3FR6A

Tetramerization and cooperativity in plasmodium falciparum glutathione transferase are mediated by the atypic loop 113-118
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
205
structure length
201
Chain Sequence
b'GDNIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKANETTFLNEDLPKWSGYFEKLLKKNHTDKYYFVGNNLTYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Tetramerization and Cooperativity in Plasmodium falciparum glutathione transferase are mediated by the atypic loop 113-118
rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 67
structure length 201
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3fr6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3fr6A01
3GKMA 4CDOA 2H8LA 2JSZA 5D9TA 1JLWA 2H76A 2B5XA 2IJYA 3F4SA 4EUYA 2JL4A 5D73A 1OC9B 2WGRA 1FAAA 3ZMLA 3GTUA 1XCCA 4Q5FA 6GSYA 1HQOA 2LS5A 4O32A 2GVPA 2YV9A 4IQ1A 3GRXA 5DCHA 2K9FA 2RM5A 3TKSA 5GSSA 1KNGA 4XIHA 1UC7A 2JZSA 3HHVA 4PXOA 3Q6OA 4XTSA 2MMNA 2F51A 1ZYEA 3IAM2 2V32A 3C8EA 1AAZA 2B7KA 3JCML 2HFDA 2VD1A 4BVXA 2H74A 3I9V2 4MJCA 5IMAA 3ZFLA 2FWEA 4ZBBA 2DIZA 2FUG2 1GSEA 3FZAA 5G31A 4MMMA 4GRFA 4IP6A 3HXSA 2GS3A 1Z7RA 2OBKA 4BA7A 2GSQA 4YQUA 5A4UA 3HA9A 1MDJA 3GFKA 1VF2A 3SWLA 4TR1B 4X43A 1G6WA 5B8AA 4K7NA 2HSHA 2GTUA 3GN3A 3C1RA 5ECOB 1X9MB 2AHEA 3IBHA 4L8EA 3R2QA 1RQMA 1T4ZA 4MF7A 5JWQB 4HOJA 3TKSE 1SD8A 4KDUA 3ERGA 1PRXA 1GSQA 1XIYA 3IK9A 5IM9A 2LJAA 5F05A 4P3YB 1V2AA 2H6XA 2DLXA 2OADA 3GSTA 4I2TA 3GL5A 2C80A 4ZBAA 5DAKA 2C0EA 4GSNA 2FNOA 4XHMA 3NZNA 3P90A 3F0IA 5C04A 4JR6A 1SKRB 4XRDA 5JWOB 1OYJA 3FHKA 2EIRA 2QKEA 4WBRD 3L4NA 4IJ3A 3ZREA 1TK8B 4YAVA 2OA7A 2GDRA 5HFGA 1FO5A 4TR4A 2EC4A 4K1FA 1T8EB 4RUVA 2H6YA 2V6KA 3TDGA 4PNFA 3N5OA 2VLTA 1Y25A 3D22A 3G9BA 4WETA 4J2FA 4KX4A 2JACA 3BOAA 5HR2A 3GL3A 5ECIB 3TJKA 3W6GA 3GX8A 1X9SB 4NXIA 22GSA 1OE7A 2PWJA 4KSMA 1TK5B 1SL1B 4ZL8A 4DSQA 3FW2A 4O92A 4YQVA 3D4MA 3UAPA 3F3RA 4NHWA 2VAFA 1Z7PA 4ECCA 2C0FA 5HR3A 2HRAA 2NTOA 4YAPA 2GSSA 5HR1A 2M80A 4KA0A 5EVOA 5F0GA 3F4TA 4OCFA 2A4VA 1CQGA 3ZL5A 5LD0A 1TDIA 4NAXA 1W4VA 2VL3A 2HE3A 1TK0B 3H1NA 4MJAA 5IOXA 5C00A 2F3MA 3RAZA 2ZCTA 3GA4A 2EIOA 4IP1A 4EL1A 4J56E 1BYEA 4JU5A 4HUAA 3EINA 5ENUA 2F9SA 3EMXA 3M1GA 5FT3A 5GAPD 3EMPA 3L9SA 2WDUA 3QAVA 2CX4A 3AY8A 1OKDA 2YWIA 4CHSA 4DVCA 2B1LA 2GQLA 3EU4A 3F6FA 3EYTA 2AV4A 3IOSA 2X64A 2HT9A 13GSA 2WRTA 4V1Ap 3FZ9A 1YEXA 3GTUB 2P31A 5BMUA 12GSA 1I9DA 2L4CA 4K0GA 1B9YC 4E8EA 2C3NA 14GSA 1XOBA 4F0CA 3Q18A 1O8WA 1XW9A 1XVWA 5H5RA 3Q74A 4PQHA 4XS1A 4XRAA 3RPPA 1BG5A 1R5AA 4F9ZA 5ELAA 3GHAA 1BAYA 1GRXA 4TW5A 4BVXB 2FWHA 4EXJA 1K0BA 1MD4A 2DMLA 2YWMA 4EC0A 1TRSA 4WR5A 1F3AA 3HCZA 3IC8A 1K3YA 2H1AA 4V2NA 4IGJA 2REMA 5IIZA 3FR9A 2VCQA 3HJMA 2I3YA 2QC7A 2B5EA 2R5GA 2NBSA 4PX1A 2FWFA 4BL7A 5DQYA 5J41A 3VLNA 2VM2A 2K6VA 3MAKA 4H86A 5AISA 4TR0A 5HQPA 1WOUA 2HQTA 4IS0A 2VL9A 2ZUPA 2XPEA 5D96A 3IRAA 1GTAA 2NVLA 2YNXA 2MZCA 1WRYA 1TI3A 4KW6A 2WB9A 1UVZA 4OWYA 4MP4A 3VPTA 4GQCA 4N30A 5DAKB 5EY6A 1ZL9A 3C73A 3G7JA 3DYRA 1WPIA 1V9WA 3Q19A 1ILOA 1E6BA 2WCIA 2VUPA 1TU7A 5IMZA 1WE0A 2HZEA 3TJBA 4BVYA 4PGTA 3E0UA 2RLIA 5G1LA 2XBQA 3UIWA 4HZ4A 4G0KA 1Q4JA 5EPFA 1AQWA 4ECBA 2OJLA 2GSTA 4OMVA 1X9WB 4ML6A 2YOIA 5JCWA 2C0GA 5COHA 3DVWA 3H4KA 3KH7A 1GUMA 4XCSA 4NWYA 1M7TA 1SKWB 1V58A 3GH9A 5LNKe 3GSSA 1Y6EA 2Z9SA 1GTIA 2IMEA 3H8QA 1SL2B 4MPGA 1TTZA 3DEXA 1ST9A 4ZL7A 2A2RA 2WJUA 2OKAA 1QGVA 1GULA 3RDWA 2OE3A 4KGIA 1A24A 1ZGNA 3IE3A 4YH2A 2DJ0A 1EEJA 2R37A 3FRCA 3VWVA 1AW9A 3ED3A 2PMTA 3E3EA 2CVKA 1XVQA 3GKNA 4HDEA 2CT6A 4ZL9A 1OAZA 2H73A 1XWGA 5ECSA 3FKFA 4IW9A 2HSMA 1BX9A 4L5OA 1QXHA 1BJXA 3PPUA 4G0IA 2KP2A 3GURA 1A8YA 1TRVA 2B3SA 1J0FA 1ZYQB 1OKTA 3M0FA 3CSJA 5B7CA 5ECQB 3C1SA 1THXA 3GIXA 4QL9A 1T3BA 4WR4A 3KZQA 1KTEA 1VF1A 3FR3A 4OFTA 2N5AA 5INYA 2J9HA 3K8NA 3WGDA 4O7HA 4ZIJA 2IMKA 3EWLA 4LA1A 4I8BA 4HQSA 3A2WA 2R3XA 4TXVA 1XBSA 2IMDA 1EP7A 2LJRA 1EV9A 4IHUA 3DD3A 3A2VA 2VCZA 4Z7XA 4FIWA 3CMIA 4WKWA 1S3AA 3W8SA 5ID2A 3D0ZA 4G2EA 3FZ5A 3VK9A 1MEKA 2FA8A 4ZBDA 1SKSB 1JLVA 3CBUA 4CW9A 4HQZA 2VD0A 2IWTA 3CXGA 1QFNA 3KP9A 18GSA 3QPMA 2WULA 1I5GA 3TKQA 2GQKA 1G0TA 4ZB6A 3IAS2 1GSFA 2HRKA 2J23A 4KB3A 3RPNA 3PGTA 2ALBA 4K7IA 1HD2A 2LNSA 4BL7B 4X1UA 2L6CA 2HSYA 4OD7A 1HNCA 5J4UA 1M9AA 4KE3A 3VWXA 1SD9A 1SU9A 4FH8A 3GKKA 1PD21 2MBSA 5GZZB 2FLSA 3TKRA 5DALA 2R6KA 3TRPA 2GT6A 1EV4A 3TRQA 2L6DA 5G1KA 2H75A 1V40A 3H93A 4LMVA 3UMAA 2H6ZA 2IN3A 5IQYA 2GZYA 1U87A 1XWAA 1GSSA 1FHEA 4ISDA 3ZIJA 4QL7A 4BVYB 5LCZA 2LRNA 2CZ2A 3VI5A 3TJGA 3HZ4A 5IMFA 1Q98A 3BJ5A 2E0QA 1ACVA 4K9ZA 1YEPA 3QAGA 1PA3A 1URMA 4QQ7A 1F3BA 3CSIA 4JE1A 3QFBC 4KDYA 8GSSA 4BPYA 6GSUA 3KMNA 3L78A 3SBCA 4MCUA 1EOHA 1X0RA 3HD5A 2IIYA 3ZYWA 1BQ7A 2TRXA 3HYPA 3APOA 4KDXA 1V57A 2H19A 4MF6A 1PL2A 2KHPA 3ZZXA 4HEA2 2OE1A 4ACSA 2YCDA 2LV3A 3ZIVA 2VLUA 3HVVA 3VI7A 4MA9A 1OC3A 1H75A 1YDKA 3M9JA 2YZUA 4D73A 2FY6A 5KN1A 1HNBA 4TXOA 2AYTA 1O85A 1R7HA 1PL1A 2DSAA 2BTOT 1O73A 3ZLPA 2HRFA 2RIIA 6GSSA 1PN9A 3UJ1A 19GSA 5ECNB 1GP1A 4N0VA 1SJ6A 4I2UA 4PUFC 4ZXGA 3WD6A 1N8JA 4JBBA 3J7Yk 1MTCA 2V6OA 4N10A 1X5DA 2HSMB 2YPMA 4GSTA 2E2GA 5CRDA 1AXDA 2H1GA 1ERWA 2NDOA 3UBKA 2I81A 1FW1A 2OE0A 1RK4A 4POBA 2PVQA 3LQ7A 4LLRA 4G0LA 3KEBA 5IO0A 1TI1A 3N9JA 2LSTA 1UN2A 2L59A 2XPDA 3MNGA 3QFAC 5KN3A 3EU3A 1GSUA 1ML6A 4I5QA 3L9UA 3VFIA 3S9FA 3UL3A 3NIVA 1LJRA 3F9UA 4EF0A 1ERUA 17GSA 3MSZA 4GLTA 2WS2A 3KTBA 4HS1A 3FZ4A 4V2MA 4PTSA 3CRTA 4EDZA 1TW9A 4HI7A 5IPHA 1XW6A 2DJJA 2EIQA 2HZFA 4MPFA 2CA8A 3PR8A 4JRRA 2OACA 5A4VA 4IVFA 1IYHA 1G6YA 2CZ3A 2C3TA 3KIJA 1ERTA 3KTLA 2F8FA 3QR6A 2B1KA 5ID2B 3ZRDA 1M2BA 3C71A 2IFQB 3DWVA 2PVOC 4IN0A 3ZVJD 1LBKA 3GMFA 4AJ8A 4NV2A 1X5EA 1S3CA 4ML1A 5CAXA 2IL3A 3HVSA 4V1Ag 3KM6A 5A5KA 1TJDA 1XW5A 2PN8A 2K8SA 1XZOA 5ECRB 2RUEA 5G30A 4TVEA 1ZZYA 2H01A 2H0GA 2H70A 1N2AA 3FYGA 4I6XA 4OFNA 4TRXA 1Z6NA 4KF9A 1O81A 3NOFA 4K7OA 5ELGA 2GT5A 1FVJA 1VGLA 2PU9C 3VWWA 2DJ3A 3LXTA 3ME7A 1OC8A 4NPBA 5DJLA 2E2MA 3D4TA 4IJIA 2DMMA 4L0UA 2HXKA 3E9JB 4POKA 3EC3A 5CREA 3LXZA 2H0HA 3RHCA 6GSTA 1K3OA 4V2LA 2C0DA 3WYWA 5FWGA 4POMA 3EVIA 5D93A 4GWRA 3P8WA 1XXUA 5J9CA 2UZ8A 2FD3A 2IMIA 1ZOFA 1YF1A 4ID0A 2F8AA 1SL0B 2A2SA 1F37A 3D21A 2DC5A 1YZXA 2AUVA 4PQIA 3A2XA 1X5CA 3ZVJA 3P2AA 1OE8A 1YKCA 2YZHA 1PGTA 3MWHA 4GTUA 3IR4A 4HZ2A 1SK1A 3A5WA 1T1VA 3V1WA 4XS4A 2C3QA 3TOUA 1M99A 5AIXA 2P0GA 5DVBA 2H66A 2VIMA 3UBLA 1ZMAA 3BBYA 3ISOA 5CO3A 2MBTA 2KOKA 3UEMA 3HJOA 3CYNA 2AJQB 1J9BA 1XFLA 3HZ8A 4NHZA 4D73B 1K0AA 3P7XA 2FGXA 3ME8A 4GQFA 4TXOB 5DBQA 3U6VA 1WMJA 3KCMA 3QDNA 3ERWA 5DDLA 4EDYA 2V2GA 4HU7A 10GSA 4MK3A 3F3QA 2VM1A 4OO4A 4POLA 1TRUA 3CRUA 1GTBA 3PINA 4DSRA 2AB6A 2B6MA 1AUCA 1HNAA 2YV7A 2IMFA 4BWSA 5B8BA 2PERA 2LKUA 2LTKA 4WBJA 1AQVA 1U6TA 2N5BA 1M0UA 3ZFBA 1DUGA 1Z5YE 1JZRA 2YN1A 5AIVA 5G5FA 2LNTA 4E8HA 1T7PB 4TR3A 1GLPA 5DCGA 1PKWA 3GUSA 2YP6A 2H0IA 1SK0A 2RM6A 3VURA 4MLYA 4TOPA 2K18A 2C4JA 4JEDA 5H5QA 2V41A 1VRSD 2O89A 2ON7A 1A0RP 1XWBA 2CAIA 5KEJA 1O6JA 1ERVA 2OBIA 2VO4A 3GH6A 5G5EA 4GSSA 1TXXA 2WFCA 4TKYA 3F6DA 4AF2A 3M3MA 2CVDA 4MJEA 1NW2A 2D2ZA 1WIKA 1GNEA 3CSHA 3H79A 3BCIA 2K8VA 1B9XC 1JZDA 1AIUA 3WT1A 4FYCA 2LJKA 2VCTA 1M2AA 5CRWA 2IPAA 3IDVA 2JZRA 2H30A 1XWKA 1MDIA 4L5LA 3DRNA 1EEMA 16GSA 2PGTA 4MDCA 2XBIA 1GSDA 4Q5QA 4ECIA 1O7UA 1SJZA 3CTGA 3DVXA 1XWCA 2PUKC 4F03A 1SJIA 5EL8A 2H1BA 1K0DA 5A4WA 2LUSA 5ECMB 5IMVA 1R26A 1JZOA 2JU5A 3UVHA 1MD3A 4G19A 3D5JA 3BCKA 1RW1A 3FR6A 1U88A 5GSTA 1CQHA 3TKPA 1A2LA 5HR0A 5F06A 5ABRA 2GSRA 3RHBA 1YY7A 4F2IA 2KLXA 2YWOA 2O7KA 5F07A 1T4YA 1XPVA 4G9HA 2L5OA 4XS4B 5J5NA 3ZTLA 4F82A 1GSYA 1K0MA 4MZBA 1Z9HA 4KCEA 1TKDB 2ES7A 1M9BA 4GXZA 1GUHA 2HZEB 3MDKA 1F2EA 1TOFA 1J08A 3HDCA 2HI7A 3PH9A 5J3RA 1C72A 2CAQA 3DXBA 4EVMA 1K3LA 2VLVA 1AQXA 4MH3A 1QMVA 1WJKA 2YANA 1H4OA 1YKAA 4EO3A 5ECPB 2GGTA 1EWXA 4FO5A 5KN0A 1G7EA 1DE1A 2CQ9A 1THOA 1ZCPA 3M8NA 11GSA 1QK8A 2LRTA 5CYYA 2DBCA 4FYBA 1GNWA 5D9VA 3IXRA 2ON5A 1XOAA 3L9VA 4WXTA 2X99A 4K6XA 2FA4A 2I1UA 2HSNB 1A0FA 4FYUA 1F9MA 3LWAA 1B4QA 2O87A 2X8GA 1TU8A 4WF4A 2KP1A 5IMDA 3WGEA 3WGXA 5ECLB 3I43A 4YQMA 1SYRA 5IMCA 4JR4A 3HJPA 5JCGA 2LQOA 1LU4A 1W89A 1U3AA 1E2YA 2CVBA 5IOWA 1HYUA 3UOMA 1GH2A 1QUWA 3ERFA 3UVTA 4AGSA 1EGOA 1JFUA 4Q5RA 4IKHA 4F0BA 2B5YA 2VOCA 1V98A 3US3A 2MYGA 3QAWA 4PUAA 5G2ZA 1EGRA 3TRXA 4IBPA 1TP9A 5B6NA 6GSXA 3CTFA 1GTUA 3OR5A 2TRCP 3F63A 2GQMA 2BJXA 3UARA 4KAEA 3D6IA 1BEDA 1EZKA 4K8MA 3LSZA 2VCXA 2VL2C 1DE2A 2G2QA 2RUFA 3GNJA 4K0NA 4KH7A 3FY7A 4K2DA 2FCHA 3FEUA 4KUNA 4I97A 2X8CA 3M9KA 3TUEA 1NHOA 5L71A 1O8XA 2O8VB 4L0WA 2ZNMA 2HRNA 3G7YA 4GF0A 3F8UA 3QMXA 2P5RA 3KP8A 1DBYA 1FB0A 3APQA 4NMUA 5IO2A 2MMZA 2HNLA 1JZWA 3I69A 4IELA 3I6AA 3QCPA 3VWUA 1ABAA 4LL4B 1G7OA 3GKXA 5J9BA 3ZITA 4IQAA 1ON4A 4O5RA 5AGYA 3DMLA 3U5RE 2LQQA 1PKZA 5IPGA 2YWNA 1PQNA 2GLRA 4MH2A 4EE0A 2GZZA 2HRKB 4FQUA 4USSA 5D8IA 4EKZA 5E4WA 6GSWA 1NHYA 2R4VA 2VCWA 1SK2A 4OO5A 3KD0A 1PSQA 3LYPA 2MMAA 1M2DA 2VCVA 4OCEA 4GCIA 3GX0A 4HJ2A 1AC1A 5DALB 4DSSA 1YQ1A 5CRHA 5GAND 3LG6A 1PX6A 2BMXA 4RQXA 1K0OA 3KMOA 3IK7A 2XHFA 1OVNA 1GUKA 2CV4A 3TGZA 3HVXA 2L5LA 4MABA 3EE2A 3DIEA 2QGVA 1WWJA 5DJMA 1A2JA 3VPQA 5CNWA 2I9HA 1Z3EA 3APSA 2QSIA 3LEFA 5HFIA 2M72A 3IC4A 9GSSA 4HJMA 4ZB8A 2V1MA 1OC9A 2VL2A 2N5FA 3HY2A 2C1YA 4LMWA 5FHIA 2DJKA 3GYKA 1DSBA 1EP8A 1FB6A 3QOUA 5F8BA 3J7Yb 4KNDA 5D9WA 3G7IA 2AAWA 1GL8A 1GWCA 1SENA 4RQRA 1WP0A 1VF4A 2B7JA 4X0XA 3LYKA 3IV4A 2TIRA 4ULXA 1FOVA 2YJ7A 4N0ZA 2MMOA 2HLSA 1Z6MA 1R5PA 5CRGA 3TOTA 3R3EA 2X8HA 4TR1A 3TJFA 1T00A 1USBA 4MJBA 4MZCA 1GLQA 2G0FA 2PPTA 1YJ6A 3RBTA 1A8LA 1YF0A 5B6MA 2JZTA 6GSVA 4LL1B 3KXOA 1B48A 5DQSA 1S3DA 3F4RA 1UA5A 3TB2A 2XC2A 5JCUA 1PMTA 1B4PA 1A23A 2H72A 4PQ1A 4XS6A 2FWGA 1SYXA 3GV1A 1NSWA 4AJ7A 3TJJA 2DIYA 4OFMA 4DEJA 2KUCA 4KSOA 4BWQA 3LFLA 4ZB9A 1K0CA 3BD2A 3LJRA 2L57A 4KCAA 4WF5A 5H5SA 4ILFA 2R2JA 3KGKA 4PURA 4RI6A 4WEYA 3C7MA 2LRCA 4JZQA 1FVKA 3DGQA 1PX7A 2JADA 20GSA 4TN8A 3O6TA 3TKSC 5D9XA 2FHEA 3IA1A 4MZWA 2O85A 3A3TA 4NV5A 7GSSA 3O3TA 5ECHB 2H1DA 3O76A 5CP1A 3WT2A 4G10A 2DJ1A 2PBJA 4MF5A 3W8JA 1IYIA 1EOGA 4N11A 1JHBA 3KJYA 3EURA 4Q5NA 2LEGA 2CX3A 4AJ6A 3TCOA 5ECKB 2DJ2A 1U3IA 1MDKA 2L4QA 2M46A 2I4AA 2E7PA 1F6MC 2YJHA 2GZPA 2JSYA 4RI7A 3LGCA 3LORA 1QQ2A 1FG4A 3FK8A 3DKSA 5HFKA 1K0NA 2WZ9A 3KH9A 1KEBA 4ZILA 3L0HA 2NPBA 1VF3A 1R4WA 1B8XA 3QD9A 4J57E 4PNGA 2HYXA 1KBNA 3IPZA 5KN2A 1NM3A 5E59A 4DSSB 3IHQA 2H71A 2C8UA 5JWRB 4ECJA 1TRWA 2P5QA 3HKRA 1A2MA 4HU9A 3ZMKA 2IFQA 5AN1A
chains in the Genus database with same CATH superfamily
3GKMA 4CDOA 2H8LA 2JSZA 5D9TA 1JLWA 2H76A 2B5XA 2IJYA 3F4SA 4EUYA 2JL4A 5D73A 1OC9B 2WGRA 1FAAA 3ZMLA 3GTUA 1XCCA 4Q5FA 6GSYA 1HQOA 2LS5A 4O32A 2GVPA 5J4YA 2YV9A 4IQ1A 3GRXA 3RGBC 5DCHA 2K9FA 2RM5A 2O36A 3TKSA 5GSSA 4Z2UA 1KNGA 4XIHA 1UC7A 2JZSA 3HHVA 4PXOA 3Q6OA 4XTSA 2MMNA 2F51A 1ZYEA 2H1LA 3IAM2 2V32A 3CHXC 3C8EA 1AAZA 2B7KA 3JCML 2HFDA 2VD1A 5A1NA 4BVXA 2H74A 1BF5A 3I9V2 4MJCA 5IMAA 3ZFLA 2FWEA 4ZBBA 2DIZA 2FUG2 1GSEA 3FZAA 5G31A 4MMMA 4GRFA 4IP6A 3HXSA 2GS3A 1Z7RA 2OBKA 4BA7A 2GSQA 2O5VA 4YQUA 5A4UA 3HA9A 1MDJA 3GFKA 1VF2A 3SWLA 1YVLA 4TR1B 4X43A 1G6WA 5B8AA 4K7NA 2HSHA 2GTUA 3GN3A 3C1RA 5ECOB 1X9MB 2WW0A 2AHEA 3IBHA 4L8EA 3R2QA 1RQMA 1T4ZA 4MF7A 5JWQB 4HOJA 3TKSE 1SD8A 4KDUA 3ERGA 1PRXA 1GSQA 1XIYA 3IK9A 5IM9A 2LJAA 5F05A 4P3YB 1V2AA 2H6XA 2DLXA 2OADA 3GSTA 1I1IP 4I2TA 3GL5A 4CY6A 2C80A 4ZBAA 5DAKA 2C0EA 4GSNA 2FNOA 5KOXA 4XHMA 3NZNA 3P90A 3F0IA 5C04A 4JR6A 1SKRB 4MNNA 4XRDA 5JWOB 1OYJA 3FHKA 2EIRA 2QKEA 4WBRD 3L4NA 4IJ3A 2WZSA 3ZREA 1TK8B 4YAVA 2OA7A 2GDRA 5HFGA 1FO5A 4TR4A 2EC4A 4K1FA 1T8EB 3MIXA 2WW2A 4RUVA 2H6YA 2V6KA 3TDGA 4PNFA 3N5OA 2VLTA 1Y25A 3D22A 3G9BA 4WETA 4J2FA 4KX4A 2JACA 3BOAA 5HR2A 3GL3A 5ECIB 3TJKA 3W6GA 3GX8A 1X9SB 4NXIA 22GSA 1OE7A 2PWJA 4KSMA 1TK5B 1SL1B 4ZL8A 4DSQA 3FW2A 2QA2A 4N3ZA 4O92A 4YQVA 3D4MA 3UAPA 3F3RA 4NHWA 2VAFA 1Z7PA 4ECCA 2C0FA 5HR3A 2HRAA 2NTOA 4YAPA 2GSSA 5HR1A 2M80A 4KA0A 5EVOA 5F0GA 3F4TA 4OCFA 2A4VA 1CQGA 3ZL5A 5LD0A 1TDIA 4NAXA 1W4VA 2VL3A 2HE3A 1TK0B 3H1NA 4MJAA 5IOXA 5C00A 2F3MA 3RAZA 2ZCTA 3GA4A 2EIOA 4IP1A 4EL1A 4PI2C 4J56E 1BYEA 4JU5A 4HUAA 3EINA 5ENUA 2F9SA 3EMXA 3M1GA 5FT3A 5GAPD 3EMPA 3L9SA 2WDUA 3QAVA 2CX4A 3AY8A 4E68A 1OKDA 2YWIA 4CHSA 4DVCA 2B1LA 2GQLA 4AKXB 3EU4A 3F6FA 3EYTA 2AV4A 3IOSA 2X64A 2HT9A 13GSA 2WRTA 4V1Ap 3FZ9A 1YEXA 3GTUB 2P31A 5BMUA 12GSA 1I9DA 2L4CA 4K0GA 1B9YC 4E8EA 2C3NA 14GSA 1XOBA 4F0CA 3Q18A 1O8WA 1XW9A 1XVWA 5H5RA 3Q74A 4PQHA 2A2PA 4XS1A 4XRAA 3RPPA 1BG5A 1R5AA 4F9ZA 5ELAA 3GHAA 1BAYA 1GRXA 4TW5A 4BVXB 5A1NB 2FWHA 4EXJA 1K0BA 1MD4A 2DMLA 2YWMA 4EC0A 1TRSA 4WR5A 1F3AA 3HCZA 3IC8A 1K3YA 2H1AA 4V2NA 4IGJA 2REMA 5IIZA 3FR9A 2VCQA 3HJMA 1ZYPA 2I3YA 2QC7A 2B5EA 2R5GA 2NBSA 4PX1A 2FWFA 4BL7A 5DQYA 5J41A 3VLNA 2VM2A 2K6VA 3MAKA 4H86A 4QMKA 5AISA 4TR0A 5HQPA 1WOUA 2HQTA 4IS0A 2VL9A 2ZUPA 2X49A 2XPEA 5D96A 3IRAA 1GTAA 2NVLA 2YNXA 2MZCA 3HMJG 1WRYA 1TI3A 4KW6A 2WB9A 1UVZA 4OWYA 4MP4A 3VPTA 4GQCA 4N30A 5DAKB 5EY6A 1ZL9A 3C73A 3G7JA 3DYRA 1WPIA 1V9WA 3Q19A 1ILOA 1E6BA 2WCIA 2VUPA 1TU7A 1FOHA 5IMZA 1WE0A 2HZEA 3TJBA 4BVYA 4PGTA 3E0UA 2RLIA 5G1LA 2XBQA 3UIWA 4HZ4A 4G0KA 1Q4JA 5EPFA 1AQWA 4ECBA 5A34A 2OJLA 2GSTA 4OMVA 1X9WB 4ML6A 2YOIA 5JCWA 2C0GA 5COHA 3DVWA 3H4KA 3KH7A 1GUMA 4XCSA 4NWYA 4Z2RA 1M7TA 1SKWB 1V58A 3GH9A 5LNKe 3GSSA 1Y6EA 2Z9SA 1GTIA 2IMEA 3H8QA 1SL2B 4MPGA 1TTZA 3DEXA 1ST9A 4ZL7A 2A2RA 2WJUA 2OKAA 1QGVA 1GULA 3RDWA 2OE3A 4KGIA 1A24A 1ZGNA 3IE3A 4YH2A 2DJ0A 1EEJA 2R37A 3FRCA 2X4AA 3VWVA 1AW9A 3ED3A 2PMTA 3E3EA 2CVKA 1XVQA 3GKNA 4HDEA 2CT6A 4ZL9A 1OAZA 2H73A 1XWGA 5ECSA 3FKFA 4IW9A 2HSMA 1BX9A 4L5OA 1QXHA 1BJXA 3PPUA 4G0IA 2KP2A 4PHZC 3FMWA 3GURA 1A8YA 1TRVA 2B3SA 1J0FA 1ZYQB 1OKTA 3M0FA 3CSJA 5B7CA 5ECQB 3C1SA 1THXA 3GIXA 4QL9A 1T3BA 4W66A 4WR4A 3KZQA 1KTEA 1VF1A 3FR3A 4OFTA 2N5AA 2WVXA 5INYA 2J9HA 1SVMA 3K8NA 3WGDA 4O7HA 4ZIJA 2IMKA 3EWLA 4LA1A 3IHGA 4I8BA 4HQSA 3A2WA 2R3XA 4TXVA 1XBSA 2IMDA 1EP7A 2LJRA 1EV9A 4IHUA 3DD3A 3A2VA 2VCZA 5BMUB 4Z7XA 4FIWA 3CMIA 4WKWA 1S3AA 3W8SA 5ID2A 3D0ZA 4G2EA 3FZ5A 3VK9A 1MEKA 2FA8A 4ZBDA 1SKSB 1JLVA 3CBUA 4CW9A 4HQZA 2VD0A 2IWTA 3CXGA 1QFNA 4YKGA 3KP9A 18GSA 3QPMA 2WULA 1I5GA 3TKQA 2GQKA 1G0TA 4ZB6A 3IAS2 1GSFA 2HRKA 2J23A 4KB3A 3RPNA 3PGTA 5A5HA 2ALBA 4K7IA 1HD2A 2LNSA 4BL7B 4X1UA 2L6CA 2HSYA 4OD7A 4K5RA 1HNCA 5J4UA 1M9AA 4KE3A 3VWXA 1SD9A 1SU9A 4FH8A 3GKKA 1PD21 2MBSA 5GZZB 2FLSA 3TKRA 5DALA 2R6KA 3TRPA 2GT6A 1EV4A 3TRQA 2L6DA 5G1KA 2H75A 1V40A 3H93A 4LMVA 3UMAA 2H6ZA 2IN3A 5IQYA 2GZYA 1U87A 1XWAA 1GSSA 1FHEA 4ISDA 3ZIJA 4QL7A 4BVYB 5LCZA 2LRNA 2CZ2A 3VI5A 3TJGA 3HZ4A 5IMFA 1Q98A 3BJ5A 2E0QA 1ACVA 4K9ZA 1YEPA 3QAGA 1PA3A 1URMA 4QQ7A 5A34B 4EIPA 1F3BA 3CSIA 4JE1A 3QFBC 4KDYA 8GSSA 1TXUA 2EFDA 4BPYA 6GSUA 3KMNA 3L78A 3SBCA 4MCUA 1EOHA 1X0RA 3HD5A 2IIYA 3ZYWA 1BQ7A 2TRXA 3HYPA 3APOA 4KDXA 1V57A 2H19A 4MF6A 1PL2A 2KHPA 3ZZXA 4HEA2 2OE1A 4ACSA 2YCDA 2LV3A 3ZIVA 2VLUA 3HVVA 3VI7A 4MA9A 1OC3A 1H75A 1YDKA 3M9JA 2YZUA 3RFRC 4D73A 2FY6A 5KN1A 1HNBA 4TXOA 2AYTA 1Y1UA 1O85A 1R7HA 1PL1A 2DSAA 2BTOT 1O73A 3ZLPA 2HRFA 2RIIA 6GSSA 1PN9A 3UJ1A 19GSA 5ECNB 1GP1A 4N0VA 1SJ6A 4I2UA 4PUFC 4EIQA 4ZXGA 3WD6A 1N8JA 4JBBA 3J7Yk 1MTCA 2V6OA 4N10A 1X5DA 2HSMB 2YPMA 4GSTA 2E2GA 1ZYNA 5CRDA 1AXDA 2H1GA 1ERWA 2NDOA 3UBKA 2I81A 1FW1A 2OE0A 1RK4A 4POBA 2R0CA 2PVQA 3LQ7A 4LLRA 4G0LA 3KEBA 5IO0A 1TI1A 3N9JA 2LSTA 1UN2A 2L59A 2XPDA 4CY8A 3MNGA 3QFAC 5KN3A 3EU3A 1GSUA 1ML6A 4I5QA 3L9UA 3VFIA 3S9FA 3UL3A 3NIVA 1LJRA 3F9UA 4EF0A 1ERUA 17GSA 2EFEA 3MSZA 4GLTA 2WS2A 2WW3A 3KTBA 4HS1A 3FZ4A 4V2MA 4PTSA 3CRTA 4EDZA 1TW9A 4HI7A 5IPHA 1XW6A 2UV8G 2DJJA 2EIQA 2HZFA 4MPFA 2CA8A 3PR8A 4JRRA 2OACA 5A4VA 4IVFA 1IYHA 5J40A 3HVNA 1G6YA 2CZ3A 2C3TA 3KIJA 1ERTA 3KTLA 2F8FA 3QR6A 2B1KA 5ID2B 3ZRDA 1M2BA 3C71A 2IFQB 3DWVA 2PVOC 5J47A 4IN0A 3ZVJD 1LBKA 3GMFA 4AJ8A 4NV2A 1X5EA 1S3CA 4ML1A 5CAXA 2IL3A 3HVSA 2QA1A 4AKIA 4V1Ag 3KM6A 5A5KA 1TJDA 1XW5A 2PN8A 2K8SA 1XZOA 5ECRB 2RUEA 5G30A 4TVEA 1ZZYA 2H01A 2H0GA 2H70A 1N2AA 3FYGA 4I6XA 4OFNA 4TRXA 1Z6NA 4KF9A 1O81A 3NOFA 4K7OA 5ELGA 2GT5A 1FVJA 1VGLA 2PU9C 3VWWA 2DJ3A 3LXTA 3ME7A 1OC8A 4NPBA 1BG1A 5DJLA 2E2MA 4HSCX 3D4TA 4IJIA 2DMMA 4L0UA 3MYDA 2HXKA 3E9JB 4POKA 3EC3A 5CREA 3LXZA 2H0HA 3RHCA 6GSTA 1K3OA 4V2LA 2C0DA 3WYWA 5FWGA 4POMA 3EVIA 5D93A 4GWRA 3P8WA 1XXUA 5J9CA 2UZ8A 2FD3A 2IMIA 1ZOFA 1YF1A 4ID0A 2F8AA 1SL0B 2A2SA 1F37A 3D21A 2DC5A 1YZXA 4YKFA 2AUVA 4PQIA 3A2XA 1X5CA 3ZVJA 3P2AA 1OE8A 1YKCA 2YZHA 1PGTA 3MWHA 4GTUA 3IR4A 4HZ2A 1SK1A 3A5WA 1T1VA 3V1WA 4XS4A 2C3QA 3TOUA 1M99A 5AIXA 2P0GA 5DVBA 2H66A 2VIMA 3UBLA 1ZMAA 3BBYA 3ISOA 5CO3A 2MBTA 2KOKA 2R0PA 3UEMA 3LW9A 3HJOA 3CYNA 2AJQB 1J9BA 1XFLA 3HZ8A 4NHZA 4D73B 1K0AA 3P7XA 2FGXA 3ME8A 4GQFA 4TXOB 5DBQA 3U6VA 1WMJA 3KCMA 3QDNA 3ERWA 5DDLA 4EDYA 2V2GA 4HU7A 2EFCA 10GSA 4MK3A 3F3QA 2VM1A 4OO4A 4POLA 1TRUA 3CRUA 1GTBA 3PINA 4DSRA 2AB6A 4GDFA 2B6MA 1AUCA 1HNAA 2YV7A 2IMFA 4BWSA 5B8BA 2PERA 2LKUA 2LTKA 4WBJA 1AQVA 1U6TA 2N5BA 1M0UA 4ZB7A 3ZFBA 2HSNA 1DUGA 1Z5YE 1JZRA 2YN1A 5AIVA 5G5FA 2LNTA 4E8HA 1T7PB 4TR3A 1GLPA 5DCGA 1PKWA 3GUSA 2YP6A 2H0IA 1SK0A 2RM6A 3VURA 4MLYA 4TOPA 2K18A 2C4JA 4JEDA 5H5QA 2V41A 1VRSD 2O89A 2ON7A 1A0RP 1XWBA 2CAIA 5KEJA 1O6JA 2WVZA 1ERVA 2OBIA 2VO4A 3GH6A 4A5PA 5G5EA 4GSSA 1TXXA 2WFCA 4TKYA 3F6DA 4AF2A 3M3MA 2CVDA 4MJEA 1NW2A 1YEWC 2D2ZA 1WIKA 4K5SA 1N25A 1GNEA 3CSHA 3H79A 3BCIA 2K8VA 1B9XC 2VKZG 1JZDA 1AIUA 3WT1A 4FYCA 2LJKA 2VCTA 1M2AA 5CRWA 2IPAA 3IDVA 2JZRA 2H30A 1XWKA 1MDIA 4L5LA 3DRNA 1EEMA 16GSA 2PGTA 4MDCA 2XBIA 1GSDA 4Q5QA 4ECIA 1O7UA 1SJZA 3CTGA 3DVXA 1XWCA 2PUKC 4F03A 1SJIA 5EL8A 2H1BA 1S3RA 1K0DA 5A4WA 2LUSA 5ECMB 5IMVA 1R26A 1JZOA 2JU5A 2DKHA 3UVHA 1MD3A 4G19A 3D5JA 3BCKA 1RW1A 1SVLA 3FR6A 1U88A 5GSTA 1CQHA 3TKPA 1A2LA 5HR0A 5F06A 5ABRA 2GSRA 3RHBA 1YY7A 4F2IA 2KLXA 2YWOA 2O7KA 5F07A 1T4YA 4FXYP 1XPVA 4G9HA 2L5OA 4XS4B 5J5NA 3ZTLA 4F82A 1GSYA 1K0MA 4MZBA 4AKHA 4ICYA 1Z9HA 4KCEA 1TKDB 2ES7A 1M9BA 4GXZA 1GUHA 2HZEB 3MDKA 2R0GA 1F2EA 1TOFA 1J08A 3HDCA 2HI7A 4K2XA 3PH9A 5J3RA 1C72A 4AKGA 2WW1A 2CAQA 3DXBA 4EVMA 1K3LA 2VLVA 1AQXA 1PFOA 4MH3A 1QMVA 1WJKA 2YANA 1H4OA 5BRTA 1YKAA 4EO3A 5ECPB 2GGTA 1EWXA 4FO5A 5KN0A 1G7EA 1DE1A 2CQ9A 1THOA 1ZCPA 3M8NA 11GSA 1QK8A 2LRTA 5CYYA 2DBCA 4FYBA 1GNWA 5D9VA 3IXRA 2ON5A 1XOAA 3L9VA 4WXTA 2X99A 4K6XA 2FA4A 2I1UA 2HSNB 1A0FA 4FYUA 1F9MA 3LWAA 1B4QA 2O87A 2X8GA 1TU8A 4WF4A 2KP1A 5IMDA 3WGEA 3WGXA 5ECLB 3I43A 4YQMA 1SYRA 5IMCA 4JR4A 3HJPA 5JCGA 2LQOA 1LU4A 1W89A 1U3AA 1E2YA 2CVBA 5IOWA 5KOWA 1HYUA 3UOMA 1GH2A 1S4BP 1QUWA 3ERFA 3UVTA 4Z2TA 4AGSA 1EGOA 1JFUA 4Q5RA 4IKHA 4F0BA 2B5YA 2VOCA 1V98A 3A5IA 2MYGA 3US3A 3QAWA 4PUAA 5G2ZA 1EGRA 3TRXA 4IBPA 1TP9A 5B6NA 6GSXA 3CTFA 2WVXB 1GTUA 3OR5A 2TRCP 3F63A 2GQMA 2BJXA 3UARA 4KAEA 3D6IA 1BEDA 1EZKA 4K8MA 3LSZA 2VCXA 2VL2C 1DE2A 2G2QA 2RUFA 3GNJA 4K0NA 4KH7A 3FY7A 4K2DA 2FCHA 3FEUA 4KUNA 4I97A 2X8CA 3M9KA 3TUEA 1NHOA 5L71A 1O8XA 2O8VB 4L0WA 2ZNMA 2HRNA 3G7YA 4GF0A 3F8UA 3QMXA 2P5RA 3KP8A 1DBYA 1FB0A 3APQA 4NMUA 5IO2A 2MMZA 2HNLA 4BIKA 1JZWA 3I69A 4IELA 3I6AA 3QCPA 3VWUA 1ABAA 4LL4B 1G7OA 3GKXA 5J9BA 3ZITA 4IQAA 1ON4A 4O5RA 5AGYA 3DMLA 3U5RE 2LQQA 1PKZA 5IPGA 2YWNA 1PQNA 2GLRA 4X4JA 4MH2A 4EE0A 2GZZA 2HRKB 4FQUA 4USSA 5D8IA 4EKZA 5A5HB 5E4WA 6GSWA 1NHYA 2R4VA 2VCWA 1SK2A 4OO5A 3KD0A 1PSQA 3LYPA 2EFHA 2MMAA 1M2DA 2VCVA 4OCEA 2WVYA 4GCIA 3GX0A 4HJ2A 1AC1A 5DALB 2A4HA 4DSSA 1YQ1A 5CRHA 5GAND 3LG6A 1PX6A 2BMXA 4RQXA 1K0OA 3KMOA 3IK7A 2XHFA 1OVNA 1GUKA 2CV4A 3TGZA 3HVXA 2L5LA 1M3JA 4MABA 3EE2A 3DIEA 2QGVA 1WWJA 5DJMA 1A2JA 3VPQA 5CNWA 2I9HA 1Z3EA 3APSA 2QSIA 3LEFA 5HFIA 4AI6A 2M72A 3IC4A 3TU3B 9GSSA 3EPTA 4HJMA 4ZB8A 2V1MA 1OC9A 2VL2A 2N5FA 3HY2A 2C1YA 4LMWA 5FHIA 2DJKA 3GYKA 1DSBA 1EP8A 1M3IA 1FB6A 1XG8A 3QOUA 5F8BA 3J7Yb 4KNDA 5D9WA 3G7IA 2AAWA 1GL8A 1GWCA 1SENA 4RQRA 1WP0A 1VF4A 2B7JA 4X0XA 3LYKA 2DKIA 3IV4A 2TIRA 4ULXA 1FOVA 2YJ7A 4N0ZA 2MMOA 2HLSA 1Z6MA 1R5PA 5CRGA 3TOTA 3R3EA 2X8HA 4TR1A 3TJFA 4G01A 1T00A 1USBA 4MJBA 2O3EA 4MZCA 1GLQA 2G0FA 2PPTA 1YJ6A 3RBTA 4PI0C 1A8LA 1YF0A 3CQFA 5B6MA 2JZTA 4O5QA 6GSVA 4LL1B 3KXOA 1B48A 5DQSA 1S3DA 3F4RA 1UA5A 3TB2A 2XC2A 5JCUA 1PMTA 1B4PA 1A23A 2H72A 4PQ1A 4XS6A 2FWGA 1SYXA 3GV1A 1NSWA 4AJ7A 3TJJA 3CWGA 2DIYA 4OFMA 4DEJA 2KUCA 4KSOA 4BWQA 3LFLA 4ZB9A 1K0CA 3BD2A 3LJRA 2L57A 4KCAA 4WF5A 5H5SA 4ILFA 2R2JA 3KGKA 4PURA 4RI6A 4WEYA 3C7MA 2LRCA 4JZQA 1FVKA 3DGQA 1PX7A 2JADA 20GSA 4TN8A 3O6TA 3TKSC 5D9XA 2FHEA 3IA1A 4MZWA 2O85A 3A3TA 4NV5A 7GSSA 3O3TA 5ECHB 4O5UA 2H1DA 3O76A 5CP1A 3WT2A 4G10A 2DJ1A 2PBJA 4MF5A 3W8JA 1IYIA 1EOGA 4N11A 1JHBA 3KJYA 3EURA 4Q5NA 2LEGA 2CX3A 4AJ6A 3TCOA 5ECKB 2DJ2A 1U3IA 5J4VA 1MDKA 1SVOA 2L4QA 2M46A 2I4AA 2E7PA 1F6MC 2YJHA 2GZPA 2JSYA 4RI7A 3LGCA 3LORA 1QQ2A 1FG4A 3FK8A 2OT3A 3DKSA 5HFKA 1K0NA 2WZ9A 3KH9A 1KEBA 4ZILA 3L0HA 2NPBA 1VF3A 1R4WA 1B8XA 3QD9A 4J57E 4PNGA 2HYXA 1KBNA 3IPZA 5KN2A 1NM3A 5E59A 4DSSB 3IHQA 2H71A 2C8UA 5JWRB 4ECJA 1TRWA 1PN0A 2P5QA 3HKRA 1A2MA 4HU9A 3ZMKA 2IFQA 5AN1A
chains in the Genus database with same CATH topology
3GKMA 4CDOA 2H8LA 2JSZA 5D9TA 1JLWA 2H76A 2B5XA 2IJYA 3F4SA 4EUYA 2JL4A 5D73A 1OC9B 2WGRA 1FAAA 3ZMLA 3GTUA 1XCCA 4Q5FA 6GSYA 1HQOA 2LS5A 4O32A 2GVPA 5J4YA 2YV9A 4IQ1A 3GRXA 5DCHA 2K9FA 2RM5A 3TKSA 5GSSA 4Z2UA 1KNGA 4XIHA 1UC7A 2JZSA 3HHVA 4PXOA 3Q6OA 4XTSA 2MMNA 2F51A 1ZYEA 2H1LA 3IAM2 2V32A 3C8EA 1AAZA 2B7KA 3JCML 2HFDA 2VD1A 5A1NA 4BVXA 2H74A 1BF5A 3I9V2 4MJCA 5IMAA 3ZFLA 2FWEA 4ZBBA 2DIZA 2FUG2 1GSEA 3FZAA 5G31A 4MMMA 4GRFA 4IP6A 3HXSA 2GS3A 1Z7RA 2OBKA 4BA7A 2GSQA 2O5VA 4YQUA 5A4UA 3HA9A 1MDJA 3GFKA 1VF2A 3SWLA 1YVLA 4TR1B 4X43A 1G6WA 5B8AA 4K7NA 2HSHA 2GTUA 3GN3A 3C1RA 5ECOB 1X9MB 2AHEA 3IBHA 4L8EA 3R2QA 1RQMA 1T4ZA 4MF7A 5JWQB 4HOJA 3TKSE 1SD8A 4KDUA 3ERGA 1PRXA 1GSQA 1XIYA 3IK9A 5IM9A 2LJAA 5F05A 4P3YB 1V2AA 2H6XA 2DLXA 2OADA 3GSTA 4I2TA 3GL5A 4CY6A 2C80A 4ZBAA 5DAKA 2C0EA 4GSNA 2FNOA 5KOXA 4XHMA 3NZNA 3P90A 3F0IA 5C04A 4JR6A 1SKRB 4MNNA 4XRDA 5JWOB 1OYJA 3FHKA 2EIRA 2QKEA 4WBRD 3L4NA 4IJ3A 3ZREA 1TK8B 4YAVA 2OA7A 2GDRA 5HFGA 1FO5A 4TR4A 2EC4A 4K1FA 1T8EB 3MIXA 4RUVA 2H6YA 2V6KA 3TDGA 4PNFA 3N5OA 2VLTA 1Y25A 3D22A 3G9BA 4WETA 4J2FA 4KX4A 2JACA 3BOAA 5HR2A 3GL3A 5ECIB 3TJKA 3W6GA 3GX8A 1X9SB 4NXIA 22GSA 1OE7A 2PWJA 4KSMA 1TK5B 1SL1B 4ZL8A 4DSQA 3FW2A 2QA2A 4N3ZA 4O92A 4YQVA 3D4MA 3UAPA 3F3RA 4NHWA 2VAFA 1Z7PA 4ECCA 2C0FA 5HR3A 2HRAA 2NTOA 4YAPA 2GSSA 5HR1A 2M80A 4KA0A 5EVOA 5F0GA 3F4TA 4OCFA 2A4VA 1CQGA 3ZL5A 5LD0A 1TDIA 4NAXA 1W4VA 2VL3A 2HE3A 1TK0B 3H1NA 4MJAA 5IOXA 5C00A 2F3MA 3RAZA 2ZCTA 3GA4A 2EIOA 4IP1A 4EL1A 4J56E 1BYEA 4JU5A 4HUAA 3EINA 5ENUA 2F9SA 3EMXA 3M1GA 5FT3A 5GAPD 3EMPA 3L9SA 2WDUA 3QAVA 2CX4A 3AY8A 4E68A 1OKDA 2YWIA 4CHSA 4DVCA 2B1LA 2GQLA 4AKXB 3EU4A 3F6FA 3EYTA 2AV4A 3IOSA 2X64A 2HT9A 13GSA 2WRTA 4V1Ap 3FZ9A 1YEXA 3GTUB 2P31A 5BMUA 12GSA 1I9DA 2L4CA 4K0GA 1B9YC 4E8EA 2C3NA 14GSA 1XOBA 4F0CA 3Q18A 1O8WA 1XW9A 1XVWA 5H5RA 3Q74A 4PQHA 2A2PA 4XS1A 4XRAA 3RPPA 1BG5A 1R5AA 4F9ZA 5ELAA 3GHAA 1BAYA 1GRXA 4TW5A 4BVXB 5A1NB 2FWHA 4EXJA 1K0BA 1MD4A 2DMLA 2YWMA 4EC0A 1TRSA 4WR5A 1F3AA 3HCZA 3IC8A 1K3YA 2H1AA 4V2NA 4IGJA 2REMA 5IIZA 3FR9A 2VCQA 3HJMA 1ZYPA 2I3YA 2QC7A 2B5EA 2R5GA 2NBSA 4PX1A 2FWFA 4BL7A 5DQYA 5J41A 3VLNA 2VM2A 2K6VA 3MAKA 4H86A 4QMKA 5AISA 4TR0A 5HQPA 1WOUA 2HQTA 4IS0A 2VL9A 2ZUPA 2X49A 2XPEA 5D96A 3IRAA 1GTAA 2NVLA 2YNXA 2MZCA 3HMJG 1WRYA 1TI3A 4KW6A 2WB9A 1UVZA 4OWYA 4MP4A 3VPTA 4GQCA 4N30A 5DAKB 5EY6A 1ZL9A 3C73A 3G7JA 3DYRA 1WPIA 1V9WA 3Q19A 1ILOA 1E6BA 2WCIA 2VUPA 1TU7A 1FOHA 5IMZA 1WE0A 2HZEA 3TJBA 4BVYA 4PGTA 3E0UA 2RLIA 5G1LA 2XBQA 3UIWA 4HZ4A 4G0KA 1Q4JA 5EPFA 1AQWA 4ECBA 5A34A 2OJLA 2GSTA 4OMVA 1X9WB 4ML6A 2YOIA 5JCWA 2C0GA 5COHA 3DVWA 3H4KA 3KH7A 1GUMA 4XCSA 4NWYA 4Z2RA 1M7TA 1SKWB 1V58A 3GH9A 5LNKe 3GSSA 1Y6EA 2Z9SA 1GTIA 2IMEA 3H8QA 1SL2B 4MPGA 1TTZA 3DEXA 1ST9A 4ZL7A 2A2RA 2WJUA 2OKAA 1QGVA 1GULA 3RDWA 2OE3A 4KGIA 1A24A 1ZGNA 3IE3A 4YH2A 2DJ0A 1EEJA 2R37A 3FRCA 2X4AA 3VWVA 1AW9A 3ED3A 2PMTA 3E3EA 2CVKA 1XVQA 3GKNA 4HDEA 2CT6A 4ZL9A 1OAZA 2H73A 1XWGA 5ECSA 3FKFA 4IW9A 2HSMA 1BX9A 4L5OA 1QXHA 1BJXA 3PPUA 4G0IA 2KP2A 3FMWA 3GURA 1A8YA 1TRVA 2B3SA 1J0FA 1ZYQB 1OKTA 3M0FA 3CSJA 5B7CA 5ECQB 3C1SA 1THXA 3GIXA 4QL9A 1T3BA 4W66A 4WR4A 3KZQA 1KTEA 1VF1A 3FR3A 4OFTA 2N5AA 5INYA 2J9HA 1SVMA 3K8NA 3WGDA 4O7HA 4ZIJA 2IMKA 3EWLA 4LA1A 3IHGA 4I8BA 4HQSA 3A2WA 2R3XA 4TXVA 1XBSA 2IMDA 1EP7A 2LJRA 1EV9A 4IHUA 3DD3A 3A2VA 2VCZA 5BMUB 4Z7XA 4FIWA 3CMIA 4WKWA 1S3AA 3W8SA 5ID2A 3D0ZA 4G2EA 3FZ5A 3VK9A 1MEKA 2FA8A 4ZBDA 1SKSB 1JLVA 3CBUA 4CW9A 4HQZA 2VD0A 2IWTA 3CXGA 1QFNA 4YKGA 3KP9A 18GSA 3QPMA 2WULA 1I5GA 3TKQA 2GQKA 1G0TA 4ZB6A 3IAS2 1GSFA 2HRKA 2J23A 4KB3A 3RPNA 3PGTA 5A5HA 2ALBA 4K7IA 1HD2A 2LNSA 4BL7B 4X1UA 2L6CA 2HSYA 4OD7A 4K5RA 1HNCA 5J4UA 1M9AA 4KE3A 3VWXA 1SD9A 1SU9A 4FH8A 3GKKA 1PD21 2MBSA 5GZZB 2FLSA 3TKRA 5DALA 2R6KA 3TRPA 2GT6A 1EV4A 3TRQA 2L6DA 5G1KA 2H75A 1V40A 3H93A 4LMVA 3UMAA 2H6ZA 2IN3A 5IQYA 2GZYA 1U87A 1XWAA 1GSSA 1FHEA 4ISDA 3ZIJA 4QL7A 4BVYB 5LCZA 2LRNA 2CZ2A 3VI5A 3TJGA 3HZ4A 5IMFA 1Q98A 3BJ5A 2E0QA 1ACVA 4K9ZA 1YEPA 3QAGA 1PA3A 1URMA 4QQ7A 5A34B 4EIPA 1F3BA 3CSIA 4JE1A 3QFBC 4KDYA 8GSSA 1TXUA 2EFDA 4BPYA 6GSUA 3KMNA 3L78A 3SBCA 4MCUA 1EOHA 1X0RA 3HD5A 2IIYA 3ZYWA 1BQ7A 2TRXA 3HYPA 3APOA 4KDXA 1V57A 2H19A 4MF6A 1PL2A 2KHPA 3ZZXA 4HEA2 2OE1A 4ACSA 2YCDA 2LV3A 3ZIVA 2VLUA 3HVVA 3VI7A 4MA9A 1OC3A 1H75A 1YDKA 3M9JA 2YZUA 4D73A 2FY6A 5KN1A 1HNBA 4TXOA 2AYTA 1Y1UA 1O85A 1R7HA 1PL1A 2DSAA 2BTOT 1O73A 3ZLPA 2HRFA 2RIIA 6GSSA 1PN9A 3UJ1A 19GSA 5ECNB 1GP1A 4N0VA 1SJ6A 4I2UA 4PUFC 4EIQA 4ZXGA 3WD6A 1N8JA 4JBBA 3J7Yk 1MTCA 2V6OA 4N10A 1X5DA 2HSMB 2YPMA 4GSTA 2E2GA 1ZYNA 5CRDA 1AXDA 2H1GA 1ERWA 2NDOA 3UBKA 2I81A 1FW1A 2OE0A 1RK4A 4POBA 2R0CA 2PVQA 3LQ7A 4LLRA 4G0LA 3KEBA 5IO0A 1TI1A 3N9JA 2LSTA 1UN2A 2L59A 2XPDA 4CY8A 3MNGA 3QFAC 5KN3A 3EU3A 1GSUA 1ML6A 4I5QA 3L9UA 3VFIA 3S9FA 3UL3A 3NIVA 1LJRA 3F9UA 4EF0A 1ERUA 17GSA 2EFEA 3MSZA 4GLTA 2WS2A 3KTBA 4HS1A 3FZ4A 4V2MA 4PTSA 3CRTA 4EDZA 1TW9A 4HI7A 5IPHA 1XW6A 2UV8G 2DJJA 2EIQA 2HZFA 4MPFA 2CA8A 3PR8A 4JRRA 2OACA 5A4VA 4IVFA 1IYHA 5J40A 1G6YA 2CZ3A 2C3TA 3KIJA 1ERTA 3KTLA 2F8FA 3QR6A 2B1KA 5ID2B 3ZRDA 1M2BA 3C71A 2IFQB 3DWVA 2PVOC 5J47A 4IN0A 3ZVJD 1LBKA 3GMFA 4AJ8A 4NV2A 1X5EA 1S3CA 4ML1A 5CAXA 2IL3A 3HVSA 2QA1A 4AKIA 4V1Ag 3KM6A 5A5KA 1TJDA 1XW5A 2PN8A 2K8SA 1XZOA 5ECRB 2RUEA 5G30A 4TVEA 1ZZYA 2H01A 2H0GA 2H70A 1N2AA 3FYGA 4I6XA 4OFNA 4TRXA 1Z6NA 4KF9A 1O81A 3NOFA 4K7OA 5ELGA 2GT5A 1FVJA 1VGLA 2PU9C 3VWWA 2DJ3A 3LXTA 3ME7A 1OC8A 4NPBA 1BG1A 5DJLA 2E2MA 3D4TA 4IJIA 2DMMA 4L0UA 3MYDA 2HXKA 3E9JB 4POKA 3EC3A 5CREA 3LXZA 2H0HA 3RHCA 6GSTA 1K3OA 4V2LA 2C0DA 3WYWA 5FWGA 4POMA 3EVIA 5D93A 4GWRA 3P8WA 1XXUA 5J9CA 2UZ8A 2FD3A 2IMIA 1ZOFA 1YF1A 4ID0A 2F8AA 1SL0B 2A2SA 1F37A 3D21A 2DC5A 1YZXA 4YKFA 2AUVA 4PQIA 3A2XA 1X5CA 3ZVJA 3P2AA 1OE8A 1YKCA 2YZHA 1PGTA 3MWHA 4GTUA 3IR4A 4HZ2A 1SK1A 3A5WA 1T1VA 3V1WA 4XS4A 2C3QA 3TOUA 1M99A 5AIXA 2P0GA 5DVBA 2H66A 2VIMA 3UBLA 1ZMAA 3BBYA 3ISOA 5CO3A 2MBTA 2KOKA 2R0PA 3UEMA 3LW9A 3HJOA 3CYNA 2AJQB 1J9BA 1XFLA 3HZ8A 4NHZA 4D73B 1K0AA 3P7XA 2FGXA 3ME8A 4GQFA 4TXOB 5DBQA 3U6VA 1WMJA 3KCMA 3QDNA 3ERWA 5DDLA 4EDYA 2V2GA 4HU7A 2EFCA 10GSA 4MK3A 3F3QA 2VM1A 4OO4A 4POLA 1TRUA 3CRUA 1GTBA 3PINA 4DSRA 2AB6A 4GDFA 2B6MA 1AUCA 1HNAA 2YV7A 2IMFA 4BWSA 5B8BA 2PERA 2LKUA 2LTKA 4WBJA 1AQVA 1U6TA 2N5BA 1M0UA 4ZB7A 3ZFBA 2HSNA 1DUGA 1Z5YE 1JZRA 2YN1A 5AIVA 5G5FA 2LNTA 4E8HA 1T7PB 4TR3A 1GLPA 5DCGA 1PKWA 3GUSA 2YP6A 2H0IA 1SK0A 2RM6A 3VURA 4MLYA 4TOPA 2K18A 2C4JA 4JEDA 5H5QA 2V41A 1VRSD 2O89A 2ON7A 1A0RP 1XWBA 2CAIA 5KEJA 1O6JA 1ERVA 2OBIA 2VO4A 3GH6A 4A5PA 5G5EA 4GSSA 1TXXA 2WFCA 4TKYA 3F6DA 4AF2A 3M3MA 2CVDA 4MJEA 1NW2A 2D2ZA 1WIKA 4K5SA 1N25A 1GNEA 3CSHA 3H79A 3BCIA 2K8VA 1B9XC 2VKZG 1JZDA 1AIUA 3WT1A 4FYCA 2LJKA 2VCTA 1M2AA 5CRWA 2IPAA 3IDVA 2JZRA 2H30A 1XWKA 1MDIA 4L5LA 3DRNA 1EEMA 16GSA 2PGTA 4MDCA 2XBIA 1GSDA 4Q5QA 4ECIA 1O7UA 1SJZA 3CTGA 3DVXA 1XWCA 2PUKC 4F03A 1SJIA 5EL8A 2H1BA 1K0DA 5A4WA 2LUSA 5ECMB 5IMVA 1R26A 1JZOA 2JU5A 2DKHA 3UVHA 1MD3A 4G19A 3D5JA 3BCKA 1RW1A 1SVLA 3FR6A 1U88A 5GSTA 1CQHA 3TKPA 1A2LA 5HR0A 5F06A 5ABRA 2GSRA 3RHBA 1YY7A 4F2IA 2KLXA 2YWOA 2O7KA 5F07A 1T4YA 1XPVA 4G9HA 2L5OA 4XS4B 5J5NA 3ZTLA 4F82A 1GSYA 1K0MA 4MZBA 4AKHA 4ICYA 1Z9HA 4KCEA 1TKDB 2ES7A 1M9BA 4GXZA 1GUHA 2HZEB 3MDKA 2R0GA 1F2EA 1TOFA 1J08A 3HDCA 2HI7A 4K2XA 3PH9A 5J3RA 1C72A 4AKGA 2CAQA 3DXBA 4EVMA 1K3LA 2VLVA 1AQXA 4MH3A 1QMVA 1WJKA 2YANA 1H4OA 5BRTA 1YKAA 4EO3A 5ECPB 2GGTA 1EWXA 4FO5A 5KN0A 1G7EA 1DE1A 2CQ9A 1THOA 1ZCPA 3M8NA 11GSA 1QK8A 2LRTA 5CYYA 2DBCA 4FYBA 1GNWA 5D9VA 3IXRA 2ON5A 1XOAA 3L9VA 4WXTA 2X99A 4K6XA 2FA4A 2I1UA 2HSNB 1A0FA 4FYUA 1F9MA 3LWAA 1B4QA 2O87A 2X8GA 1TU8A 4WF4A 2KP1A 5IMDA 3WGEA 3WGXA 5ECLB 3I43A 4YQMA 1SYRA 5IMCA 4JR4A 3HJPA 5JCGA 2LQOA 1LU4A 1W89A 1U3AA 1E2YA 2CVBA 5IOWA 5KOWA 1HYUA 3UOMA 1GH2A 1QUWA 3ERFA 3UVTA 4Z2TA 4AGSA 1EGOA 1JFUA 4Q5RA 4IKHA 4F0BA 2B5YA 2VOCA 1V98A 3A5IA 2MYGA 3US3A 3QAWA 4PUAA 5G2ZA 1EGRA 3TRXA 4IBPA 1TP9A 5B6NA 6GSXA 3CTFA 1GTUA 3OR5A 2TRCP 3F63A 2GQMA 2BJXA 3UARA 4KAEA 3D6IA 1BEDA 1EZKA 4K8MA 3LSZA 2VCXA 2VL2C 1DE2A 2G2QA 2RUFA 3GNJA 4K0NA 4KH7A 3FY7A 4K2DA 2FCHA 3FEUA 4KUNA 4I97A 2X8CA 3M9KA 3TUEA 1NHOA 5L71A 1O8XA 2O8VB 4L0WA 2ZNMA 2HRNA 3G7YA 4GF0A 3F8UA 3QMXA 2P5RA 3KP8A 1DBYA 1FB0A 3APQA 4NMUA 5IO2A 2MMZA 2HNLA 1JZWA 3I69A 4IELA 3I6AA 3QCPA 3VWUA 1ABAA 4LL4B 1G7OA 3GKXA 5J9BA 3ZITA 4IQAA 1ON4A 4O5RA 5AGYA 3DMLA 3U5RE 2LQQA 1PKZA 5IPGA 2YWNA 1PQNA 2GLRA 4X4JA 4MH2A 4EE0A 2GZZA 2HRKB 4FQUA 4USSA 5D8IA 4EKZA 5A5HB 5E4WA 6GSWA 1NHYA 2R4VA 2VCWA 1SK2A 4OO5A 3KD0A 1PSQA 3LYPA 2EFHA 2MMAA 1M2DA 2VCVA 4OCEA 4GCIA 3GX0A 4HJ2A 1AC1A 5DALB 2A4HA 4DSSA 1YQ1A 5CRHA 5GAND 3LG6A 1PX6A 2BMXA 4RQXA 1K0OA 3KMOA 3IK7A 2XHFA 1OVNA 1GUKA 2CV4A 3TGZA 3HVXA 2L5LA 4MABA 3EE2A 3DIEA 2QGVA 1WWJA 5DJMA 1A2JA 3VPQA 5CNWA 2I9HA 1Z3EA 3APSA 2QSIA 3LEFA 5HFIA 4AI6A 2M72A 3IC4A 3TU3B 9GSSA 3EPTA 4HJMA 4ZB8A 2V1MA 1OC9A 2VL2A 2N5FA 3HY2A 2C1YA 4LMWA 5FHIA 2DJKA 3GYKA 1DSBA 1EP8A 1FB6A 3QOUA 5F8BA 3J7Yb 4KNDA 5D9WA 3G7IA 2AAWA 1GL8A 1GWCA 1SENA 4RQRA 1WP0A 1VF4A 2B7JA 4X0XA 3LYKA 2DKIA 3IV4A 2TIRA 4ULXA 1FOVA 2YJ7A 4N0ZA 2MMOA 2HLSA 1Z6MA 1R5PA 5CRGA 3TOTA 3R3EA 2X8HA 4TR1A 3TJFA 4G01A 1T00A 1USBA 4MJBA 4MZCA 1GLQA 2G0FA 2PPTA 1YJ6A 3RBTA 1A8LA 1YF0A 5B6MA 2JZTA 4O5QA 6GSVA 4LL1B 3KXOA 1B48A 5DQSA 1S3DA 3F4RA 1UA5A 3TB2A 2XC2A 5JCUA 1PMTA 1B4PA 1A23A 2H72A 4PQ1A 4XS6A 2FWGA 1SYXA 3GV1A 1NSWA 4AJ7A 3TJJA 3CWGA 2DIYA 4OFMA 4DEJA 2KUCA 4KSOA 4BWQA 3LFLA 4ZB9A 1K0CA 3BD2A 3LJRA 2L57A 4KCAA 4WF5A 5H5SA 4ILFA 2R2JA 3KGKA 4PURA 4RI6A 4WEYA 3C7MA 2LRCA 4JZQA 1FVKA 3DGQA 1PX7A 2JADA 20GSA 4TN8A 3O6TA 3TKSC 5D9XA 2FHEA 3IA1A 4MZWA 2O85A 3A3TA 4NV5A 7GSSA 3O3TA 5ECHB 4O5UA 2H1DA 3O76A 5CP1A 3WT2A 4G10A 2DJ1A 2PBJA 4MF5A 3W8JA 1IYIA 1EOGA 4N11A 1JHBA 3KJYA 3EURA 4Q5NA 2LEGA 2CX3A 4AJ6A 3TCOA 5ECKB 2DJ2A 1U3IA 5J4VA 1MDKA 1SVOA 2L4QA 2M46A 2I4AA 2E7PA 1F6MC 2YJHA 2GZPA 2JSYA 4RI7A 3LGCA 3LORA 1QQ2A 1FG4A 3FK8A 2OT3A 3DKSA 5HFKA 1K0NA 2WZ9A 3KH9A 1KEBA 4ZILA 3L0HA 2NPBA 1VF3A 1R4WA 1B8XA 3QD9A 4J57E 4PNGA 2HYXA 1KBNA 3IPZA 5KN2A 1NM3A 5E59A 4DSSB 3IHQA 2H71A 2C8UA 5JWRB 4ECJA 1TRWA 1PN0A 2P5QA 3HKRA 1A2MA 4HU9A 3ZMKA 2IFQA 5AN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GKM A;  4CDO A;  2H8L A;  2JSZ A;  5D9T A;  1JLW A;  2H76 A;  2B5X A;  2IJY A;  3F4S A;  4EUY A;  2JL4 A;  5D73 A;  1OC9 B;  2WGR A;  1FAA A;  3ZML A;  3GTU A;  1XCC A;  4Q5F A;  6GSY A;  1HQO A;  2LS5 A;  4O32 A;  2GVP A;  2YV9 A;  4IQ1 A;  3GRX A;  5DCH A;  2K9F A;  2RM5 A;  3TKS A;  5GSS A;  1KNG A;  4XIH A;  1UC7 A;  2JZS A;  3HHV A;  4PXO A;  3Q6O A;  4XTS A;  2MMN A;  2F51 A;  1ZYE A;  3IAM 2;  2V32 A;  3C8E A;  1AAZ A;  2B7K A;  3JCM L;  2HFD A;  2VD1 A;  4BVX A;  2H74 A;  3I9V 2;  4MJC A;  5IMA A;  3ZFL A;  2FWE A;  4ZBB A;  2DIZ A;  2FUG 2;  1GSE A;  3FZA A;  5G31 A;  4MMM A;  4GRF A;  4IP6 A;  3HXS A;  2GS3 A;  1Z7R A;  2OBK A;  4BA7 A;  2GSQ A;  4YQU A;  5A4U A;  3HA9 A;  1MDJ A;  3GFK A;  1VF2 A;  3SWL A;  4TR1 B;  4X43 A;  1G6W A;  5B8A A;  4K7N A;  2HSH A;  2GTU A;  3GN3 A;  3C1R A;  5ECO B;  1X9M B;  2AHE A;  3IBH A;  4L8E A;  3R2Q A;  1RQM A;  1T4Z A;  4MF7 A;  5JWQ B;  4HOJ A;  3TKS E;  1SD8 A;  4KDU A;  3ERG A;  1PRX A;  1GSQ A;  1XIY A;  3IK9 A;  5IM9 A;  2LJA A;  5F05 A;  4P3Y B;  1V2A A;  2H6X A;  2DLX A;  2OAD A;  3GST A;  4I2T A;  3GL5 A;  2C80 A;  4ZBA A;  5DAK A;  2C0E A;  4GSN A;  2FNO A;  4XHM A;  3NZN A;  3P90 A;  3F0I A;  5C04 A;  4JR6 A;  1SKR B;  4XRD A;  5JWO B;  1OYJ A;  3FHK A;  2EIR A;  2QKE A;  4WBR D;  3L4N A;  4IJ3 A;  3ZRE A;  1TK8 B;  4YAV A;  2OA7 A;  2GDR A;  5HFG A;  1FO5 A;  4TR4 A;  2EC4 A;  4K1F A;  1T8E B;  4RUV A;  2H6Y A;  2V6K A;  3TDG A;  4PNF A;  3N5O A;  2VLT A;  1Y25 A;  3D22 A;  3G9B A;  4WET A;  4J2F A;  4KX4 A;  2JAC A;  3BOA A;  5HR2 A;  3GL3 A;  5ECI B;  3TJK A;  3W6G A;  3GX8 A;  1X9S B;  4NXI A;  22GS A;  1OE7 A;  2PWJ A;  4KSM A;  1TK5 B;  1SL1 B;  4ZL8 A;  4DSQ A;  3FW2 A;  4O92 A;  4YQV A;  3D4M A;  3UAP A;  3F3R A;  4NHW A;  2VAF A;  1Z7P A;  4ECC A;  2C0F A;  5HR3 A;  2HRA A;  2NTO A;  4YAP A;  2GSS A;  5HR1 A;  2M80 A;  4KA0 A;  5EVO A;  5F0G A;  3F4T A;  4OCF A;  2A4V A;  1CQG A;  3ZL5 A;  5LD0 A;  1TDI A;  4NAX A;  1W4V A;  2VL3 A;  2HE3 A;  1TK0 B;  3H1N A;  4MJA A;  5IOX A;  5C00 A;  2F3M A;  3RAZ A;  2ZCT A;  3GA4 A;  2EIO A;  4IP1 A;  4EL1 A;  4J56 E;  1BYE A;  4JU5 A;  4HUA A;  3EIN A;  5ENU A;  2F9S A;  3EMX A;  3M1G A;  5FT3 A;  5GAP D;  3EMP A;  3L9S A;  2WDU A;  3QAV A;  2CX4 A;  3AY8 A;  1OKD A;  2YWI A;  4CHS A;  4DVC A;  2B1L A;  2GQL A;  3EU4 A;  3F6F A;  3EYT A;  2AV4 A;  3IOS A;  2X64 A;  2HT9 A;  13GS A;  2WRT A;  4V1A p;  3FZ9 A;  1YEX A;  3GTU B;  2P31 A;  5BMU A;  12GS A;  1I9D A;  2L4C A;  4K0G A;  1B9Y C;  4E8E A;  2C3N A;  14GS A;  1XOB A;  4F0C A;  3Q18 A;  1O8W A;  1XW9 A;  1XVW A;  5H5R A;  3Q74 A;  4PQH A;  4XS1 A;  4XRA A;  3RPP A;  1BG5 A;  1R5A A;  4F9Z A;  5ELA A;  3GHA A;  1BAY A;  1GRX A;  4TW5 A;  4BVX B;  2FWH A;  4EXJ A;  1K0B A;  1MD4 A;  2DML A;  2YWM A;  4EC0 A;  1TRS A;  4WR5 A;  1F3A A;  3HCZ A;  3IC8 A;  1K3Y A;  2H1A A;  4V2N A;  4IGJ A;  2REM A;  5IIZ A;  3FR9 A;  2VCQ A;  3HJM A;  2I3Y A;  2QC7 A;  2B5E A;  2R5G A;  2NBS A;  4PX1 A;  2FWF A;  4BL7 A;  5DQY A;  5J41 A;  3VLN A;  2VM2 A;  2K6V A;  3MAK A;  4H86 A;  5AIS A;  4TR0 A;  5HQP A;  1WOU A;  2HQT A;  4IS0 A;  2VL9 A;  2ZUP A;  2XPE A;  5D96 A;  3IRA A;  1GTA A;  2NVL A;  2YNX A;  2MZC A;  1WRY A;  1TI3 A;  4KW6 A;  2WB9 A;  1UVZ A;  4OWY A;  4MP4 A;  3VPT A;  4GQC A;  4N30 A;  5DAK B;  5EY6 A;  1ZL9 A;  3C73 A;  3G7J A;  3DYR A;  1WPI A;  1V9W A;  3Q19 A;  1ILO A;  1E6B A;  2WCI A;  2VUP A;  1TU7 A;  5IMZ A;  1WE0 A;  2HZE A;  3TJB A;  4BVY A;  4PGT A;  3E0U A;  2RLI A;  5G1L A;  2XBQ A;  3UIW A;  4HZ4 A;  4G0K A;  1Q4J A;  5EPF A;  1AQW A;  4ECB A;  2OJL A;  2GST A;  4OMV A;  1X9W B;  4ML6 A;  2YOI A;  5JCW A;  2C0G A;  5COH A;  3DVW A;  3H4K A;  3KH7 A;  1GUM A;  4XCS A;  4NWY A;  1M7T A;  1SKW B;  1V58 A;  3GH9 A;  5LNK e;  3GSS A;  1Y6E A;  2Z9S A;  1GTI A;  2IME A;  3H8Q A;  1SL2 B;  4MPG A;  1TTZ A;  3DEX A;  1ST9 A;  4ZL7 A;  2A2R A;  2WJU A;  2OKA A;  1QGV A;  1GUL A;  3RDW A;  2OE3 A;  4KGI A;  1A24 A;  1ZGN A;  3IE3 A;  4YH2 A;  2DJ0 A;  1EEJ A;  2R37 A;  3FRC A;  3VWV A;  1AW9 A;  3ED3 A;  2PMT A;  3E3E A;  2CVK A;  1XVQ A;  3GKN A;  4HDE A;  2CT6 A;  4ZL9 A;  1OAZ A;  2H73 A;  1XWG A;  5ECS A;  3FKF A;  4IW9 A;  2HSM A;  1BX9 A;  4L5O A;  1QXH A;  1BJX A;  3PPU A;  4G0I A;  2KP2 A;  3GUR A;  1A8Y A;  1TRV A;  2B3S A;  1J0F A;  1ZYQ B;  1OKT A;  3M0F A;  3CSJ A;  5B7C A;  5ECQ B;  3C1S A;  1THX A;  3GIX A;  4QL9 A;  1T3B A;  4WR4 A;  3KZQ A;  1KTE A;  1VF1 A;  3FR3 A;  4OFT A;  2N5A A;  5INY A;  2J9H A;  3K8N A;  3WGD A;  4O7H A;  4ZIJ A;  2IMK A;  3EWL A;  4LA1 A;  4I8B A;  4HQS A;  3A2W A;  2R3X A;  4TXV A;  1XBS A;  2IMD A;  1EP7 A;  2LJR A;  1EV9 A;  4IHU A;  3DD3 A;  3A2V A;  2VCZ A;  4Z7X A;  4FIW A;  3CMI A;  4WKW A;  1S3A A;  3W8S A;  5ID2 A;  3D0Z A;  4G2E A;  3FZ5 A;  3VK9 A;  1MEK A;  2FA8 A;  4ZBD A;  1SKS B;  1JLV A;  3CBU A;  4CW9 A;  4HQZ A;  2VD0 A;  2IWT A;  3CXG A;  1QFN A;  3KP9 A;  18GS A;  3QPM A;  2WUL A;  1I5G A;  3TKQ A;  2GQK A;  1G0T A;  4ZB6 A;  3IAS 2;  1GSF A;  2HRK A;  2J23 A;  4KB3 A;  3RPN A;  3PGT A;  2ALB A;  4K7I A;  1HD2 A;  2LNS A;  4BL7 B;  4X1U A;  2L6C A;  2HSY A;  4OD7 A;  1HNC A;  5J4U A;  1M9A A;  4KE3 A;  3VWX A;  1SD9 A;  1SU9 A;  4FH8 A;  3GKK A;  1PD2 1;  2MBS A;  5GZZ B;  2FLS A;  3TKR A;  5DAL A;  2R6K A;  3TRP A;  2GT6 A;  1EV4 A;  3TRQ A;  2L6D A;  5G1K A;  2H75 A;  1V40 A;  3H93 A;  4LMV A;  3UMA A;  2H6Z A;  2IN3 A;  5IQY A;  2GZY A;  1U87 A;  1XWA A;  1GSS A;  1FHE A;  4ISD A;  3ZIJ A;  4QL7 A;  4BVY B;  5LCZ A;  2LRN A;  2CZ2 A;  3VI5 A;  3TJG A;  3HZ4 A;  5IMF A;  1Q98 A;  3BJ5 A;  2E0Q A;  1ACV A;  4K9Z A;  1YEP A;  3QAG A;  1PA3 A;  1URM A;  4QQ7 A;  1F3B A;  3CSI A;  4JE1 A;  3QFB C;  4KDY A;  8GSS A;  4BPY A;  6GSU A;  3KMN A;  3L78 A;  3SBC A;  4MCU A;  1EOH A;  1X0R A;  3HD5 A;  2IIY A;  3ZYW A;  1BQ7 A;  2TRX A;  3HYP A;  3APO A;  4KDX A;  1V57 A;  2H19 A;  4MF6 A;  1PL2 A;  2KHP A;  3ZZX A;  4HEA 2;  2OE1 A;  4ACS A;  2YCD A;  2LV3 A;  3ZIV A;  2VLU A;  3HVV A;  3VI7 A;  4MA9 A;  1OC3 A;  1H75 A;  1YDK A;  3M9J A;  2YZU A;  4D73 A;  2FY6 A;  5KN1 A;  1HNB A;  4TXO A;  2AYT A;  1O85 A;  1R7H A;  1PL1 A;  2DSA A;  2BTO T;  1O73 A;  3ZLP A;  2HRF A;  2RII A;  6GSS A;  1PN9 A;  3UJ1 A;  19GS A;  5ECN B;  1GP1 A;  4N0V A;  1SJ6 A;  4I2U A;  4PUF C;  4ZXG A;  3WD6 A;  1N8J A;  4JBB A;  3J7Y k;  1MTC A;  2V6O A;  4N10 A;  1X5D A;  2HSM B;  2YPM A;  4GST A;  2E2G A;  5CRD A;  1AXD A;  2H1G A;  1ERW A;  2NDO A;  3UBK A;  2I81 A;  1FW1 A;  2OE0 A;  1RK4 A;  4POB A;  2PVQ A;  3LQ7 A;  4LLR A;  4G0L A;  3KEB A;  5IO0 A;  1TI1 A;  3N9J A;  2LST A;  1UN2 A;  2L59 A;  2XPD A;  3MNG A;  3QFA C;  5KN3 A;  3EU3 A;  1GSU A;  1ML6 A;  4I5Q A;  3L9U A;  3VFI A;  3S9F A;  3UL3 A;  3NIV A;  1LJR A;  3F9U A;  4EF0 A;  1ERU A;  17GS A;  3MSZ A;  4GLT A;  2WS2 A;  3KTB A;  4HS1 A;  3FZ4 A;  4V2M A;  4PTS A;  3CRT A;  4EDZ A;  1TW9 A;  4HI7 A;  5IPH A;  1XW6 A;  2DJJ A;  2EIQ A;  2HZF A;  4MPF A;  2CA8 A;  3PR8 A;  4JRR A;  2OAC A;  5A4V A;  4IVF A;  1IYH A;  1G6Y A;  2CZ3 A;  2C3T A;  3KIJ A;  1ERT A;  3KTL A;  2F8F A;  3QR6 A;  2B1K A;  5ID2 B;  3ZRD A;  1M2B A;  3C71 A;  2IFQ B;  3DWV A;  2PVO C;  4IN0 A;  3ZVJ D;  1LBK A;  3GMF A;  4AJ8 A;  4NV2 A;  1X5E A;  1S3C A;  4ML1 A;  5CAX A;  2IL3 A;  3HVS A;  4V1A g;  3KM6 A;  5A5K A;  1TJD A;  1XW5 A;  2PN8 A;  2K8S A;  1XZO A;  5ECR B;  2RUE A;  5G30 A;  4TVE A;  1ZZY A;  2H01 A;  2H0G A;  2H70 A;  1N2A A;  3FYG A;  4I6X A;  4OFN A;  4TRX A;  1Z6N A;  4KF9 A;  1O81 A;  3NOF A;  4K7O A;  5ELG A;  2GT5 A;  1FVJ A;  1VGL A;  2PU9 C;  3VWW A;  2DJ3 A;  3LXT A;  3ME7 A;  1OC8 A;  4NPB A;  5DJL A;  2E2M A;  3D4T A;  4IJI A;  2DMM A;  4L0U A;  2HXK A;  3E9J B;  4POK A;  3EC3 A;  5CRE A;  3LXZ A;  2H0H A;  3RHC A;  6GST A;  1K3O A;  4V2L A;  2C0D A;  3WYW A;  5FWG A;  4POM A;  3EVI A;  5D93 A;  4GWR A;  3P8W A;  1XXU A;  5J9C A;  2UZ8 A;  2FD3 A;  2IMI A;  1ZOF A;  1YF1 A;  4ID0 A;  2F8A A;  1SL0 B;  2A2S A;  1F37 A;  3D21 A;  2DC5 A;  1YZX A;  2AUV A;  4PQI A;  3A2X A;  1X5C A;  3ZVJ A;  3P2A A;  1OE8 A;  1YKC A;  2YZH A;  1PGT A;  3MWH A;  4GTU A;  3IR4 A;  4HZ2 A;  1SK1 A;  3A5W A;  1T1V A;  3V1W A;  4XS4 A;  2C3Q A;  3TOU A;  1M99 A;  5AIX A;  2P0G A;  5DVB A;  2H66 A;  2VIM A;  3UBL A;  1ZMA A;  3BBY A;  3ISO A;  5CO3 A;  2MBT A;  2KOK A;  3UEM A;  3HJO A;  3CYN A;  2AJQ B;  1J9B A;  1XFL A;  3HZ8 A;  4NHZ A;  4D73 B;  1K0A A;  3P7X A;  2FGX A;  3ME8 A;  4GQF A;  4TXO B;  5DBQ A;  3U6V A;  1WMJ A;  3KCM A;  3QDN A;  3ERW A;  5DDL A;  4EDY A;  2V2G A;  4HU7 A;  10GS A;  4MK3 A;  3F3Q A;  2VM1 A;  4OO4 A;  4POL A;  1TRU A;  3CRU A;  1GTB A;  3PIN A;  4DSR A;  2AB6 A;  2B6M A;  1AUC A;  1HNA A;  2YV7 A;  2IMF A;  4BWS A;  5B8B A;  2PER A;  2LKU A;  2LTK A;  4WBJ A;  1AQV A;  1U6T A;  2N5B A;  1M0U A;  3ZFB A;  1DUG A;  1Z5Y E;  1JZR A;  2YN1 A;  5AIV A;  5G5F A;  2LNT A;  4E8H A;  1T7P B;  4TR3 A;  1GLP A;  5DCG A;  1PKW A;  3GUS A;  2YP6 A;  2H0I A;  1SK0 A;  2RM6 A;  3VUR A;  4MLY A;  4TOP A;  2K18 A;  2C4J A;  4JED A;  5H5Q A;  2V41 A;  1VRS D;  2O89 A;  2ON7 A;  1A0R P;  1XWB A;  2CAI A;  5KEJ A;  1O6J A;  1ERV A;  2OBI A;  2VO4 A;  3GH6 A;  5G5E A;  4GSS A;  1TXX A;  2WFC A;  4TKY A;  3F6D A;  4AF2 A;  3M3M A;  2CVD A;  4MJE A;  1NW2 A;  2D2Z A;  1WIK A;  1GNE A;  3CSH A;  3H79 A;  3BCI A;  2K8V A;  1B9X C;  1JZD A;  1AIU A;  3WT1 A;  4FYC A;  2LJK A;  2VCT A;  1M2A A;  5CRW A;  2IPA A;  3IDV A;  2JZR A;  2H30 A;  1XWK A;  1MDI A;  4L5L A;  3DRN A;  1EEM A;  16GS A;  2PGT A;  4MDC A;  2XBI A;  1GSD A;  4Q5Q A;  4ECI A;  1O7U A;  1SJZ A;  3CTG A;  3DVX A;  1XWC A;  2PUK C;  4F03 A;  1SJI A;  5EL8 A;  2H1B A;  1K0D A;  5A4W A;  2LUS A;  5ECM B;  5IMV A;  1R26 A;  1JZO A;  2JU5 A;  3UVH A;  1MD3 A;  4G19 A;  3D5J A;  3BCK A;  1RW1 A;  3FR6 A;  1U88 A;  5GST A;  1CQH A;  3TKP A;  1A2L A;  5HR0 A;  5F06 A;  5ABR A;  2GSR A;  3RHB A;  1YY7 A;  4F2I A;  2KLX A;  2YWO A;  2O7K A;  5F07 A;  1T4Y A;  1XPV A;  4G9H A;  2L5O A;  4XS4 B;  5J5N A;  3ZTL A;  4F82 A;  1GSY A;  1K0M A;  4MZB A;  1Z9H A;  4KCE A;  1TKD B;  2ES7 A;  1M9B A;  4GXZ A;  1GUH A;  2HZE B;  3MDK A;  1F2E A;  1TOF A;  1J08 A;  3HDC A;  2HI7 A;  3PH9 A;  5J3R A;  1C72 A;  2CAQ A;  3DXB A;  4EVM A;  1K3L A;  2VLV A;  1AQX A;  4MH3 A;  1QMV A;  1WJK A;  2YAN A;  1H4O A;  1YKA A;  4EO3 A;  5ECP B;  2GGT A;  1EWX A;  4FO5 A;  5KN0 A;  1G7E A;  1DE1 A;  2CQ9 A;  1THO A;  1ZCP A;  3M8N A;  11GS A;  1QK8 A;  2LRT A;  5CYY A;  2DBC A;  4FYB A;  1GNW A;  5D9V A;  3IXR A;  2ON5 A;  1XOA A;  3L9V A;  4WXT A;  2X99 A;  4K6X A;  2FA4 A;  2I1U A;  2HSN B;  1A0F A;  4FYU A;  1F9M A;  3LWA A;  1B4Q A;  2O87 A;  2X8G A;  1TU8 A;  4WF4 A;  2KP1 A;  5IMD A;  3WGE A;  3WGX A;  5ECL B;  3I43 A;  4YQM A;  1SYR A;  5IMC A;  4JR4 A;  3HJP A;  5JCG A;  2LQO A;  1LU4 A;  1W89 A;  1U3A A;  1E2Y A;  2CVB A;  5IOW A;  1HYU A;  3UOM A;  1GH2 A;  1QUW A;  3ERF A;  3UVT A;  4AGS A;  1EGO A;  1JFU A;  4Q5R A;  4IKH A;  4F0B A;  2B5Y A;  2VOC A;  1V98 A;  3US3 A;  2MYG A;  3QAW A;  4PUA A;  5G2Z A;  1EGR A;  3TRX A;  4IBP A;  1TP9 A;  5B6N A;  6GSX A;  3CTF A;  1GTU A;  3OR5 A;  2TRC P;  3F63 A;  2GQM A;  2BJX A;  3UAR A;  4KAE A;  3D6I A;  1BED A;  1EZK A;  4K8M A;  3LSZ A;  2VCX A;  2VL2 C;  1DE2 A;  2G2Q A;  2RUF A;  3GNJ A;  4K0N A;  4KH7 A;  3FY7 A;  4K2D A;  2FCH A;  3FEU A;  4KUN A;  4I97 A;  2X8C A;  3M9K A;  3TUE A;  1NHO A;  5L71 A;  1O8X A;  2O8V B;  4L0W A;  2ZNM A;  2HRN A;  3G7Y A;  4GF0 A;  3F8U A;  3QMX A;  2P5R A;  3KP8 A;  1DBY A;  1FB0 A;  3APQ A;  4NMU A;  5IO2 A;  2MMZ A;  2HNL A;  1JZW A;  3I69 A;  4IEL A;  3I6A A;  3QCP A;  3VWU A;  1ABA A;  4LL4 B;  1G7O A;  3GKX A;  5J9B A;  3ZIT A;  4IQA A;  1ON4 A;  4O5R A;  5AGY A;  3DML A;  3U5R E;  2LQQ A;  1PKZ A;  5IPG A;  2YWN A;  1PQN A;  2GLR A;  4MH2 A;  4EE0 A;  2GZZ A;  2HRK B;  4FQU A;  4USS A;  5D8I A;  4EKZ A;  5E4W A;  6GSW A;  1NHY A;  2R4V A;  2VCW A;  1SK2 A;  4OO5 A;  3KD0 A;  1PSQ A;  3LYP A;  2MMA A;  1M2D A;  2VCV A;  4OCE A;  4GCI A;  3GX0 A;  4HJ2 A;  1AC1 A;  5DAL B;  4DSS A;  1YQ1 A;  5CRH A;  5GAN D;  3LG6 A;  1PX6 A;  2BMX A;  4RQX A;  1K0O A;  3KMO A;  3IK7 A;  2XHF A;  1OVN A;  1GUK A;  2CV4 A;  3TGZ A;  3HVX A;  2L5L A;  4MAB A;  3EE2 A;  3DIE A;  2QGV A;  1WWJ A;  5DJM A;  1A2J A;  3VPQ A;  5CNW A;  2I9H A;  1Z3E A;  3APS A;  2QSI A;  3LEF A;  5HFI A;  2M72 A;  3IC4 A;  9GSS A;  4HJM A;  4ZB8 A;  2V1M A;  1OC9 A;  2VL2 A;  2N5F A;  3HY2 A;  2C1Y A;  4LMW A;  5FHI A;  2DJK A;  3GYK A;  1DSB A;  1EP8 A;  1FB6 A;  3QOU A;  5F8B A;  3J7Y b;  4KND A;  5D9W A;  3G7I A;  2AAW A;  1GL8 A;  1GWC A;  1SEN A;  4RQR A;  1WP0 A;  1VF4 A;  2B7J A;  4X0X A;  3LYK A;  3IV4 A;  2TIR A;  4ULX A;  1FOV A;  2YJ7 A;  4N0Z A;  2MMO A;  2HLS A;  1Z6M A;  1R5P A;  5CRG A;  3TOT A;  3R3E A;  2X8H A;  4TR1 A;  3TJF A;  1T00 A;  1USB A;  4MJB A;  4MZC A;  1GLQ A;  2G0F A;  2PPT A;  1YJ6 A;  3RBT A;  1A8L A;  1YF0 A;  5B6M A;  2JZT A;  6GSV A;  4LL1 B;  3KXO A;  1B48 A;  5DQS A;  1S3D A;  3F4R A;  1UA5 A;  3TB2 A;  2XC2 A;  5JCU A;  1PMT A;  1B4P A;  1A23 A;  2H72 A;  4PQ1 A;  4XS6 A;  2FWG A;  1SYX A;  3GV1 A;  1NSW A;  4AJ7 A;  3TJJ A;  2DIY A;  4OFM A;  4DEJ A;  2KUC A;  4KSO A;  4BWQ A;  3LFL A;  4ZB9 A;  1K0C A;  3BD2 A;  3LJR A;  2L57 A;  4KCA A;  4WF5 A;  5H5S A;  4ILF A;  2R2J A;  3KGK A;  4PUR A;  4RI6 A;  4WEY A;  3C7M A;  2LRC A;  4JZQ A;  1FVK A;  3DGQ A;  1PX7 A;  2JAD A;  20GS A;  4TN8 A;  3O6T A;  3TKS C;  5D9X A;  2FHE A;  3IA1 A;  4MZW A;  2O85 A;  3A3T A;  4NV5 A;  7GSS A;  3O3T A;  5ECH B;  2H1D A;  3O76 A;  5CP1 A;  3WT2 A;  4G10 A;  2DJ1 A;  2PBJ A;  4MF5 A;  3W8J A;  1IYI A;  1EOG A;  4N11 A;  1JHB A;  3KJY A;  3EUR A;  4Q5N A;  2LEG A;  2CX3 A;  4AJ6 A;  3TCO A;  5ECK B;  2DJ2 A;  1U3I A;  1MDK A;  2L4Q A;  2M46 A;  2I4A A;  2E7P A;  1F6M C;  2YJH A;  2GZP A;  2JSY A;  4RI7 A;  3LGC A;  3LOR A;  1QQ2 A;  1FG4 A;  3FK8 A;  3DKS A;  5HFK A;  1K0N A;  2WZ9 A;  3KH9 A;  1KEB A;  4ZIL A;  3L0H A;  2NPB A;  1VF3 A;  1R4W A;  1B8X A;  3QD9 A;  4J57 E;  4PNG A;  2HYX A;  1KBN A;  3IPZ A;  5KN2 A;  1NM3 A;  5E59 A;  4DSS B;  3IHQ A;  2H71 A;  2C8U A;  5JWR B;  4ECJ A;  1TRW A;  2P5Q A;  3HKR A;  1A2M A;  4HU9 A;  3ZMK A;  2IFQ A;  5AN1 A; 
#chains in the Genus database with same CATH topology
 3GKM A;  4CDO A;  2H8L A;  2JSZ A;  5D9T A;  1JLW A;  2H76 A;  2B5X A;  2IJY A;  3F4S A;  4EUY A;  2JL4 A;  5D73 A;  1OC9 B;  2WGR A;  1FAA A;  3ZML A;  3GTU A;  1XCC A;  4Q5F A;  6GSY A;  1HQO A;  2LS5 A;  4O32 A;  2GVP A;  5J4Y A;  2YV9 A;  4IQ1 A;  3GRX A;  3RGB C;  5DCH A;  2K9F A;  2RM5 A;  2O36 A;  3TKS A;  5GSS A;  4Z2U A;  1KNG A;  4XIH A;  1UC7 A;  2JZS A;  3HHV A;  4PXO A;  3Q6O A;  4XTS A;  2MMN A;  2F51 A;  1ZYE A;  2H1L A;  3IAM 2;  2V32 A;  3CHX C;  3C8E A;  1AAZ A;  2B7K A;  3JCM L;  2HFD A;  2VD1 A;  5A1N A;  4BVX A;  2H74 A;  1BF5 A;  3I9V 2;  4MJC A;  5IMA A;  3ZFL A;  2FWE A;  4ZBB A;  2DIZ A;  2FUG 2;  1GSE A;  3FZA A;  5G31 A;  4MMM A;  4GRF A;  4IP6 A;  3HXS A;  2GS3 A;  1Z7R A;  2OBK A;  4BA7 A;  2GSQ A;  2O5V A;  4YQU A;  5A4U A;  3HA9 A;  1MDJ A;  3GFK A;  1VF2 A;  3SWL A;  1YVL A;  4TR1 B;  4X43 A;  1G6W A;  5B8A A;  4K7N A;  2HSH A;  2GTU A;  3GN3 A;  3C1R A;  5ECO B;  1X9M B;  2WW0 A;  2AHE A;  3IBH A;  4L8E A;  3R2Q A;  1RQM A;  1T4Z A;  4MF7 A;  5JWQ B;  4HOJ A;  3TKS E;  1SD8 A;  4KDU A;  3ERG A;  1PRX A;  1GSQ A;  1XIY A;  3IK9 A;  5IM9 A;  2LJA A;  5F05 A;  4P3Y B;  1V2A A;  2H6X A;  2DLX A;  2OAD A;  3GST A;  1I1I P;  4I2T A;  3GL5 A;  4CY6 A;  2C80 A;  4ZBA A;  5DAK A;  2C0E A;  4GSN A;  2FNO A;  5KOX A;  4XHM A;  3NZN A;  3P90 A;  3F0I A;  5C04 A;  4JR6 A;  1SKR B;  4MNN A;  4XRD A;  5JWO B;  1OYJ A;  3FHK A;  2EIR A;  2QKE A;  4WBR D;  3L4N A;  4IJ3 A;  2WZS A;  3ZRE A;  1TK8 B;  4YAV A;  2OA7 A;  2GDR A;  5HFG A;  1FO5 A;  4TR4 A;  2EC4 A;  4K1F A;  1T8E B;  3MIX A;  2WW2 A;  4RUV A;  2H6Y A;  2V6K A;  3TDG A;  4PNF A;  3N5O A;  2VLT A;  1Y25 A;  3D22 A;  3G9B A;  4WET A;  4J2F A;  4KX4 A;  2JAC A;  3BOA A;  5HR2 A;  3GL3 A;  5ECI B;  3TJK A;  3W6G A;  3GX8 A;  1X9S B;  4NXI A;  22GS A;  1OE7 A;  2PWJ A;  4KSM A;  1TK5 B;  1SL1 B;  4ZL8 A;  4DSQ A;  3FW2 A;  2QA2 A;  4N3Z A;  4O92 A;  4YQV A;  3D4M A;  3UAP A;  3F3R A;  4NHW A;  2VAF A;  1Z7P A;  4ECC A;  2C0F A;  5HR3 A;  2HRA A;  2NTO A;  4YAP A;  2GSS A;  5HR1 A;  2M80 A;  4KA0 A;  5EVO A;  5F0G A;  3F4T A;  4OCF A;  2A4V A;  1CQG A;  3ZL5 A;  5LD0 A;  1TDI A;  4NAX A;  1W4V A;  2VL3 A;  2HE3 A;  1TK0 B;  3H1N A;  4MJA A;  5IOX A;  5C00 A;  2F3M A;  3RAZ A;  2ZCT A;  3GA4 A;  2EIO A;  4IP1 A;  4EL1 A;  4PI2 C;  4J56 E;  1BYE A;  4JU5 A;  4HUA A;  3EIN A;  5ENU A;  2F9S A;  3EMX A;  3M1G A;  5FT3 A;  5GAP D;  3EMP A;  3L9S A;  2WDU A;  3QAV A;  2CX4 A;  3AY8 A;  4E68 A;  1OKD A;  2YWI A;  4CHS A;  4DVC A;  2B1L A;  2GQL A;  4AKX B;  3EU4 A;  3F6F A;  3EYT A;  2AV4 A;  3IOS A;  2X64 A;  2HT9 A;  13GS A;  2WRT A;  4V1A p;  3FZ9 A;  1YEX A;  3GTU B;  2P31 A;  5BMU A;  12GS A;  1I9D A;  2L4C A;  4K0G A;  1B9Y C;  4E8E A;  2C3N A;  14GS A;  1XOB A;  4F0C A;  3Q18 A;  1O8W A;  1XW9 A;  1XVW A;  5H5R A;  3Q74 A;  4PQH A;  2A2P A;  4XS1 A;  4XRA A;  3RPP A;  1BG5 A;  1R5A A;  4F9Z A;  5ELA A;  3GHA A;  1BAY A;  1GRX A;  4TW5 A;  4BVX B;  5A1N B;  2FWH A;  4EXJ A;  1K0B A;  1MD4 A;  2DML A;  2YWM A;  4EC0 A;  1TRS A;  4WR5 A;  1F3A A;  3HCZ A;  3IC8 A;  1K3Y A;  2H1A A;  4V2N A;  4IGJ A;  2REM A;  5IIZ A;  3FR9 A;  2VCQ A;  3HJM A;  1ZYP A;  2I3Y A;  2QC7 A;  2B5E A;  2R5G A;  2NBS A;  4PX1 A;  2FWF A;  4BL7 A;  5DQY A;  5J41 A;  3VLN A;  2VM2 A;  2K6V A;  3MAK A;  4H86 A;  4QMK A;  5AIS A;  4TR0 A;  5HQP A;  1WOU A;  2HQT A;  4IS0 A;  2VL9 A;  2ZUP A;  2X49 A;  2XPE A;  5D96 A;  3IRA A;  1GTA A;  2NVL A;  2YNX A;  2MZC A;  3HMJ G;  1WRY A;  1TI3 A;  4KW6 A;  2WB9 A;  1UVZ A;  4OWY A;  4MP4 A;  3VPT A;  4GQC A;  4N30 A;  5DAK B;  5EY6 A;  1ZL9 A;  3C73 A;  3G7J A;  3DYR A;  1WPI A;  1V9W A;  3Q19 A;  1ILO A;  1E6B A;  2WCI A;  2VUP A;  1TU7 A;  1FOH A;  5IMZ A;  1WE0 A;  2HZE A;  3TJB A;  4BVY A;  4PGT A;  3E0U A;  2RLI A;  5G1L A;  2XBQ A;  3UIW A;  4HZ4 A;  4G0K A;  1Q4J A;  5EPF A;  1AQW A;  4ECB A;  5A34 A;  2OJL A;  2GST A;  4OMV A;  1X9W B;  4ML6 A;  2YOI A;  5JCW A;  2C0G A;  5COH A;  3DVW A;  3H4K A;  3KH7 A;  1GUM A;  4XCS A;  4NWY A;  4Z2R A;  1M7T A;  1SKW B;  1V58 A;  3GH9 A;  5LNK e;  3GSS A;  1Y6E A;  2Z9S A;  1GTI A;  2IME A;  3H8Q A;  1SL2 B;  4MPG A;  1TTZ A;  3DEX A;  1ST9 A;  4ZL7 A;  2A2R A;  2WJU A;  2OKA A;  1QGV A;  1GUL A;  3RDW A;  2OE3 A;  4KGI A;  1A24 A;  1ZGN A;  3IE3 A;  4YH2 A;  2DJ0 A;  1EEJ A;  2R37 A;  3FRC A;  2X4A A;  3VWV A;  1AW9 A;  3ED3 A;  2PMT A;  3E3E A;  2CVK A;  1XVQ A;  3GKN A;  4HDE A;  2CT6 A;  4ZL9 A;  1OAZ A;  2H73 A;  1XWG A;  5ECS A;  3FKF A;  4IW9 A;  2HSM A;  1BX9 A;  4L5O A;  1QXH A;  1BJX A;  3PPU A;  4G0I A;  2KP2 A;  4PHZ C;  3FMW A;  3GUR A;  1A8Y A;  1TRV A;  2B3S A;  1J0F A;  1ZYQ B;  1OKT A;  3M0F A;  3CSJ A;  5B7C A;  5ECQ B;  3C1S A;  1THX A;  3GIX A;  4QL9 A;  1T3B A;  4W66 A;  4WR4 A;  3KZQ A;  1KTE A;  1VF1 A;  3FR3 A;  4OFT A;  2N5A A;  2WVX A;  5INY A;  2J9H A;  1SVM A;  3K8N A;  3WGD A;  4O7H A;  4ZIJ A;  2IMK A;  3EWL A;  4LA1 A;  3IHG A;  4I8B A;  4HQS A;  3A2W A;  2R3X A;  4TXV A;  1XBS A;  2IMD A;  1EP7 A;  2LJR A;  1EV9 A;  4IHU A;  3DD3 A;  3A2V A;  2VCZ A;  5BMU B;  4Z7X A;  4FIW A;  3CMI A;  4WKW A;  1S3A A;  3W8S A;  5ID2 A;  3D0Z A;  4G2E A;  3FZ5 A;  3VK9 A;  1MEK A;  2FA8 A;  4ZBD A;  1SKS B;  1JLV A;  3CBU A;  4CW9 A;  4HQZ A;  2VD0 A;  2IWT A;  3CXG A;  1QFN A;  4YKG A;  3KP9 A;  18GS A;  3QPM A;  2WUL A;  1I5G A;  3TKQ A;  2GQK A;  1G0T A;  4ZB6 A;  3IAS 2;  1GSF A;  2HRK A;  2J23 A;  4KB3 A;  3RPN A;  3PGT A;  5A5H A;  2ALB A;  4K7I A;  1HD2 A;  2LNS A;  4BL7 B;  4X1U A;  2L6C A;  2HSY A;  4OD7 A;  4K5R A;  1HNC A;  5J4U A;  1M9A A;  4KE3 A;  3VWX A;  1SD9 A;  1SU9 A;  4FH8 A;  3GKK A;  1PD2 1;  2MBS A;  5GZZ B;  2FLS A;  3TKR A;  5DAL A;  2R6K A;  3TRP A;  2GT6 A;  1EV4 A;  3TRQ A;  2L6D A;  5G1K A;  2H75 A;  1V40 A;  3H93 A;  4LMV A;  3UMA A;  2H6Z A;  2IN3 A;  5IQY A;  2GZY A;  1U87 A;  1XWA A;  1GSS A;  1FHE A;  4ISD A;  3ZIJ A;  4QL7 A;  4BVY B;  5LCZ A;  2LRN A;  2CZ2 A;  3VI5 A;  3TJG A;  3HZ4 A;  5IMF A;  1Q98 A;  3BJ5 A;  2E0Q A;  1ACV A;  4K9Z A;  1YEP A;  3QAG A;  1PA3 A;  1URM A;  4QQ7 A;  5A34 B;  4EIP A;  1F3B A;  3CSI A;  4JE1 A;  3QFB C;  4KDY A;  8GSS A;  1TXU A;  2EFD A;  4BPY A;  6GSU A;  3KMN A;  3L78 A;  3SBC A;  4MCU A;  1EOH A;  1X0R A;  3HD5 A;  2IIY A;  3ZYW A;  1BQ7 A;  2TRX A;  3HYP A;  3APO A;  4KDX A;  1V57 A;  2H19 A;  4MF6 A;  1PL2 A;  2KHP A;  3ZZX A;  4HEA 2;  2OE1 A;  4ACS A;  2YCD A;  2LV3 A;  3ZIV A;  2VLU A;  3HVV A;  3VI7 A;  4MA9 A;  1OC3 A;  1H75 A;  1YDK A;  3M9J A;  2YZU A;  3RFR C;  4D73 A;  2FY6 A;  5KN1 A;  1HNB A;  4TXO A;  2AYT A;  1Y1U A;  1O85 A;  1R7H A;  1PL1 A;  2DSA A;  2BTO T;  1O73 A;  3ZLP A;  2HRF A;  2RII A;  6GSS A;  1PN9 A;  3UJ1 A;  19GS A;  5ECN B;  1GP1 A;  4N0V A;  1SJ6 A;  4I2U A;  4PUF C;  4EIQ A;  4ZXG A;  3WD6 A;  1N8J A;  4JBB A;  3J7Y k;  1MTC A;  2V6O A;  4N10 A;  1X5D A;  2HSM B;  2YPM A;  4GST A;  2E2G A;  1ZYN A;  5CRD A;  1AXD A;  2H1G A;  1ERW A;  2NDO A;  3UBK A;  2I81 A;  1FW1 A;  2OE0 A;  1RK4 A;  4POB A;  2R0C A;  2PVQ A;  3LQ7 A;  4LLR A;  4G0L A;  3KEB A;  5IO0 A;  1TI1 A;  3N9J A;  2LST A;  1UN2 A;  2L59 A;  2XPD A;  4CY8 A;  3MNG A;  3QFA C;  5KN3 A;  3EU3 A;  1GSU A;  1ML6 A;  4I5Q A;  3L9U A;  3VFI A;  3S9F A;  3UL3 A;  3NIV A;  1LJR A;  3F9U A;  4EF0 A;  1ERU A;  17GS A;  2EFE A;  3MSZ A;  4GLT A;  2WS2 A;  2WW3 A;  3KTB A;  4HS1 A;  3FZ4 A;  4V2M A;  4PTS A;  3CRT A;  4EDZ A;  1TW9 A;  4HI7 A;  5IPH A;  1XW6 A;  2UV8 G;  2DJJ A;  2EIQ A;  2HZF A;  4MPF A;  2CA8 A;  3PR8 A;  4JRR A;  2OAC A;  5A4V A;  4IVF A;  1IYH A;  5J40 A;  3HVN A;  1G6Y A;  2CZ3 A;  2C3T A;  3KIJ A;  1ERT A;  3KTL A;  2F8F A;  3QR6 A;  2B1K A;  5ID2 B;  3ZRD A;  1M2B A;  3C71 A;  2IFQ B;  3DWV A;  2PVO C;  5J47 A;  4IN0 A;  3ZVJ D;  1LBK A;  3GMF A;  4AJ8 A;  4NV2 A;  1X5E A;  1S3C A;  4ML1 A;  5CAX A;  2IL3 A;  3HVS A;  2QA1 A;  4AKI A;  4V1A g;  3KM6 A;  5A5K A;  1TJD A;  1XW5 A;  2PN8 A;  2K8S A;  1XZO A;  5ECR B;  2RUE A;  5G30 A;  4TVE A;  1ZZY A;  2H01 A;  2H0G A;  2H70 A;  1N2A A;  3FYG A;  4I6X A;  4OFN A;  4TRX A;  1Z6N A;  4KF9 A;  1O81 A;  3NOF A;  4K7O A;  5ELG A;  2GT5 A;  1FVJ A;  1VGL A;  2PU9 C;  3VWW A;  2DJ3 A;  3LXT A;  3ME7 A;  1OC8 A;  4NPB A;  1BG1 A;  5DJL A;  2E2M A;  4HSC X;  3D4T A;  4IJI A;  2DMM A;  4L0U A;  3MYD A;  2HXK A;  3E9J B;  4POK A;  3EC3 A;  5CRE A;  3LXZ A;  2H0H A;  3RHC A;  6GST A;  1K3O A;  4V2L A;  2C0D A;  3WYW A;  5FWG A;  4POM A;  3EVI A;  5D93 A;  4GWR A;  3P8W A;  1XXU A;  5J9C A;  2UZ8 A;  2FD3 A;  2IMI A;  1ZOF A;  1YF1 A;  4ID0 A;  2F8A A;  1SL0 B;  2A2S A;  1F37 A;  3D21 A;  2DC5 A;  1YZX A;  4YKF A;  2AUV A;  4PQI A;  3A2X A;  1X5C A;  3ZVJ A;  3P2A A;  1OE8 A;  1YKC A;  2YZH A;  1PGT A;  3MWH A;  4GTU A;  3IR4 A;  4HZ2 A;  1SK1 A;  3A5W A;  1T1V A;  3V1W A;  4XS4 A;  2C3Q A;  3TOU A;  1M99 A;  5AIX A;  2P0G A;  5DVB A;  2H66 A;  2VIM A;  3UBL A;  1ZMA A;  3BBY A;  3ISO A;  5CO3 A;  2MBT A;  2KOK A;  2R0P A;  3UEM A;  3LW9 A;  3HJO A;  3CYN A;  2AJQ B;  1J9B A;  1XFL A;  3HZ8 A;  4NHZ A;  4D73 B;  1K0A A;  3P7X A;  2FGX A;  3ME8 A;  4GQF A;  4TXO B;  5DBQ A;  3U6V A;  1WMJ A;  3KCM A;  3QDN A;  3ERW A;  5DDL A;  4EDY A;  2V2G A;  4HU7 A;  2EFC A;  10GS A;  4MK3 A;  3F3Q A;  2VM1 A;  4OO4 A;  4POL A;  1TRU A;  3CRU A;  1GTB A;  3PIN A;  4DSR A;  2AB6 A;  4GDF A;  2B6M A;  1AUC A;  1HNA A;  2YV7 A;  2IMF A;  4BWS A;  5B8B A;  2PER A;  2LKU A;  2LTK A;  4WBJ A;  1AQV A;  1U6T A;  2N5B A;  1M0U A;  4ZB7 A;  3ZFB A;  2HSN A;  1DUG A;  1Z5Y E;  1JZR A;  2YN1 A;  5AIV A;  5G5F A;  2LNT A;  4E8H A;  1T7P B;  4TR3 A;  1GLP A;  5DCG A;  1PKW A;  3GUS A;  2YP6 A;  2H0I A;  1SK0 A;  2RM6 A;  3VUR A;  4MLY A;  4TOP A;  2K18 A;  2C4J A;  4JED A;  5H5Q A;  2V41 A;  1VRS D;  2O89 A;  2ON7 A;  1A0R P;  1XWB A;  2CAI A;  5KEJ A;  1O6J A;  2WVZ A;  1ERV A;  2OBI A;  2VO4 A;  3GH6 A;  4A5P A;  5G5E A;  4GSS A;  1TXX A;  2WFC A;  4TKY A;  3F6D A;  4AF2 A;  3M3M A;  2CVD A;  4MJE A;  1NW2 A;  1YEW C;  2D2Z A;  1WIK A;  4K5S A;  1N25 A;  1GNE A;  3CSH A;  3H79 A;  3BCI A;  2K8V A;  1B9X C;  2VKZ G;  1JZD A;  1AIU A;  3WT1 A;  4FYC A;  2LJK A;  2VCT A;  1M2A A;  5CRW A;  2IPA A;  3IDV A;  2JZR A;  2H30 A;  1XWK A;  1MDI A;  4L5L A;  3DRN A;  1EEM A;  16GS A;  2PGT A;  4MDC A;  2XBI A;  1GSD A;  4Q5Q A;  4ECI A;  1O7U A;  1SJZ A;  3CTG A;  3DVX A;  1XWC A;  2PUK C;  4F03 A;  1SJI A;  5EL8 A;  2H1B A;  1S3R A;  1K0D A;  5A4W A;  2LUS A;  5ECM B;  5IMV A;  1R26 A;  1JZO A;  2JU5 A;  2DKH A;  3UVH A;  1MD3 A;  4G19 A;  3D5J A;  3BCK A;  1RW1 A;  1SVL A;  3FR6 A;  1U88 A;  5GST A;  1CQH A;  3TKP A;  1A2L A;  5HR0 A;  5F06 A;  5ABR A;  2GSR A;  3RHB A;  1YY7 A;  4F2I A;  2KLX A;  2YWO A;  2O7K A;  5F07 A;  1T4Y A;  4FXY P;  1XPV A;  4G9H A;  2L5O A;  4XS4 B;  5J5N A;  3ZTL A;  4F82 A;  1GSY A;  1K0M A;  4MZB A;  4AKH A;  4ICY A;  1Z9H A;  4KCE A;  1TKD B;  2ES7 A;  1M9B A;  4GXZ A;  1GUH A;  2HZE B;  3MDK A;  2R0G A;  1F2E A;  1TOF A;  1J08 A;  3HDC A;  2HI7 A;  4K2X A;  3PH9 A;  5J3R A;  1C72 A;  4AKG A;  2WW1 A;  2CAQ A;  3DXB A;  4EVM A;  1K3L A;  2VLV A;  1AQX A;  1PFO A;  4MH3 A;  1QMV A;  1WJK A;  2YAN A;  1H4O A;  5BRT A;  1YKA A;  4EO3 A;  5ECP B;  2GGT A;  1EWX A;  4FO5 A;  5KN0 A;  1G7E A;  1DE1 A;  2CQ9 A;  1THO A;  1ZCP A;  3M8N A;  11GS A;  1QK8 A;  2LRT A;  5CYY A;  2DBC A;  4FYB A;  1GNW A;  5D9V A;  3IXR A;  2ON5 A;  1XOA A;  3L9V A;  4WXT A;  2X99 A;  4K6X A;  2FA4 A;  2I1U A;  2HSN B;  1A0F A;  4FYU A;  1F9M A;  3LWA A;  1B4Q A;  2O87 A;  2X8G A;  1TU8 A;  4WF4 A;  2KP1 A;  5IMD A;  3WGE A;  3WGX A;  5ECL B;  3I43 A;  4YQM A;  1SYR A;  5IMC A;  4JR4 A;  3HJP A;  5JCG A;  2LQO A;  1LU4 A;  1W89 A;  1U3A A;  1E2Y A;  2CVB A;  5IOW A;  5KOW A;  1HYU A;  3UOM A;  1GH2 A;  1S4B P;  1QUW A;  3ERF A;  3UVT A;  4Z2T A;  4AGS A;  1EGO A;  1JFU A;  4Q5R A;  4IKH A;  4F0B A;  2B5Y A;  2VOC A;  1V98 A;  3A5I A;  2MYG A;  3US3 A;  3QAW A;  4PUA A;  5G2Z A;  1EGR A;  3TRX A;  4IBP A;  1TP9 A;  5B6N A;  6GSX A;  3CTF A;  2WVX B;  1GTU A;  3OR5 A;  2TRC P;  3F63 A;  2GQM A;  2BJX A;  3UAR A;  4KAE A;  3D6I A;  1BED A;  1EZK A;  4K8M A;  3LSZ A;  2VCX A;  2VL2 C;  1DE2 A;  2G2Q A;  2RUF A;  3GNJ A;  4K0N A;  4KH7 A;  3FY7 A;  4K2D A;  2FCH A;  3FEU A;  4KUN A;  4I97 A;  2X8C A;  3M9K A;  3TUE A;  1NHO A;  5L71 A;  1O8X A;  2O8V B;  4L0W A;  2ZNM A;  2HRN A;  3G7Y A;  4GF0 A;  3F8U A;  3QMX A;  2P5R A;  3KP8 A;  1DBY A;  1FB0 A;  3APQ A;  4NMU A;  5IO2 A;  2MMZ A;  2HNL A;  4BIK A;  1JZW A;  3I69 A;  4IEL A;  3I6A A;  3QCP A;  3VWU A;  1ABA A;  4LL4 B;  1G7O A;  3GKX A;  5J9B A;  3ZIT A;  4IQA A;  1ON4 A;  4O5R A;  5AGY A;  3DML A;  3U5R E;  2LQQ A;  1PKZ A;  5IPG A;  2YWN A;  1PQN A;  2GLR A;  4X4J A;  4MH2 A;  4EE0 A;  2GZZ A;  2HRK B;  4FQU A;  4USS A;  5D8I A;  4EKZ A;  5A5H B;  5E4W A;  6GSW A;  1NHY A;  2R4V A;  2VCW A;  1SK2 A;  4OO5 A;  3KD0 A;  1PSQ A;  3LYP A;  2EFH A;  2MMA A;  1M2D A;  2VCV A;  4OCE A;  2WVY A;  4GCI A;  3GX0 A;  4HJ2 A;  1AC1 A;  5DAL B;  2A4H A;  4DSS A;  1YQ1 A;  5CRH A;  5GAN D;  3LG6 A;  1PX6 A;  2BMX A;  4RQX A;  1K0O A;  3KMO A;  3IK7 A;  2XHF A;  1OVN A;  1GUK A;  2CV4 A;  3TGZ A;  3HVX A;  2L5L A;  1M3J A;  4MAB A;  3EE2 A;  3DIE A;  2QGV A;  1WWJ A;  5DJM A;  1A2J A;  3VPQ A;  5CNW A;  2I9H A;  1Z3E A;  3APS A;  2QSI A;  3LEF A;  5HFI A;  4AI6 A;  2M72 A;  3IC4 A;  3TU3 B;  9GSS A;  3EPT A;  4HJM A;  4ZB8 A;  2V1M A;  1OC9 A;  2VL2 A;  2N5F A;  3HY2 A;  2C1Y A;  4LMW A;  5FHI A;  2DJK A;  3GYK A;  1DSB A;  1EP8 A;  1M3I A;  1FB6 A;  1XG8 A;  3QOU A;  5F8B A;  3J7Y b;  4KND A;  5D9W A;  3G7I A;  2AAW A;  1GL8 A;  1GWC A;  1SEN A;  4RQR A;  1WP0 A;  1VF4 A;  2B7J A;  4X0X A;  3LYK A;  2DKI A;  3IV4 A;  2TIR A;  4ULX A;  1FOV A;  2YJ7 A;  4N0Z A;  2MMO A;  2HLS A;  1Z6M A;  1R5P A;  5CRG A;  3TOT A;  3R3E A;  2X8H A;  4TR1 A;  3TJF A;  4G01 A;  1T00 A;  1USB A;  4MJB A;  2O3E A;  4MZC A;  1GLQ A;  2G0F A;  2PPT A;  1YJ6 A;  3RBT A;  4PI0 C;  1A8L A;  1YF0 A;  3CQF A;  5B6M A;  2JZT A;  4O5Q A;  6GSV A;  4LL1 B;  3KXO A;  1B48 A;  5DQS A;  1S3D A;  3F4R A;  1UA5 A;  3TB2 A;  2XC2 A;  5JCU A;  1PMT A;  1B4P A;  1A23 A;  2H72 A;  4PQ1 A;  4XS6 A;  2FWG A;  1SYX A;  3GV1 A;  1NSW A;  4AJ7 A;  3TJJ A;  3CWG A;  2DIY A;  4OFM A;  4DEJ A;  2KUC A;  4KSO A;  4BWQ A;  3LFL A;  4ZB9 A;  1K0C A;  3BD2 A;  3LJR A;  2L57 A;  4KCA A;  4WF5 A;  5H5S A;  4ILF A;  2R2J A;  3KGK A;  4PUR A;  4RI6 A;  4WEY A;  3C7M A;  2LRC A;  4JZQ A;  1FVK A;  3DGQ A;  1PX7 A;  2JAD A;  20GS A;  4TN8 A;  3O6T A;  3TKS C;  5D9X A;  2FHE A;  3IA1 A;  4MZW A;  2O85 A;  3A3T A;  4NV5 A;  7GSS A;  3O3T A;  5ECH B;  4O5U A;  2H1D A;  3O76 A;  5CP1 A;  3WT2 A;  4G10 A;  2DJ1 A;  2PBJ A;  4MF5 A;  3W8J A;  1IYI A;  1EOG A;  4N11 A;  1JHB A;  3KJY A;  3EUR A;  4Q5N A;  2LEG A;  2CX3 A;  4AJ6 A;  3TCO A;  5ECK B;  2DJ2 A;  1U3I A;  5J4V A;  1MDK A;  1SVO A;  2L4Q A;  2M46 A;  2I4A A;  2E7P A;  1F6M C;  2YJH A;  2GZP A;  2JSY A;  4RI7 A;  3LGC A;  3LOR A;  1QQ2 A;  1FG4 A;  3FK8 A;  2OT3 A;  3DKS A;  5HFK A;  1K0N A;  2WZ9 A;  3KH9 A;  1KEB A;  4ZIL A;  3L0H A;  2NPB A;  1VF3 A;  1R4W A;  1B8X A;  3QD9 A;  4J57 E;  4PNG A;  2HYX A;  1KBN A;  3IPZ A;  5KN2 A;  1NM3 A;  5E59 A;  4DSS B;  3IHQ A;  2H71 A;  2C8U A;  5JWR B;  4ECJ A;  1TRW A;  1PN0 A;  2P5Q A;  3HKR A;  1A2M A;  4HU9 A;  3ZMK A;  2IFQ A;  5AN1 A; 
#chains in the Genus database with same CATH homology
 3GKM A;  4CDO A;  2H8L A;  2JSZ A;  5D9T A;  1JLW A;  2H76 A;  2B5X A;  2IJY A;  3F4S A;  4EUY A;  2JL4 A;  5D73 A;  1OC9 B;  2WGR A;  1FAA A;  3ZML A;  3GTU A;  1XCC A;  4Q5F A;  6GSY A;  1HQO A;  2LS5 A;  4O32 A;  2GVP A;  5J4Y A;  2YV9 A;  4IQ1 A;  3GRX A;  5DCH A;  2K9F A;  2RM5 A;  3TKS A;  5GSS A;  4Z2U A;  1KNG A;  4XIH A;  1UC7 A;  2JZS A;  3HHV A;  4PXO A;  3Q6O A;  4XTS A;  2MMN A;  2F51 A;  1ZYE A;  2H1L A;  3IAM 2;  2V32 A;  3C8E A;  1AAZ A;  2B7K A;  3JCM L;  2HFD A;  2VD1 A;  5A1N A;  4BVX A;  2H74 A;  1BF5 A;  3I9V 2;  4MJC A;  5IMA A;  3ZFL A;  2FWE A;  4ZBB A;  2DIZ A;  2FUG 2;  1GSE A;  3FZA A;  5G31 A;  4MMM A;  4GRF A;  4IP6 A;  3HXS A;  2GS3 A;  1Z7R A;  2OBK A;  4BA7 A;  2GSQ A;  2O5V A;  4YQU A;  5A4U A;  3HA9 A;  1MDJ A;  3GFK A;  1VF2 A;  3SWL A;  1YVL A;  4TR1 B;  4X43 A;  1G6W A;  5B8A A;  4K7N A;  2HSH A;  2GTU A;  3GN3 A;  3C1R A;  5ECO B;  1X9M B;  2AHE A;  3IBH A;  4L8E A;  3R2Q A;  1RQM A;  1T4Z A;  4MF7 A;  5JWQ B;  4HOJ A;  3TKS E;  1SD8 A;  4KDU A;  3ERG A;  1PRX A;  1GSQ A;  1XIY A;  3IK9 A;  5IM9 A;  2LJA A;  5F05 A;  4P3Y B;  1V2A A;  2H6X A;  2DLX A;  2OAD A;  3GST A;  4I2T A;  3GL5 A;  4CY6 A;  2C80 A;  4ZBA A;  5DAK A;  2C0E A;  4GSN A;  2FNO A;  5KOX A;  4XHM A;  3NZN A;  3P90 A;  3F0I A;  5C04 A;  4JR6 A;  1SKR B;  4MNN A;  4XRD A;  5JWO B;  1OYJ A;  3FHK A;  2EIR A;  2QKE A;  4WBR D;  3L4N A;  4IJ3 A;  3ZRE A;  1TK8 B;  4YAV A;  2OA7 A;  2GDR A;  5HFG A;  1FO5 A;  4TR4 A;  2EC4 A;  4K1F A;  1T8E B;  3MIX A;  4RUV A;  2H6Y A;  2V6K A;  3TDG A;  4PNF A;  3N5O A;  2VLT A;  1Y25 A;  3D22 A;  3G9B A;  4WET A;  4J2F A;  4KX4 A;  2JAC A;  3BOA A;  5HR2 A;  3GL3 A;  5ECI B;  3TJK A;  3W6G A;  3GX8 A;  1X9S B;  4NXI A;  22GS A;  1OE7 A;  2PWJ A;  4KSM A;  1TK5 B;  1SL1 B;  4ZL8 A;  4DSQ A;  3FW2 A;  2QA2 A;  4N3Z A;  4O92 A;  4YQV A;  3D4M A;  3UAP A;  3F3R A;  4NHW A;  2VAF A;  1Z7P A;  4ECC A;  2C0F A;  5HR3 A;  2HRA A;  2NTO A;  4YAP A;  2GSS A;  5HR1 A;  2M80 A;  4KA0 A;  5EVO A;  5F0G A;  3F4T A;  4OCF A;  2A4V A;  1CQG A;  3ZL5 A;  5LD0 A;  1TDI A;  4NAX A;  1W4V A;  2VL3 A;  2HE3 A;  1TK0 B;  3H1N A;  4MJA A;  5IOX A;  5C00 A;  2F3M A;  3RAZ A;  2ZCT A;  3GA4 A;  2EIO A;  4IP1 A;  4EL1 A;  4J56 E;  1BYE A;  4JU5 A;  4HUA A;  3EIN A;  5ENU A;  2F9S A;  3EMX A;  3M1G A;  5FT3 A;  5GAP D;  3EMP A;  3L9S A;  2WDU A;  3QAV A;  2CX4 A;  3AY8 A;  4E68 A;  1OKD A;  2YWI A;  4CHS A;  4DVC A;  2B1L A;  2GQL A;  4AKX B;  3EU4 A;  3F6F A;  3EYT A;  2AV4 A;  3IOS A;  2X64 A;  2HT9 A;  13GS A;  2WRT A;  4V1A p;  3FZ9 A;  1YEX A;  3GTU B;  2P31 A;  5BMU A;  12GS A;  1I9D A;  2L4C A;  4K0G A;  1B9Y C;  4E8E A;  2C3N A;  14GS A;  1XOB A;  4F0C A;  3Q18 A;  1O8W A;  1XW9 A;  1XVW A;  5H5R A;  3Q74 A;  4PQH A;  2A2P A;  4XS1 A;  4XRA A;  3RPP A;  1BG5 A;  1R5A A;  4F9Z A;  5ELA A;  3GHA A;  1BAY A;  1GRX A;  4TW5 A;  4BVX B;  5A1N B;  2FWH A;  4EXJ A;  1K0B A;  1MD4 A;  2DML A;  2YWM A;  4EC0 A;  1TRS A;  4WR5 A;  1F3A A;  3HCZ A;  3IC8 A;  1K3Y A;  2H1A A;  4V2N A;  4IGJ A;  2REM A;  5IIZ A;  3FR9 A;  2VCQ A;  3HJM A;  1ZYP A;  2I3Y A;  2QC7 A;  2B5E A;  2R5G A;  2NBS A;  4PX1 A;  2FWF A;  4BL7 A;  5DQY A;  5J41 A;  3VLN A;  2VM2 A;  2K6V A;  3MAK A;  4H86 A;  4QMK A;  5AIS A;  4TR0 A;  5HQP A;  1WOU A;  2HQT A;  4IS0 A;  2VL9 A;  2ZUP A;  2X49 A;  2XPE A;  5D96 A;  3IRA A;  1GTA A;  2NVL A;  2YNX A;  2MZC A;  3HMJ G;  1WRY A;  1TI3 A;  4KW6 A;  2WB9 A;  1UVZ A;  4OWY A;  4MP4 A;  3VPT A;  4GQC A;  4N30 A;  5DAK B;  5EY6 A;  1ZL9 A;  3C73 A;  3G7J A;  3DYR A;  1WPI A;  1V9W A;  3Q19 A;  1ILO A;  1E6B A;  2WCI A;  2VUP A;  1TU7 A;  1FOH A;  5IMZ A;  1WE0 A;  2HZE A;  3TJB A;  4BVY A;  4PGT A;  3E0U A;  2RLI A;  5G1L A;  2XBQ A;  3UIW A;  4HZ4 A;  4G0K A;  1Q4J A;  5EPF A;  1AQW A;  4ECB A;  5A34 A;  2OJL A;  2GST A;  4OMV A;  1X9W B;  4ML6 A;  2YOI A;  5JCW A;  2C0G A;  5COH A;  3DVW A;  3H4K A;  3KH7 A;  1GUM A;  4XCS A;  4NWY A;  4Z2R A;  1M7T A;  1SKW B;  1V58 A;  3GH9 A;  5LNK e;  3GSS A;  1Y6E A;  2Z9S A;  1GTI A;  2IME A;  3H8Q A;  1SL2 B;  4MPG A;  1TTZ A;  3DEX A;  1ST9 A;  4ZL7 A;  2A2R A;  2WJU A;  2OKA A;  1QGV A;  1GUL A;  3RDW A;  2OE3 A;  4KGI A;  1A24 A;  1ZGN A;  3IE3 A;  4YH2 A;  2DJ0 A;  1EEJ A;  2R37 A;  3FRC A;  2X4A A;  3VWV A;  1AW9 A;  3ED3 A;  2PMT A;  3E3E A;  2CVK A;  1XVQ A;  3GKN A;  4HDE A;  2CT6 A;  4ZL9 A;  1OAZ A;  2H73 A;  1XWG A;  5ECS A;  3FKF A;  4IW9 A;  2HSM A;  1BX9 A;  4L5O A;  1QXH A;  1BJX A;  3PPU A;  4G0I A;  2KP2 A;  3FMW A;  3GUR A;  1A8Y A;  1TRV A;  2B3S A;  1J0F A;  1ZYQ B;  1OKT A;  3M0F A;  3CSJ A;  5B7C A;  5ECQ B;  3C1S A;  1THX A;  3GIX A;  4QL9 A;  1T3B A;  4W66 A;  4WR4 A;  3KZQ A;  1KTE A;  1VF1 A;  3FR3 A;  4OFT A;  2N5A A;  5INY A;  2J9H A;  1SVM A;  3K8N A;  3WGD A;  4O7H A;  4ZIJ A;  2IMK A;  3EWL A;  4LA1 A;  3IHG A;  4I8B A;  4HQS A;  3A2W A;  2R3X A;  4TXV A;  1XBS A;  2IMD A;  1EP7 A;  2LJR A;  1EV9 A;  4IHU A;  3DD3 A;  3A2V A;  2VCZ A;  5BMU B;  4Z7X A;  4FIW A;  3CMI A;  4WKW A;  1S3A A;  3W8S A;  5ID2 A;  3D0Z A;  4G2E A;  3FZ5 A;  3VK9 A;  1MEK A;  2FA8 A;  4ZBD A;  1SKS B;  1JLV A;  3CBU A;  4CW9 A;  4HQZ A;  2VD0 A;  2IWT A;  3CXG A;  1QFN A;  4YKG A;  3KP9 A;  18GS A;  3QPM A;  2WUL A;  1I5G A;  3TKQ A;  2GQK A;  1G0T A;  4ZB6 A;  3IAS 2;  1GSF A;  2HRK A;  2J23 A;  4KB3 A;  3RPN A;  3PGT A;  5A5H A;  2ALB A;  4K7I A;  1HD2 A;  2LNS A;  4BL7 B;  4X1U A;  2L6C A;  2HSY A;  4OD7 A;  4K5R A;  1HNC A;  5J4U A;  1M9A A;  4KE3 A;  3VWX A;  1SD9 A;  1SU9 A;  4FH8 A;  3GKK A;  1PD2 1;  2MBS A;  5GZZ B;  2FLS A;  3TKR A;  5DAL A;  2R6K A;  3TRP A;  2GT6 A;  1EV4 A;  3TRQ A;  2L6D A;  5G1K A;  2H75 A;  1V40 A;  3H93 A;  4LMV A;  3UMA A;  2H6Z A;  2IN3 A;  5IQY A;  2GZY A;  1U87 A;  1XWA A;  1GSS A;  1FHE A;  4ISD A;  3ZIJ A;  4QL7 A;  4BVY B;  5LCZ A;  2LRN A;  2CZ2 A;  3VI5 A;  3TJG A;  3HZ4 A;  5IMF A;  1Q98 A;  3BJ5 A;  2E0Q A;  1ACV A;  4K9Z A;  1YEP A;  3QAG A;  1PA3 A;  1URM A;  4QQ7 A;  5A34 B;  4EIP A;  1F3B A;  3CSI A;  4JE1 A;  3QFB C;  4KDY A;  8GSS A;  1TXU A;  2EFD A;  4BPY A;  6GSU A;  3KMN A;  3L78 A;  3SBC A;  4MCU A;  1EOH A;  1X0R A;  3HD5 A;  2IIY A;  3ZYW A;  1BQ7 A;  2TRX A;  3HYP A;  3APO A;  4KDX A;  1V57 A;  2H19 A;  4MF6 A;  1PL2 A;  2KHP A;  3ZZX A;  4HEA 2;  2OE1 A;  4ACS A;  2YCD A;  2LV3 A;  3ZIV A;  2VLU A;  3HVV A;  3VI7 A;  4MA9 A;  1OC3 A;  1H75 A;  1YDK A;  3M9J A;  2YZU A;  4D73 A;  2FY6 A;  5KN1 A;  1HNB A;  4TXO A;  2AYT A;  1Y1U A;  1O85 A;  1R7H A;  1PL1 A;  2DSA A;  2BTO T;  1O73 A;  3ZLP A;  2HRF A;  2RII A;  6GSS A;  1PN9 A;  3UJ1 A;  19GS A;  5ECN B;  1GP1 A;  4N0V A;  1SJ6 A;  4I2U A;  4PUF C;  4EIQ A;  4ZXG A;  3WD6 A;  1N8J A;  4JBB A;  3J7Y k;  1MTC A;  2V6O A;  4N10 A;  1X5D A;  2HSM B;  2YPM A;  4GST A;  2E2G A;  1ZYN A;  5CRD A;  1AXD A;  2H1G A;  1ERW A;  2NDO A;  3UBK A;  2I81 A;  1FW1 A;  2OE0 A;  1RK4 A;  4POB A;  2R0C A;  2PVQ A;  3LQ7 A;  4LLR A;  4G0L A;  3KEB A;  5IO0 A;  1TI1 A;  3N9J A;  2LST A;  1UN2 A;  2L59 A;  2XPD A;  4CY8 A;  3MNG A;  3QFA C;  5KN3 A;  3EU3 A;  1GSU A;  1ML6 A;  4I5Q A;  3L9U A;  3VFI A;  3S9F A;  3UL3 A;  3NIV A;  1LJR A;  3F9U A;  4EF0 A;  1ERU A;  17GS A;  2EFE A;  3MSZ A;  4GLT A;  2WS2 A;  3KTB A;  4HS1 A;  3FZ4 A;  4V2M A;  4PTS A;  3CRT A;  4EDZ A;  1TW9 A;  4HI7 A;  5IPH A;  1XW6 A;  2UV8 G;  2DJJ A;  2EIQ A;  2HZF A;  4MPF A;  2CA8 A;  3PR8 A;  4JRR A;  2OAC A;  5A4V A;  4IVF A;  1IYH A;  5J40 A;  1G6Y A;  2CZ3 A;  2C3T A;  3KIJ A;  1ERT A;  3KTL A;  2F8F A;  3QR6 A;  2B1K A;  5ID2 B;  3ZRD A;  1M2B A;  3C71 A;  2IFQ B;  3DWV A;  2PVO C;  5J47 A;  4IN0 A;  3ZVJ D;  1LBK A;  3GMF A;  4AJ8 A;  4NV2 A;  1X5E A;  1S3C A;  4ML1 A;  5CAX A;  2IL3 A;  3HVS A;  2QA1 A;  4AKI A;  4V1A g;  3KM6 A;  5A5K A;  1TJD A;  1XW5 A;  2PN8 A;  2K8S A;  1XZO A;  5ECR B;  2RUE A;  5G30 A;  4TVE A;  1ZZY A;  2H01 A;  2H0G A;  2H70 A;  1N2A A;  3FYG A;  4I6X A;  4OFN A;  4TRX A;  1Z6N A;  4KF9 A;  1O81 A;  3NOF A;  4K7O A;  5ELG A;  2GT5 A;  1FVJ A;  1VGL A;  2PU9 C;  3VWW A;  2DJ3 A;  3LXT A;  3ME7 A;  1OC8 A;  4NPB A;  1BG1 A;  5DJL A;  2E2M A;  3D4T A;  4IJI A;  2DMM A;  4L0U A;  3MYD A;  2HXK A;  3E9J B;  4POK A;  3EC3 A;  5CRE A;  3LXZ A;  2H0H A;  3RHC A;  6GST A;  1K3O A;  4V2L A;  2C0D A;  3WYW A;  5FWG A;  4POM A;  3EVI A;  5D93 A;  4GWR A;  3P8W A;  1XXU A;  5J9C A;  2UZ8 A;  2FD3 A;  2IMI A;  1ZOF A;  1YF1 A;  4ID0 A;  2F8A A;  1SL0 B;  2A2S A;  1F37 A;  3D21 A;  2DC5 A;  1YZX A;  4YKF A;  2AUV A;  4PQI A;  3A2X A;  1X5C A;  3ZVJ A;  3P2A A;  1OE8 A;  1YKC A;  2YZH A;  1PGT A;  3MWH A;  4GTU A;  3IR4 A;  4HZ2 A;  1SK1 A;  3A5W A;  1T1V A;  3V1W A;  4XS4 A;  2C3Q A;  3TOU A;  1M99 A;  5AIX A;  2P0G A;  5DVB A;  2H66 A;  2VIM A;  3UBL A;  1ZMA A;  3BBY A;  3ISO A;  5CO3 A;  2MBT A;  2KOK A;  2R0P A;  3UEM A;  3LW9 A;  3HJO A;  3CYN A;  2AJQ B;  1J9B A;  1XFL A;  3HZ8 A;  4NHZ A;  4D73 B;  1K0A A;  3P7X A;  2FGX A;  3ME8 A;  4GQF A;  4TXO B;  5DBQ A;  3U6V A;  1WMJ A;  3KCM A;  3QDN A;  3ERW A;  5DDL A;  4EDY A;  2V2G A;  4HU7 A;  2EFC A;  10GS A;  4MK3 A;  3F3Q A;  2VM1 A;  4OO4 A;  4POL A;  1TRU A;  3CRU A;  1GTB A;  3PIN A;  4DSR A;  2AB6 A;  4GDF A;  2B6M A;  1AUC A;  1HNA A;  2YV7 A;  2IMF A;  4BWS A;  5B8B A;  2PER A;  2LKU A;  2LTK A;  4WBJ A;  1AQV A;  1U6T A;  2N5B A;  1M0U A;  4ZB7 A;  3ZFB A;  2HSN A;  1DUG A;  1Z5Y E;  1JZR A;  2YN1 A;  5AIV A;  5G5F A;  2LNT A;  4E8H A;  1T7P B;  4TR3 A;  1GLP A;  5DCG A;  1PKW A;  3GUS A;  2YP6 A;  2H0I A;  1SK0 A;  2RM6 A;  3VUR A;  4MLY A;  4TOP A;  2K18 A;  2C4J A;  4JED A;  5H5Q A;  2V41 A;  1VRS D;  2O89 A;  2ON7 A;  1A0R P;  1XWB A;  2CAI A;  5KEJ A;  1O6J A;  1ERV A;  2OBI A;  2VO4 A;  3GH6 A;  4A5P A;  5G5E A;  4GSS A;  1TXX A;  2WFC A;  4TKY A;  3F6D A;  4AF2 A;  3M3M A;  2CVD A;  4MJE A;  1NW2 A;  2D2Z A;  1WIK A;  4K5S A;  1N25 A;  1GNE A;  3CSH A;  3H79 A;  3BCI A;  2K8V A;  1B9X C;  2VKZ G;  1JZD A;  1AIU A;  3WT1 A;  4FYC A;  2LJK A;  2VCT A;  1M2A A;  5CRW A;  2IPA A;  3IDV A;  2JZR A;  2H30 A;  1XWK A;  1MDI A;  4L5L A;  3DRN A;  1EEM A;  16GS A;  2PGT A;  4MDC A;  2XBI A;  1GSD A;  4Q5Q A;  4ECI A;  1O7U A;  1SJZ A;  3CTG A;  3DVX A;  1XWC A;  2PUK C;  4F03 A;  1SJI A;  5EL8 A;  2H1B A;  1K0D A;  5A4W A;  2LUS A;  5ECM B;  5IMV A;  1R26 A;  1JZO A;  2JU5 A;  2DKH A;  3UVH A;  1MD3 A;  4G19 A;  3D5J A;  3BCK A;  1RW1 A;  1SVL A;  3FR6 A;  1U88 A;  5GST A;  1CQH A;  3TKP A;  1A2L A;  5HR0 A;  5F06 A;  5ABR A;  2GSR A;  3RHB A;  1YY7 A;  4F2I A;  2KLX A;  2YWO A;  2O7K A;  5F07 A;  1T4Y A;  1XPV A;  4G9H A;  2L5O A;  4XS4 B;  5J5N A;  3ZTL A;  4F82 A;  1GSY A;  1K0M A;  4MZB A;  4AKH A;  4ICY A;  1Z9H A;  4KCE A;  1TKD B;  2ES7 A;  1M9B A;  4GXZ A;  1GUH A;  2HZE B;  3MDK A;  2R0G A;  1F2E A;  1TOF A;  1J08 A;  3HDC A;  2HI7 A;  4K2X A;  3PH9 A;  5J3R A;  1C72 A;  4AKG A;  2CAQ A;  3DXB A;  4EVM A;  1K3L A;  2VLV A;  1AQX A;  4MH3 A;  1QMV A;  1WJK A;  2YAN A;  1H4O A;  5BRT A;  1YKA A;  4EO3 A;  5ECP B;  2GGT A;  1EWX A;  4FO5 A;  5KN0 A;  1G7E A;  1DE1 A;  2CQ9 A;  1THO A;  1ZCP A;  3M8N A;  11GS A;  1QK8 A;  2LRT A;  5CYY A;  2DBC A;  4FYB A;  1GNW A;  5D9V A;  3IXR A;  2ON5 A;  1XOA A;  3L9V A;  4WXT A;  2X99 A;  4K6X A;  2FA4 A;  2I1U A;  2HSN B;  1A0F A;  4FYU A;  1F9M A;  3LWA A;  1B4Q A;  2O87 A;  2X8G A;  1TU8 A;  4WF4 A;  2KP1 A;  5IMD A;  3WGE A;  3WGX A;  5ECL B;  3I43 A;  4YQM A;  1SYR A;  5IMC A;  4JR4 A;  3HJP A;  5JCG A;  2LQO A;  1LU4 A;  1W89 A;  1U3A A;  1E2Y A;  2CVB A;  5IOW A;  5KOW A;  1HYU A;  3UOM A;  1GH2 A;  1QUW A;  3ERF A;  3UVT A;  4Z2T A;  4AGS A;  1EGO A;  1JFU A;  4Q5R A;  4IKH A;  4F0B A;  2B5Y A;  2VOC A;  1V98 A;  3A5I A;  2MYG A;  3US3 A;  3QAW A;  4PUA A;  5G2Z A;  1EGR A;  3TRX A;  4IBP A;  1TP9 A;  5B6N A;  6GSX A;  3CTF A;  1GTU A;  3OR5 A;  2TRC P;  3F63 A;  2GQM A;  2BJX A;  3UAR A;  4KAE A;  3D6I A;  1BED A;  1EZK A;  4K8M A;  3LSZ A;  2VCX A;  2VL2 C;  1DE2 A;  2G2Q A;  2RUF A;  3GNJ A;  4K0N A;  4KH7 A;  3FY7 A;  4K2D A;  2FCH A;  3FEU A;  4KUN A;  4I97 A;  2X8C A;  3M9K A;  3TUE A;  1NHO A;  5L71 A;  1O8X A;  2O8V B;  4L0W A;  2ZNM A;  2HRN A;  3G7Y A;  4GF0 A;  3F8U A;  3QMX A;  2P5R A;  3KP8 A;  1DBY A;  1FB0 A;  3APQ A;  4NMU A;  5IO2 A;  2MMZ A;  2HNL A;  1JZW A;  3I69 A;  4IEL A;  3I6A A;  3QCP A;  3VWU A;  1ABA A;  4LL4 B;  1G7O A;  3GKX A;  5J9B A;  3ZIT A;  4IQA A;  1ON4 A;  4O5R A;  5AGY A;  3DML A;  3U5R E;  2LQQ A;  1PKZ A;  5IPG A;  2YWN A;  1PQN A;  2GLR A;  4X4J A;  4MH2 A;  4EE0 A;  2GZZ A;  2HRK B;  4FQU A;  4USS A;  5D8I A;  4EKZ A;  5A5H B;  5E4W A;  6GSW A;  1NHY A;  2R4V A;  2VCW A;  1SK2 A;  4OO5 A;  3KD0 A;  1PSQ A;  3LYP A;  2EFH A;  2MMA A;  1M2D A;  2VCV A;  4OCE A;  4GCI A;  3GX0 A;  4HJ2 A;  1AC1 A;  5DAL B;  2A4H A;  4DSS A;  1YQ1 A;  5CRH A;  5GAN D;  3LG6 A;  1PX6 A;  2BMX A;  4RQX A;  1K0O A;  3KMO A;  3IK7 A;  2XHF A;  1OVN A;  1GUK A;  2CV4 A;  3TGZ A;  3HVX A;  2L5L A;  4MAB A;  3EE2 A;  3DIE A;  2QGV A;  1WWJ A;  5DJM A;  1A2J A;  3VPQ A;  5CNW A;  2I9H A;  1Z3E A;  3APS A;  2QSI A;  3LEF A;  5HFI A;  4AI6 A;  2M72 A;  3IC4 A;  3TU3 B;  9GSS A;  3EPT A;  4HJM A;  4ZB8 A;  2V1M A;  1OC9 A;  2VL2 A;  2N5F A;  3HY2 A;  2C1Y A;  4LMW A;  5FHI A;  2DJK A;  3GYK A;  1DSB A;  1EP8 A;  1FB6 A;  3QOU A;  5F8B A;  3J7Y b;  4KND A;  5D9W A;  3G7I A;  2AAW A;  1GL8 A;  1GWC A;  1SEN A;  4RQR A;  1WP0 A;  1VF4 A;  2B7J A;  4X0X A;  3LYK A;  2DKI A;  3IV4 A;  2TIR A;  4ULX A;  1FOV A;  2YJ7 A;  4N0Z A;  2MMO A;  2HLS A;  1Z6M A;  1R5P A;  5CRG A;  3TOT A;  3R3E A;  2X8H A;  4TR1 A;  3TJF A;  4G01 A;  1T00 A;  1USB A;  4MJB A;  4MZC A;  1GLQ A;  2G0F A;  2PPT A;  1YJ6 A;  3RBT A;  1A8L A;  1YF0 A;  5B6M A;  2JZT A;  4O5Q A;  6GSV A;  4LL1 B;  3KXO A;  1B48 A;  5DQS A;  1S3D A;  3F4R A;  1UA5 A;  3TB2 A;  2XC2 A;  5JCU A;  1PMT A;  1B4P A;  1A23 A;  2H72 A;  4PQ1 A;  4XS6 A;  2FWG A;  1SYX A;  3GV1 A;  1NSW A;  4AJ7 A;  3TJJ A;  3CWG A;  2DIY A;  4OFM A;  4DEJ A;  2KUC A;  4KSO A;  4BWQ A;  3LFL A;  4ZB9 A;  1K0C A;  3BD2 A;  3LJR A;  2L57 A;  4KCA A;  4WF5 A;  5H5S A;  4ILF A;  2R2J A;  3KGK A;  4PUR A;  4RI6 A;  4WEY A;  3C7M A;  2LRC A;  4JZQ A;  1FVK A;  3DGQ A;  1PX7 A;  2JAD A;  20GS A;  4TN8 A;  3O6T A;  3TKS C;  5D9X A;  2FHE A;  3IA1 A;  4MZW A;  2O85 A;  3A3T A;  4NV5 A;  7GSS A;  3O3T A;  5ECH B;  4O5U A;  2H1D A;  3O76 A;  5CP1 A;  3WT2 A;  4G10 A;  2DJ1 A;  2PBJ A;  4MF5 A;  3W8J A;  1IYI A;  1EOG A;  4N11 A;  1JHB A;  3KJY A;  3EUR A;  4Q5N A;  2LEG A;  2CX3 A;  4AJ6 A;  3TCO A;  5ECK B;  2DJ2 A;  1U3I A;  5J4V A;  1MDK A;  1SVO A;  2L4Q A;  2M46 A;  2I4A A;  2E7P A;  1F6M C;  2YJH A;  2GZP A;  2JSY A;  4RI7 A;  3LGC A;  3LOR A;  1QQ2 A;  1FG4 A;  3FK8 A;  2OT3 A;  3DKS A;  5HFK A;  1K0N A;  2WZ9 A;  3KH9 A;  1KEB A;  4ZIL A;  3L0H A;  2NPB A;  1VF3 A;  1R4W A;  1B8X A;  3QD9 A;  4J57 E;  4PNG A;  2HYX A;  1KBN A;  3IPZ A;  5KN2 A;  1NM3 A;  5E59 A;  4DSS B;  3IHQ A;  2H71 A;  2C8U A;  5JWR B;  4ECJ A;  1TRW A;  1PN0 A;  2P5Q A;  3HKR A;  1A2M A;  4HU9 A;  3ZMK A;  2IFQ A;  5AN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...