3FRKA

X-ray structure of qdtb from t. thermosaccharolyticum in complex with a plp:tdp-3-aminoquinovose aldimine
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
365
structure length
365
Chain Sequence
MKISFASFKPMHDEIEYEIKFKFEEIYKRNWFILGDEDKKFEQEFADYCNVNYCIGCGNGLDALHLILKGYDIGFGDEVIVPSNTFIATALAVSYTGAKPIFVEPDIRTYNIDPSLIESAITEKTKAIIAVHLYGQPADMDEIKRIAKKYNLKLIEDAAQAHGSLYKGMKVGSLGDAAGFSFYPAKNLGSLGDGGAVVTNDKDLAEKIKALSNYGSEKKYHHIYKGFNSRLDELQAGFLRVKLKYLDKWNEERRKIAQKYIAGINNPNVIIPVEADYAKHVWYTFVIRSEKRDELQKYLNNNGIGTLIHYPIPIHLQQAYKDLGFKTGNFPIAEKIANEILSIPIWYGMKNEEIEYVIDKINAWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords QdtB
publication title Structural analysis of QdtB, an aminotransferase required for the biosynthesis of dTDP-3-acetamido-3,6-dideoxy-alpha-D-glucose.
pubmed doi rcsb
source organism Thermoanaerobacterium thermosaccharolyticum
molecule tags Transferase
total genus 137
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01041 DegT_DnrJ_EryC1 DegT/DnrJ/EryC1/StrS aminotransferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3frkA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3frkA02
4UQVA 2O1BA 1J32A 1W7LA 3FZ6A 3ZZJA 5EIGB 1IX7A 4W91A 2ORDA 3MAFA 1TPLA 1C7OA 1EQBA 2VYCA 3II0A 3PPLA 1MDXA 2W8TA 3FQ8A 2W8WA 3CQ6A 1VEFA 4ATQA 1CQ7A 1LW4A 1AHGA 1UU1A 1W7MA 1UU0A 4ZWMA 1CS1A 1IVRA 7AATA 1WSTA 3MC6A 1I41A 1CL1A 1JF9A 1QGNA 4IW7A 1B8GA 4F4EA 3E9KA 1LKCA 4TN4A 2VMVA 3EZ1A 1Y4IA 2EPJA 2GSAA 3ATHA 1AKBA 2VMTA 2BI5A 1OHVA 3L8AA 1TOJA 1TOKA 1IX6A 3NNKA 4IYOA 1DJEA 1RV3A 4R5ZA 1WYVB 4JF0A 3MC6C 1V72A 2Z1ZA 3VP6A 2FQ6A 1BJOB 4ZSYA 2HUUA 3AEMA 4AO9A 1XEYA 5I92A 3A9YA 2AY9A 1DJ9A 1JG8A 3BWNC 2X5DA 3DZZA 2AY1A 3E2ZB 4KXKA 3T32A 1YJSA 3FTBA 3UWCA 1SZKA 3I16A 4PFFA 1ASMA 3B1EA 3ECDA 2W7KA 3FDBA 2EZ1A 1AY8A 3M5UA 3NYSA 4MSOA 1KKJA 1ASAA 1IBJA 4MQRA 4W5KA 1ELQA 3FRKA 4WXBA 4WYEA 2ZY5A 1G7WA 2VLHA 1AICA 1TOGA 5EIGA 4RM1A 2Z1YA 3AENB 1VJOA 3JWBA 3PIUA 1ASFA 3AELA 3DR7A 3FVSA 4H51A 1GD9A 4W1VA 2BI3A 2VMSA 3USFA 3FVUA 4B9BA 4UOYA 1D2FA 4MY5A 3FDDA 4E3QA 2VMWA 3AEPA 3VOMA 1LC5A 2ZP7A 2JJHA 4M2MA 1CL2A 4PIWA 1AKCA 1AHEA 4ZLVA 1AY5A 2OGEA 1ASDA 1M7YA 1WYVA 2VMUA 4RKDA 1PMMA 3R9AA 2VMYA 2XH1A 2PO3A 3AEJA 1BKGA 2CTZA 3GBXA 3B8XA 3UE8A 1BJOA 4P7YA 3PDXA 3QI6A 3DYDA 5EFSA 2VIBA 2E7IA 2YCNA 2JISA 2Z9UA 3RBLA 1QJ5A 1Z7DA 3BN1A 3E2ZA 4JE5D 1O4SA 2W8JA 2GB3A 3CQ5A 3G7QA 4O6ZA 4RJ0A 4UHMA 1OXOA 5D5SA 4PFNA 2VMQA 3QM2A 1AHYA 1MLYA 3FD0A 4I8AA 3AENA 1O69A 3B1DA 1LK9A 2ZSMA 1AMRA 4GSAA 4BMKA 3PGYA 1PG8A 3GR9A 2BIGA 2D7YA 1FG3A 2AY2A 4LW4A 4EB7A 1H0CA 2ZUKA 1EG5A 4U1TA 2E7JA 2WK8A 1XI9A 4KAMA 3BCBA 1DTYA 2CJHA 4Y0IA 5TF5A 4F5JA 1S08A 2W7HA 8AATA 4MGRA 4ZDOA 2BYLA 1AJRA 1C7GA 2FN6A 1ASBA 1O62A 2AY8A 1N8PA 2VMZA 2DGMA 2W7FA 3FZ8A 2EGYA 1AMQA 1D7SA 1WKHA 3WCOA 1PMOA 1WYTB 5K8BA 3EUCA 2AY3A 5M4BA 1GEWA 1CZCA 1SVVA 3WKSA 3BCAA 3GJUA 1AJSB 1LW5A 1S0AA 2CY8A 3QPGA 4ZWVA 1N2TA 1IAXA 3G8MA 3L44A 3AOWA 1DJUA 1UKJA 3CAIA 3F9TA 3GZCA 4WP0A 3ELEA 1ASLA 3HBXA 4GRXA 4JE5A 4RJYA 1IUGA 1YJYA 1YNUA 2NMPA 3RUYA 1ELUA 3KE3A 3A8UX 4EMYA 1W3UA 4EU1A 3QN6A 3D6KA 2JJEA 3NX3A 3WCNA 2Z61A 2BWOA 4JEWA 2QMAA 4JEXA 2AY4A 1BS0A 1S09A 4CXRA 4CVQA 1J04A 3DC1A 2ZJGA 3FSLA 3NUBA 4L0OA 4QGRA 2VGWA 4WB0B 3GZDC 2DGKA 4ITGA 4J5UA 3AV7A 3VK2A 2OATA 2Q7WA 2X8UA 4IXZA 2HUIA 5EAVA 3ZZKA 2YKUA 1DKAA 3BWNA 3PAAA 4JEYA 1QITA 1AKAA 1QIRA 1O61A 2D66A 1GCKA 2FM1A 1KKPA 3G0TA 4M2JA 4UHOA 5DJ9A 3WGBA 1C9CA 2V1PA 1WYTA 1QJ3A 2OKKA 4LW2A 3FKDA 4RAEA 3MAUA 1AJSA 2AEUA 1CQ6A 2YCPA 1ASGA 3N75A 3DXVA 2FNUA 3TFUA 3E6GA 1B9HA 1S07A 4WYFA 1BJ4A 1C4KA 1KMKA 1BQDA 2W7JA 4WYAA 4AZJA 2ZY2A 1D7VA 4IX8A 3TATA 2C44A 3RQ1A 3NU7A 4ADCA 3JWAA 4M2KA 2VIAA 1BW0A 1LC8A 5E5IA 2Z9WA 2AY5A 1GEYA 4GDYA 2FNIA 3LVMA 1MAPA 2BHXA 2O7CA 3F0HA 4WYGA 2QA3A 3IHJA 4RLGA 3DU4A 3TCMA 4AZKA 3WX9A 1D7RA 2W7DA 5EUDA 3EI6A 5BJ4A 3ACZA 4ZASA 4LNMA 1D7UA 2VMPA 3FQAA 4OYTA 4Q31A 4WB0A 4W8IA 3RI6A 3A9XA 1WKGA 4A0GA 1AHXA 3BS8A 3ELPA 2R5EA 4Q6RA 1W23A 2Z20A 4MKKA 2E7UA 3HLMA 3DR4A 3KGXA 1DGEA 4WXFA 1P3WA 4OTLA 1M0NA 1VP4A 1SF2A 4RIZA 4BA5A 4OCAA 4ZAHA 2HOZA 2W8VA 3BCXA 2BI9A 3AOVA 4ZM4A 1V2EA 2VGTA 4WLJA 4IY7A 3W1JA 5HHYA 1SZSA 3JW9A 4JEVA 3NTJA 2YKVA 3IF2A 4A6UA 3K28A 3HVYA 3BV0A 2PB2A 2HOXA 1BQAA 3DXWA 4WLHA 4ZDLA 1N31A 2Z9XA 2AATA 5DX5A 4K2BA 3VK4A 2VMOA 2CSTA 2YHKA 3NYUA 4K2MA 2CH1A 1H1CA 5G09A 1X2AA 3EZSA 1M0QA 2JJFA 4XJLA 1W7NA 5FT6A 2F8JA 4E3RA 4A0FA 4R8DA 2OGAA 5G2QA 4JF1A 1AIAA 1SZUA 2DKJA 3WLXA 3VK3A 2ZY3A 2DOUA 3QGUA 3WGCA 4RITA 2R0TA 4GE9A 1GBNA 2GMSA 5BJ3A 1UU2A 1X28A 9AATA 1I43A 3FFRA 1LC7A 3HT4A 3HQTA 2JGTA 4GE4A 1IX8A 2X3LA 2Z9VA 2BWPA 2R5CB 4ATPA 2ZY4A 2JJGA 4UHNA 4ITXA 2BIAA 2YCTA 4Q76A 1OHWA 2HP1A 3LVKA 1BT4A 4TV7A 1ECXA 3EI7A 4E1OA 1KL1A 1M0OA 1V2DA 2AY7A 2AY6A 3LVLB 3MBBA 2VGSA 3OP7A 3Q8NA 1YOOA 1MLZA 1AMAA 3ZRPA 1GC0A 3A2BA 3EI5A 4J8LA 4WBTA 4BHDA 2YKYA 5LH9A 3LV2A 2W7LA 5IWQA 2QB2A 1I29A 2VI8A 5G4JA 2Z67A 3GZDA 3AATA 4F5HA 3I5TA 1AMSA 2YOBA 4U2HA 3KGWA 4XK1A 1OHYA 2AEVA 2YRIA 3COGA 4ISYA 3WY7A 3NUIA 4Y0DA 5HDMA 2W7MA 3P6KA 4F5KA 1BJNA 1RV4A 1EJIA 3B1CA 1TOIA 1B5PA 3FZ7A 2EH6A 3R4TA 4CBRA 2YRRA 2O0RA 1C7NA 4B98A 4HF8A 4R2NA 5F8VA 1SFFA 3DRDA 1ARGA 2HORA 3NDNA 1GC4A 5DB5A 3K40A 3A9ZA 2D7ZA 3P1TA 1JS6A 4OT8A 1GC2A 2PB0A 5EAAA 1ZOBA 3ASAA 3HDOA 4F5MA 2R5CA 2QBTA 1S06A 2WK7A 3FQ7A 3NU8A 4BA4A 2W7IA 4EB5A 5FT4A 2HZPA 4W1XA 1ASEA 4DQ6A 2FYFA 1X29A 4ZM3A 1TOEA 1ASCA 1MDZA 2D65A 2CJDA 4XAUA 5JAYA 4MQPA 5HXXA 3BC8A 1ARIA 4A6TA 4A72A 2CANA 4DGTA 3FFHA 4F5IA 1OXPA 1YIYA 3PDBB 3FVXA 3LVJA 2W7GA 3JTXA 2TPLA 4DBCA 2BIEA 2GMUA 1G7XA 5E4ZA 4WYDA 5J8QA 1ORDA 4A0RA 3DODA 3TQXA 1YJZA 4XQ2A 5EQCA 1KMJA 3H14A 5M46A 3ASBA 1QZ9A 2V0YA 3FCRA 4LNLA 4MQQA 4OBUA 3NYTA 4CXQA 2YKXA 4WD2A 1ASNA 2RFVA 2CB1A 1AHFA 4ADEA 2CINA 2DR1A 1C0NA 1AX4A 5G4IA 4BQ0A 2VGVA 2D63A 2HUFA 3BB8A 1KL2A 3K7YA 3LY1A 3W1IA 4IXSA 3EI8A 1RVUA 2C0RA 3I4JA 2DKBA 4OBVA 3RCHB 3PD6B 2W7EA 3GETA 3GSBA 3H7FA 2EZ2A 3KKIA 3MADA 3QBOA 3QHXA 3HMUA 5E3KA 4KYOA 2QB3A 3EI9A 1TARA 4RKCA 5C6UA 1B9IA 1E5FA 2VGUA 4XJPA 4EFFA 4AH3A 4A0HA 1M4NA 1GDEA 3AEMC 3AEOA 3PJ0A 2WKAA 3LWSA 2BYJA 1I48A 4XJOA 3MEBA 1DGDA 5F9SA 4E77A 1BJWA 1AIBA 1G4XA 2D61A 3EIBA 1IJIA 5EUNA 2ZSLA 4FFCA 1WYUB 2BI1A 4FL0A 5G0AA 4ADDA 3N0LA 3PDBA 4N0WA 2WK9A 1SPAA 4F5LA 2QLRA 4Q75A 1RVYA 2VLFA 4PVFA 2ZYJA 3LG0A 1AAWA 4LNJA 2BI2A 4ZSWA 1MGVA 3E2FA 3WZFA 3NRAA 1LS3A 3PA9A 2W8UA 2ZC0A 3WKRA 5AX8A 3CBFA 5G2PA 1MAQA 3JU7A 1V2FA 2C81A 2JG2A 3OKSA 1E5EA 3E77A 4HVKA 5M49A 3MAFB 3RCHA 3HL2A 4MKJA 1FC4A 1MDOA 1YAAA 3PD6A 4GEBA 3TFTA 2C7TA 2G6WA 2D5YA 3JZLA 4AOAA 3W1HA 1M32A 2E54A 3ZRRA 4IXOA 3UAKA 3AEJC 2HOYA 3MKJA 4A00A 1ARSA 5DJ1A 1GC3A 2CH2A 3B46A 1M6SA 2HP2A 2R2NA 3BWOA 3E2YA 3GWPA 4K2IA 1G4VA 4Y0HA 1ARTA 3VAXA 3ISLA 4F5GA 4CBSA 2D64A 2BWNA 5EUEA 2VI9A 4ADBA 1DFOA 1M0PA 4WXGA 2VMRA 4ZDPA 4OC9A 1YIZA 1U08A 2XBNA 1JS3A 3F6TA 1QISA 4AO4A 4IYOB 3RBFA 1FG7A 3N5MA 1WYUA 1ARHA 4F5FA 4TMRA 4JEZA 1Z3ZA 2GQNA 2OQXA 4XJMA 1AAMA 2BKWA 1IAYA 4GE7A 5D95A 2DGLA 1GEXA 1CJ0A 2VGZA 5M4DA 1X0MA 1ZC9A 4XEWA 4N0BA 1PFFA 1OATA 1T3IA 1B4XA 1TASA 1TATA 2EO5A 2CFBA 4OMAA 5FT8A 2VMXA 4A6RA 2OKJA 4P3MA 1CQ8A 4WYCA 4W1WA 3CQ4A 5LHAA 1B5OA 1ZODA 4LC3A 4NOGA 4R5FA 2CJGA 3ZRQA 1AY4A 5FT5A 2X5FA 2VMNA 3EIAA 1CZEA
chains in the Genus database with same CATH superfamily
4UQVA 2O1BA 1J32A 1W7LA 3FZ6A 3ZZJA 5EIGB 1IX7A 4W91A 2ORDA 3MAFA 1TPLA 1C7OA 1EQBA 2VYCA 3II0A 3PPLA 1MDXA 2W8TA 3FQ8A 2W8WA 3CQ6A 2FKIA 1VEFA 4ATQA 1CQ7A 1LW4A 1AHGA 1UU1A 1W7MA 1UU0A 4ZWMA 1CS1A 1IVRA 7AATA 1WSTA 3MC6A 3N4XA 1I41A 1CL1A 1JF9A 1QGNA 4IW7A 1B8GA 4F4EA 3E9KA 1LKCA 4TN4A 2VMVA 3EZ1A 1Y4IA 2EPJA 2GSAA 3ATHA 1AKBA 2VMTA 2BI5A 1OHVA 3L8AA 1TOJA 1TOKA 1IX6A 3NNKA 4IYOA 1DJEA 1RV3A 4R5ZA 1WYVB 4JF0A 2G7JA 3MC6C 1V72A 2Z1ZA 3VP6A 2FQ6A 1BJOB 4ZSYA 2HUUA 3AEMA 4AO9A 1XEYA 5I92A 3A9YA 2AY9A 1DJ9A 1JG8A 3BWNC 2X5DA 3DZZA 2AY1A 3E2ZB 4KXKA 3T32A 1YJSA 3FTBA 3UWCA 1SZKA 3I16A 4PFFA 1ASMA 3B1EA 3ECDA 2W7KA 3FDBA 2QSRA 2EZ1A 1AY8A 3M5UA 3NYSA 4MSOA 1KKJA 1ASAA 1IBJA 4MQRA 4W5KA 1ELQA 3FRKA 4WXBA 4WYEA 2ZY5A 1G7WA 2VLHA 1AICA 1TOGA 5EIGA 4RM1A 2Z1YA 3AENB 1VJOA 3JWBA 3PIUA 1ASFA 3AELA 3DR7A 3FVSA 4H51A 1GD9A 4W1VA 2BI3A 2VMSA 3USFA 3FVUA 4B9BA 4UOYA 1D2FA 4MY5A 3FDDA 4E3QA 2VMWA 3AEPA 3VOMA 1LC5A 2ZP7A 2JJHA 4M2MA 1CL2A 4PIWA 1AKCA 1AHEA 4ZLVA 1AY5A 2OGEA 1ASDA 1M7YA 1WYVA 2VMUA 4RKDA 1PMMA 3R9AA 2VMYA 2XH1A 2PO3A 3AEJA 1BKGA 2CTZA 3GBXA 3B8XA 3UE8A 1BJOA 4P7YA 3PDXA 3QI6A 3DYDA 5EFSA 2VIBA 2E7IA 2YCNA 2JISA 2Z9UA 3RBLA 1QJ5A 1Z7DA 3BN1A 3E2ZA 4JE5D 1O4SA 2W8JA 2GB3A 3CQ5A 3G7QA 4O6ZA 4RJ0A 4UHMA 2EYQA 1OXOA 5D5SA 2A1VA 4PFNA 2VMQA 3QM2A 1AHYA 1MLYA 3FD0A 4I8AA 3AENA 1O69A 3B1DA 1LK9A 2ZSMA 1AMRA 4GSAA 4BMKA 3PGYA 1PG8A 3GR9A 2BIGA 2D7YA 1FG3A 2AY2A 4LW4A 4EB7A 1H0CA 2ZUKA 1EG5A 4U1TA 2E7JA 2WK8A 1XI9A 4KAMA 3BCBA 1DTYA 2CJHA 4Y0IA 5TF5A 4F5JA 1S08A 2W7HA 8AATA 4MGRA 4ZDOA 2BYLA 1AJRA 1C7GA 2FN6A 1ASBA 1O62A 2AY8A 1N8PA 2VMZA 2DGMA 2W7FA 3FZ8A 3N7NA 2EGYA 1AMQA 1D7SA 1WKHA 3WCOA 4K05A 1PMOA 1WYTB 5K8BA 3EUCA 2AY3A 5M4BA 1GEWA 1CZCA 1SVVA 3WKSA 3BCAA 3GJUA 1AJSB 1LW5A 1S0AA 2CY8A 3QPGA 4ZWVA 1N2TA 1IAXA 3G8MA 3L44A 3AOWA 1DJUA 1UKJA 3CAIA 3F9TA 3GZCA 4WP0A 3ELEA 1ASLA 3HBXA 4GRXA 4JE5A 4RJYA 1IUGA 1YJYA 1YNUA 2NMPA 3RUYA 1ELUA 5KTBA 3KE3A 3A8UX 4EMYA 1W3UA 4EU1A 3QN6A 3D6KA 2JJEA 3NX3A 3WCNA 2Z61A 2BWOA 4JEWA 2QMAA 4JEXA 2AY4A 1BS0A 1S09A 4CXRA 4CVQA 1J04A 3DC1A 2ZJGA 3FSLA 3NUBA 4L0OA 4QGRA 2VGWA 4WB0B 3GZDC 2DGKA 3N4RA 4ITGA 4J5UA 3AV7A 3VK2A 2OATA 2Q7WA 2X8UA 4IXZA 2HUIA 5EAVA 3ZZKA 2YKUA 1DKAA 3BWNA 3PAAA 4JEYA 1QITA 1AKAA 1QIRA 1O61A 2D66A 1GCKA 2FM1A 1KKPA 3G0TA 4M2JA 4UHOA 5DJ9A 3WGBA 1C9CA 2V1PA 1WYTA 1QJ3A 2OKKA 4LW2A 3FKDA 4RAEA 3MAUA 1AJSA 2AEUA 1CQ6A 2YCPA 1ASGA 3N75A 3DXVA 2FNUA 3TFUA 3E6GA 1B9HA 1S07A 4WYFA 1BJ4A 1C4KA 1KMKA 1BQDA 2W7JA 4WYAA 4AZJA 2ZY2A 1D7VA 4IX8A 3TATA 2C44A 3RQ1A 3NU7A 4ADCA 3JWAA 4M2KA 2VIAA 1BW0A 1LC8A 5E5IA 2Z9WA 2AY5A 1GEYA 4GDYA 2FNIA 3LVMA 1MAPA 2BHXA 2O7CA 3F0HA 4WYGA 2QA3A 3IHJA 4RLGA 3DU4A 3TCMA 4AZKA 3WX9A 1D7RA 2W7DA 5EUDA 3EI6A 5BJ4A 3ACZA 4ZASA 4LNMA 1D7UA 2VMPA 3FQAA 4OYTA 4Q31A 4WB0A 4W8IA 3RI6A 3A9XA 1WKGA 4A0GA 1AHXA 3BS8A 3ELPA 2R5EA 4Q6RA 1W23A 2Z20A 4MKKA 2E7UA 3HLMA 3DR4A 3KGXA 1DGEA 4WXFA 1P3WA 4OTLA 1M0NA 1VP4A 1SF2A 4RIZA 4BA5A 4OCAA 4ZAHA 2HOZA 2W8VA 3BCXA 2BI9A 3AOVA 4ZM4A 1V2EA 4H63Q 2VGTA 4WLJA 4IY7A 3W1JA 5HHYA 1SZSA 3JW9A 4JEVA 3NTJA 2YKVA 3IF2A 4A6UA 3K28A 3HVYA 3BV0A 2PB2A 2HOXA 1BQAA 3DXWA 4WLHA 4ZDLA 1N31A 2Z9XA 2AATA 5DX5A 4K2BA 3VK4A 2VMOA 2CSTA 2YHKA 3NYUA 4K2MA 2CH1A 1H1CA 5G09A 1X2AA 3EZSA 1M0QA 2JJFA 4XJLA 1W7NA 5FT6A 2F8JA 4E3RA 4A0FA 1KAFA 4R8DA 2OGAA 5G2QA 4JF1A 1AIAA 1SZUA 2DKJA 3WLXA 3VK3A 2ZY3A 2DOUA 3QGUA 3WGCA 4RITA 2R0TA 4GE9A 1GBNA 2GMSA 5BJ3A 1UU2A 1X28A 9AATA 1I43A 3FFRA 1LC7A 3HT4A 3HQTA 2JGTA 4GE4A 1IX8A 2X3LA 2Z9VA 2BWPA 2R5CB 4ATPA 2ZY4A 2JJGA 4UHNA 4ITXA 2BIAA 2YCTA 4Q76A 1OHWA 2HP1A 3N4SA 3LVKA 1BT4A 4TV7A 1ECXA 3EI7A 4E1OA 1KL1A 1M0OA 1V2DA 2AY7A 2AY6A 3LVLB 3MBBA 2VGSA 3OP7A 3Q8NA 1YOOA 1MLZA 1AMAA 3ZRPA 1GC0A 3A2BA 3EI5A 4J8LA 4WBTA 4BHDA 2YKYA 5LH9A 3LV2A 2W7LA 5IWQA 2QB2A 1I29A 2VI8A 5G4JA 2Z67A 3GZDA 3AATA 4F5HA 3I5TA 1AMSA 2YOBA 4U2HA 3KGWA 4XK1A 1OHYA 2AEVA 2YRIA 3COGA 4ISYA 3WY7A 3NUIA 4Y0DA 5HDMA 2W7MA 3P6KA 4F5KA 1BJNA 1RV4A 1EJIA 3B1CA 1TOIA 1B5PA 3FZ7A 2EH6A 3R4TA 4CBRA 2YRRA 2O0RA 1C7NA 4B98A 4HF8A 4R2NA 5F8VA 1SFFA 3DRDA 1ARGA 2HORA 3NDNA 1GC4A 2WB6A 5DB5A 3K40A 3A9ZA 2D7ZA 3P1TA 1JS6A 4OT8A 1GC2A 2PB0A 5EAAA 1ZOBA 3ASAA 3HDOA 4F5MA 2R5CA 2QBTA 1S06A 2WK7A 3FQ7A 3NU8A 4BA4A 2W7IA 4EB5A 5FT4A 2HZPA 4W1XA 1ASEA 4DQ6A 2FYFA 1X29A 4ZM3A 1TOEA 1ASCA 1MDZA 2D65A 2CJDA 4XAUA 5JAYA 4MQPA 5HXXA 3BC8A 1ARIA 4A6TA 4A72A 2CANA 4DGTA 3FFHA 4F5IA 1OXPA 1YIYA 3PDBB 3FVXA 3LVJA 2W7GA 3JTXA 2TPLA 4DBCA 2BIEA 2GMUA 1G7XA 5E4ZA 4WYDA 5J8QA 1ORDA 4A0RA 3DODA 3TQXA 1YJZA 4XQ2A 5EQCA 1KMJA 3H14A 5M46A 3ASBA 1QZ9A 2V0YA 3FCRA 4LNLA 4MQQA 4OBUA 3NYTA 4CXQA 2YKXA 4WD2A 1ASNA 2RFVA 2CB1A 1AHFA 4ADEA 2CINA 2DR1A 1C0NA 1AX4A 5G4IA 4BQ0A 2VGVA 2D63A 2HUFA 3BB8A 1KL2A 3K7YA 3LY1A 3W1IA 4IXSA 3EI8A 1RVUA 2C0RA 3I4JA 2DKBA 4OBVA 3RCHB 3PD6B 2W7EA 3GETA 3GSBA 3H7FA 2EZ2A 3KKIA 3MADA 3QBOA 3QHXA 3HMUA 5E3KA 4KYOA 2QB3A 3EI9A 1TARA 4RKCA 5C6UA 1B9IA 1E5FA 2VGUA 4XJPA 4EFFA 4AH3A 4A0HA 3H9XA 1M4NA 2KFPA 1GDEA 3AEMC 3AEOA 3PJ0A 2WKAA 3LWSA 2BYJA 1I48A 4XJOA 3MEBA 1DGDA 5F9SA 4E77A 1BJWA 1AIBA 1G4XA 2D61A 3EIBA 1IJIA 5EUNA 2ZSLA 4FFCA 1WYUB 2BI1A 4FL0A 5G0AA 4ADDA 3N0LA 3PDBA 4N0WA 2WK9A 1SPAA 4F5LA 2QLRA 4Q75A 1RVYA 2VLFA 4PVFA 2ZYJA 3LG0A 1AAWA 4LNJA 2BI2A 4ZSWA 1MGVA 3E2FA 3WZFA 3NRAA 1LS3A 3PA9A 2W8UA 2ZC0A 3WKRA 5AX8A 3CBFA 5G2PA 1MAQA 3JU7A 1V2FA 2C81A 2JG2A 3OKSA 1E5EA 3E77A 4HVKA 5M49A 3MAFB 3RCHA 3HL2A 4MKJA 1FC4A 1MDOA 1YAAA 3PD6A 4GEBA 3TFTA 2C7TA 2G6WA 2D5YA 3JZLA 4AOAA 3W1HA 1M32A 2E54A 3ZRRA 4IXOA 3UAKA 3AEJC 2HOYA 3MKJA 4A00A 1ARSA 5DJ1A 1GC3A 2CH2A 3B46A 1M6SA 2HP2A 2R2NA 3BWOA 3E2YA 3GWPA 4K2IA 1G4VA 4Y0HA 1ARTA 3VAXA 3ISLA 4F5GA 4CBSA 2D64A 2BWNA 5EUEA 2VI9A 4ADBA 1DFOA 1M0PA 4WXGA 2VMRA 4ZDPA 4OC9A 1YIZA 1U08A 2XBNA 1JS3A 3F6TA 1QISA 4AO4A 4IYOB 3RBFA 1FG7A 3N5MA 1WYUA 1ARHA 4F5FA 4TMRA 4JEZA 1Z3ZA 2GQNA 2OQXA 4XJMA 1AAMA 2BKWA 1IAYA 4GE7A 5D95A 2DGLA 1GEXA 1CJ0A 2VGZA 5M4DA 1X0MA 1ZC9A 4XEWA 4N0BA 1PFFA 1OATA 1T3IA 1B4XA 1TASA 1TATA 2EO5A 2CFBA 4OMAA 5FT8A 2VMXA 4A6RA 2OKJA 4P3MA 1CQ8A 4WYCA 4W1WA 3CQ4A 5LHAA 1B5OA 1ZODA 4LC3A 4NOGA 4R5FA 2CJGA 3ZRQA 1AY4A 5FT5A 2X5FA 2VMNA 3EIAA 1CZEA
chains in the Genus database with same CATH topology
4UQVA 2O1BA 1J32A 1W7LA 3FZ6A 3ZZJA 5EIGB 1IX7A 4W91A 2ORDA 3MAFA 1TPLA 1C7OA 1EQBA 2VYCA 3II0A 3PPLA 1MDXA 2W8TA 3FQ8A 2W8WA 3CQ6A 2FKIA 1VEFA 4ATQA 1CQ7A 1LW4A 1AHGA 1UU1A 1W7MA 1UU0A 4ZWMA 1CS1A 1IVRA 7AATA 1WSTA 3MC6A 3N4XA 1I41A 1CL1A 1JF9A 1QGNA 4IW7A 1B8GA 4F4EA 3E9KA 1LKCA 4TN4A 2VMVA 3EZ1A 1Y4IA 2EPJA 2GSAA 3ATHA 1AKBA 2VMTA 2BI5A 1OHVA 3L8AA 1TOJA 1TOKA 1IX6A 3NNKA 4IYOA 1DJEA 1RV3A 4R5ZA 1WYVB 4JF0A 2G7JA 3MC6C 1V72A 2Z1ZA 3VP6A 2FQ6A 1BJOB 4ZSYA 2HUUA 3AEMA 4AO9A 1XEYA 5I92A 3A9YA 2AY9A 1DJ9A 1JG8A 3BWNC 2X5DA 3DZZA 2AY1A 3E2ZB 4KXKA 3T32A 1YJSA 3FTBA 3UWCA 1SZKA 3I16A 4PFFA 1ASMA 3B1EA 3ECDA 2W7KA 3FDBA 2QSRA 2EZ1A 1AY8A 3M5UA 3NYSA 4MSOA 1KKJA 1ASAA 1IBJA 4MQRA 4W5KA 1ELQA 3FRKA 4WXBA 4WYEA 2ZY5A 1G7WA 2VLHA 1AICA 1TOGA 5EIGA 4RM1A 2Z1YA 3AENB 1VJOA 3JWBA 3PIUA 1ASFA 3AELA 3DR7A 3FVSA 4H51A 1GD9A 4W1VA 2BI3A 2VMSA 3USFA 3FVUA 4B9BA 4UOYA 1D2FA 4MY5A 3FDDA 4E3QA 2VMWA 3AEPA 3VOMA 1LC5A 2ZP7A 2JJHA 4M2MA 1CL2A 4PIWA 1AKCA 1AHEA 4ZLVA 1AY5A 2OGEA 1ASDA 1M7YA 1WYVA 2VMUA 4RKDA 1PMMA 3R9AA 2VMYA 2XH1A 2PO3A 3AEJA 1BKGA 2CTZA 3GBXA 3B8XA 3UE8A 1BJOA 4P7YA 3PDXA 3QI6A 3DYDA 5EFSA 2VIBA 2E7IA 2YCNA 2JISA 2Z9UA 3RBLA 1QJ5A 1Z7DA 3BN1A 3E2ZA 4JE5D 1O4SA 2W8JA 2GB3A 3CQ5A 3G7QA 4O6ZA 4RJ0A 4UHMA 2EYQA 1OXOA 5D5SA 2A1VA 4PFNA 2VMQA 3QM2A 1AHYA 1MLYA 3FD0A 4I8AA 3AENA 1O69A 3B1DA 1LK9A 2ZSMA 1AMRA 4GSAA 4BMKA 3PGYA 1PG8A 3GR9A 2BIGA 2D7YA 1FG3A 2AY2A 4LW4A 4EB7A 1H0CA 2ZUKA 1EG5A 4U1TA 2E7JA 2WK8A 1XI9A 4KAMA 3BCBA 1DTYA 2CJHA 4Y0IA 5TF5A 4F5JA 1S08A 2W7HA 8AATA 4MGRA 4ZDOA 2BYLA 1AJRA 1C7GA 2FN6A 1ASBA 1O62A 2AY8A 1N8PA 2VMZA 2DGMA 2W7FA 3FZ8A 3N7NA 2EGYA 1AMQA 1D7SA 1WKHA 3WCOA 4K05A 1PMOA 1WYTB 5K8BA 3EUCA 2AY3A 5M4BA 1GEWA 1CZCA 1SVVA 3WKSA 3BCAA 3GJUA 1AJSB 1LW5A 1S0AA 2CY8A 3QPGA 4ZWVA 1N2TA 1IAXA 3G8MA 3L44A 3AOWA 1DJUA 1UKJA 3CAIA 3F9TA 3GZCA 4WP0A 3ELEA 1ASLA 3HBXA 4GRXA 4JE5A 4RJYA 1IUGA 1YJYA 1YNUA 2NMPA 3RUYA 1ELUA 5KTBA 3KE3A 3A8UX 4EMYA 1W3UA 4EU1A 3QN6A 3D6KA 2JJEA 3NX3A 3WCNA 2Z61A 2BWOA 4JEWA 2QMAA 4JEXA 2AY4A 1BS0A 1S09A 4CXRA 4CVQA 1J04A 3DC1A 2ZJGA 3FSLA 3NUBA 4L0OA 4QGRA 2VGWA 4WB0B 3GZDC 2DGKA 3N4RA 4ITGA 4J5UA 3AV7A 3VK2A 2OATA 2Q7WA 2X8UA 4IXZA 2HUIA 5EAVA 3ZZKA 2YKUA 1DKAA 3BWNA 3PAAA 4JEYA 1QITA 1AKAA 1QIRA 1O61A 2D66A 1GCKA 2FM1A 1KKPA 3G0TA 4M2JA 4UHOA 5DJ9A 3WGBA 1C9CA 2V1PA 1WYTA 1QJ3A 2OKKA 4LW2A 3FKDA 4RAEA 3MAUA 1AJSA 2AEUA 1CQ6A 2YCPA 1ASGA 3N75A 3DXVA 2FNUA 3TFUA 3E6GA 1B9HA 1S07A 4WYFA 1BJ4A 1C4KA 1KMKA 1BQDA 2W7JA 4WYAA 4AZJA 2ZY2A 1D7VA 4IX8A 3TATA 2C44A 3RQ1A 3NU7A 4ADCA 3JWAA 4M2KA 2VIAA 1BW0A 1LC8A 5E5IA 2Z9WA 2AY5A 1GEYA 4GDYA 2FNIA 3LVMA 1MAPA 2BHXA 2O7CA 3F0HA 4WYGA 2QA3A 3IHJA 4RLGA 3DU4A 3TCMA 4AZKA 3WX9A 1D7RA 2W7DA 5EUDA 3EI6A 5BJ4A 3ACZA 4ZASA 4LNMA 1D7UA 2VMPA 3FQAA 4OYTA 4Q31A 4WB0A 4W8IA 3RI6A 3A9XA 1WKGA 4A0GA 1AHXA 3BS8A 3ELPA 2R5EA 4Q6RA 1W23A 2Z20A 4MKKA 2E7UA 3HLMA 3DR4A 3KGXA 1DGEA 4WXFA 1P3WA 4OTLA 1M0NA 1VP4A 1SF2A 4RIZA 4BA5A 4OCAA 4ZAHA 2HOZA 2W8VA 3BCXA 2BI9A 3AOVA 4ZM4A 1V2EA 4H63Q 2VGTA 4WLJA 4IY7A 3W1JA 5HHYA 1SZSA 3JW9A 4JEVA 3NTJA 2YKVA 3IF2A 4A6UA 3K28A 3HVYA 3BV0A 2PB2A 2HOXA 1BQAA 3DXWA 4WLHA 4ZDLA 1N31A 2Z9XA 2AATA 5DX5A 4K2BA 3VK4A 2VMOA 2CSTA 2YHKA 3NYUA 4K2MA 2CH1A 1H1CA 5G09A 1X2AA 3EZSA 1M0QA 2JJFA 4XJLA 1W7NA 5FT6A 2F8JA 4E3RA 4A0FA 4R8DA 2OGAA 5G2QA 4JF1A 1AIAA 1SZUA 2DKJA 3WLXA 3VK3A 2ZY3A 2DOUA 3QGUA 3WGCA 4RITA 2R0TA 4GE9A 1GBNA 2GMSA 5BJ3A 1UU2A 1X28A 9AATA 1I43A 3FFRA 1LC7A 3HT4A 3HQTA 2JGTA 4GE4A 1IX8A 2X3LA 2Z9VA 2BWPA 2R5CB 4ATPA 2ZY4A 2JJGA 4UHNA 4ITXA 2BIAA 2YCTA 4Q76A 1OHWA 2HP1A 3N4SA 3LVKA 1BT4A 4TV7A 1ECXA 3EI7A 4E1OA 1KL1A 1M0OA 1V2DA 2AY7A 2AY6A 3LVLB 3MBBA 2VGSA 3OP7A 3Q8NA 1YOOA 1MLZA 1AMAA 3ZRPA 1GC0A 3A2BA 3EI5A 4J8LA 4WBTA 4BHDA 2YKYA 5LH9A 3LV2A 2W7LA 5IWQA 2QB2A 1I29A 2VI8A 5G4JA 2Z67A 3GZDA 3AATA 4F5HA 3I5TA 1AMSA 2YOBA 4U2HA 3KGWA 4XK1A 1OHYA 2AEVA 2YRIA 3COGA 4ISYA 3WY7A 3NUIA 4Y0DA 5HDMA 2W7MA 3P6KA 4F5KA 1BJNA 1RV4A 1EJIA 3B1CA 1TOIA 1B5PA 3FZ7A 2EH6A 3R4TA 4CBRA 2YRRA 2O0RA 1C7NA 4B98A 4HF8A 4R2NA 5F8VA 1SFFA 3DRDA 1ARGA 2HORA 3NDNA 1GC4A 2WB6A 5DB5A 3K40A 3A9ZA 2D7ZA 3P1TA 1JS6A 4OT8A 1GC2A 2PB0A 5EAAA 1ZOBA 3ASAA 3HDOA 4F5MA 2R5CA 2QBTA 1S06A 2WK7A 3FQ7A 3NU8A 4BA4A 2W7IA 4EB5A 5FT4A 2HZPA 4W1XA 1ASEA 4DQ6A 2FYFA 1X29A 4ZM3A 1TOEA 1ASCA 1MDZA 2D65A 2CJDA 4XAUA 5JAYA 4MQPA 5HXXA 3BC8A 1ARIA 4A6TA 4A72A 2CANA 4DGTA 3FFHA 4F5IA 1OXPA 1YIYA 3PDBB 3FVXA 3LVJA 2W7GA 3JTXA 2TPLA 4DBCA 2BIEA 2GMUA 1G7XA 5E4ZA 4WYDA 5J8QA 1ORDA 4A0RA 3DODA 3TQXA 1YJZA 4XQ2A 5EQCA 1KMJA 3H14A 5M46A 3ASBA 1QZ9A 2V0YA 3FCRA 4LNLA 4MQQA 4OBUA 3NYTA 4CXQA 2YKXA 4WD2A 1ASNA 2RFVA 2CB1A 1AHFA 4ADEA 2CINA 2DR1A 1C0NA 1AX4A 5G4IA 4BQ0A 2VGVA 2D63A 2HUFA 3BB8A 1KL2A 3K7YA 3LY1A 3W1IA 4IXSA 3EI8A 1RVUA 2C0RA 3I4JA 2DKBA 4OBVA 3RCHB 3PD6B 2W7EA 3GETA 3GSBA 3H7FA 2EZ2A 3KKIA 3MADA 3QBOA 3QHXA 3HMUA 5E3KA 4KYOA 2QB3A 3EI9A 1TARA 4RKCA 5C6UA 1B9IA 1E5FA 2VGUA 4XJPA 4EFFA 4AH3A 4A0HA 3H9XA 1M4NA 2KFPA 1GDEA 3AEMC 3AEOA 3PJ0A 2WKAA 3LWSA 2BYJA 1I48A 4XJOA 3MEBA 1DGDA 5F9SA 4E77A 1BJWA 1AIBA 1G4XA 2D61A 3EIBA 1IJIA 5EUNA 2ZSLA 4FFCA 1WYUB 2BI1A 4FL0A 5G0AA 4ADDA 3N0LA 3PDBA 4N0WA 2WK9A 1SPAA 4F5LA 2QLRA 4Q75A 1RVYA 2VLFA 4PVFA 2ZYJA 3LG0A 1AAWA 4LNJA 2BI2A 4ZSWA 1MGVA 3E2FA 3WZFA 3NRAA 1LS3A 3PA9A 2W8UA 2ZC0A 3WKRA 5AX8A 3CBFA 5G2PA 1MAQA 3JU7A 1V2FA 2C81A 2JG2A 3OKSA 1E5EA 3E77A 4HVKA 5M49A 3MAFB 3RCHA 3HL2A 4MKJA 1FC4A 1MDOA 1YAAA 3PD6A 4GEBA 3TFTA 2C7TA 2G6WA 2D5YA 3JZLA 4AOAA 3W1HA 1M32A 2E54A 3ZRRA 4IXOA 3UAKA 3AEJC 2HOYA 3MKJA 4A00A 1ARSA 5DJ1A 1GC3A 2CH2A 3B46A 1M6SA 2HP2A 2R2NA 3BWOA 3E2YA 3GWPA 4K2IA 1G4VA 4Y0HA 1ARTA 3VAXA 3ISLA 4F5GA 4CBSA 2D64A 2BWNA 5EUEA 2VI9A 4ADBA 1DFOA 1M0PA 4WXGA 2VMRA 4ZDPA 4OC9A 1YIZA 1U08A 2XBNA 1JS3A 3F6TA 1QISA 4AO4A 4IYOB 3RBFA 1FG7A 3N5MA 1WYUA 1ARHA 4F5FA 4TMRA 4JEZA 1Z3ZA 2GQNA 2OQXA 4XJMA 1AAMA 2BKWA 1IAYA 4GE7A 5D95A 2DGLA 1GEXA 1CJ0A 2VGZA 5M4DA 1X0MA 1ZC9A 4XEWA 4N0BA 1PFFA 1OATA 1T3IA 1B4XA 1TASA 1TATA 2EO5A 2CFBA 4OMAA 5FT8A 2VMXA 4A6RA 2OKJA 4P3MA 1CQ8A 4WYCA 4W1WA 3CQ4A 5LHAA 1B5OA 1ZODA 4LC3A 4NOGA 4R5FA 2CJGA 3ZRQA 1AY4A 5FT5A 2X5FA 2VMNA 3EIAA 1CZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UQV A;  2O1B A;  1J32 A;  1W7L A;  3FZ6 A;  3ZZJ A;  5EIG B;  1IX7 A;  4W91 A;  2ORD A;  3MAF A;  1TPL A;  1C7O A;  1EQB A;  2VYC A;  3II0 A;  3PPL A;  1MDX A;  2W8T A;  3FQ8 A;  2W8W A;  3CQ6 A;  1VEF A;  4ATQ A;  1CQ7 A;  1LW4 A;  1AHG A;  1UU1 A;  1W7M A;  1UU0 A;  4ZWM A;  1CS1 A;  1IVR A;  7AAT A;  1WST A;  3MC6 A;  1I41 A;  1CL1 A;  1JF9 A;  1QGN A;  4IW7 A;  1B8G A;  4F4E A;  3E9K A;  1LKC A;  4TN4 A;  2VMV A;  3EZ1 A;  1Y4I A;  2EPJ A;  2GSA A;  3ATH A;  1AKB A;  2VMT A;  2BI5 A;  1OHV A;  3L8A A;  1TOJ A;  1TOK A;  1IX6 A;  3NNK A;  4IYO A;  1DJE A;  1RV3 A;  4R5Z A;  1WYV B;  4JF0 A;  3MC6 C;  1V72 A;  2Z1Z A;  3VP6 A;  2FQ6 A;  1BJO B;  4ZSY A;  2HUU A;  3AEM A;  4AO9 A;  1XEY A;  5I92 A;  3A9Y A;  2AY9 A;  1DJ9 A;  1JG8 A;  3BWN C;  2X5D A;  3DZZ A;  2AY1 A;  3E2Z B;  4KXK A;  3T32 A;  1YJS A;  3FTB A;  3UWC A;  1SZK A;  3I16 A;  4PFF A;  1ASM A;  3B1E A;  3ECD A;  2W7K A;  3FDB A;  2EZ1 A;  1AY8 A;  3M5U A;  3NYS A;  4MSO A;  1KKJ A;  1ASA A;  1IBJ A;  4MQR A;  4W5K A;  1ELQ A;  3FRK A;  4WXB A;  4WYE A;  2ZY5 A;  1G7W A;  2VLH A;  1AIC A;  1TOG A;  5EIG A;  4RM1 A;  2Z1Y A;  3AEN B;  1VJO A;  3JWB A;  3PIU A;  1ASF A;  3AEL A;  3DR7 A;  3FVS A;  4H51 A;  1GD9 A;  4W1V A;  2BI3 A;  2VMS A;  3USF A;  3FVU A;  4B9B A;  4UOY A;  1D2F A;  4MY5 A;  3FDD A;  4E3Q A;  2VMW A;  3AEP A;  3VOM A;  1LC5 A;  2ZP7 A;  2JJH A;  4M2M A;  1CL2 A;  4PIW A;  1AKC A;  1AHE A;  4ZLV A;  1AY5 A;  2OGE A;  1ASD A;  1M7Y A;  1WYV A;  2VMU A;  4RKD A;  1PMM A;  3R9A A;  2VMY A;  2XH1 A;  2PO3 A;  3AEJ A;  1BKG A;  2CTZ A;  3GBX A;  3B8X A;  3UE8 A;  1BJO A;  4P7Y A;  3PDX A;  3QI6 A;  3DYD A;  5EFS A;  2VIB A;  2E7I A;  2YCN A;  2JIS A;  2Z9U A;  3RBL A;  1QJ5 A;  1Z7D A;  3BN1 A;  3E2Z A;  4JE5 D;  1O4S A;  2W8J A;  2GB3 A;  3CQ5 A;  3G7Q A;  4O6Z A;  4RJ0 A;  4UHM A;  1OXO A;  5D5S A;  4PFN A;  2VMQ A;  3QM2 A;  1AHY A;  1MLY A;  3FD0 A;  4I8A A;  3AEN A;  1O69 A;  3B1D A;  1LK9 A;  2ZSM A;  1AMR A;  4GSA A;  4BMK A;  3PGY A;  1PG8 A;  3GR9 A;  2BIG A;  2D7Y A;  1FG3 A;  2AY2 A;  4LW4 A;  4EB7 A;  1H0C A;  2ZUK A;  1EG5 A;  4U1T A;  2E7J A;  2WK8 A;  1XI9 A;  4KAM A;  3BCB A;  1DTY A;  2CJH A;  4Y0I A;  5TF5 A;  4F5J A;  1S08 A;  2W7H A;  8AAT A;  4MGR A;  4ZDO A;  2BYL A;  1AJR A;  1C7G A;  2FN6 A;  1ASB A;  1O62 A;  2AY8 A;  1N8P A;  2VMZ A;  2DGM A;  2W7F A;  3FZ8 A;  2EGY A;  1AMQ A;  1D7S A;  1WKH A;  3WCO A;  1PMO A;  1WYT B;  5K8B A;  3EUC A;  2AY3 A;  5M4B A;  1GEW A;  1CZC A;  1SVV A;  3WKS A;  3BCA A;  3GJU A;  1AJS B;  1LW5 A;  1S0A A;  2CY8 A;  3QPG A;  4ZWV A;  1N2T A;  1IAX A;  3G8M A;  3L44 A;  3AOW A;  1DJU A;  1UKJ A;  3CAI A;  3F9T A;  3GZC A;  4WP0 A;  3ELE A;  1ASL A;  3HBX A;  4GRX A;  4JE5 A;  4RJY A;  1IUG A;  1YJY A;  1YNU A;  2NMP A;  3RUY A;  1ELU A;  3KE3 A;  3A8U X;  4EMY A;  1W3U A;  4EU1 A;  3QN6 A;  3D6K A;  2JJE A;  3NX3 A;  3WCN A;  2Z61 A;  2BWO A;  4JEW A;  2QMA A;  4JEX A;  2AY4 A;  1BS0 A;  1S09 A;  4CXR A;  4CVQ A;  1J04 A;  3DC1 A;  2ZJG A;  3FSL A;  3NUB A;  4L0O A;  4QGR A;  2VGW A;  4WB0 B;  3GZD C;  2DGK A;  4ITG A;  4J5U A;  3AV7 A;  3VK2 A;  2OAT A;  2Q7W A;  2X8U A;  4IXZ A;  2HUI A;  5EAV A;  3ZZK A;  2YKU A;  1DKA A;  3BWN A;  3PAA A;  4JEY A;  1QIT A;  1AKA A;  1QIR A;  1O61 A;  2D66 A;  1GCK A;  2FM1 A;  1KKP A;  3G0T A;  4M2J A;  4UHO A;  5DJ9 A;  3WGB A;  1C9C A;  2V1P A;  1WYT A;  1QJ3 A;  2OKK A;  4LW2 A;  3FKD A;  4RAE A;  3MAU A;  1AJS A;  2AEU A;  1CQ6 A;  2YCP A;  1ASG A;  3N75 A;  3DXV A;  2FNU A;  3TFU A;  3E6G A;  1B9H A;  1S07 A;  4WYF A;  1BJ4 A;  1C4K A;  1KMK A;  1BQD A;  2W7J A;  4WYA A;  4AZJ A;  2ZY2 A;  1D7V A;  4IX8 A;  3TAT A;  2C44 A;  3RQ1 A;  3NU7 A;  4ADC A;  3JWA A;  4M2K A;  2VIA A;  1BW0 A;  1LC8 A;  5E5I A;  2Z9W A;  2AY5 A;  1GEY A;  4GDY A;  2FNI A;  3LVM A;  1MAP A;  2BHX A;  2O7C A;  3F0H A;  4WYG A;  2QA3 A;  3IHJ A;  4RLG A;  3DU4 A;  3TCM A;  4AZK A;  3WX9 A;  1D7R A;  2W7D A;  5EUD A;  3EI6 A;  5BJ4 A;  3ACZ A;  4ZAS A;  4LNM A;  1D7U A;  2VMP A;  3FQA A;  4OYT A;  4Q31 A;  4WB0 A;  4W8I A;  3RI6 A;  3A9X A;  1WKG A;  4A0G A;  1AHX A;  3BS8 A;  3ELP A;  2R5E A;  4Q6R A;  1W23 A;  2Z20 A;  4MKK A;  2E7U A;  3HLM A;  3DR4 A;  3KGX A;  1DGE A;  4WXF A;  1P3W A;  4OTL A;  1M0N A;  1VP4 A;  1SF2 A;  4RIZ A;  4BA5 A;  4OCA A;  4ZAH A;  2HOZ A;  2W8V A;  3BCX A;  2BI9 A;  3AOV A;  4ZM4 A;  1V2E A;  2VGT A;  4WLJ A;  4IY7 A;  3W1J A;  5HHY A;  1SZS A;  3JW9 A;  4JEV A;  3NTJ A;  2YKV A;  3IF2 A;  4A6U A;  3K28 A;  3HVY A;  3BV0 A;  2PB2 A;  2HOX A;  1BQA A;  3DXW A;  4WLH A;  4ZDL A;  1N31 A;  2Z9X A;  2AAT A;  5DX5 A;  4K2B A;  3VK4 A;  2VMO A;  2CST A;  2YHK A;  3NYU A;  4K2M A;  2CH1 A;  1H1C A;  5G09 A;  1X2A A;  3EZS A;  1M0Q A;  2JJF A;  4XJL A;  1W7N A;  5FT6 A;  2F8J A;  4E3R A;  4A0F A;  4R8D A;  2OGA A;  5G2Q A;  4JF1 A;  1AIA A;  1SZU A;  2DKJ A;  3WLX A;  3VK3 A;  2ZY3 A;  2DOU A;  3QGU A;  3WGC A;  4RIT A;  2R0T A;  4GE9 A;  1GBN A;  2GMS A;  5BJ3 A;  1UU2 A;  1X28 A;  9AAT A;  1I43 A;  3FFR A;  1LC7 A;  3HT4 A;  3HQT A;  2JGT A;  4GE4 A;  1IX8 A;  2X3L A;  2Z9V A;  2BWP A;  2R5C B;  4ATP A;  2ZY4 A;  2JJG A;  4UHN A;  4ITX A;  2BIA A;  2YCT A;  4Q76 A;  1OHW A;  2HP1 A;  3LVK A;  1BT4 A;  4TV7 A;  1ECX A;  3EI7 A;  4E1O A;  1KL1 A;  1M0O A;  1V2D A;  2AY7 A;  2AY6 A;  3LVL B;  3MBB A;  2VGS A;  3OP7 A;  3Q8N A;  1YOO A;  1MLZ A;  1AMA A;  3ZRP A;  1GC0 A;  3A2B A;  3EI5 A;  4J8L A;  4WBT A;  4BHD A;  2YKY A;  5LH9 A;  3LV2 A;  2W7L A;  5IWQ A;  2QB2 A;  1I29 A;  2VI8 A;  5G4J A;  2Z67 A;  3GZD A;  3AAT A;  4F5H A;  3I5T A;  1AMS A;  2YOB A;  4U2H A;  3KGW A;  4XK1 A;  1OHY A;  2AEV A;  2YRI A;  3COG A;  4ISY A;  3WY7 A;  3NUI A;  4Y0D A;  5HDM A;  2W7M A;  3P6K A;  4F5K A;  1BJN A;  1RV4 A;  1EJI A;  3B1C A;  1TOI A;  1B5P A;  3FZ7 A;  2EH6 A;  3R4T A;  4CBR A;  2YRR A;  2O0R A;  1C7N A;  4B98 A;  4HF8 A;  4R2N A;  5F8V A;  1SFF A;  3DRD A;  1ARG A;  2HOR A;  3NDN A;  1GC4 A;  5DB5 A;  3K40 A;  3A9Z A;  2D7Z A;  3P1T A;  1JS6 A;  4OT8 A;  1GC2 A;  2PB0 A;  5EAA A;  1ZOB A;  3ASA A;  3HDO A;  4F5M A;  2R5C A;  2QBT A;  1S06 A;  2WK7 A;  3FQ7 A;  3NU8 A;  4BA4 A;  2W7I A;  4EB5 A;  5FT4 A;  2HZP A;  4W1X A;  1ASE A;  4DQ6 A;  2FYF A;  1X29 A;  4ZM3 A;  1TOE A;  1ASC A;  1MDZ A;  2D65 A;  2CJD A;  4XAU A;  5JAY A;  4MQP A;  5HXX A;  3BC8 A;  1ARI A;  4A6T A;  4A72 A;  2CAN A;  4DGT A;  3FFH A;  4F5I A;  1OXP A;  1YIY A;  3PDB B;  3FVX A;  3LVJ A;  2W7G A;  3JTX A;  2TPL A;  4DBC A;  2BIE A;  2GMU A;  1G7X A;  5E4Z A;  4WYD A;  5J8Q A;  1ORD A;  4A0R A;  3DOD A;  3TQX A;  1YJZ A;  4XQ2 A;  5EQC A;  1KMJ A;  3H14 A;  5M46 A;  3ASB A;  1QZ9 A;  2V0Y A;  3FCR A;  4LNL A;  4MQQ A;  4OBU A;  3NYT A;  4CXQ A;  2YKX A;  4WD2 A;  1ASN A;  2RFV A;  2CB1 A;  1AHF A;  4ADE A;  2CIN A;  2DR1 A;  1C0N A;  1AX4 A;  5G4I A;  4BQ0 A;  2VGV A;  2D63 A;  2HUF A;  3BB8 A;  1KL2 A;  3K7Y A;  3LY1 A;  3W1I A;  4IXS A;  3EI8 A;  1RVU A;  2C0R A;  3I4J A;  2DKB A;  4OBV A;  3RCH B;  3PD6 B;  2W7E A;  3GET A;  3GSB A;  3H7F A;  2EZ2 A;  3KKI A;  3MAD A;  3QBO A;  3QHX A;  3HMU A;  5E3K A;  4KYO A;  2QB3 A;  3EI9 A;  1TAR A;  4RKC A;  5C6U A;  1B9I A;  1E5F A;  2VGU A;  4XJP A;  4EFF A;  4AH3 A;  4A0H A;  1M4N A;  1GDE A;  3AEM C;  3AEO A;  3PJ0 A;  2WKA A;  3LWS A;  2BYJ A;  1I48 A;  4XJO A;  3MEB A;  1DGD A;  5F9S A;  4E77 A;  1BJW A;  1AIB A;  1G4X A;  2D61 A;  3EIB A;  1IJI A;  5EUN A;  2ZSL A;  4FFC A;  1WYU B;  2BI1 A;  4FL0 A;  5G0A A;  4ADD A;  3N0L A;  3PDB A;  4N0W A;  2WK9 A;  1SPA A;  4F5L A;  2QLR A;  4Q75 A;  1RVY A;  2VLF A;  4PVF A;  2ZYJ A;  3LG0 A;  1AAW A;  4LNJ A;  2BI2 A;  4ZSW A;  1MGV A;  3E2F A;  3WZF A;  3NRA A;  1LS3 A;  3PA9 A;  2W8U A;  2ZC0 A;  3WKR A;  5AX8 A;  3CBF A;  5G2P A;  1MAQ A;  3JU7 A;  1V2F A;  2C81 A;  2JG2 A;  3OKS A;  1E5E A;  3E77 A;  4HVK A;  5M49 A;  3MAF B;  3RCH A;  3HL2 A;  4MKJ A;  1FC4 A;  1MDO A;  1YAA A;  3PD6 A;  4GEB A;  3TFT A;  2C7T A;  2G6W A;  2D5Y A;  3JZL A;  4AOA A;  3W1H A;  1M32 A;  2E54 A;  3ZRR A;  4IXO A;  3UAK A;  3AEJ C;  2HOY A;  3MKJ A;  4A00 A;  1ARS A;  5DJ1 A;  1GC3 A;  2CH2 A;  3B46 A;  1M6S A;  2HP2 A;  2R2N A;  3BWO A;  3E2Y A;  3GWP A;  4K2I A;  1G4V A;  4Y0H A;  1ART A;  3VAX A;  3ISL A;  4F5G A;  4CBS A;  2D64 A;  2BWN A;  5EUE A;  2VI9 A;  4ADB A;  1DFO A;  1M0P A;  4WXG A;  2VMR A;  4ZDP A;  4OC9 A;  1YIZ A;  1U08 A;  2XBN A;  1JS3 A;  3F6T A;  1QIS A;  4AO4 A;  4IYO B;  3RBF A;  1FG7 A;  3N5M A;  1WYU A;  1ARH A;  4F5F A;  4TMR A;  4JEZ A;  1Z3Z A;  2GQN A;  2OQX A;  4XJM A;  1AAM A;  2BKW A;  1IAY A;  4GE7 A;  5D95 A;  2DGL A;  1GEX A;  1CJ0 A;  2VGZ A;  5M4D A;  1X0M A;  1ZC9 A;  4XEW A;  4N0B A;  1PFF A;  1OAT A;  1T3I A;  1B4X A;  1TAS A;  1TAT A;  2EO5 A;  2CFB A;  4OMA A;  5FT8 A;  2VMX A;  4A6R A;  2OKJ A;  4P3M A;  1CQ8 A;  4WYC A;  4W1W A;  3CQ4 A;  5LHA A;  1B5O A;  1ZOD A;  4LC3 A;  4NOG A;  4R5F A;  2CJG A;  3ZRQ A;  1AY4 A;  5FT5 A;  2X5F A;  2VMN A;  3EIA A;  1CZE A; 
#chains in the Genus database with same CATH topology
 4UQV A;  2O1B A;  1J32 A;  1W7L A;  3FZ6 A;  3ZZJ A;  5EIG B;  1IX7 A;  4W91 A;  2ORD A;  3MAF A;  1TPL A;  1C7O A;  1EQB A;  2VYC A;  3II0 A;  3PPL A;  1MDX A;  2W8T A;  3FQ8 A;  2W8W A;  3CQ6 A;  2FKI A;  1VEF A;  4ATQ A;  1CQ7 A;  1LW4 A;  1AHG A;  1UU1 A;  1W7M A;  1UU0 A;  4ZWM A;  1CS1 A;  1IVR A;  7AAT A;  1WST A;  3MC6 A;  3N4X A;  1I41 A;  1CL1 A;  1JF9 A;  1QGN A;  4IW7 A;  1B8G A;  4F4E A;  3E9K A;  1LKC A;  4TN4 A;  2VMV A;  3EZ1 A;  1Y4I A;  2EPJ A;  2GSA A;  3ATH A;  1AKB A;  2VMT A;  2BI5 A;  1OHV A;  3L8A A;  1TOJ A;  1TOK A;  1IX6 A;  3NNK A;  4IYO A;  1DJE A;  1RV3 A;  4R5Z A;  1WYV B;  4JF0 A;  2G7J A;  3MC6 C;  1V72 A;  2Z1Z A;  3VP6 A;  2FQ6 A;  1BJO B;  4ZSY A;  2HUU A;  3AEM A;  4AO9 A;  1XEY A;  5I92 A;  3A9Y A;  2AY9 A;  1DJ9 A;  1JG8 A;  3BWN C;  2X5D A;  3DZZ A;  2AY1 A;  3E2Z B;  4KXK A;  3T32 A;  1YJS A;  3FTB A;  3UWC A;  1SZK A;  3I16 A;  4PFF A;  1ASM A;  3B1E A;  3ECD A;  2W7K A;  3FDB A;  2QSR A;  2EZ1 A;  1AY8 A;  3M5U A;  3NYS A;  4MSO A;  1KKJ A;  1ASA A;  1IBJ A;  4MQR A;  4W5K A;  1ELQ A;  3FRK A;  4WXB A;  4WYE A;  2ZY5 A;  1G7W A;  2VLH A;  1AIC A;  1TOG A;  5EIG A;  4RM1 A;  2Z1Y A;  3AEN B;  1VJO A;  3JWB A;  3PIU A;  1ASF A;  3AEL A;  3DR7 A;  3FVS A;  4H51 A;  1GD9 A;  4W1V A;  2BI3 A;  2VMS A;  3USF A;  3FVU A;  4B9B A;  4UOY A;  1D2F A;  4MY5 A;  3FDD A;  4E3Q A;  2VMW A;  3AEP A;  3VOM A;  1LC5 A;  2ZP7 A;  2JJH A;  4M2M A;  1CL2 A;  4PIW A;  1AKC A;  1AHE A;  4ZLV A;  1AY5 A;  2OGE A;  1ASD A;  1M7Y A;  1WYV A;  2VMU A;  4RKD A;  1PMM A;  3R9A A;  2VMY A;  2XH1 A;  2PO3 A;  3AEJ A;  1BKG A;  2CTZ A;  3GBX A;  3B8X A;  3UE8 A;  1BJO A;  4P7Y A;  3PDX A;  3QI6 A;  3DYD A;  5EFS A;  2VIB A;  2E7I A;  2YCN A;  2JIS A;  2Z9U A;  3RBL A;  1QJ5 A;  1Z7D A;  3BN1 A;  3E2Z A;  4JE5 D;  1O4S A;  2W8J A;  2GB3 A;  3CQ5 A;  3G7Q A;  4O6Z A;  4RJ0 A;  4UHM A;  2EYQ A;  1OXO A;  5D5S A;  2A1V A;  4PFN A;  2VMQ A;  3QM2 A;  1AHY A;  1MLY A;  3FD0 A;  4I8A A;  3AEN A;  1O69 A;  3B1D A;  1LK9 A;  2ZSM A;  1AMR A;  4GSA A;  4BMK A;  3PGY A;  1PG8 A;  3GR9 A;  2BIG A;  2D7Y A;  1FG3 A;  2AY2 A;  4LW4 A;  4EB7 A;  1H0C A;  2ZUK A;  1EG5 A;  4U1T A;  2E7J A;  2WK8 A;  1XI9 A;  4KAM A;  3BCB A;  1DTY A;  2CJH A;  4Y0I A;  5TF5 A;  4F5J A;  1S08 A;  2W7H A;  8AAT A;  4MGR A;  4ZDO A;  2BYL A;  1AJR A;  1C7G A;  2FN6 A;  1ASB A;  1O62 A;  2AY8 A;  1N8P A;  2VMZ A;  2DGM A;  2W7F A;  3FZ8 A;  3N7N A;  2EGY A;  1AMQ A;  1D7S A;  1WKH A;  3WCO A;  4K05 A;  1PMO A;  1WYT B;  5K8B A;  3EUC A;  2AY3 A;  5M4B A;  1GEW A;  1CZC A;  1SVV A;  3WKS A;  3BCA A;  3GJU A;  1AJS B;  1LW5 A;  1S0A A;  2CY8 A;  3QPG A;  4ZWV A;  1N2T A;  1IAX A;  3G8M A;  3L44 A;  3AOW A;  1DJU A;  1UKJ A;  3CAI A;  3F9T A;  3GZC A;  4WP0 A;  3ELE A;  1ASL A;  3HBX A;  4GRX A;  4JE5 A;  4RJY A;  1IUG A;  1YJY A;  1YNU A;  2NMP A;  3RUY A;  1ELU A;  5KTB A;  3KE3 A;  3A8U X;  4EMY A;  1W3U A;  4EU1 A;  3QN6 A;  3D6K A;  2JJE A;  3NX3 A;  3WCN A;  2Z61 A;  2BWO A;  4JEW A;  2QMA A;  4JEX A;  2AY4 A;  1BS0 A;  1S09 A;  4CXR A;  4CVQ A;  1J04 A;  3DC1 A;  2ZJG A;  3FSL A;  3NUB A;  4L0O A;  4QGR A;  2VGW A;  4WB0 B;  3GZD C;  2DGK A;  3N4R A;  4ITG A;  4J5U A;  3AV7 A;  3VK2 A;  2OAT A;  2Q7W A;  2X8U A;  4IXZ A;  2HUI A;  5EAV A;  3ZZK A;  2YKU A;  1DKA A;  3BWN A;  3PAA A;  4JEY A;  1QIT A;  1AKA A;  1QIR A;  1O61 A;  2D66 A;  1GCK A;  2FM1 A;  1KKP A;  3G0T A;  4M2J A;  4UHO A;  5DJ9 A;  3WGB A;  1C9C A;  2V1P A;  1WYT A;  1QJ3 A;  2OKK A;  4LW2 A;  3FKD A;  4RAE A;  3MAU A;  1AJS A;  2AEU A;  1CQ6 A;  2YCP A;  1ASG A;  3N75 A;  3DXV A;  2FNU A;  3TFU A;  3E6G A;  1B9H A;  1S07 A;  4WYF A;  1BJ4 A;  1C4K A;  1KMK A;  1BQD A;  2W7J A;  4WYA A;  4AZJ A;  2ZY2 A;  1D7V A;  4IX8 A;  3TAT A;  2C44 A;  3RQ1 A;  3NU7 A;  4ADC A;  3JWA A;  4M2K A;  2VIA A;  1BW0 A;  1LC8 A;  5E5I A;  2Z9W A;  2AY5 A;  1GEY A;  4GDY A;  2FNI A;  3LVM A;  1MAP A;  2BHX A;  2O7C A;  3F0H A;  4WYG A;  2QA3 A;  3IHJ A;  4RLG A;  3DU4 A;  3TCM A;  4AZK A;  3WX9 A;  1D7R A;  2W7D A;  5EUD A;  3EI6 A;  5BJ4 A;  3ACZ A;  4ZAS A;  4LNM A;  1D7U A;  2VMP A;  3FQA A;  4OYT A;  4Q31 A;  4WB0 A;  4W8I A;  3RI6 A;  3A9X A;  1WKG A;  4A0G A;  1AHX A;  3BS8 A;  3ELP A;  2R5E A;  4Q6R A;  1W23 A;  2Z20 A;  4MKK A;  2E7U A;  3HLM A;  3DR4 A;  3KGX A;  1DGE A;  4WXF A;  1P3W A;  4OTL A;  1M0N A;  1VP4 A;  1SF2 A;  4RIZ A;  4BA5 A;  4OCA A;  4ZAH A;  2HOZ A;  2W8V A;  3BCX A;  2BI9 A;  3AOV A;  4ZM4 A;  1V2E A;  4H63 Q;  2VGT A;  4WLJ A;  4IY7 A;  3W1J A;  5HHY A;  1SZS A;  3JW9 A;  4JEV A;  3NTJ A;  2YKV A;  3IF2 A;  4A6U A;  3K28 A;  3HVY A;  3BV0 A;  2PB2 A;  2HOX A;  1BQA A;  3DXW A;  4WLH A;  4ZDL A;  1N31 A;  2Z9X A;  2AAT A;  5DX5 A;  4K2B A;  3VK4 A;  2VMO A;  2CST A;  2YHK A;  3NYU A;  4K2M A;  2CH1 A;  1H1C A;  5G09 A;  1X2A A;  3EZS A;  1M0Q A;  2JJF A;  4XJL A;  1W7N A;  5FT6 A;  2F8J A;  4E3R A;  4A0F A;  1KAF A;  4R8D A;  2OGA A;  5G2Q A;  4JF1 A;  1AIA A;  1SZU A;  2DKJ A;  3WLX A;  3VK3 A;  2ZY3 A;  2DOU A;  3QGU A;  3WGC A;  4RIT A;  2R0T A;  4GE9 A;  1GBN A;  2GMS A;  5BJ3 A;  1UU2 A;  1X28 A;  9AAT A;  1I43 A;  3FFR A;  1LC7 A;  3HT4 A;  3HQT A;  2JGT A;  4GE4 A;  1IX8 A;  2X3L A;  2Z9V A;  2BWP A;  2R5C B;  4ATP A;  2ZY4 A;  2JJG A;  4UHN A;  4ITX A;  2BIA A;  2YCT A;  4Q76 A;  1OHW A;  2HP1 A;  3N4S A;  3LVK A;  1BT4 A;  4TV7 A;  1ECX A;  3EI7 A;  4E1O A;  1KL1 A;  1M0O A;  1V2D A;  2AY7 A;  2AY6 A;  3LVL B;  3MBB A;  2VGS A;  3OP7 A;  3Q8N A;  1YOO A;  1MLZ A;  1AMA A;  3ZRP A;  1GC0 A;  3A2B A;  3EI5 A;  4J8L A;  4WBT A;  4BHD A;  2YKY A;  5LH9 A;  3LV2 A;  2W7L A;  5IWQ A;  2QB2 A;  1I29 A;  2VI8 A;  5G4J A;  2Z67 A;  3GZD A;  3AAT A;  4F5H A;  3I5T A;  1AMS A;  2YOB A;  4U2H A;  3KGW A;  4XK1 A;  1OHY A;  2AEV A;  2YRI A;  3COG A;  4ISY A;  3WY7 A;  3NUI A;  4Y0D A;  5HDM A;  2W7M A;  3P6K A;  4F5K A;  1BJN A;  1RV4 A;  1EJI A;  3B1C A;  1TOI A;  1B5P A;  3FZ7 A;  2EH6 A;  3R4T A;  4CBR A;  2YRR A;  2O0R A;  1C7N A;  4B98 A;  4HF8 A;  4R2N A;  5F8V A;  1SFF A;  3DRD A;  1ARG A;  2HOR A;  3NDN A;  1GC4 A;  2WB6 A;  5DB5 A;  3K40 A;  3A9Z A;  2D7Z A;  3P1T A;  1JS6 A;  4OT8 A;  1GC2 A;  2PB0 A;  5EAA A;  1ZOB A;  3ASA A;  3HDO A;  4F5M A;  2R5C A;  2QBT A;  1S06 A;  2WK7 A;  3FQ7 A;  3NU8 A;  4BA4 A;  2W7I A;  4EB5 A;  5FT4 A;  2HZP A;  4W1X A;  1ASE A;  4DQ6 A;  2FYF A;  1X29 A;  4ZM3 A;  1TOE A;  1ASC A;  1MDZ A;  2D65 A;  2CJD A;  4XAU A;  5JAY A;  4MQP A;  5HXX A;  3BC8 A;  1ARI A;  4A6T A;  4A72 A;  2CAN A;  4DGT A;  3FFH A;  4F5I A;  1OXP A;  1YIY A;  3PDB B;  3FVX A;  3LVJ A;  2W7G A;  3JTX A;  2TPL A;  4DBC A;  2BIE A;  2GMU A;  1G7X A;  5E4Z A;  4WYD A;  5J8Q A;  1ORD A;  4A0R A;  3DOD A;  3TQX A;  1YJZ A;  4XQ2 A;  5EQC A;  1KMJ A;  3H14 A;  5M46 A;  3ASB A;  1QZ9 A;  2V0Y A;  3FCR A;  4LNL A;  4MQQ A;  4OBU A;  3NYT A;  4CXQ A;  2YKX A;  4WD2 A;  1ASN A;  2RFV A;  2CB1 A;  1AHF A;  4ADE A;  2CIN A;  2DR1 A;  1C0N A;  1AX4 A;  5G4I A;  4BQ0 A;  2VGV A;  2D63 A;  2HUF A;  3BB8 A;  1KL2 A;  3K7Y A;  3LY1 A;  3W1I A;  4IXS A;  3EI8 A;  1RVU A;  2C0R A;  3I4J A;  2DKB A;  4OBV A;  3RCH B;  3PD6 B;  2W7E A;  3GET A;  3GSB A;  3H7F A;  2EZ2 A;  3KKI A;  3MAD A;  3QBO A;  3QHX A;  3HMU A;  5E3K A;  4KYO A;  2QB3 A;  3EI9 A;  1TAR A;  4RKC A;  5C6U A;  1B9I A;  1E5F A;  2VGU A;  4XJP A;  4EFF A;  4AH3 A;  4A0H A;  3H9X A;  1M4N A;  2KFP A;  1GDE A;  3AEM C;  3AEO A;  3PJ0 A;  2WKA A;  3LWS A;  2BYJ A;  1I48 A;  4XJO A;  3MEB A;  1DGD A;  5F9S A;  4E77 A;  1BJW A;  1AIB A;  1G4X A;  2D61 A;  3EIB A;  1IJI A;  5EUN A;  2ZSL A;  4FFC A;  1WYU B;  2BI1 A;  4FL0 A;  5G0A A;  4ADD A;  3N0L A;  3PDB A;  4N0W A;  2WK9 A;  1SPA A;  4F5L A;  2QLR A;  4Q75 A;  1RVY A;  2VLF A;  4PVF A;  2ZYJ A;  3LG0 A;  1AAW A;  4LNJ A;  2BI2 A;  4ZSW A;  1MGV A;  3E2F A;  3WZF A;  3NRA A;  1LS3 A;  3PA9 A;  2W8U A;  2ZC0 A;  3WKR A;  5AX8 A;  3CBF A;  5G2P A;  1MAQ A;  3JU7 A;  1V2F A;  2C81 A;  2JG2 A;  3OKS A;  1E5E A;  3E77 A;  4HVK A;  5M49 A;  3MAF B;  3RCH A;  3HL2 A;  4MKJ A;  1FC4 A;  1MDO A;  1YAA A;  3PD6 A;  4GEB A;  3TFT A;  2C7T A;  2G6W A;  2D5Y A;  3JZL A;  4AOA A;  3W1H A;  1M32 A;  2E54 A;  3ZRR A;  4IXO A;  3UAK A;  3AEJ C;  2HOY A;  3MKJ A;  4A00 A;  1ARS A;  5DJ1 A;  1GC3 A;  2CH2 A;  3B46 A;  1M6S A;  2HP2 A;  2R2N A;  3BWO A;  3E2Y A;  3GWP A;  4K2I A;  1G4V A;  4Y0H A;  1ART A;  3VAX A;  3ISL A;  4F5G A;  4CBS A;  2D64 A;  2BWN A;  5EUE A;  2VI9 A;  4ADB A;  1DFO A;  1M0P A;  4WXG A;  2VMR A;  4ZDP A;  4OC9 A;  1YIZ A;  1U08 A;  2XBN A;  1JS3 A;  3F6T A;  1QIS A;  4AO4 A;  4IYO B;  3RBF A;  1FG7 A;  3N5M A;  1WYU A;  1ARH A;  4F5F A;  4TMR A;  4JEZ A;  1Z3Z A;  2GQN A;  2OQX A;  4XJM A;  1AAM A;  2BKW A;  1IAY A;  4GE7 A;  5D95 A;  2DGL A;  1GEX A;  1CJ0 A;  2VGZ A;  5M4D A;  1X0M A;  1ZC9 A;  4XEW A;  4N0B A;  1PFF A;  1OAT A;  1T3I A;  1B4X A;  1TAS A;  1TAT A;  2EO5 A;  2CFB A;  4OMA A;  5FT8 A;  2VMX A;  4A6R A;  2OKJ A;  4P3M A;  1CQ8 A;  4WYC A;  4W1W A;  3CQ4 A;  5LHA A;  1B5O A;  1ZOD A;  4LC3 A;  4NOG A;  4R5F A;  2CJG A;  3ZRQ A;  1AY4 A;  5FT5 A;  2X5F A;  2VMN A;  3EIA A;  1CZE A; 
#chains in the Genus database with same CATH homology
 4UQV A;  2O1B A;  1J32 A;  1W7L A;  3FZ6 A;  3ZZJ A;  5EIG B;  1IX7 A;  4W91 A;  2ORD A;  3MAF A;  1TPL A;  1C7O A;  1EQB A;  2VYC A;  3II0 A;  3PPL A;  1MDX A;  2W8T A;  3FQ8 A;  2W8W A;  3CQ6 A;  2FKI A;  1VEF A;  4ATQ A;  1CQ7 A;  1LW4 A;  1AHG A;  1UU1 A;  1W7M A;  1UU0 A;  4ZWM A;  1CS1 A;  1IVR A;  7AAT A;  1WST A;  3MC6 A;  3N4X A;  1I41 A;  1CL1 A;  1JF9 A;  1QGN A;  4IW7 A;  1B8G A;  4F4E A;  3E9K A;  1LKC A;  4TN4 A;  2VMV A;  3EZ1 A;  1Y4I A;  2EPJ A;  2GSA A;  3ATH A;  1AKB A;  2VMT A;  2BI5 A;  1OHV A;  3L8A A;  1TOJ A;  1TOK A;  1IX6 A;  3NNK A;  4IYO A;  1DJE A;  1RV3 A;  4R5Z A;  1WYV B;  4JF0 A;  2G7J A;  3MC6 C;  1V72 A;  2Z1Z A;  3VP6 A;  2FQ6 A;  1BJO B;  4ZSY A;  2HUU A;  3AEM A;  4AO9 A;  1XEY A;  5I92 A;  3A9Y A;  2AY9 A;  1DJ9 A;  1JG8 A;  3BWN C;  2X5D A;  3DZZ A;  2AY1 A;  3E2Z B;  4KXK A;  3T32 A;  1YJS A;  3FTB A;  3UWC A;  1SZK A;  3I16 A;  4PFF A;  1ASM A;  3B1E A;  3ECD A;  2W7K A;  3FDB A;  2QSR A;  2EZ1 A;  1AY8 A;  3M5U A;  3NYS A;  4MSO A;  1KKJ A;  1ASA A;  1IBJ A;  4MQR A;  4W5K A;  1ELQ A;  3FRK A;  4WXB A;  4WYE A;  2ZY5 A;  1G7W A;  2VLH A;  1AIC A;  1TOG A;  5EIG A;  4RM1 A;  2Z1Y A;  3AEN B;  1VJO A;  3JWB A;  3PIU A;  1ASF A;  3AEL A;  3DR7 A;  3FVS A;  4H51 A;  1GD9 A;  4W1V A;  2BI3 A;  2VMS A;  3USF A;  3FVU A;  4B9B A;  4UOY A;  1D2F A;  4MY5 A;  3FDD A;  4E3Q A;  2VMW A;  3AEP A;  3VOM A;  1LC5 A;  2ZP7 A;  2JJH A;  4M2M A;  1CL2 A;  4PIW A;  1AKC A;  1AHE A;  4ZLV A;  1AY5 A;  2OGE A;  1ASD A;  1M7Y A;  1WYV A;  2VMU A;  4RKD A;  1PMM A;  3R9A A;  2VMY A;  2XH1 A;  2PO3 A;  3AEJ A;  1BKG A;  2CTZ A;  3GBX A;  3B8X A;  3UE8 A;  1BJO A;  4P7Y A;  3PDX A;  3QI6 A;  3DYD A;  5EFS A;  2VIB A;  2E7I A;  2YCN A;  2JIS A;  2Z9U A;  3RBL A;  1QJ5 A;  1Z7D A;  3BN1 A;  3E2Z A;  4JE5 D;  1O4S A;  2W8J A;  2GB3 A;  3CQ5 A;  3G7Q A;  4O6Z A;  4RJ0 A;  4UHM A;  2EYQ A;  1OXO A;  5D5S A;  2A1V A;  4PFN A;  2VMQ A;  3QM2 A;  1AHY A;  1MLY A;  3FD0 A;  4I8A A;  3AEN A;  1O69 A;  3B1D A;  1LK9 A;  2ZSM A;  1AMR A;  4GSA A;  4BMK A;  3PGY A;  1PG8 A;  3GR9 A;  2BIG A;  2D7Y A;  1FG3 A;  2AY2 A;  4LW4 A;  4EB7 A;  1H0C A;  2ZUK A;  1EG5 A;  4U1T A;  2E7J A;  2WK8 A;  1XI9 A;  4KAM A;  3BCB A;  1DTY A;  2CJH A;  4Y0I A;  5TF5 A;  4F5J A;  1S08 A;  2W7H A;  8AAT A;  4MGR A;  4ZDO A;  2BYL A;  1AJR A;  1C7G A;  2FN6 A;  1ASB A;  1O62 A;  2AY8 A;  1N8P A;  2VMZ A;  2DGM A;  2W7F A;  3FZ8 A;  3N7N A;  2EGY A;  1AMQ A;  1D7S A;  1WKH A;  3WCO A;  4K05 A;  1PMO A;  1WYT B;  5K8B A;  3EUC A;  2AY3 A;  5M4B A;  1GEW A;  1CZC A;  1SVV A;  3WKS A;  3BCA A;  3GJU A;  1AJS B;  1LW5 A;  1S0A A;  2CY8 A;  3QPG A;  4ZWV A;  1N2T A;  1IAX A;  3G8M A;  3L44 A;  3AOW A;  1DJU A;  1UKJ A;  3CAI A;  3F9T A;  3GZC A;  4WP0 A;  3ELE A;  1ASL A;  3HBX A;  4GRX A;  4JE5 A;  4RJY A;  1IUG A;  1YJY A;  1YNU A;  2NMP A;  3RUY A;  1ELU A;  5KTB A;  3KE3 A;  3A8U X;  4EMY A;  1W3U A;  4EU1 A;  3QN6 A;  3D6K A;  2JJE A;  3NX3 A;  3WCN A;  2Z61 A;  2BWO A;  4JEW A;  2QMA A;  4JEX A;  2AY4 A;  1BS0 A;  1S09 A;  4CXR A;  4CVQ A;  1J04 A;  3DC1 A;  2ZJG A;  3FSL A;  3NUB A;  4L0O A;  4QGR A;  2VGW A;  4WB0 B;  3GZD C;  2DGK A;  3N4R A;  4ITG A;  4J5U A;  3AV7 A;  3VK2 A;  2OAT A;  2Q7W A;  2X8U A;  4IXZ A;  2HUI A;  5EAV A;  3ZZK A;  2YKU A;  1DKA A;  3BWN A;  3PAA A;  4JEY A;  1QIT A;  1AKA A;  1QIR A;  1O61 A;  2D66 A;  1GCK A;  2FM1 A;  1KKP A;  3G0T A;  4M2J A;  4UHO A;  5DJ9 A;  3WGB A;  1C9C A;  2V1P A;  1WYT A;  1QJ3 A;  2OKK A;  4LW2 A;  3FKD A;  4RAE A;  3MAU A;  1AJS A;  2AEU A;  1CQ6 A;  2YCP A;  1ASG A;  3N75 A;  3DXV A;  2FNU A;  3TFU A;  3E6G A;  1B9H A;  1S07 A;  4WYF A;  1BJ4 A;  1C4K A;  1KMK A;  1BQD A;  2W7J A;  4WYA A;  4AZJ A;  2ZY2 A;  1D7V A;  4IX8 A;  3TAT A;  2C44 A;  3RQ1 A;  3NU7 A;  4ADC A;  3JWA A;  4M2K A;  2VIA A;  1BW0 A;  1LC8 A;  5E5I A;  2Z9W A;  2AY5 A;  1GEY A;  4GDY A;  2FNI A;  3LVM A;  1MAP A;  2BHX A;  2O7C A;  3F0H A;  4WYG A;  2QA3 A;  3IHJ A;  4RLG A;  3DU4 A;  3TCM A;  4AZK A;  3WX9 A;  1D7R A;  2W7D A;  5EUD A;  3EI6 A;  5BJ4 A;  3ACZ A;  4ZAS A;  4LNM A;  1D7U A;  2VMP A;  3FQA A;  4OYT A;  4Q31 A;  4WB0 A;  4W8I A;  3RI6 A;  3A9X A;  1WKG A;  4A0G A;  1AHX A;  3BS8 A;  3ELP A;  2R5E A;  4Q6R A;  1W23 A;  2Z20 A;  4MKK A;  2E7U A;  3HLM A;  3DR4 A;  3KGX A;  1DGE A;  4WXF A;  1P3W A;  4OTL A;  1M0N A;  1VP4 A;  1SF2 A;  4RIZ A;  4BA5 A;  4OCA A;  4ZAH A;  2HOZ A;  2W8V A;  3BCX A;  2BI9 A;  3AOV A;  4ZM4 A;  1V2E A;  4H63 Q;  2VGT A;  4WLJ A;  4IY7 A;  3W1J A;  5HHY A;  1SZS A;  3JW9 A;  4JEV A;  3NTJ A;  2YKV A;  3IF2 A;  4A6U A;  3K28 A;  3HVY A;  3BV0 A;  2PB2 A;  2HOX A;  1BQA A;  3DXW A;  4WLH A;  4ZDL A;  1N31 A;  2Z9X A;  2AAT A;  5DX5 A;  4K2B A;  3VK4 A;  2VMO A;  2CST A;  2YHK A;  3NYU A;  4K2M A;  2CH1 A;  1H1C A;  5G09 A;  1X2A A;  3EZS A;  1M0Q A;  2JJF A;  4XJL A;  1W7N A;  5FT6 A;  2F8J A;  4E3R A;  4A0F A;  4R8D A;  2OGA A;  5G2Q A;  4JF1 A;  1AIA A;  1SZU A;  2DKJ A;  3WLX A;  3VK3 A;  2ZY3 A;  2DOU A;  3QGU A;  3WGC A;  4RIT A;  2R0T A;  4GE9 A;  1GBN A;  2GMS A;  5BJ3 A;  1UU2 A;  1X28 A;  9AAT A;  1I43 A;  3FFR A;  1LC7 A;  3HT4 A;  3HQT A;  2JGT A;  4GE4 A;  1IX8 A;  2X3L A;  2Z9V A;  2BWP A;  2R5C B;  4ATP A;  2ZY4 A;  2JJG A;  4UHN A;  4ITX A;  2BIA A;  2YCT A;  4Q76 A;  1OHW A;  2HP1 A;  3N4S A;  3LVK A;  1BT4 A;  4TV7 A;  1ECX A;  3EI7 A;  4E1O A;  1KL1 A;  1M0O A;  1V2D A;  2AY7 A;  2AY6 A;  3LVL B;  3MBB A;  2VGS A;  3OP7 A;  3Q8N A;  1YOO A;  1MLZ A;  1AMA A;  3ZRP A;  1GC0 A;  3A2B A;  3EI5 A;  4J8L A;  4WBT A;  4BHD A;  2YKY A;  5LH9 A;  3LV2 A;  2W7L A;  5IWQ A;  2QB2 A;  1I29 A;  2VI8 A;  5G4J A;  2Z67 A;  3GZD A;  3AAT A;  4F5H A;  3I5T A;  1AMS A;  2YOB A;  4U2H A;  3KGW A;  4XK1 A;  1OHY A;  2AEV A;  2YRI A;  3COG A;  4ISY A;  3WY7 A;  3NUI A;  4Y0D A;  5HDM A;  2W7M A;  3P6K A;  4F5K A;  1BJN A;  1RV4 A;  1EJI A;  3B1C A;  1TOI A;  1B5P A;  3FZ7 A;  2EH6 A;  3R4T A;  4CBR A;  2YRR A;  2O0R A;  1C7N A;  4B98 A;  4HF8 A;  4R2N A;  5F8V A;  1SFF A;  3DRD A;  1ARG A;  2HOR A;  3NDN A;  1GC4 A;  2WB6 A;  5DB5 A;  3K40 A;  3A9Z A;  2D7Z A;  3P1T A;  1JS6 A;  4OT8 A;  1GC2 A;  2PB0 A;  5EAA A;  1ZOB A;  3ASA A;  3HDO A;  4F5M A;  2R5C A;  2QBT A;  1S06 A;  2WK7 A;  3FQ7 A;  3NU8 A;  4BA4 A;  2W7I A;  4EB5 A;  5FT4 A;  2HZP A;  4W1X A;  1ASE A;  4DQ6 A;  2FYF A;  1X29 A;  4ZM3 A;  1TOE A;  1ASC A;  1MDZ A;  2D65 A;  2CJD A;  4XAU A;  5JAY A;  4MQP A;  5HXX A;  3BC8 A;  1ARI A;  4A6T A;  4A72 A;  2CAN A;  4DGT A;  3FFH A;  4F5I A;  1OXP A;  1YIY A;  3PDB B;  3FVX A;  3LVJ A;  2W7G A;  3JTX A;  2TPL A;  4DBC A;  2BIE A;  2GMU A;  1G7X A;  5E4Z A;  4WYD A;  5J8Q A;  1ORD A;  4A0R A;  3DOD A;  3TQX A;  1YJZ A;  4XQ2 A;  5EQC A;  1KMJ A;  3H14 A;  5M46 A;  3ASB A;  1QZ9 A;  2V0Y A;  3FCR A;  4LNL A;  4MQQ A;  4OBU A;  3NYT A;  4CXQ A;  2YKX A;  4WD2 A;  1ASN A;  2RFV A;  2CB1 A;  1AHF A;  4ADE A;  2CIN A;  2DR1 A;  1C0N A;  1AX4 A;  5G4I A;  4BQ0 A;  2VGV A;  2D63 A;  2HUF A;  3BB8 A;  1KL2 A;  3K7Y A;  3LY1 A;  3W1I A;  4IXS A;  3EI8 A;  1RVU A;  2C0R A;  3I4J A;  2DKB A;  4OBV A;  3RCH B;  3PD6 B;  2W7E A;  3GET A;  3GSB A;  3H7F A;  2EZ2 A;  3KKI A;  3MAD A;  3QBO A;  3QHX A;  3HMU A;  5E3K A;  4KYO A;  2QB3 A;  3EI9 A;  1TAR A;  4RKC A;  5C6U A;  1B9I A;  1E5F A;  2VGU A;  4XJP A;  4EFF A;  4AH3 A;  4A0H A;  3H9X A;  1M4N A;  2KFP A;  1GDE A;  3AEM C;  3AEO A;  3PJ0 A;  2WKA A;  3LWS A;  2BYJ A;  1I48 A;  4XJO A;  3MEB A;  1DGD A;  5F9S A;  4E77 A;  1BJW A;  1AIB A;  1G4X A;  2D61 A;  3EIB A;  1IJI A;  5EUN A;  2ZSL A;  4FFC A;  1WYU B;  2BI1 A;  4FL0 A;  5G0A A;  4ADD A;  3N0L A;  3PDB A;  4N0W A;  2WK9 A;  1SPA A;  4F5L A;  2QLR A;  4Q75 A;  1RVY A;  2VLF A;  4PVF A;  2ZYJ A;  3LG0 A;  1AAW A;  4LNJ A;  2BI2 A;  4ZSW A;  1MGV A;  3E2F A;  3WZF A;  3NRA A;  1LS3 A;  3PA9 A;  2W8U A;  2ZC0 A;  3WKR A;  5AX8 A;  3CBF A;  5G2P A;  1MAQ A;  3JU7 A;  1V2F A;  2C81 A;  2JG2 A;  3OKS A;  1E5E A;  3E77 A;  4HVK A;  5M49 A;  3MAF B;  3RCH A;  3HL2 A;  4MKJ A;  1FC4 A;  1MDO A;  1YAA A;  3PD6 A;  4GEB A;  3TFT A;  2C7T A;  2G6W A;  2D5Y A;  3JZL A;  4AOA A;  3W1H A;  1M32 A;  2E54 A;  3ZRR A;  4IXO A;  3UAK A;  3AEJ C;  2HOY A;  3MKJ A;  4A00 A;  1ARS A;  5DJ1 A;  1GC3 A;  2CH2 A;  3B46 A;  1M6S A;  2HP2 A;  2R2N A;  3BWO A;  3E2Y A;  3GWP A;  4K2I A;  1G4V A;  4Y0H A;  1ART A;  3VAX A;  3ISL A;  4F5G A;  4CBS A;  2D64 A;  2BWN A;  5EUE A;  2VI9 A;  4ADB A;  1DFO A;  1M0P A;  4WXG A;  2VMR A;  4ZDP A;  4OC9 A;  1YIZ A;  1U08 A;  2XBN A;  1JS3 A;  3F6T A;  1QIS A;  4AO4 A;  4IYO B;  3RBF A;  1FG7 A;  3N5M A;  1WYU A;  1ARH A;  4F5F A;  4TMR A;  4JEZ A;  1Z3Z A;  2GQN A;  2OQX A;  4XJM A;  1AAM A;  2BKW A;  1IAY A;  4GE7 A;  5D95 A;  2DGL A;  1GEX A;  1CJ0 A;  2VGZ A;  5M4D A;  1X0M A;  1ZC9 A;  4XEW A;  4N0B A;  1PFF A;  1OAT A;  1T3I A;  1B4X A;  1TAS A;  1TAT A;  2EO5 A;  2CFB A;  4OMA A;  5FT8 A;  2VMX A;  4A6R A;  2OKJ A;  4P3M A;  1CQ8 A;  4WYC A;  4W1W A;  3CQ4 A;  5LHA A;  1B5O A;  1ZOD A;  4LC3 A;  4NOG A;  4R5F A;  2CJG A;  3ZRQ A;  1AY4 A;  5FT5 A;  2X5F A;  2VMN A;  3EIA A;  1CZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...