOS A;  2KLX A;  5DQY A;  2N5F A;  4LL1 B;  4F0C A;  4NWY A;  4H86 A;  4QMK A;  3QFB C;  2DML A;  3PH9 A;  5DBQ A;  3LXT A;  1PL1 A;  5JCW A;  1ERV A;  4IVF A;  3LYK A;  4K5R A;  2FNO A;  3R3E A;  2JZT A;  1WWJ A;  3E9J B;  2H8L A;  3F4R A;  2B6M A;  2OBK A;  1TXU A;  3LFL A;  1FG4 A;  1M9A A;  1N8J A;  1X9M B;  2ES7 A;  2C3Q A;  4AF2 A;  3UBK A;  4XRD A;  2LJR A;  1PN9 A;  5H5S A;  4O7H A;  1W89 A;  1T1V A;  5A1N A;  2YZU A;  1PD2 1;  3M1G A;  2XPD A;  4F03 A;  3FK8 A;  4NMU A;  3TJG A;  2H1B A;  9GSS A;  4J56 E;  7GSS A;  3CMI A;  3BCI A;  4CDO A;  3G7J A;  2DIZ A;  3HA9 A;  1F3A A;  2XBQ A;  1UC7 A;  2CA8 A;  3ZIT A;  4F82 A;  5A4U A;  3MIX A;  4NHZ A;  1DUG A;  2OE0 A;  4ZL8 A;  5F8B A;  2V1M A;  1I9D A;  3L78 A;  5J40 A;  4I97 A;  3QPM A;  2VLT A;  3H93 A;  4K2X A;  4XTS A;  1J0F A;  5J47 A;  5GSS A;  2GQM A;  4RI6 A;  3C73 A;  2DSA A;  5J4U A;  1V57 A;  2PVO C;  5IIZ A;  3FZ9 A;  1XPV A;  3UAP A;  3ME8 A;  3IA1 A;  3I69 A;  2AJQ B;  5HR1 A;  3LSZ A;  1M0U A;  4AKX B;  5ELA A;  2C3N A;  5DQS A;  2MYG A;  1O85 A;  1LBK A;  1K0A A;  2CX4 A;  1NSW A;  2GS3 A;  5KN1 A;  1BED A;  4BA7 A;  1M2D A;  1TOF A;  1WP0 A;  1O7U A;  1TRW A;  2O85 A;  3D4M A;  4DSS B;  3RBT A;  1YZX A;  4OO4 A;  2N5A A;  4JZQ A;  4QL7 A;  2J9H A;  2H01 A;  3GHA A;  3VWV A;  2LNT A;  4GWR A;  4HS1 A;  3AY8 A;  5ELG A;  1K3O A;  4LL4 B;  4MPF A;  2ZCT A;  4WET A;  4D73 B;  1GTB A;  4I5Q A;  4YQV A;  5JWR B;  2YZH A;  1FAA A;  3VFI A;  5E59 A;  1OKT A;  3FMW A;  2UZ8 A;  1DBY A;  1U3I A;  3UJ1 A;  5IQY A;  13GS A;  2YV7 A;  3TUE A;  3ZFB A;  2H1L A;  2HFD A;  5IMZ A;  1YEX A;  1QUW A;  3KEB A;  1JZD A;  12GS A;  5GAP D;  8GSS A;  2IIY A;  3M9K A;  1GUK A;  1A2M A;  2GDR A;  1ST9 A;  2QKE A;  3HJO A;  3F4T A;  2VCZ A;  4JE1 A;  3EPT A;  4OO5 A;  5D73 A;  4ECI A;  2WZ9 A;  1EOG A;  3RPP A;  4X43 A;  4WXT A;  2H71 A;  6GSX A;  1PX6 A;  3ZL5 A;  2C4J A;  2N5B A;  1K0M A;  2H6Y A;  2FLS A;  4BVY B;  3D0Z A;  4CW9 A;  2DJ3 A;  4I2T A;  4MA9 A;  1SJ6 A;  2L5L A;  3DVW A;  4OFM A;  2DJ2 A;  2FCH A;  3CRU A;  1T4Y A;  3A2V A;  2NBS A;  4RI7 A;  3WT2 A;  5LD0 A;  4FO5 A;  3P90 A;  1HNC A;  3LWA A;  1NHO A;  4AI6 A;  5G2Z A;  3TU3 B;  3L9S A;  1YDK A;  2MMO A;  3U5R E;  4HUA A;  2H74 A;  4XS6 A;  4IN0 A;  3TRQ A;  4MK3 A;  2HI7 A;  3D21 A;  3KIJ A;  2VIM A;  3F3Q A;  2QA2 A;  5KN2 A;  5IMA A;  1SEN A;  5BRT A;  1T00 A;  2WRT A;  1TJD A;  2VD0 A;  3U6V A;  4O5R A;  2V32 A;  4KE3 A;  5J5N A;  4HI7 A;  4ILF A;  4WR4 A;  4KH7 A;  2MBS A;  4IP1 A;  1XWK A;  3C7M A;  4GQF A;  2YPM A;  3VI7 A;  1A8L A;  2WFC A;  1MTC A;  4AJ7 A;  1G7O A;  5L71 A;  4EIP A;  2K9F A;  4JBB A;  1LJR A;  1ZMA A;  3M9J A;  3E3E A;  4K1F A;  2LQO A;  5DCH A;  3PR8 A;  4EE0 A;  3HY2 A;  2EFD A;  4KND A;  2O8V B;  2PER A;  1YQ1 A;  5IMC A;  1VRS D;  1SU9 A;  5KOW A;  4BPY A;  2P5R A;  2C80 A;  3QFA C;  2GZP A;  1RQM A;  4FIW A;  1CQG A;  3CBU A;  1V2A A;  4O5U A;  2C8U A;  2HYX A;  1F9M A;  3GRX A;  4ICY A;  4Z7X A;  1XVW A;  2YJH A;  2HE3 A;  1R4W A;  2GQL A;  1M99 A;  5ID2 B;  3LJR A;  1PKW A;  1QGV A;  1JFU A;  4AGS A;  3I6A A;  4NAX A;  1AQW A;  1GSD A;  4KSO A;  4POK A;  2GT6 A;  3LEF A;  3MDK A;  2R4V A;  2L5O A;  4V2N A;  1Z9H A;  1LU4 A;  20GS A;  1ZYP A;  1TK5 B;  2RII A;  2FGX A;  3M3M A;  5ECO B;  3GKN A;  2AAW A;  3NOF A;  1FO5 A;  1X9S B;  5JWQ B;  1MDI A;  4AKH A;  2NTO A;  2V6K A;  2CVD A;  5CAX A;  5COH A;  3A3T A;  1K0N A;  2M72 A;  1U6T A;  4TW5 A;  3GA4 A;  2CT6 A;  4TXO A;  1YF1 A;  3ZRD A;  4E68 A;  3HVS A;  4OWY A;  3DWV A;  4TR1 A;  1RK4 A;  1GRX A;  4PQ1 A;  1XW6 A;  1G6W A;  4DSR A;  4KDX A;  1GH2 A;  6GSV A;  1SD9 A;  3APS A;  4L0W A;  2I81 A;  6GSS A;  3EMP A;  3KP9 A;  1UA5 A;  1A23 A;  2HZF A;  1SK1 A;  1Z6N A;  2AUV A;  1V40 A;  4G9H A;  2LTK A;  4EDZ A;  4CY6 A;  2CZ2 A;  2QSI A;  5A5H B;  2IMD A;  2WS2 A;  1G6Y A;  4ECC A;  1ML6 A;  1WPI A;  3SBC A;  4LMW A;  3FR9 A;  2PPT A;  2LJK A;  2X49 A;  3Q6O A;  2CVB A;  4W66 A;  5HFI A;  3US3 A;  2F8A A;  1SL0 B;  4EO3 A;  1AQV A;  4GDF A;  4FH8 A;  2MMN A;  4LLR A;  3APO A;  1IYH A;  3MYD A;  2A2S A;  2CAQ A;  22GS A;  2UV8 G;  4X0X A;  4RQR A;  4ZB7 A;  5BMU A;  2CAI A;  3IRA A;  4WF4 A;  2HSM A;  2GLR A;  4IQ1 A;  4ZB8 A;  5G31 A;  2R0G A;  4GCI A;  1Y25 A;  4K9Z A;  4RQX A;  4IJ3 A;  4N3Z A;  2MMZ A;  1UVZ A;  4J2F A;  3DD3 A;  2I1U A;  1SVL A;  4KW6 A;  1XFL A;  3WYW A;  4YAV A;  1MEK A;  3EWL A;  3IV4 A;  1K0B A;  3C1S A;  5J9C A;  2CQ9 A;  1ZOF A;  3EYT A;  4XS4 A;  1EP7 A;  3BOA A;  5CRD A;  4OMV A;  5EVO A;  2MMA A;  2EFE A;  4V2M A;  1DE2 A;  2GGT A;  4MMM A;  2EFC A;  2R2J A;  3PIN A;  2HSN B;  4TXV A;  5EY6 A;  2C0G A;  1WMJ A;  1U3A A;  2XC2 A;  1YVL A;  4TN8 A;  10GS A;  5B8A A;  3ZRE A;  3UVH A;  2VL3 A;  2H0G A;  2DC5 A;  5DCG A;  5D9T A;  4N10 A;  1U88 A;  4A5P A;  2I3Y A;  2GSQ A;  4KA0 A;  4MAB A;  4YQU A;  4MJE A;  4AKI A;  4O92 A;  5G5F A;  1FVK A;  5CYY A;  1WRY A;  3G9B A;  4MJA A;  5ECL B;  4E8E A;  2VL2 A;  2VL2 C;  5INY A;  1SYX A;  2C0D A;  3UMA A;  2ALB A;  4PNF A;  5IMF A;  2YWO A;  2VD1 A;  3P7X A;  2R0C A;  4XCS A;  5IOW A;  2X8C A;  1PRX A;  4ZIL A;  2GQK A;  1GUL A;  1A2L A;  1O81 A;  2BMX A;  2F51 A;  2IWT A;  3NIV A;  1AQX A;  1SL2 B;  4USS A;  3KMO A;  1Q4J A;  2NPB A;  3ZTL A;  4WBJ A;  2R6K A;  4O5Q A;  2HRA A;  2DBC A;  2JSY A;  18GS A;  5ECH B;  3V1W A;  1OE8 A;  4PNG A;  1ZYE A;  4IEL A;  1ILO A;  5AIX A;  4JR4 A;  3FHK A;  1K3Y A;  2HT9 A;  3VWX A;  4F0B A;  2V41 A;  4L0U A;  1J9B A;  2IME A;  2AB6 A;  3EMX A;  3F63 A;  3DIE A;  2JAC A;  1T8E B;  4YAP A;  3A5I A;  3GFK A;  1SD8 A;  4IGJ A;  3GTU B;  2GVP A;  4BVX A;  5H5R A;  4MP4 A;  5ECR B;  4GF0 A;  19GS A;  3HHV A;  1SVO A;  2A4H A;  1B9Y C;  2NVL A;  4MLY A;  3D4T A;  2PGT A;  2XPE A;  5DAL A;  3HKR A;  2V2G A;  5CO3 A;  2L57 A;  2C1Y A;  4FYU A;  3GSS A;  2CV4 A;  5D9V A;  5GST A;  1ERT A;  4JR6 A;  4JU5 A;  2H76 A;  3MSZ A;  2KHP A;  4PQH A;  4GST A;  5G5E A;  4GSN A;  2AV4 A;  1A0R P;  4GQC A;  2DJK A;  2OAC A;  4QL9 A;  1EZK A;  4Z2T A;  4N0V A;  3BBY A;  4KUN A;  3RAZ A;  4GRF A;  3I9V 2;  4EL1 A;  1OC8 A;  1FOV A;  2TRX A;  4N11 A;  1TRS A;  2YWI A;  1M2B A;  4TR3 A;  4K8M A;  5ECS A;  2VLU A;  1T3B A;  1BG1 A;  1G0T A;  3F6F A;  1I5G A;  2L4C A;  2RM5 A;  3ERF A;  1XWA A;  3TOU A;  4V1A p;  4K6X A;  2RLI A;  3VI5 A;  3FEU A;  2H30 A;  4EVM A;  1XWG A;  4ECB A;  1SK0 A;  5DAK B;  3WGX A;  4Z2U A;  3D6I A;  3LGC A;  1URM A;  3O76 A;  4IHU A;  3LYP A;  5B7C A;  4IP6 A;  2CX3 A;  2LNS A;  11GS A;  1GSQ A;  1PKZ A;  3GUR A;  5DDL A;  4OCE A;  4DSS A;  4AKG A;  4HZ4 A;  1DE1 A;  3IC4 A;  3GX0 A;  1K0O A;  4D73 A;  2TIR A;  2QA1 A;  5IO2 A;  3HJP A;  3FR3 A;  3G7Y A;  3HZ8 A;  4DSQ A;  4F2I A;  2MZC A;  4G10 A;  5HFG A;  1H75 A;  4WF5 A;  3W8J A;  4ISD A;  1QMV A;  1WJK A;  3DML A;  1F3B A;  2FA8 A;  4PTS A;  1E6B A;  6GSU A;  1VF4 A;  2WB9 A;  2GST A;  3GMF A;  1FVJ A;  3LG6 A;  1USB A;  1Z5Y E;  2DKI A;  1EP8 A;  1ABA A;  1X0R A;  2JU5 A;  2BTO T;  1AIU A;  5DJL A;  2OE3 A;  2HRN A;  2FD3 A;  2WUL A;  3N5O A;  2VCT A;  2F8F A;  2G2Q A;  3GIX A;  4EXJ A;  1E2Y A;  4MPG A;  4WBR D;  3HXS A;  1V58 A;  2NDO A;  5CNW A;  1S3C A;  4BVY A;  4ID0 A;  3VPT A;  2IMK A;  3TRX A;  1AC1 A;  1GSU A;  1OYJ A;  2R3X A;  5E4W A;  1XZO A;  2JAD A;  3P2A A;  1QK8 A;  1SL1 B;  1GSY A;  2OKA A;  4MJB A;  3FYG A;  1GSF A;  1A0F A;  5F06 A;  1HYU A;  1OVN A;  1VF3 A;  2X64 A;  4ZL7 A;  4XS1 A;  4PXO A;  3IC8 A;  3TJJ A;  1PL2 A;  1NM3 A;  5ECN B;  1SKW B;  3GNJ A;  4I2U A;  3Q18 A;  3W6G A;  4ZBD A;  5IM9 A;  2RM6 A;  4K2D A;  3IE3 A;  5FT3 A;  1AUC A;  4K7O A;  1JHB A;  3WT1 A;  5A34 B;  4ZL9 A;  1WE0 A;  5AIV A;  5D9W A;  1PA3 A;  3KTB A;  3F0I A;  1PGT A;  4K7N A;  3H4K A;  4KB3 A;  4DVC A;  2EIQ A;  4TXO B;  2LV3 A;  4GTU A;  4QQ7 A;  1GL8 A;  4RUV A;  3TKS C;  2IJY A;  3QR6 A;  3MNG A;  3WD6 A;  3ZZX A;  2E0Q A;  5LCZ A;  4PX1 A;  2H1D A;  3GH6 A;  2IFQ A;  1QFN A;  5JCU A;  2GSS A;  1Q98 A;  1RW1 A;  2PN8 A;  1XWB A;  1XXU A;  3KM6 A;  3TDG A;  4G0L A;  4V2L A;  2FY6 A;  3M0F A;  5CRW A;  1GNE A;  4EIQ A;  4L5O A;  5JCG A;  1K0C A;  3FZA A;  2FHE A;  3Q74 A;  3DEX A;  4PUF C;  5CRH A;  4K0G A;  4BWS A;  4MZC A;  1M7T A;  5D9X A;  1ZGN A;  3RHC A;  1TDI A;  4I6X A;  3ZVJ D;  5J3R A;  4E8H A;  1BQ7 A;  2GZY A;  2FWE A;  5D8I A;  2REM A;  2H1G A;  5B6M A;  5B8B A;  4HJ2 A;  5F07 A;  2PMT A;  2XHF A;  2XBI A;  4TR4 A;  2OJL A;  2X8G A;  3KXO A;  1AXD A;  1YKC A;  1TK0 B;  3J7Y k;  2FWG A;  1GP1 A;  3VWW A;  4I8B A;  1YJ6 A;  2ON7 A;  4K0N A;  3VUR A;  5BMU B;  3FR6 A;  5G30 A;  1THO A;  1C72 A;  4N30 A;  4PUR A;  1X5C A;  4IBP A;  4POL A;  1THX A;  1BF5 A;  2HZE B;  1Y1U A;  1ACV A;  2IMI A;  5A4W A;  1VF1 A;  2H66 A;  1ZCP A;  4MZW A;  1M9B A;  3QAW A;  5D93 A;  3EU4 A;  3BCK A;  3EUR A;  5C04 A;  4EC0 A;  2IPA A;  2B1L A;  1IYI A;  1SVM A;  4P3Y B;  2LRN A;  2WDU A;  1Z3E A;  3BD2 A;  2YNX A;  3G7I A;  4YKG A;  1TXX A;  3ED3 A;  3CTF A;  3ERW A;  1O8X A;  2B7K A;  3KJY A;  2LKU A;  1FHE A;  1T7P B;  1SYR A;  3DYR A;  2HLS A;  2CZ3 A;  5IO0 A;  2HRK B;  1TU8 A;  1OC9 A;  2KUC A;  1QQ2 A;  3NZN A;  4HU7 A;  2BJX A;  1BX9 A;  2I9H A;  4MF6 A;  2LRC A;  3SWL A;  3RDW A;  2AYT A;  6GST A;  2VM2 A;  5IPH A;  3ZIJ A;  1S3D A;  3FRC A;  2PVQ A;  2A2R A;  5HR3 A;  1GWC A;  2B5X A;  1EGO A;  3P8W A;  2J23 A;  5H5Q A;  3A2W A;  4YKF A;  2VCQ A;  2L59 A;  1XIY A;  1XW5 A;  3TCO A;  1TRU A;  3MAK A;  1O6J A;  3PGT A;  1V98 A;  2EFH A;  5IPG A;  1O73 A;  3TKR A;  2M80 A;  2FUG 2;  4CY8 A;  1GTA A;  1B4P A;  4MDC A;  1UN2 A;  1XWC A;  2OE1 A;  2WCI A;  5ECQ B;  3J7Y b;  2O5V A;  1TI3 A;  2B5Y A;  2VLV A;  2YP6 A;  4MCU A;  2VCW A;  2HNL A;  1EWX A;  5A1N B;  5ECP B;  4NXI A;  3DVX A;  4XIH A;  3QDN A;  4OFT A;  5IMV A;  3UBL A;  2R0P A;  4HOJ A;  1ERU A;  3TJK A;  3UEM A;  4POM A;  2DKH A;  3GYK A;  3K8N A;  2LJA A;  1BJX A;  1OAZ A;  5LNK e;  2HSN A;  5A5K A;  1BAY A;  3L0H A;  2H70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...