3FRDX

S. aureus dhfr complexed with nadph and folate
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
157
structure length
157
Chain Sequence
TLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increased hydrophobic interactions of iclaprim with Staphylococcus aureus dihydrofolate reductase are responsible for the increase in affinity and antibacterial activity
pubmed doi rcsb
molecule keywords Dihydrofolate reductase
molecule tags Oxidoreductase
source organism Staphylococcus aureus
total genus 40
structure length 157
sequence length 157
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00186 DHFR_1 Dihydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 3frdX00
4NX6A 1RX1A 3K74A 2L28A 3S3VA 3S9UA 2W9GA 1OHJA 4XE6X 3JWCA 1AOEA 1LUDA 3JWKA 3FRBX 5HPBA 4XT8A 3GYFA 3QYLA 1RX8A 1DR5A 1ZDRA 1RX9A 1DHJA 4P66A 3FQVA 4X5IA 1DG8A 4ELEA 4RGCA 3NZ9X 1DRHA 1TDRA 4PSYA 5HQYA 1DR4A 3E0BA 1M7AA 1OHKA 3SR5X 4KJKA 3FQOA 3HJ3A 2QK8A 5HSRA 4XT7A 3GHCA 2D0KA 3KY8A 1KMVA 3CLBA 3SRSX 3NTZA 4PSSA 1RB2A 4KY8A 5CCCA 1DAJA 4KLXA 5HF0X 5ECXA 3K45A 1HFQA 4H97A 5DXVA 3DL5A 3JW5A 3FS6A 3TQ8A 3NZCX 3QLSA 1DREA 1S3WA 4GH8A 1BZFA 1DISA 3JW3A 3EX8A 1DF7A 4KAKA 5HSUA 3UM6A 3FY8X 3CD2A 3DATA 4G3MA 2H2QA 1JUVA 2W3WA 4OR7A 4ELFA 4QHVA 2W3MA 1LY3A 2W9SA 4HOFA 1S3YA 3F8ZA 1DR2A 3FL9A 1DLRA 4IXGX 6DFRA 2OIPA 1RE7A 4X5GA 2BLBA 3GHVA 3SRQX 4QLFA 4PTJA 1QZFA 2INQA 4PTHA 3TD8A 5JA3A 1KMSA 4LAHX 2ITHA 3NZDA 3QFXA 4Q0EA 1MVTA 1RD7A 5CC9A 3ROAA 3LG4A 2CIGA 2LF1A 3D80A 3FY9X 3NZBX 3IROA 4OSGA 5HF2X 3QLRA 4M6LA 1DR7A 1S3UA 4I13A 1DDRA 4LAGX 2W3AA 3F0QX 3JWFA 3JWMA 4KM2A 1RA8A 2W9TA 4Q6AA 1LY4A 5HT4A 4IXFX 3TQAA 2BLAA 2AZNA 3FRDX 1JOMA 3NZAX 3EELA 3QL0A 1DRBA 3L3RA 1YHOA 2C2TA 2FZHA 3UM8A 4KM0A 3FYWX 1CZ3A 1DR3A 1VDRA 3FQZA 2FZIA 3SGYA 2JYBA 2CD2A 3SA1A 1RA1A 4FGGA 2DHFA 4HOEA 4G95A 3KGYA 3FQFA 1U70A 1D1GA 4KY4A 1MVSA 5U27A 2XW7A 4DPDA 3FQCA 4DP3A 2BL9A 3QG2A 1AO8A 4LEKX 1E26A 1M78A 4EJ1A 3SRRX 3QLWA 1RA9A 3JTWA 4H95A 3DRCA 5HI6A 4HA7A 1HFRA 1DRFA 1RX3A 3IX9A 4NX7A 4CD2A 1DYIA 2ANQA 3S7AA 3F0BX 4XT4A 3DAUA 3IRMA 4QI9A 1DG5A 4QLEA 4X5FA 4X5JA 4KJLA 4P3QA 5HVBA 3FRFX 4HOGA 1PDBA 4DFRA 3F0VX 1DLSA 2G6VA 3Q1HA 3NRRA 1RA3A 4XT6A 2O7PA 3EIGA 2W3VA 3NXVA 3F0SX 1IA4A 5DFRA 2HXVA 2HM9A 3FYVX 3SQYX 3EEJA 4M7VA 3QLYA 1RX7A 2DRCA 2W3BA 1PD8A 4EIZA 3GHWA 4KFJA 1J3KA 3NXRA 4DDRA 4DPHA 3NZ6X 4QJZD 2GD9A 1U71A 3EEKA 3F8YA 3NU0A 3SA2A 2C2SA 1RB3A 3INVA 4M2XA 3SRWX 5U26A 3RG9A 1S3VA 3KJRA 4KL9A 4I1NA 1IA1A 4M6KA 3TQBA 4P3RA 1RX6A 1IA3A 4QLGA 1VJ3A 1J3IA 1J3JA 1AI9A 4Q0DA 3JSUA 3M08A 1CD2A 3DL6A 3DFRA 3EEMA 1IA2A 4X5HA 3CL9A 1DR1A 1RH3A 3ZPCA 5HT5A 4KNEA 3KJSA 5HVEA 4IXED 4ELBA 3I3RA 3FRAX 3FREX 4TU5X 3K2HA 1DYRA 3HBBA 3I8AX 3IRNA 3TQ9A 5E8QA 4ECKA 3IA5A 1JOLA 2W9HA 3R33A 3IA4A 3QYOA 1BOZA 3NXTA 2ANOA 2HQPA 3OCHA 3SH2A 1DHFA 3N0HA 4PDJA 4FGHA 4PSTA 3F0XX 1RA2A 1HFPA 1DYHA 4M7UA 4P68A 3QGTA 2B3ZA 3F0UX 4KYAA 5HQZA 3F91A 1DRAA 5ECCA 1DHIA 3CSEA 2D5NA 1RX5A 2ZZAA 1SEJA 3D84X 3NXXA 3K47A 1RC4A 1DR6A 3KFYA 2OBCA 3ZPGA 3OAFA 1DIUA 3UM5A 1DG7A 1U72A 3RO9A 3DGAA 1DDSA 1M79A 4KEBA 3NXOA 4H96A 1RG7A 3FQ0A 3M09A 3VCOA 4H98A 4HA9A 5JG0X 3GI2A 4LAEX 3FL8A 1RX4A 3QLXA 4QJCA 3QL3A 2BLCA 1PD9A 3DG8A 8DFRA 4ELGA 4KD7A 4EILA 2FZJA 4FHBA 7DFRA 3SRUX 4KBNA 1RF7A 4KJJA 4G8ZX 4XT5A 5HUIA 4EIGA 5FDAA 4M6JA 4Q67A 2KGKA 5EAJA 3SAIA 3JVXA 4XECX 3NXYA 1DYJA 1KLKA 4ELHA 2P4GA 4XRBA 1RX2A 3QLZA
chains in the Genus database with same CATH superfamily
4NX6A 1RX1A 3K74A 2L28A 3S3VA 3S9UA 2W9GA 1OHJA 4XE6X 3JWCA 1AOEA 1LUDA 3JWKA 3FRBX 5HPBA 4XT8A 3GYFA 3QYLA 1RX8A 1DR5A 1ZDRA 1RX9A 1DHJA 4P66A 3FQVA 4X5IA 1DG8A 4ELEA 4RGCA 3NZ9X 1DRHA 1TDRA 4PSYA 5HQYA 1DR4A 3E0BA 1M7AA 1OHKA 3SR5X 4KJKA 3FQOA 3HJ3A 2QK8A 5HSRA 4XT7A 3GHCA 2D0KA 3KY8A 1KMVA 3CLBA 3SRSX 3NTZA 4PSSA 1RB2A 4KY8A 5CCCA 1DAJA 4KLXA 5HF0X 5ECXA 3K45A 1HFQA 4H97A 5DXVA 3DL5A 3JW5A 3FS6A 3TQ8A 3NZCX 3QLSA 1DREA 1S3WA 4GH8A 1BZFA 1DISA 3JW3A 3EX8A 1DF7A 4KAKA 5HSUA 3UM6A 3FY8X 3CD2A 3DATA 4G3MA 2H2QA 1JUVA 2W3WA 4OR7A 4ELFA 4QHVA 2W3MA 1LY3A 2W9SA 4HOFA 1S3YA 3F8ZA 1DR2A 3FL9A 1DLRA 4IXGX 6DFRA 2OIPA 1RE7A 4X5GA 2BLBA 3GHVA 3SRQX 4QLFA 4PTJA 1QZFA 2INQA 4PTHA 3TD8A 5JA3A 1KMSA 4LAHX 2ITHA 3NZDA 3QFXA 4Q0EA 1MVTA 1RD7A 5CC9A 3ROAA 3LG4A 2CIGA 2LF1A 3D80A 3FY9X 3NZBX 3IROA 4OSGA 5HF2X 3QLRA 4M6LA 1DR7A 1S3UA 4I13A 1DDRA 4LAGX 2W3AA 3F0QX 3JWFA 3JWMA 4KM2A 1RA8A 2W9TA 4Q6AA 1LY4A 5HT4A 4IXFX 3TQAA 2BLAA 2AZNA 3FRDX 1JOMA 3NZAX 3EELA 3QL0A 1DRBA 3L3RA 1YHOA 2C2TA 2FZHA 3UM8A 4KM0A 3FYWX 1CZ3A 1DR3A 1VDRA 3FQZA 2FZIA 3SGYA 2JYBA 2CD2A 3SA1A 1RA1A 4FGGA 2DHFA 4HOEA 4G95A 3KGYA 3FQFA 1U70A 1D1GA 4KY4A 1MVSA 5U27A 2XW7A 4DPDA 3FQCA 4DP3A 2BL9A 3QG2A 1AO8A 4LEKX 1E26A 1M78A 4EJ1A 3SRRX 3QLWA 1RA9A 3JTWA 4H95A 3DRCA 5HI6A 4HA7A 1HFRA 1DRFA 1RX3A 3IX9A 4NX7A 4CD2A 1DYIA 2ANQA 3S7AA 3F0BX 4XT4A 3DAUA 3IRMA 4QI9A 1DG5A 4QLEA 4X5FA 4X5JA 4KJLA 4P3QA 5HVBA 3FRFX 4HOGA 1PDBA 4DFRA 3F0VX 1DLSA 2G6VA 3Q1HA 3NRRA 1RA3A 4XT6A 2O7PA 3EIGA 2W3VA 3NXVA 3F0SX 1IA4A 5DFRA 2HXVA 2HM9A 3FYVX 3SQYX 3EEJA 4M7VA 3QLYA 1RX7A 2DRCA 2W3BA 1PD8A 4EIZA 3GHWA 4KFJA 1J3KA 3NXRA 4DDRA 4DPHA 3NZ6X 4QJZD 2GD9A 1U71A 3EEKA 3F8YA 3NU0A 3SA2A 2C2SA 1RB3A 3INVA 4M2XA 3SRWX 5U26A 3RG9A 1S3VA 3KJRA 4KL9A 4I1NA 1IA1A 4M6KA 3TQBA 4P3RA 1RX6A 1IA3A 4QLGA 1VJ3A 1J3IA 1J3JA 1AI9A 4Q0DA 3JSUA 3M08A 1CD2A 3DL6A 3DFRA 3EEMA 1IA2A 4X5HA 3CL9A 1DR1A 1RH3A 3ZPCA 5HT5A 4KNEA 3KJSA 5HVEA 4IXED 4ELBA 3I3RA 3FRAX 3FREX 4TU5X 3K2HA 1DYRA 3HBBA 3I8AX 3IRNA 3TQ9A 5E8QA 4ECKA 3IA5A 1JOLA 2W9HA 3R33A 3IA4A 3QYOA 1BOZA 3NXTA 2ANOA 2HQPA 3OCHA 3SH2A 1DHFA 3N0HA 4PDJA 4FGHA 4PSTA 3F0XX 1RA2A 1HFPA 1DYHA 4M7UA 4P68A 3QGTA 2B3ZA 3F0UX 4KYAA 5HQZA 3F91A 1DRAA 5ECCA 1DHIA 3CSEA 2D5NA 1RX5A 2ZZAA 1SEJA 3D84X 3NXXA 3K47A 1RC4A 1DR6A 3KFYA 2OBCA 3ZPGA 3OAFA 1DIUA 3UM5A 1DG7A 1U72A 3RO9A 3DGAA 1DDSA 1M79A 4KEBA 3NXOA 4H96A 1RG7A 3FQ0A 3M09A 3VCOA 4H98A 4HA9A 5JG0X 3GI2A 4LAEX 3FL8A 1RX4A 3QLXA 4QJCA 3QL3A 2BLCA 1PD9A 3DG8A 8DFRA 4ELGA 4KD7A 4EILA 2FZJA 4FHBA 7DFRA 3SRUX 4KBNA 1RF7A 4KJJA 4G8ZX 4XT5A 5HUIA 4EIGA 5FDAA 4M6JA 4Q67A 2KGKA 5EAJA 3SAIA 3JVXA 4XECX 3NXYA 1DYJA 1KLKA 4ELHA 2P4GA 4XRBA 1RX2A 3QLZA
chains in the Genus database with same CATH topology
4NX6A 1RX1A 3K74A 2L28A 3S3VA 3S9UA 2W9GA 1OHJA 4XE6X 3JWCA 1AOEA 1LUDA 3JWKA 3FRBX 5HPBA 4XT8A 3GYFA 3QYLA 1RX8A 1DR5A 1ZDRA 1RX9A 1DHJA 4P66A 3FQVA 4X5IA 1DG8A 4ELEA 4RGCA 3NZ9X 1DRHA 1TDRA 4PSYA 5HQYA 1DR4A 3E0BA 1M7AA 1OHKA 3SR5X 4KJKA 3FQOA 3HJ3A 2QK8A 5HSRA 4XT7A 3GHCA 2D0KA 3KY8A 1KMVA 3CLBA 3SRSX 3NTZA 4PSSA 1RB2A 4KY8A 5CCCA 1DAJA 4KLXA 5HF0X 5ECXA 3K45A 1HFQA 4H97A 5DXVA 3DL5A 3JW5A 3FS6A 3TQ8A 3NZCX 3QLSA 1DREA 1S3WA 4GH8A 1BZFA 1DISA 3JW3A 3EX8A 1DF7A 4KAKA 5HSUA 3UM6A 3FY8X 3CD2A 3DATA 4G3MA 2H2QA 1JUVA 2W3WA 4OR7A 4ELFA 4QHVA 2W3MA 1LY3A 2W9SA 4HOFA 1S3YA 3F8ZA 1DR2A 3FL9A 1DLRA 4IXGX 6DFRA 2OIPA 1RE7A 4X5GA 2BLBA 3GHVA 3SRQX 4QLFA 4PTJA 1QZFA 2INQA 4PTHA 3TD8A 5JA3A 1KMSA 4LAHX 2ITHA 3NZDA 3QFXA 4Q0EA 1MVTA 1RD7A 5CC9A 3ROAA 3LG4A 2CIGA 2LF1A 3D80A 3FY9X 3NZBX 3IROA 4OSGA 5HF2X 3QLRA 4M6LA 1DR7A 1S3UA 4I13A 1DDRA 4LAGX 2W3AA 3F0QX 3JWFA 3JWMA 4KM2A 1RA8A 2W9TA 4Q6AA 1LY4A 5HT4A 4IXFX 3TQAA 2BLAA 2AZNA 3FRDX 1JOMA 3NZAX 3EELA 3QL0A 1DRBA 3L3RA 1YHOA 2C2TA 2FZHA 3UM8A 4KM0A 3FYWX 1CZ3A 1DR3A 1VDRA 3FQZA 2FZIA 3SGYA 2JYBA 2CD2A 3SA1A 1RA1A 4FGGA 2DHFA 4HOEA 4G95A 3KGYA 3FQFA 1U70A 1D1GA 4KY4A 1MVSA 5U27A 2XW7A 4DPDA 3FQCA 4DP3A 2BL9A 3QG2A 1AO8A 4LEKX 1E26A 1M78A 4EJ1A 3SRRX 3QLWA 1RA9A 3JTWA 4H95A 3DRCA 5HI6A 4HA7A 1HFRA 1DRFA 1RX3A 3IX9A 4NX7A 4CD2A 1DYIA 2ANQA 3S7AA 3F0BX 4XT4A 3DAUA 3IRMA 4QI9A 1DG5A 4QLEA 4X5FA 4X5JA 4KJLA 4P3QA 5HVBA 3FRFX 4HOGA 1PDBA 4DFRA 3F0VX 1DLSA 2G6VA 3Q1HA 3NRRA 1RA3A 4XT6A 2O7PA 3EIGA 2W3VA 3NXVA 3F0SX 1IA4A 5DFRA 2HXVA 2HM9A 3FYVX 3SQYX 3EEJA 4M7VA 3QLYA 1RX7A 2DRCA 2W3BA 1PD8A 4EIZA 3GHWA 4KFJA 1J3KA 3NXRA 4DDRA 4DPHA 3NZ6X 4QJZD 2GD9A 1U71A 3EEKA 3F8YA 3NU0A 3SA2A 2C2SA 1RB3A 3INVA 4M2XA 3SRWX 5U26A 3RG9A 1S3VA 3KJRA 4KL9A 4I1NA 1IA1A 4M6KA 3TQBA 4P3RA 1RX6A 1IA3A 4QLGA 1VJ3A 1J3IA 1J3JA 1AI9A 4Q0DA 3JSUA 3M08A 1CD2A 3DL6A 3DFRA 3EEMA 1IA2A 4X5HA 3CL9A 1DR1A 1RH3A 3ZPCA 5HT5A 4KNEA 3KJSA 5HVEA 4IXED 4ELBA 3I3RA 3FRAX 3FREX 4TU5X 3K2HA 1DYRA 3HBBA 3I8AX 3IRNA 3TQ9A 5E8QA 4ECKA 3IA5A 1JOLA 2W9HA 3R33A 3IA4A 3QYOA 1BOZA 3NXTA 2ANOA 2HQPA 3OCHA 3SH2A 1DHFA 3N0HA 4PDJA 4FGHA 4PSTA 3F0XX 1RA2A 1HFPA 1DYHA 4M7UA 4P68A 3QGTA 2B3ZA 3F0UX 4KYAA 5HQZA 3F91A 1DRAA 5ECCA 1DHIA 3CSEA 2D5NA 1RX5A 2ZZAA 1SEJA 3D84X 3NXXA 3K47A 1RC4A 1DR6A 3KFYA 2OBCA 3ZPGA 3OAFA 1DIUA 3UM5A 1DG7A 1U72A 3RO9A 3DGAA 1DDSA 1M79A 4KEBA 3NXOA 4H96A 1RG7A 3FQ0A 3M09A 3VCOA 4H98A 4HA9A 5JG0X 3GI2A 4LAEX 3FL8A 1RX4A 3QLXA 4QJCA 3QL3A 2BLCA 1PD9A 3DG8A 8DFRA 4ELGA 4KD7A 4EILA 2FZJA 4FHBA 7DFRA 3SRUX 4KBNA 1RF7A 4KJJA 4G8ZX 4XT5A 5HUIA 4EIGA 5FDAA 4M6JA 4Q67A 2KGKA 5EAJA 3SAIA 3JVXA 4XECX 3NXYA 1DYJA 1KLKA 4ELHA 2P4GA 4XRBA 1RX2A 3QLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NX6 A;  1RX1 A;  3K74 A;  2L28 A;  3S3V A;  3S9U A;  2W9G A;  1OHJ A;  4XE6 X;  3JWC A;  1AOE A;  1LUD A;  3JWK A;  3FRB X;  5HPB A;  4XT8 A;  3GYF A;  3QYL A;  1RX8 A;  1DR5 A;  1ZDR A;  1RX9 A;  1DHJ A;  4P66 A;  3FQV A;  4X5I A;  1DG8 A;  4ELE A;  4RGC A;  3NZ9 X;  1DRH A;  1TDR A;  4PSY A;  5HQY A;  1DR4 A;  3E0B A;  1M7A A;  1OHK A;  3SR5 X;  4KJK A;  3FQO A;  3HJ3 A;  2QK8 A;  5HSR A;  4XT7 A;  3GHC A;  2D0K A;  3KY8 A;  1KMV A;  3CLB A;  3SRS X;  3NTZ A;  4PSS A;  1RB2 A;  4KY8 A;  5CCC A;  1DAJ A;  4KLX A;  5HF0 X;  5ECX A;  3K45 A;  1HFQ A;  4H97 A;  5DXV A;  3DL5 A;  3JW5 A;  3FS6 A;  3TQ8 A;  3NZC X;  3QLS A;  1DRE A;  1S3W A;  4GH8 A;  1BZF A;  1DIS A;  3JW3 A;  3EX8 A;  1DF7 A;  4KAK A;  5HSU A;  3UM6 A;  3FY8 X;  3CD2 A;  3DAT A;  4G3M A;  2H2Q A;  1JUV A;  2W3W A;  4OR7 A;  4ELF A;  4QHV A;  2W3M A;  1LY3 A;  2W9S A;  4HOF A;  1S3Y A;  3F8Z A;  1DR2 A;  3FL9 A;  1DLR A;  4IXG X;  6DFR A;  2OIP A;  1RE7 A;  4X5G A;  2BLB A;  3GHV A;  3SRQ X;  4QLF A;  4PTJ A;  1QZF A;  2INQ A;  4PTH A;  3TD8 A;  5JA3 A;  1KMS A;  4LAH X;  2ITH A;  3NZD A;  3QFX A;  4Q0E A;  1MVT A;  1RD7 A;  5CC9 A;  3ROA A;  3LG4 A;  2CIG A;  2LF1 A;  3D80 A;  3FY9 X;  3NZB X;  3IRO A;  4OSG A;  5HF2 X;  3QLR A;  4M6L A;  1DR7 A;  1S3U A;  4I13 A;  1DDR A;  4LAG X;  2W3A A;  3F0Q X;  3JWF A;  3JWM A;  4KM2 A;  1RA8 A;  2W9T A;  4Q6A A;  1LY4 A;  5HT4 A;  4IXF X;  3TQA A;  2BLA A;  2AZN A;  3FRD X;  1JOM A;  3NZA X;  3EEL A;  3QL0 A;  1DRB A;  3L3R A;  1YHO A;  2C2T A;  2FZH A;  3UM8 A;  4KM0 A;  3FYW X;  1CZ3 A;  1DR3 A;  1VDR A;  3FQZ A;  2FZI A;  3SGY A;  2JYB A;  2CD2 A;  3SA1 A;  1RA1 A;  4FGG A;  2DHF A;  4HOE A;  4G95 A;  3KGY A;  3FQF A;  1U70 A;  1D1G A;  4KY4 A;  1MVS A;  5U27 A;  2XW7 A;  4DPD A;  3FQC A;  4DP3 A;  2BL9 A;  3QG2 A;  1AO8 A;  4LEK X;  1E26 A;  1M78 A;  4EJ1 A;  3SRR X;  3QLW A;  1RA9 A;  3JTW A;  4H95 A;  3DRC A;  5HI6 A;  4HA7 A;  1HFR A;  1DRF A;  1RX3 A;  3IX9 A;  4NX7 A;  4CD2 A;  1DYI A;  2ANQ A;  3S7A A;  3F0B X;  4XT4 A;  3DAU A;  3IRM A;  4QI9 A;  1DG5 A;  4QLE A;  4X5F A;  4X5J A;  4KJL A;  4P3Q A;  5HVB A;  3FRF X;  4HOG A;  1PDB A;  4DFR A;  3F0V X;  1DLS A;  2G6V A;  3Q1H A;  3NRR A;  1RA3 A;  4XT6 A;  2O7P A;  3EIG A;  2W3V A;  3NXV A;  3F0S X;  1IA4 A;  5DFR A;  2HXV A;  2HM9 A;  3FYV X;  3SQY X;  3EEJ A;  4M7V A;  3QLY A;  1RX7 A;  2DRC A;  2W3B A;  1PD8 A;  4EIZ A;  3GHW A;  4KFJ A;  1J3K A;  3NXR A;  4DDR A;  4DPH A;  3NZ6 X;  4QJZ D;  2GD9 A;  1U71 A;  3EEK A;  3F8Y A;  3NU0 A;  3SA2 A;  2C2S A;  1RB3 A;  3INV A;  4M2X A;  3SRW X;  5U26 A;  3RG9 A;  1S3V A;  3KJR A;  4KL9 A;  4I1N A;  1IA1 A;  4M6K A;  3TQB A;  4P3R A;  1RX6 A;  1IA3 A;  4QLG A;  1VJ3 A;  1J3I A;  1J3J A;  1AI9 A;  4Q0D A;  3JSU A;  3M08 A;  1CD2 A;  3DL6 A;  3DFR A;  3EEM A;  1IA2 A;  4X5H A;  3CL9 A;  1DR1 A;  1RH3 A;  3ZPC A;  5HT5 A;  4KNE A;  3KJS A;  5HVE A;  4IXE D;  4ELB A;  3I3R A;  3FRA X;  3FRE X;  4TU5 X;  3K2H A;  1DYR A;  3HBB A;  3I8A X;  3IRN A;  3TQ9 A;  5E8Q A;  4ECK A;  3IA5 A;  1JOL A;  2W9H A;  3R33 A;  3IA4 A;  3QYO A;  1BOZ A;  3NXT A;  2ANO A;  2HQP A;  3OCH A;  3SH2 A;  1DHF A;  3N0H A;  4PDJ A;  4FGH A;  4PST A;  3F0X X;  1RA2 A;  1HFP A;  1DYH A;  4M7U A;  4P68 A;  3QGT A;  2B3Z A;  3F0U X;  4KYA A;  5HQZ A;  3F91 A;  1DRA A;  5ECC A;  1DHI A;  3CSE A;  2D5N A;  1RX5 A;  2ZZA A;  1SEJ A;  3D84 X;  3NXX A;  3K47 A;  1RC4 A;  1DR6 A;  3KFY A;  2OBC A;  3ZPG A;  3OAF A;  1DIU A;  3UM5 A;  1DG7 A;  1U72 A;  3RO9 A;  3DGA A;  1DDS A;  1M79 A;  4KEB A;  3NXO A;  4H96 A;  1RG7 A;  3FQ0 A;  3M09 A;  3VCO A;  4H98 A;  4HA9 A;  5JG0 X;  3GI2 A;  4LAE X;  3FL8 A;  1RX4 A;  3QLX A;  4QJC A;  3QL3 A;  2BLC A;  1PD9 A;  3DG8 A;  8DFR A;  4ELG A;  4KD7 A;  4EIL A;  2FZJ A;  4FHB A;  7DFR A;  3SRU X;  4KBN A;  1RF7 A;  4KJJ A;  4G8Z X;  4XT5 A;  5HUI A;  4EIG A;  5FDA A;  4M6J A;  4Q67 A;  2KGK A;  5EAJ A;  3SAI A;  3JVX A;  4XEC X;  3NXY A;  1DYJ A;  1KLK A;  4ELH A;  2P4G A;  4XRB A;  1RX2 A;  3QLZ A; 
#chains in the Genus database with same CATH topology
 4NX6 A;  1RX1 A;  3K74 A;  2L28 A;  3S3V A;  3S9U A;  2W9G A;  1OHJ A;  4XE6 X;  3JWC A;  1AOE A;  1LUD A;  3JWK A;  3FRB X;  5HPB A;  4XT8 A;  3GYF A;  3QYL A;  1RX8 A;  1DR5 A;  1ZDR A;  1RX9 A;  1DHJ A;  4P66 A;  3FQV A;  4X5I A;  1DG8 A;  4ELE A;  4RGC A;  3NZ9 X;  1DRH A;  1TDR A;  4PSY A;  5HQY A;  1DR4 A;  3E0B A;  1M7A A;  1OHK A;  3SR5 X;  4KJK A;  3FQO A;  3HJ3 A;  2QK8 A;  5HSR A;  4XT7 A;  3GHC A;  2D0K A;  3KY8 A;  1KMV A;  3CLB A;  3SRS X;  3NTZ A;  4PSS A;  1RB2 A;  4KY8 A;  5CCC A;  1DAJ A;  4KLX A;  5HF0 X;  5ECX A;  3K45 A;  1HFQ A;  4H97 A;  5DXV A;  3DL5 A;  3JW5 A;  3FS6 A;  3TQ8 A;  3NZC X;  3QLS A;  1DRE A;  1S3W A;  4GH8 A;  1BZF A;  1DIS A;  3JW3 A;  3EX8 A;  1DF7 A;  4KAK A;  5HSU A;  3UM6 A;  3FY8 X;  3CD2 A;  3DAT A;  4G3M A;  2H2Q A;  1JUV A;  2W3W A;  4OR7 A;  4ELF A;  4QHV A;  2W3M A;  1LY3 A;  2W9S A;  4HOF A;  1S3Y A;  3F8Z A;  1DR2 A;  3FL9 A;  1DLR A;  4IXG X;  6DFR A;  2OIP A;  1RE7 A;  4X5G A;  2BLB A;  3GHV A;  3SRQ X;  4QLF A;  4PTJ A;  1QZF A;  2INQ A;  4PTH A;  3TD8 A;  5JA3 A;  1KMS A;  4LAH X;  2ITH A;  3NZD A;  3QFX A;  4Q0E A;  1MVT A;  1RD7 A;  5CC9 A;  3ROA A;  3LG4 A;  2CIG A;  2LF1 A;  3D80 A;  3FY9 X;  3NZB X;  3IRO A;  4OSG A;  5HF2 X;  3QLR A;  4M6L A;  1DR7 A;  1S3U A;  4I13 A;  1DDR A;  4LAG X;  2W3A A;  3F0Q X;  3JWF A;  3JWM A;  4KM2 A;  1RA8 A;  2W9T A;  4Q6A A;  1LY4 A;  5HT4 A;  4IXF X;  3TQA A;  2BLA A;  2AZN A;  3FRD X;  1JOM A;  3NZA X;  3EEL A;  3QL0 A;  1DRB A;  3L3R A;  1YHO A;  2C2T A;  2FZH A;  3UM8 A;  4KM0 A;  3FYW X;  1CZ3 A;  1DR3 A;  1VDR A;  3FQZ A;  2FZI A;  3SGY A;  2JYB A;  2CD2 A;  3SA1 A;  1RA1 A;  4FGG A;  2DHF A;  4HOE A;  4G95 A;  3KGY A;  3FQF A;  1U70 A;  1D1G A;  4KY4 A;  1MVS A;  5U27 A;  2XW7 A;  4DPD A;  3FQC A;  4DP3 A;  2BL9 A;  3QG2 A;  1AO8 A;  4LEK X;  1E26 A;  1M78 A;  4EJ1 A;  3SRR X;  3QLW A;  1RA9 A;  3JTW A;  4H95 A;  3DRC A;  5HI6 A;  4HA7 A;  1HFR A;  1DRF A;  1RX3 A;  3IX9 A;  4NX7 A;  4CD2 A;  1DYI A;  2ANQ A;  3S7A A;  3F0B X;  4XT4 A;  3DAU A;  3IRM A;  4QI9 A;  1DG5 A;  4QLE A;  4X5F A;  4X5J A;  4KJL A;  4P3Q A;  5HVB A;  3FRF X;  4HOG A;  1PDB A;  4DFR A;  3F0V X;  1DLS A;  2G6V A;  3Q1H A;  3NRR A;  1RA3 A;  4XT6 A;  2O7P A;  3EIG A;  2W3V A;  3NXV A;  3F0S X;  1IA4 A;  5DFR A;  2HXV A;  2HM9 A;  3FYV X;  3SQY X;  3EEJ A;  4M7V A;  3QLY A;  1RX7 A;  2DRC A;  2W3B A;  1PD8 A;  4EIZ A;  3GHW A;  4KFJ A;  1J3K A;  3NXR A;  4DDR A;  4DPH A;  3NZ6 X;  4QJZ D;  2GD9 A;  1U71 A;  3EEK A;  3F8Y A;  3NU0 A;  3SA2 A;  2C2S A;  1RB3 A;  3INV A;  4M2X A;  3SRW X;  5U26 A;  3RG9 A;  1S3V A;  3KJR A;  4KL9 A;  4I1N A;  1IA1 A;  4M6K A;  3TQB A;  4P3R A;  1RX6 A;  1IA3 A;  4QLG A;  1VJ3 A;  1J3I A;  1J3J A;  1AI9 A;  4Q0D A;  3JSU A;  3M08 A;  1CD2 A;  3DL6 A;  3DFR A;  3EEM A;  1IA2 A;  4X5H A;  3CL9 A;  1DR1 A;  1RH3 A;  3ZPC A;  5HT5 A;  4KNE A;  3KJS A;  5HVE A;  4IXE D;  4ELB A;  3I3R A;  3FRA X;  3FRE X;  4TU5 X;  3K2H A;  1DYR A;  3HBB A;  3I8A X;  3IRN A;  3TQ9 A;  5E8Q A;  4ECK A;  3IA5 A;  1JOL A;  2W9H A;  3R33 A;  3IA4 A;  3QYO A;  1BOZ A;  3NXT A;  2ANO A;  2HQP A;  3OCH A;  3SH2 A;  1DHF A;  3N0H A;  4PDJ A;  4FGH A;  4PST A;  3F0X X;  1RA2 A;  1HFP A;  1DYH A;  4M7U A;  4P68 A;  3QGT A;  2B3Z A;  3F0U X;  4KYA A;  5HQZ A;  3F91 A;  1DRA A;  5ECC A;  1DHI A;  3CSE A;  2D5N A;  1RX5 A;  2ZZA A;  1SEJ A;  3D84 X;  3NXX A;  3K47 A;  1RC4 A;  1DR6 A;  3KFY A;  2OBC A;  3ZPG A;  3OAF A;  1DIU A;  3UM5 A;  1DG7 A;  1U72 A;  3RO9 A;  3DGA A;  1DDS A;  1M79 A;  4KEB A;  3NXO A;  4H96 A;  1RG7 A;  3FQ0 A;  3M09 A;  3VCO A;  4H98 A;  4HA9 A;  5JG0 X;  3GI2 A;  4LAE X;  3FL8 A;  1RX4 A;  3QLX A;  4QJC A;  3QL3 A;  2BLC A;  1PD9 A;  3DG8 A;  8DFR A;  4ELG A;  4KD7 A;  4EIL A;  2FZJ A;  4FHB A;  7DFR A;  3SRU X;  4KBN A;  1RF7 A;  4KJJ A;  4G8Z X;  4XT5 A;  5HUI A;  4EIG A;  5FDA A;  4M6J A;  4Q67 A;  2KGK A;  5EAJ A;  3SAI A;  3JVX A;  4XEC X;  3NXY A;  1DYJ A;  1KLK A;  4ELH A;  2P4G A;  4XRB A;  1RX2 A;  3QLZ A; 
#chains in the Genus database with same CATH homology
 4NX6 A;  1RX1 A;  3K74 A;  2L28 A;  3S3V A;  3S9U A;  2W9G A;  1OHJ A;  4XE6 X;  3JWC A;  1AOE A;  1LUD A;  3JWK A;  3FRB X;  5HPB A;  4XT8 A;  3GYF A;  3QYL A;  1RX8 A;  1DR5 A;  1ZDR A;  1RX9 A;  1DHJ A;  4P66 A;  3FQV A;  4X5I A;  1DG8 A;  4ELE A;  4RGC A;  3NZ9 X;  1DRH A;  1TDR A;  4PSY A;  5HQY A;  1DR4 A;  3E0B A;  1M7A A;  1OHK A;  3SR5 X;  4KJK A;  3FQO A;  3HJ3 A;  2QK8 A;  5HSR A;  4XT7 A;  3GHC A;  2D0K A;  3KY8 A;  1KMV A;  3CLB A;  3SRS X;  3NTZ A;  4PSS A;  1RB2 A;  4KY8 A;  5CCC A;  1DAJ A;  4KLX A;  5HF0 X;  5ECX A;  3K45 A;  1HFQ A;  4H97 A;  5DXV A;  3DL5 A;  3JW5 A;  3FS6 A;  3TQ8 A;  3NZC X;  3QLS A;  1DRE A;  1S3W A;  4GH8 A;  1BZF A;  1DIS A;  3JW3 A;  3EX8 A;  1DF7 A;  4KAK A;  5HSU A;  3UM6 A;  3FY8 X;  3CD2 A;  3DAT A;  4G3M A;  2H2Q A;  1JUV A;  2W3W A;  4OR7 A;  4ELF A;  4QHV A;  2W3M A;  1LY3 A;  2W9S A;  4HOF A;  1S3Y A;  3F8Z A;  1DR2 A;  3FL9 A;  1DLR A;  4IXG X;  6DFR A;  2OIP A;  1RE7 A;  4X5G A;  2BLB A;  3GHV A;  3SRQ X;  4QLF A;  4PTJ A;  1QZF A;  2INQ A;  4PTH A;  3TD8 A;  5JA3 A;  1KMS A;  4LAH X;  2ITH A;  3NZD A;  3QFX A;  4Q0E A;  1MVT A;  1RD7 A;  5CC9 A;  3ROA A;  3LG4 A;  2CIG A;  2LF1 A;  3D80 A;  3FY9 X;  3NZB X;  3IRO A;  4OSG A;  5HF2 X;  3QLR A;  4M6L A;  1DR7 A;  1S3U A;  4I13 A;  1DDR A;  4LAG X;  2W3A A;  3F0Q X;  3JWF A;  3JWM A;  4KM2 A;  1RA8 A;  2W9T A;  4Q6A A;  1LY4 A;  5HT4 A;  4IXF X;  3TQA A;  2BLA A;  2AZN A;  3FRD X;  1JOM A;  3NZA X;  3EEL A;  3QL0 A;  1DRB A;  3L3R A;  1YHO A;  2C2T A;  2FZH A;  3UM8 A;  4KM0 A;  3FYW X;  1CZ3 A;  1DR3 A;  1VDR A;  3FQZ A;  2FZI A;  3SGY A;  2JYB A;  2CD2 A;  3SA1 A;  1RA1 A;  4FGG A;  2DHF A;  4HOE A;  4G95 A;  3KGY A;  3FQF A;  1U70 A;  1D1G A;  4KY4 A;  1MVS A;  5U27 A;  2XW7 A;  4DPD A;  3FQC A;  4DP3 A;  2BL9 A;  3QG2 A;  1AO8 A;  4LEK X;  1E26 A;  1M78 A;  4EJ1 A;  3SRR X;  3QLW A;  1RA9 A;  3JTW A;  4H95 A;  3DRC A;  5HI6 A;  4HA7 A;  1HFR A;  1DRF A;  1RX3 A;  3IX9 A;  4NX7 A;  4CD2 A;  1DYI A;  2ANQ A;  3S7A A;  3F0B X;  4XT4 A;  3DAU A;  3IRM A;  4QI9 A;  1DG5 A;  4QLE A;  4X5F A;  4X5J A;  4KJL A;  4P3Q A;  5HVB A;  3FRF X;  4HOG A;  1PDB A;  4DFR A;  3F0V X;  1DLS A;  2G6V A;  3Q1H A;  3NRR A;  1RA3 A;  4XT6 A;  2O7P A;  3EIG A;  2W3V A;  3NXV A;  3F0S X;  1IA4 A;  5DFR A;  2HXV A;  2HM9 A;  3FYV X;  3SQY X;  3EEJ A;  4M7V A;  3QLY A;  1RX7 A;  2DRC A;  2W3B A;  1PD8 A;  4EIZ A;  3GHW A;  4KFJ A;  1J3K A;  3NXR A;  4DDR A;  4DPH A;  3NZ6 X;  4QJZ D;  2GD9 A;  1U71 A;  3EEK A;  3F8Y A;  3NU0 A;  3SA2 A;  2C2S A;  1RB3 A;  3INV A;  4M2X A;  3SRW X;  5U26 A;  3RG9 A;  1S3V A;  3KJR A;  4KL9 A;  4I1N A;  1IA1 A;  4M6K A;  3TQB A;  4P3R A;  1RX6 A;  1IA3 A;  4QLG A;  1VJ3 A;  1J3I A;  1J3J A;  1AI9 A;  4Q0D A;  3JSU A;  3M08 A;  1CD2 A;  3DL6 A;  3DFR A;  3EEM A;  1IA2 A;  4X5H A;  3CL9 A;  1DR1 A;  1RH3 A;  3ZPC A;  5HT5 A;  4KNE A;  3KJS A;  5HVE A;  4IXE D;  4ELB A;  3I3R A;  3FRA X;  3FRE X;  4TU5 X;  3K2H A;  1DYR A;  3HBB A;  3I8A X;  3IRN A;  3TQ9 A;  5E8Q A;  4ECK A;  3IA5 A;  1JOL A;  2W9H A;  3R33 A;  3IA4 A;  3QYO A;  1BOZ A;  3NXT A;  2ANO A;  2HQP A;  3OCH A;  3SH2 A;  1DHF A;  3N0H A;  4PDJ A;  4FGH A;  4PST A;  3F0X X;  1RA2 A;  1HFP A;  1DYH A;  4M7U A;  4P68 A;  3QGT A;  2B3Z A;  3F0U X;  4KYA A;  5HQZ A;  3F91 A;  1DRA A;  5ECC A;  1DHI A;  3CSE A;  2D5N A;  1RX5 A;  2ZZA A;  1SEJ A;  3D84 X;  3NXX A;  3K47 A;  1RC4 A;  1DR6 A;  3KFY A;  2OBC A;  3ZPG A;  3OAF A;  1DIU A;  3UM5 A;  1DG7 A;  1U72 A;  3RO9 A;  3DGA A;  1DDS A;  1M79 A;  4KEB A;  3NXO A;  4H96 A;  1RG7 A;  3FQ0 A;  3M09 A;  3VCO A;  4H98 A;  4HA9 A;  5JG0 X;  3GI2 A;  4LAE X;  3FL8 A;  1RX4 A;  3QLX A;  4QJC A;  3QL3 A;  2BLC A;  1PD9 A;  3DG8 A;  8DFR A;  4ELG A;  4KD7 A;  4EIL A;  2FZJ A;  4FHB A;  7DFR A;  3SRU X;  4KBN A;  1RF7 A;  4KJJ A;  4G8Z X;  4XT5 A;  5HUI A;  4EIG A;  5FDA A;  4M6J A;  4Q67 A;  2KGK A;  5EAJ A;  3SAI A;  3JVX A;  4XEC X;  3NXY A;  1DYJ A;  1KLK A;  4ELH A;  2P4G A;  4XRB A;  1RX2 A;  3QLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...