3FRKA

X-ray structure of qdtb from t. thermosaccharolyticum in complex with a plp:tdp-3-aminoquinovose aldimine
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
365
structure length
365
Chain Sequence
b'MKISFASFKPMHDEIEYEIKFKFEEIYKRNWFILGDEDKKFEQEFADYCNVNYCIGCGNGLDALHLILKGYDIGFGDEVIVPSNTFIATALAVSYTGAKPIFVEPDIRTYNIDPSLIESAITEKTKAIIAVHLYGQPADMDEIKRIAKKYNLKLIEDAAQAHGSLYKGMKVGSLGDAAGFSFYPAKNLGSLGDGGAVVTNDKDLAEKIKALSNYGSEKKYHHIYKGFNSRLDELQAGFLRVKLKYLDKWNEERRKIAQKYIAGINNPNVIIPVEADYAKHVWYTFVIRSEKRDELQKYLNNNGIGTLIHYPIPIHLQQAYKDLGFKTGNFPIAEKIANEILSIPIWYGMKNEEIEYVIDKINAWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords QdtB
publication title Structural analysis of QdtB, an aminotransferase required for the biosynthesis of dTDP-3-acetamido-3,6-dideoxy-alpha-D-glucose.
pubmed doi rcsb
source organism Thermoanaerobacterium thermosaccharolyticum
molecule tags Transferase
total genus 137
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01041 DegT_DnrJ_EryC1 DegT/DnrJ/EryC1/StrS aminotransferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3frkA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3frkA02
2EO5A 1JG8A 2O7CA 1ZOBA 2FN6A 2W7FA 2XH1A 4BA4A 4A00A 4UHNA 1ASBA 5DX5A 5G2QA 1DJUA 1MDOA 2W7DA 2Z9UA 2W7JA 2OQXA 3AEPA 2W8JA 2W8TA 2ZSLA 3ZRRA 2ZP7A 4A6UA 1ARIA 3FZ7A 1ORDA 4ADDA 1JS3A 1PG8A 1AKAA 2EZ2A 1MLZA 2CFBA 3MADA 2BIEA 2R5CA 1B9HA 4F5IA 3F9TA 4Y0HA 1ASNA 1EG5A 3B46A 3AEOA 4W1WA 2HOZA 4RKCA 3H7FA 4I8AA 4F5LA 1BJOA 3FTBA 3F6TA 4ZWMA 3AEMC 8AATA 3EZSA 2FNUA 2Q7WA 2ZSMA 3VK4A 4WXFA 3JU7A 2YCPA 3ZZKA 2D7ZA 2W7GA 2D61A 2X5DA 2VMPA 1CZEA 1BJWA 1KKPA 1X28A 3G0TA 4ITXA 7AATA 4JF1A 2CJDA 3UE8A 5F9SA 1SFFA 3FVSA 4XK1A 5I92A 3FDDA 3BWNC 2XBNA 3ELEA 2EH6A 4MQPA 4MKKA 4ZAHA 4U2HA 4E77A 3RQ1A 4MKJA 3USFA 3MKJA 4XJLA 1SZKA 2BKWA 2Z9XA 2VMWA 4ZWVA 1AMRA 4RIZA 3ZRQA 1YIYA 1M0OA 4P3MA 4JEXA 3MC6C 3PPLA 3HVYA 3NTJA 1OXOA 1JS6A 4ZM3A 3UAKA 1WYVA 1W3UA 2C44A 1TASA 2VMVA 3FRKA 3QGUA 2EZ1A 4PFNA 4U1TA 4W1VA 4ZLVA 4A0GA 3NNKA 3E2YA 1QJ3A 5G2PA 5HHYA 2HUUA 1IUGA 5EQCA 1CZCA 2WK7A 3W1IA 1IAXA 4BA5A 2CSTA 1TOEA 1VEFA 3FD0A 4J5UA 4Q31A 3KE3A 4WYEA 4WYFA 2DKBA 1B8GA 3FZ8A 4ZSYA 1MLYA 2QBTA 1AJRA 3DR4A 4LNLA 1S09A 1C7NA 3LV2A 1TOIA 1WYTB 3NRAA 5EUNA 3RI6A 3E6GA 4JEZA 4LC3A 2X5FA 3DRDA 4IXZA 1B9IA 4OCAA 2GMSA 1D7RA 1I41A 1BQDA 1AIAA 1ASFA 2ZUKA 3AEJA 3WGBA 5HXXA 1ARGA 3MEBA 3ELPA 3CAIA 2YOBA 1AICA 2W7IA 1C4KA 2HZPA 2JJFA 3AOVA 4EFFA 3A2BA 4EU1A 1N2TA 2DGMA 4F5HA 1LW5A 1MAQA 2FNIA 4Q75A 2FM1A 2VMOA 2YRRA 5FT8A 2EGYA 2HUIA 4O6ZA 1KL2A 4XEWA 3ECDA 2VGVA 1CJ0A 2D5YA 4P7YA 2GSAA 4RJYA 3FZ6A 3N0LA 3N75A 4WBTA 3E77A 2BI9A 4WD2A 2C81A 4CVQA 3FFHA 1PMMA 1YAAA 3HDOA 3K28A 3P1TA 4DBCA 1GDEA 4IXSA 4UHOA 4JEVA 1ASMA 2D7YA 1GEWA 1GD9A 3EI9A 1SZUA 3B1CA 4GSAA 4IXOA 1WYUA 2DKJA 2YKYA 1AKBA 3CQ5A 3H14A 3PDBA 4WYAA 4ZDLA 4F4EA 3ZZJA 4ADBA 5FT5A 4WYCA 2QB3A 1M0PA 3HMUA 3NYSA 4E3RA 1AMSA 4ZM4A 5TF5A 1QISA 4A0HA 4R8DA 1C7OA 2W7HA 2AY5A 1I29A 5DB5A 2ORDA 2VIBA 2VMNA 3JW9A 1AMAA 1ASCA 3PA9A 4W1XA 2VYCA 1WKGA 2YHKA 2VI9A 4CBRA 3A9YA 2PB2A 2PB0A 3FFRA 5HDMA 3NDNA 1M0QA 2CB1A 4GE7A 2YRIA 4OBUA 1DJEA 4UOYA 5DJ9A 4MQRA 3FKDA 1I43A 4Y0IA 4BHDA 2PO3A 5K8BA 4FFCA 3NYTA 3GZDA 1DGEA 1TOJA 2X8UA 4FL0A 3KKIA 1IAYA 4WLHA 2HOXA 2NMPA 3BCBA 3PDXA 3TCMA 4EB5A 1G7XA 3LG0A 4IX8A 4AZKA 4ISYA 1FG7A 1TOGA 1OHWA 1OATA 3RCHA 1AY8A 3WKSA 4OC9A 1IX7A 2O0RA 5EAVA 9AATA 3MBBA 1N31A 4WYGA 3BWNA 4UHMA 5E3KA 2AY9A 1V2DA 3VAXA 1ASAA 2HUFA 4IW7A 3EI7A 3QM2A 1YIZA 5BJ4A 1DKAA 3WCNA 1MDXA 2VGUA 3E2FA 4LNJA 4A6TA 1V72A 3QI6A 1O4SA 1U08A 1UU2A 3VK3A 3KGWA 2CINA 3BCAA 3BV0A 4JE5D 1TATA 3JWAA 4MGRA 2BYJA 4N0BA 1LKCA 1J32A 1E5EA 1EJIA 3EUCA 3MAFB 1AAWA 4A72A 1UU1A 3WLXA 1QIRA 1O69A 1ELUA 3HL2A 3Q8NA 2BWNA 1GC4A 2E7JA 1MAPA 3L8AA 1MGVA 3HQTA 1WSTA 1GBNA 1AHGA 2VMTA 1B4XA 1AIBA 1BQAA 1OHYA 2VI8A 3BB8A 3BC8A 3FQ8A 1CL1A 3ACZA 4PVFA 3ISLA 1AY5A 2Z67A 3UWCA 3AELA 3R4TA 4B98A 1KL1A 5LHAA 2VLFA 3HBXA 3DR7A 2WK8A 1LC5A 3ASAA 3AOWA 4LNMA 1OXPA 1QITA 1V2FA 1VP4A 5EIGA 3FQ7A 4Q76A 1Z3ZA 4HVKA 2JG2A 3EIAA 3M5UA 3NU8A 2R5EA 3II0A 2W7MA 4BMKA 2VGZA 2C0RA 2CH2A 2JGTA 3QN6A 5DJ1A 3B8XA 2DOUA 5EUDA 1M7YA 2HP1A 1IJIA 2W8VA 1BW0A 3PD6B 4MY5A 2YKVA 1KMJA 2Z9WA 3IF2A 3LVMA 2YKXA 3ATHA 3NU7A 2D66A 3B1DA 4PIWA 1GCKA 3I16A 3VK2A 1SZSA 1UU0A 2FQ6A 2EPJA 4JF0A 1QZ9A 2DR1A 3WX9A 1BT4A 1ELQA 4M2JA 1UKJA 2C7TA 1FG3A 3RBFA 4JEYA 4M2KA 1W23A 3FVXA 4EMYA 3NYUA 1AHFA 3B1EA 1IX6A 4M2MA 4F5KA 1YJSA 5M49A 3GJUA 3KGXA 4XJMA 5E4ZA 5E5IA 1QGNA 3JTXA 1LK9A 1D7SA 2HOYA 4W91A 4DGTA 4LW2A 2AY8A 5M46A 1X0MA 4KXKA 1S0AA 2BI5A 1M32A 4WXBA 4F5FA 4ADEA 3BN1A 4JE5A 3I4JA 1BJOB 4KAMA 3GBXA 1RV3A 4WYDA 2AY1A 1I48A 3CQ4A 4W5KA 2AATA 3W1HA 2DGKA 3T32A 2ZC0A 1AKCA 1IBJA 1N8PA 2AEUA 1AY4A 2JJGA 1H1CA 2GQNA 2VGSA 2ZYJA 4N0WA 4B9BA 2DGLA 3EIBA 3TQXA 3HLMA 3HT4A 4WLJA 1ECXA 3A9ZA 1GC3A 1D7UA 1EQBA 2VGTA 1D2FA 3AENB 3AEJC 3E2ZB 3TFTA 2BYLA 4UQVA 4K2IA 3JZLA 3MAFA 2D63A 4H51A 1YNUA 1GEYA 4ITGA 2QB2A 3ZRPA 1S06A 3FVUA 3QBOA 4PFFA 2O1BA 1W7MA 2FYFA 2VMZA 2OGAA 4L0OA 2ZY2A 4TV7A 2ZY3A 4ZSWA 1QJ5A 3WGCA 2Z61A 1CS1A 3K7YA 2YKUA 2R0TA 3TATA 1RVYA 5IWQA 2ZY5A 1ARSA 1S08A 5G4IA 1X29A 1AJSB 1SPAA 3AEMA 3D6KA 4IYOB 3K40A 4WB0B 4XAUA 2F8JA 2BHXA 4CBSA 1LC8A 3A8UX 1LS3A 2R2NA 1G4VA 1AX4A 3EI5A 2V1PA 3GWPA 1W7LA 4OTLA 2BIAA 4K2MA 1BJ4A 5FT4A 2JJHA 1SVVA 1TOKA 1E5FA 4AO9A 1WYTA 1XEYA 4A0RA 1BKGA 2AY4A 2D65A 1CQ6A 1Y4IA 3QPGA 4HF8A 1T3IA 1AAMA 5G4JA 4RITA 1J04A 2BIGA 2TPLA 3A9XA 2WK9A 3OP7A 1WKHA 2OATA 3PAAA 5BJ3A 3G8MA 1C0NA 3MC6A 3LVLB 2GMUA 3PJ0A 1LC7A 2BI1A 1C7GA 3CQ6A 5EUEA 4WP0A 2X3LA 1IX8A 3VOMA 3BS8A 2YCTA 4NOGA 1D7VA 2AY6A 4RLGA 5EAAA 1PFFA 4CXRA 1SF2A 3COGA 2BWOA 2VMUA 3GZDC 4R2NA 1DJ9A 2AEVA 1MDZA 1LW4A 1CQ8A 3LWSA 4A6RA 1WYUB 1H0CA 1AHYA 1S07A 1W7NA 3BWOA 3NUBA 3PDBB 2AY3A 4LW4A 2BI3A 2CJGA 5F8VA 2Z1ZA 3GSBA 3QHXA 4BQ0A 4MSOA 2OGEA 1YJZA 1YJYA 3FDBA 3AV7A 3R9AA 3GR9A 4TN4A 1ASEA 5JAYA 2OKJA 4IY7A 1ZODA 3N5MA 5C6UA 4XQ2A 3AENA 1ASGA 3ASBA 3DXWA 3E2ZA 1ZC9A 4GE9A 4JEWA 4ZDOA 2WKAA 3PGYA 4F5JA 3I5TA 1TPLA 3LVJA 3DXVA 1C9CA 2D64A 2JISA 2ZJGA 1M4NA 2E7IA 3FQAA 3OKSA 2VLHA 4J8LA 1FC4A 1O61A 2E54A 4MQQA 4GE4A 2Z20A 4W8IA 4E3QA 1ASLA 4XJPA 4RJ0A 1DFOA 1AHXA 1X2AA 2VMXA 3WY7A 3RBLA 5G0AA 2E7UA 2CTZA 2YCNA 5J8QA 4Y0DA 4F5GA 1O62A 3JWBA 3RCHB 1AJSA 2R5CB 4IYOA 4WB0A 4OYTA 2CJHA 1B5PA 1Z7DA 2BWPA 4AO4A 4E1OA 1GEXA 2BI2A 4K2BA 5D95A 2AY2A 4ATQA 1V2EA 4CXQA 3CBFA 3MAUA 3RUYA 2W7LA 2VMQA 1KMKA 4OBVA 5D5SA 1M6SA 2CANA 1ARTA 1VJOA 3GZCA 2VMYA 4QGRA 3DZZA 2VIAA 1PMOA 1XI9A 3FSLA 4R5ZA 4WXGA 4AH3A 1M0NA 2HORA 4RKDA 3DODA 2JJEA 1CL2A 1G4XA 3G7QA 4OT8A 2QA3A 1AHEA 3EI8A 4AZJA 3GETA 3WKRA 4KYOA 1ARHA 2V0YA 1G7WA 4ADCA 5M4DA 4F5MA 3E9KA 2QMAA 2VMSA 5AX8A 4EB7A 4GDYA 5M4BA 3EI6A 3AATA 1CQ7A 2ZY4A 2OKKA 4R5FA 1P3WA 3LVKA 2W7KA 1BJNA 1IVRA 2W8WA 3IHJA 1WYVB 1GC0A 4GEBA 2CY8A 2W8UA 4RM1A 3DU4A 2RFVA 4A0FA 1BS0A 2Z1YA 5EIGB 2GB3A 3LY1A 1RV4A 2CH1A 4ZASA 3DYDA 1TARA 1GC2A 5EFSA 1AMQA 1DGDA 1OHVA 1YOOA 2W7EA 3FCRA 3NUIA 4ATPA 4DQ6A 1KKJA 4GRXA 3L44A 4AOAA 1B5OA 4ZDPA 2QLRA 3BCXA 4TMRA 3VP6A 2HP2A 3EZ1A 3DC1A 3WCOA 1JF9A 5LH9A 2AY7A 3PIUA 1RVUA 2VMRA 3TFUA 1DTYA 5FT6A 3W1JA 4XJOA 1ASDA 3F0HA 4RAEA 4Q6RA 3WZFA 3NX3A 3P6KA 3PD6A 5G09A 2VGWA 2G6WA 4OMAA 2Z9VA
chains in the Genus database with same CATH superfamily
2EO5A 1JG8A 2O7CA 1ZOBA 2FN6A 2W7FA 2XH1A 4BA4A 4A00A 4UHNA 1ASBA 5DX5A 5G2QA 1DJUA 1MDOA 2W7DA 2Z9UA 2W7JA 2OQXA 3AEPA 2W8JA 2W8TA 2ZSLA 3ZRRA 2ZP7A 4A6UA 1ARIA 3FZ7A 1ORDA 4ADDA 1JS3A 1PG8A 1AKAA 2EZ2A 1MLZA 2CFBA 3MADA 2BIEA 2R5CA 1B9HA 4F5IA 3F9TA 4Y0HA 1ASNA 1EG5A 3B46A 3AEOA 4W1WA 2HOZA 4RKCA 3H7FA 4I8AA 4F5LA 1BJOA 3FTBA 3F6TA 4ZWMA 3AEMC 8AATA 3EZSA 2FNUA 2Q7WA 2ZSMA 3VK4A 4WXFA 3JU7A 2YCPA 3ZZKA 2D7ZA 2W7GA 2D61A 2X5DA 2VMPA 1CZEA 1BJWA 1KKPA 1X28A 3G0TA 4ITXA 7AATA 4JF1A 2CJDA 3UE8A 5F9SA 1SFFA 3FVSA 4XK1A 5I92A 3FDDA 3BWNC 2XBNA 3ELEA 2EH6A 4MQPA 4MKKA 4ZAHA 4U2HA 4E77A 3RQ1A 4MKJA 3USFA 3MKJA 4XJLA 1SZKA 2BKWA 2Z9XA 2VMWA 4ZWVA 1AMRA 4RIZA 3ZRQA 1YIYA 1M0OA 4P3MA 4JEXA 3MC6C 3PPLA 3HVYA 3NTJA 1OXOA 1JS6A 4ZM3A 3UAKA 1WYVA 1W3UA 2C44A 1TASA 2VMVA 3FRKA 3QGUA 2EZ1A 4PFNA 4U1TA 4W1VA 4ZLVA 4A0GA 3NNKA 3E2YA 1QJ3A 5G2PA 5HHYA 2HUUA 1IUGA 5EQCA 1CZCA 2WK7A 3W1IA 1IAXA 4BA5A 2CSTA 1TOEA 1VEFA 3FD0A 4J5UA 4Q31A 3KE3A 4WYEA 2FKIA 4WYFA 2DKBA 1B8GA 3FZ8A 4ZSYA 1MLYA 2QBTA 1AJRA 3DR4A 4LNLA 1S09A 1C7NA 3LV2A 1TOIA 1WYTB 3NRAA 5EUNA 3RI6A 2EYQA 3E6GA 4JEZA 4LC3A 2X5FA 3DRDA 4IXZA 1B9IA 4OCAA 2GMSA 1D7RA 1I41A 1BQDA 1AIAA 1ASFA 2ZUKA 3AEJA 3WGBA 5HXXA 1ARGA 3MEBA 3ELPA 3CAIA 2YOBA 1AICA 2W7IA 1C4KA 2HZPA 2JJFA 3AOVA 4EFFA 3A2BA 4EU1A 1N2TA 2DGMA 4F5HA 1LW5A 1MAQA 2FNIA 4Q75A 3N7NA 2FM1A 2VMOA 2YRRA 5FT8A 2EGYA 2HUIA 4O6ZA 1KL2A 4XEWA 3ECDA 2VGVA 1CJ0A 2D5YA 4P7YA 2GSAA 4RJYA 3FZ6A 3N0LA 3N75A 4WBTA 3E77A 2BI9A 4WD2A 2C81A 4CVQA 3FFHA 1PMMA 1YAAA 3HDOA 3K28A 3P1TA 4DBCA 1GDEA 4IXSA 4UHOA 4JEVA 1ASMA 2D7YA 1GEWA 1GD9A 3EI9A 1SZUA 3B1CA 4GSAA 4IXOA 1WYUA 2DKJA 2YKYA 1AKBA 3CQ5A 3H14A 3PDBA 4WYAA 4ZDLA 4F4EA 3ZZJA 4ADBA 5FT5A 4WYCA 2QB3A 1M0PA 3HMUA 3NYSA 4E3RA 1AMSA 4ZM4A 5TF5A 1QISA 4A0HA 4R8DA 1C7OA 2W7HA 2AY5A 1I29A 5DB5A 2ORDA 2VIBA 2VMNA 3JW9A 1AMAA 1ASCA 3PA9A 4W1XA 2VYCA 1KAFA 1WKGA 2YHKA 2VI9A 4CBRA 3A9YA 2PB2A 2PB0A 3FFRA 5HDMA 3NDNA 1M0QA 2CB1A 4GE7A 2YRIA 4OBUA 1DJEA 4UOYA 5DJ9A 4MQRA 3FKDA 1I43A 4Y0IA 4BHDA 2PO3A 5K8BA 4FFCA 3NYTA 3GZDA 1DGEA 1TOJA 2X8UA 4FL0A 3KKIA 1IAYA 4WLHA 2HOXA 2NMPA 3BCBA 3PDXA 3TCMA 2G7JA 4EB5A 1G7XA 3LG0A 4IX8A 4AZKA 4ISYA 1FG7A 1TOGA 1OHWA 1OATA 3RCHA 1AY8A 3WKSA 4OC9A 1IX7A 2O0RA 5EAVA 9AATA 3MBBA 1N31A 4WYGA 3BWNA 4UHMA 5E3KA 2AY9A 1V2DA 3VAXA 1ASAA 2HUFA 4IW7A 3EI7A 3QM2A 1YIZA 5BJ4A 1DKAA 3WCNA 1MDXA 2VGUA 3E2FA 4LNJA 4A6TA 1V72A 3QI6A 1O4SA 1U08A 1UU2A 3VK3A 3KGWA 2CINA 3BCAA 3BV0A 4JE5D 1TATA 3JWAA 4MGRA 2BYJA 4N0BA 1LKCA 1J32A 1E5EA 1EJIA 3EUCA 3MAFB 1AAWA 4A72A 1UU1A 3WLXA 1QIRA 1O69A 1ELUA 3HL2A 3Q8NA 2BWNA 1GC4A 2E7JA 1MAPA 3L8AA 1MGVA 3HQTA 1WSTA 1GBNA 1AHGA 2VMTA 1B4XA 1AIBA 1BQAA 1OHYA 2VI8A 3BB8A 3BC8A 3FQ8A 1CL1A 3ACZA 4PVFA 3ISLA 1AY5A 2Z67A 3UWCA 3AELA 3R4TA 4B98A 1KL1A 5LHAA 2VLFA 3HBXA 3DR7A 2WK8A 1LC5A 3ASAA 3AOWA 4LNMA 1OXPA 1QITA 1V2FA 1VP4A 5EIGA 3FQ7A 4Q76A 1Z3ZA 4HVKA 2JG2A 3EIAA 3M5UA 3NU8A 2R5EA 3II0A 2W7MA 4BMKA 2VGZA 2C0RA 2CH2A 2JGTA 3QN6A 5DJ1A 3B8XA 2DOUA 5EUDA 2A1VA 1M7YA 5KTBA 2HP1A 1IJIA 2W8VA 1BW0A 3PD6B 4MY5A 2KFPA 2YKVA 1KMJA 2Z9WA 3IF2A 3LVMA 2YKXA 3ATHA 3NU7A 2D66A 3B1DA 4PIWA 1GCKA 3I16A 3VK2A 1SZSA 1UU0A 2FQ6A 2EPJA 4JF0A 4H63Q 1QZ9A 2DR1A 3WX9A 1BT4A 1ELQA 4M2JA 1UKJA 2C7TA 1FG3A 3RBFA 4JEYA 4M2KA 1W23A 3FVXA 4EMYA 3NYUA 1AHFA 3B1EA 1IX6A 4M2MA 4F5KA 3N4SA 1YJSA 5M49A 3GJUA 3KGXA 4XJMA 5E4ZA 5E5IA 1QGNA 3JTXA 1LK9A 1D7SA 2HOYA 4W91A 4DGTA 4LW2A 2AY8A 5M46A 1X0MA 4KXKA 1S0AA 2BI5A 1M32A 4WXBA 4F5FA 4ADEA 3BN1A 4JE5A 3I4JA 1BJOB 4KAMA 3GBXA 1RV3A 4WYDA 2AY1A 1I48A 3CQ4A 4W5KA 2AATA 3W1HA 2DGKA 3T32A 2ZC0A 1AKCA 1IBJA 1N8PA 2AEUA 1AY4A 2JJGA 1H1CA 2GQNA 2VGSA 2ZYJA 4N0WA 4B9BA 2DGLA 3EIBA 3TQXA 3HLMA 3HT4A 4WLJA 1ECXA 3A9ZA 1GC3A 1D7UA 1EQBA 2VGTA 1D2FA 3AENB 3AEJC 3E2ZB 3TFTA 2BYLA 4UQVA 4K2IA 3JZLA 3MAFA 2D63A 4H51A 1YNUA 1GEYA 4ITGA 2QB2A 3ZRPA 1S06A 3FVUA 3QBOA 4PFFA 2O1BA 1W7MA 2FYFA 2VMZA 2OGAA 4L0OA 2ZY2A 4TV7A 2ZY3A 4ZSWA 1QJ5A 3WGCA 2Z61A 1CS1A 3K7YA 2YKUA 2R0TA 3TATA 1RVYA 5IWQA 2ZY5A 1ARSA 1S08A 5G4IA 1X29A 1AJSB 1SPAA 3AEMA 3D6KA 4IYOB 3K40A 4WB0B 4XAUA 2F8JA 2BHXA 4CBSA 1LC8A 3A8UX 1LS3A 2R2NA 1G4VA 1AX4A 3EI5A 2V1PA 3GWPA 1W7LA 4OTLA 2BIAA 4K2MA 1BJ4A 5FT4A 2JJHA 1SVVA 1TOKA 1E5FA 4AO9A 1WYTA 1XEYA 4A0RA 1BKGA 2AY4A 2D65A 1CQ6A 1Y4IA 3QPGA 4HF8A 1T3IA 1AAMA 5G4JA 3N4XA 4RITA 1J04A 2BIGA 2TPLA 3A9XA 2WK9A 3OP7A 1WKHA 2OATA 3PAAA 5BJ3A 3G8MA 1C0NA 3MC6A 3LVLB 2GMUA 3PJ0A 1LC7A 2BI1A 1C7GA 3CQ6A 5EUEA 4WP0A 2X3LA 1IX8A 3VOMA 3BS8A 2YCTA 4NOGA 1D7VA 2AY6A 4RLGA 5EAAA 1PFFA 4CXRA 1SF2A 3COGA 2BWOA 2VMUA 3GZDC 4R2NA 1DJ9A 2AEVA 1MDZA 1LW4A 1CQ8A 3LWSA 4A6RA 1WYUB 1H0CA 1AHYA 1S07A 1W7NA 3BWOA 3NUBA 3PDBB 2AY3A 4LW4A 2BI3A 2CJGA 5F8VA 2Z1ZA 3GSBA 3QHXA 4BQ0A 4MSOA 2OGEA 1YJZA 1YJYA 3FDBA 3AV7A 3R9AA 3GR9A 4TN4A 1ASEA 5JAYA 2OKJA 4IY7A 1ZODA 3N5MA 5C6UA 4XQ2A 3AENA 1ASGA 3ASBA 3DXWA 3E2ZA 1ZC9A 4GE9A 4JEWA 4ZDOA 2WKAA 3PGYA 4F5JA 3I5TA 1TPLA 3LVJA 3DXVA 1C9CA 2D64A 2JISA 2ZJGA 1M4NA 2E7IA 3FQAA 3OKSA 2VLHA 3H9XA 4J8LA 1FC4A 1O61A 2E54A 4MQQA 4GE4A 2Z20A 4W8IA 4E3QA 1ASLA 4XJPA 4RJ0A 1DFOA 1AHXA 1X2AA 2VMXA 3WY7A 3RBLA 5G0AA 2E7UA 2CTZA 2YCNA 5J8QA 4Y0DA 4F5GA 1O62A 3JWBA 3RCHB 1AJSA 2R5CB 4IYOA 4WB0A 3N4RA 4OYTA 2CJHA 1B5PA 1Z7DA 2BWPA 4AO4A 2WB6A 4E1OA 1GEXA 2BI2A 4K2BA 5D95A 2AY2A 4ATQA 1V2EA 4CXQA 3CBFA 2QSRA 3MAUA 3RUYA 2W7LA 2VMQA 1KMKA 4OBVA 5D5SA 1M6SA 2CANA 1ARTA 1VJOA 3GZCA 2VMYA 4QGRA 3DZZA 2VIAA 1PMOA 1XI9A 3FSLA 4R5ZA 4WXGA 4AH3A 1M0NA 2HORA 4RKDA 3DODA 2JJEA 1CL2A 1G4XA 3G7QA 4OT8A 2QA3A 1AHEA 3EI8A 4AZJA 3GETA 3WKRA 4KYOA 1ARHA 2V0YA 1G7WA 4ADCA 5M4DA 4F5MA 3E9KA 2QMAA 2VMSA 5AX8A 4EB7A 4GDYA 5M4BA 3EI6A 3AATA 1CQ7A 2ZY4A 2OKKA 4R5FA 1P3WA 3LVKA 2W7KA 1BJNA 1IVRA 2W8WA 3IHJA 1WYVB 1GC0A 4GEBA 2CY8A 2W8UA 4RM1A 3DU4A 2RFVA 4A0FA 1BS0A 2Z1YA 5EIGB 2GB3A 3LY1A 1RV4A 2CH1A 4ZASA 3DYDA 1TARA 1GC2A 5EFSA 1AMQA 1DGDA 1OHVA 1YOOA 2W7EA 3FCRA 3NUIA 4ATPA 4DQ6A 1KKJA 4GRXA 3L44A 4AOAA 1B5OA 4ZDPA 2QLRA 3BCXA 4TMRA 3VP6A 2HP2A 3EZ1A 3DC1A 3WCOA 1JF9A 5LH9A 2AY7A 3PIUA 1RVUA 2VMRA 3TFUA 1DTYA 5FT6A 3W1JA 4K05A 4XJOA 1ASDA 3F0HA 4RAEA 4Q6RA 3WZFA 3NX3A 3P6KA 3PD6A 5G09A 2VGWA 2G6WA 4OMAA 2Z9VA
chains in the Genus database with same CATH topology
2EO5A 1JG8A 2O7CA 1ZOBA 2FN6A 2W7FA 2XH1A 4BA4A 4A00A 4UHNA 1ASBA 5DX5A 5G2QA 1DJUA 1MDOA 2W7DA 2Z9UA 2W7JA 2OQXA 3AEPA 2W8JA 2W8TA 2ZSLA 3ZRRA 2ZP7A 4A6UA 1ARIA 3FZ7A 1ORDA 4ADDA 1JS3A 1PG8A 1AKAA 2EZ2A 1MLZA 2CFBA 3MADA 2BIEA 2R5CA 1B9HA 4F5IA 3F9TA 4Y0HA 1ASNA 1EG5A 3B46A 3AEOA 4W1WA 2HOZA 4RKCA 3H7FA 4I8AA 4F5LA 1BJOA 3FTBA 3F6TA 4ZWMA 3AEMC 8AATA 3EZSA 2FNUA 2Q7WA 2ZSMA 3VK4A 4WXFA 3JU7A 2YCPA 3ZZKA 2D7ZA 2W7GA 2D61A 2X5DA 2VMPA 1CZEA 1BJWA 1KKPA 1X28A 3G0TA 4ITXA 7AATA 4JF1A 2CJDA 3UE8A 5F9SA 1SFFA 3FVSA 4XK1A 5I92A 3FDDA 3BWNC 2XBNA 3ELEA 2EH6A 4MQPA 4MKKA 4ZAHA 4U2HA 4E77A 3RQ1A 4MKJA 3USFA 3MKJA 4XJLA 1SZKA 2BKWA 2Z9XA 2VMWA 4ZWVA 1AMRA 4RIZA 3ZRQA 1YIYA 1M0OA 4P3MA 4JEXA 3MC6C 3PPLA 3HVYA 3NTJA 1OXOA 1JS6A 4ZM3A 3UAKA 1WYVA 1W3UA 2C44A 1TASA 2VMVA 3FRKA 3QGUA 2EZ1A 4PFNA 4U1TA 4W1VA 4ZLVA 4A0GA 3NNKA 3E2YA 1QJ3A 5G2PA 5HHYA 2HUUA 1IUGA 5EQCA 1CZCA 2WK7A 3W1IA 1IAXA 4BA5A 2CSTA 1TOEA 1VEFA 3FD0A 4J5UA 4Q31A 3KE3A 4WYEA 2FKIA 4WYFA 2DKBA 1B8GA 3FZ8A 4ZSYA 1MLYA 2QBTA 1AJRA 3DR4A 4LNLA 1S09A 1C7NA 3LV2A 1TOIA 1WYTB 3NRAA 5EUNA 3RI6A 2EYQA 3E6GA 4JEZA 4LC3A 2X5FA 3DRDA 4IXZA 1B9IA 4OCAA 2GMSA 1D7RA 1I41A 1BQDA 1AIAA 1ASFA 2ZUKA 3AEJA 3WGBA 5HXXA 1ARGA 3MEBA 3ELPA 3CAIA 2YOBA 1AICA 2W7IA 1C4KA 2HZPA 2JJFA 3AOVA 4EFFA 3A2BA 4EU1A 1N2TA 2DGMA 4F5HA 1LW5A 1MAQA 2FNIA 4Q75A 3N7NA 2FM1A 2VMOA 2YRRA 5FT8A 2EGYA 2HUIA 4O6ZA 1KL2A 4XEWA 3ECDA 2VGVA 1CJ0A 2D5YA 4P7YA 2GSAA 4RJYA 3FZ6A 3N0LA 3N75A 4WBTA 3E77A 2BI9A 4WD2A 2C81A 4CVQA 3FFHA 1PMMA 1YAAA 3HDOA 3K28A 3P1TA 4DBCA 1GDEA 4IXSA 4UHOA 4JEVA 1ASMA 2D7YA 1GEWA 1GD9A 3EI9A 1SZUA 3B1CA 4GSAA 4IXOA 1WYUA 2DKJA 2YKYA 1AKBA 3CQ5A 3H14A 3PDBA 4WYAA 4ZDLA 4F4EA 3ZZJA 4ADBA 5FT5A 4WYCA 2QB3A 1M0PA 3HMUA 3NYSA 4E3RA 1AMSA 4ZM4A 5TF5A 1QISA 4A0HA 4R8DA 1C7OA 2W7HA 2AY5A 1I29A 5DB5A 2ORDA 2VIBA 2VMNA 3JW9A 1AMAA 1ASCA 3PA9A 4W1XA 2VYCA 1WKGA 2YHKA 2VI9A 4CBRA 3A9YA 2PB2A 2PB0A 3FFRA 5HDMA 3NDNA 1M0QA 2CB1A 4GE7A 2YRIA 4OBUA 1DJEA 4UOYA 5DJ9A 4MQRA 3FKDA 1I43A 4Y0IA 4BHDA 2PO3A 5K8BA 4FFCA 3NYTA 3GZDA 1DGEA 1TOJA 2X8UA 4FL0A 3KKIA 1IAYA 4WLHA 2HOXA 2NMPA 3BCBA 3PDXA 3TCMA 2G7JA 4EB5A 1G7XA 3LG0A 4IX8A 4AZKA 4ISYA 1FG7A 1TOGA 1OHWA 1OATA 3RCHA 1AY8A 3WKSA 4OC9A 1IX7A 2O0RA 5EAVA 9AATA 3MBBA 1N31A 4WYGA 3BWNA 4UHMA 5E3KA 2AY9A 1V2DA 3VAXA 1ASAA 2HUFA 4IW7A 3EI7A 3QM2A 1YIZA 5BJ4A 1DKAA 3WCNA 1MDXA 2VGUA 3E2FA 4LNJA 4A6TA 1V72A 3QI6A 1O4SA 1U08A 1UU2A 3VK3A 3KGWA 2CINA 3BCAA 3BV0A 4JE5D 1TATA 3JWAA 4MGRA 2BYJA 4N0BA 1LKCA 1J32A 1E5EA 1EJIA 3EUCA 3MAFB 1AAWA 4A72A 1UU1A 3WLXA 1QIRA 1O69A 1ELUA 3HL2A 3Q8NA 2BWNA 1GC4A 2E7JA 1MAPA 3L8AA 1MGVA 3HQTA 1WSTA 1GBNA 1AHGA 2VMTA 1B4XA 1AIBA 1BQAA 1OHYA 2VI8A 3BB8A 3BC8A 3FQ8A 1CL1A 3ACZA 4PVFA 3ISLA 1AY5A 2Z67A 3UWCA 3AELA 3R4TA 4B98A 1KL1A 5LHAA 2VLFA 3HBXA 3DR7A 2WK8A 1LC5A 3ASAA 3AOWA 4LNMA 1OXPA 1QITA 1V2FA 1VP4A 5EIGA 3FQ7A 4Q76A 1Z3ZA 4HVKA 2JG2A 3EIAA 3M5UA 3NU8A 2R5EA 3II0A 2W7MA 4BMKA 2VGZA 2C0RA 2CH2A 2JGTA 3QN6A 5DJ1A 3B8XA 2DOUA 5EUDA 2A1VA 1M7YA 5KTBA 2HP1A 1IJIA 2W8VA 1BW0A 3PD6B 4MY5A 2KFPA 2YKVA 1KMJA 2Z9WA 3IF2A 3LVMA 2YKXA 3ATHA 3NU7A 2D66A 3B1DA 4PIWA 1GCKA 3I16A 3VK2A 1SZSA 1UU0A 2FQ6A 2EPJA 4JF0A 4H63Q 1QZ9A 2DR1A 3WX9A 1BT4A 1ELQA 4M2JA 1UKJA 2C7TA 1FG3A 3RBFA 4JEYA 4M2KA 1W23A 3FVXA 4EMYA 3NYUA 1AHFA 3B1EA 1IX6A 4M2MA 4F5KA 3N4SA 1YJSA 5M49A 3GJUA 3KGXA 4XJMA 5E4ZA 5E5IA 1QGNA 3JTXA 1LK9A 1D7SA 2HOYA 4W91A 4DGTA 4LW2A 2AY8A 5M46A 1X0MA 4KXKA 1S0AA 2BI5A 1M32A 4WXBA 4F5FA 4ADEA 3BN1A 4JE5A 3I4JA 1BJOB 4KAMA 3GBXA 1RV3A 4WYDA 2AY1A 1I48A 3CQ4A 4W5KA 2AATA 3W1HA 2DGKA 3T32A 2ZC0A 1AKCA 1IBJA 1N8PA 2AEUA 1AY4A 2JJGA 1H1CA 2GQNA 2VGSA 2ZYJA 4N0WA 4B9BA 2DGLA 3EIBA 3TQXA 3HLMA 3HT4A 4WLJA 1ECXA 3A9ZA 1GC3A 1D7UA 1EQBA 2VGTA 1D2FA 3AENB 3AEJC 3E2ZB 3TFTA 2BYLA 4UQVA 4K2IA 3JZLA 3MAFA 2D63A 4H51A 1YNUA 1GEYA 4ITGA 2QB2A 3ZRPA 1S06A 3FVUA 3QBOA 4PFFA 2O1BA 1W7MA 2FYFA 2VMZA 2OGAA 4L0OA 2ZY2A 4TV7A 2ZY3A 4ZSWA 1QJ5A 3WGCA 2Z61A 1CS1A 3K7YA 2YKUA 2R0TA 3TATA 1RVYA 5IWQA 2ZY5A 1ARSA 1S08A 5G4IA 1X29A 1AJSB 1SPAA 3AEMA 3D6KA 4IYOB 3K40A 4WB0B 4XAUA 2F8JA 2BHXA 4CBSA 1LC8A 3A8UX 1LS3A 2R2NA 1G4VA 1AX4A 3EI5A 2V1PA 3GWPA 1W7LA 4OTLA 2BIAA 4K2MA 1BJ4A 5FT4A 2JJHA 1SVVA 1TOKA 1E5FA 4AO9A 1WYTA 1XEYA 4A0RA 1BKGA 2AY4A 2D65A 1CQ6A 1Y4IA 3QPGA 4HF8A 1T3IA 1AAMA 5G4JA 3N4XA 4RITA 1J04A 2BIGA 2TPLA 3A9XA 2WK9A 3OP7A 1WKHA 2OATA 3PAAA 5BJ3A 3G8MA 1C0NA 3MC6A 3LVLB 2GMUA 3PJ0A 1LC7A 2BI1A 1C7GA 3CQ6A 5EUEA 4WP0A 2X3LA 1IX8A 3VOMA 3BS8A 2YCTA 4NOGA 1D7VA 2AY6A 4RLGA 5EAAA 1PFFA 4CXRA 1SF2A 3COGA 2BWOA 2VMUA 3GZDC 4R2NA 1DJ9A 2AEVA 1MDZA 1LW4A 1CQ8A 3LWSA 4A6RA 1WYUB 1H0CA 1AHYA 1S07A 1W7NA 3BWOA 3NUBA 3PDBB 2AY3A 4LW4A 2BI3A 2CJGA 5F8VA 2Z1ZA 3GSBA 3QHXA 4BQ0A 4MSOA 2OGEA 1YJZA 1YJYA 3FDBA 3AV7A 3R9AA 3GR9A 4TN4A 1ASEA 5JAYA 2OKJA 4IY7A 1ZODA 3N5MA 5C6UA 4XQ2A 3AENA 1ASGA 3ASBA 3DXWA 3E2ZA 1ZC9A 4GE9A 4JEWA 4ZDOA 2WKAA 3PGYA 4F5JA 3I5TA 1TPLA 3LVJA 3DXVA 1C9CA 2D64A 2JISA 2ZJGA 1M4NA 2E7IA 3FQAA 3OKSA 2VLHA 3H9XA 4J8LA 1FC4A 1O61A 2E54A 4MQQA 4GE4A 2Z20A 4W8IA 4E3QA 1ASLA 4XJPA 4RJ0A 1DFOA 1AHXA 1X2AA 2VMXA 3WY7A 3RBLA 5G0AA 2E7UA 2CTZA 2YCNA 5J8QA 4Y0DA 4F5GA 1O62A 3JWBA 3RCHB 1AJSA 2R5CB 4IYOA 4WB0A 3N4RA 4OYTA 2CJHA 1B5PA 1Z7DA 2BWPA 4AO4A 2WB6A 4E1OA 1GEXA 2BI2A 4K2BA 5D95A 2AY2A 4ATQA 1V2EA 4CXQA 3CBFA 2QSRA 3MAUA 3RUYA 2W7LA 2VMQA 1KMKA 4OBVA 5D5SA 1M6SA 2CANA 1ARTA 1VJOA 3GZCA 2VMYA 4QGRA 3DZZA 2VIAA 1PMOA 1XI9A 3FSLA 4R5ZA 4WXGA 4AH3A 1M0NA 2HORA 4RKDA 3DODA 2JJEA 1CL2A 1G4XA 3G7QA 4OT8A 2QA3A 1AHEA 3EI8A 4AZJA 3GETA 3WKRA 4KYOA 1ARHA 2V0YA 1G7WA 4ADCA 5M4DA 4F5MA 3E9KA 2QMAA 2VMSA 5AX8A 4EB7A 4GDYA 5M4BA 3EI6A 3AATA 1CQ7A 2ZY4A 2OKKA 4R5FA 1P3WA 3LVKA 2W7KA 1BJNA 1IVRA 2W8WA 3IHJA 1WYVB 1GC0A 4GEBA 2CY8A 2W8UA 4RM1A 3DU4A 2RFVA 4A0FA 1BS0A 2Z1YA 5EIGB 2GB3A 3LY1A 1RV4A 2CH1A 4ZASA 3DYDA 1TARA 1GC2A 5EFSA 1AMQA 1DGDA 1OHVA 1YOOA 2W7EA 3FCRA 3NUIA 4ATPA 4DQ6A 1KKJA 4GRXA 3L44A 4AOAA 1B5OA 4ZDPA 2QLRA 3BCXA 4TMRA 3VP6A 2HP2A 3EZ1A 3DC1A 3WCOA 1JF9A 5LH9A 2AY7A 3PIUA 1RVUA 2VMRA 3TFUA 1DTYA 5FT6A 3W1JA 4K05A 4XJOA 1ASDA 3F0HA 4RAEA 4Q6RA 3WZFA 3NX3A 3P6KA 3PD6A 5G09A 2VGWA 2G6WA 4OMAA 2Z9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EO5 A;  1JG8 A;  2O7C A;  1ZOB A;  2FN6 A;  2W7F A;  2XH1 A;  4BA4 A;  4A00 A;  4UHN A;  1ASB A;  5DX5 A;  5G2Q A;  1DJU A;  1MDO A;  2W7D A;  2Z9U A;  2W7J A;  2OQX A;  3AEP A;  2W8J A;  2W8T A;  2ZSL A;  3ZRR A;  2ZP7 A;  4A6U A;  1ARI A;  3FZ7 A;  1ORD A;  4ADD A;  1JS3 A;  1PG8 A;  1AKA A;  2EZ2 A;  1MLZ A;  2CFB A;  3MAD A;  2BIE A;  2R5C A;  1B9H A;  4F5I A;  3F9T A;  4Y0H A;  1ASN A;  1EG5 A;  3B46 A;  3AEO A;  4W1W A;  2HOZ A;  4RKC A;  3H7F A;  4I8A A;  4F5L A;  1BJO A;  3FTB A;  3F6T A;  4ZWM A;  3AEM C;  8AAT A;  3EZS A;  2FNU A;  2Q7W A;  2ZSM A;  3VK4 A;  4WXF A;  3JU7 A;  2YCP A;  3ZZK A;  2D7Z A;  2W7G A;  2D61 A;  2X5D A;  2VMP A;  1CZE A;  1BJW A;  1KKP A;  1X28 A;  3G0T A;  4ITX A;  7AAT A;  4JF1 A;  2CJD A;  3UE8 A;  5F9S A;  1SFF A;  3FVS A;  4XK1 A;  5I92 A;  3FDD A;  3BWN C;  2XBN A;  3ELE A;  2EH6 A;  4MQP A;  4MKK A;  4ZAH A;  4U2H A;  4E77 A;  3RQ1 A;  4MKJ A;  3USF A;  3MKJ A;  4XJL A;  1SZK A;  2BKW A;  2Z9X A;  2VMW A;  4ZWV A;  1AMR A;  4RIZ A;  3ZRQ A;  1YIY A;  1M0O A;  4P3M A;  4JEX A;  3MC6 C;  3PPL A;  3HVY A;  3NTJ A;  1OXO A;  1JS6 A;  4ZM3 A;  3UAK A;  1WYV A;  1W3U A;  2C44 A;  1TAS A;  2VMV A;  3FRK A;  3QGU A;  2EZ1 A;  4PFN A;  4U1T A;  4W1V A;  4ZLV A;  4A0G A;  3NNK A;  3E2Y A;  1QJ3 A;  5G2P A;  5HHY A;  2HUU A;  1IUG A;  5EQC A;  1CZC A;  2WK7 A;  3W1I A;  1IAX A;  4BA5 A;  2CST A;  1TOE A;  1VEF A;  3FD0 A;  4J5U A;  4Q31 A;  3KE3 A;  4WYE A;  4WYF A;  2DKB A;  1B8G A;  3FZ8 A;  4ZSY A;  1MLY A;  2QBT A;  1AJR A;  3DR4 A;  4LNL A;  1S09 A;  1C7N A;  3LV2 A;  1TOI A;  1WYT B;  3NRA A;  5EUN A;  3RI6 A;  3E6G A;  4JEZ A;  4LC3 A;  2X5F A;  3DRD A;  4IXZ A;  1B9I A;  4OCA A;  2GMS A;  1D7R A;  1I41 A;  1BQD A;  1AIA A;  1ASF A;  2ZUK A;  3AEJ A;  3WGB A;  5HXX A;  1ARG A;  3MEB A;  3ELP A;  3CAI A;  2YOB A;  1AIC A;  2W7I A;  1C4K A;  2HZP A;  2JJF A;  3AOV A;  4EFF A;  3A2B A;  4EU1 A;  1N2T A;  2DGM A;  4F5H A;  1LW5 A;  1MAQ A;  2FNI A;  4Q75 A;  2FM1 A;  2VMO A;  2YRR A;  5FT8 A;  2EGY A;  2HUI A;  4O6Z A;  1KL2 A;  4XEW A;  3ECD A;  2VGV A;  1CJ0 A;  2D5Y A;  4P7Y A;  2GSA A;  4RJY A;  3FZ6 A;  3N0L A;  3N75 A;  4WBT A;  3E77 A;  2BI9 A;  4WD2 A;  2C81 A;  4CVQ A;  3FFH A;  1PMM A;  1YAA A;  3HDO A;  3K28 A;  3P1T A;  4DBC A;  1GDE A;  4IXS A;  4UHO A;  4JEV A;  1ASM A;  2D7Y A;  1GEW A;  1GD9 A;  3EI9 A;  1SZU A;  3B1C A;  4GSA A;  4IXO A;  1WYU A;  2DKJ A;  2YKY A;  1AKB A;  3CQ5 A;  3H14 A;  3PDB A;  4WYA A;  4ZDL A;  4F4E A;  3ZZJ A;  4ADB A;  5FT5 A;  4WYC A;  2QB3 A;  1M0P A;  3HMU A;  3NYS A;  4E3R A;  1AMS A;  4ZM4 A;  5TF5 A;  1QIS A;  4A0H A;  4R8D A;  1C7O A;  2W7H A;  2AY5 A;  1I29 A;  5DB5 A;  2ORD A;  2VIB A;  2VMN A;  3JW9 A;  1AMA A;  1ASC A;  3PA9 A;  4W1X A;  2VYC A;  1WKG A;  2YHK A;  2VI9 A;  4CBR A;  3A9Y A;  2PB2 A;  2PB0 A;  3FFR A;  5HDM A;  3NDN A;  1M0Q A;  2CB1 A;  4GE7 A;  2YRI A;  4OBU A;  1DJE A;  4UOY A;  5DJ9 A;  4MQR A;  3FKD A;  1I43 A;  4Y0I A;  4BHD A;  2PO3 A;  5K8B A;  4FFC A;  3NYT A;  3GZD A;  1DGE A;  1TOJ A;  2X8U A;  4FL0 A;  3KKI A;  1IAY A;  4WLH A;  2HOX A;  2NMP A;  3BCB A;  3PDX A;  3TCM A;  4EB5 A;  1G7X A;  3LG0 A;  4IX8 A;  4AZK A;  4ISY A;  1FG7 A;  1TOG A;  1OHW A;  1OAT A;  3RCH A;  1AY8 A;  3WKS A;  4OC9 A;  1IX7 A;  2O0R A;  5EAV A;  9AAT A;  3MBB A;  1N31 A;  4WYG A;  3BWN A;  4UHM A;  5E3K A;  2AY9 A;  1V2D A;  3VAX A;  1ASA A;  2HUF A;  4IW7 A;  3EI7 A;  3QM2 A;  1YIZ A;  5BJ4 A;  1DKA A;  3WCN A;  1MDX A;  2VGU A;  3E2F A;  4LNJ A;  4A6T A;  1V72 A;  3QI6 A;  1O4S A;  1U08 A;  1UU2 A;  3VK3 A;  3KGW A;  2CIN A;  3BCA A;  3BV0 A;  4JE5 D;  1TAT A;  3JWA A;  4MGR A;  2BYJ A;  4N0B A;  1LKC A;  1J32 A;  1E5E A;  1EJI A;  3EUC A;  3MAF B;  1AAW A;  4A72 A;  1UU1 A;  3WLX A;  1QIR A;  1O69 A;  1ELU A;  3HL2 A;  3Q8N A;  2BWN A;  1GC4 A;  2E7J A;  1MAP A;  3L8A A;  1MGV A;  3HQT A;  1WST A;  1GBN A;  1AHG A;  2VMT A;  1B4X A;  1AIB A;  1BQA A;  1OHY A;  2VI8 A;  3BB8 A;  3BC8 A;  3FQ8 A;  1CL1 A;  3ACZ A;  4PVF A;  3ISL A;  1AY5 A;  2Z67 A;  3UWC A;  3AEL A;  3R4T A;  4B98 A;  1KL1 A;  5LHA A;  2VLF A;  3HBX A;  3DR7 A;  2WK8 A;  1LC5 A;  3ASA A;  3AOW A;  4LNM A;  1OXP A;  1QIT A;  1V2F A;  1VP4 A;  5EIG A;  3FQ7 A;  4Q76 A;  1Z3Z A;  4HVK A;  2JG2 A;  3EIA A;  3M5U A;  3NU8 A;  2R5E A;  3II0 A;  2W7M A;  4BMK A;  2VGZ A;  2C0R A;  2CH2 A;  2JGT A;  3QN6 A;  5DJ1 A;  3B8X A;  2DOU A;  5EUD A;  1M7Y A;  2HP1 A;  1IJI A;  2W8V A;  1BW0 A;  3PD6 B;  4MY5 A;  2YKV A;  1KMJ A;  2Z9W A;  3IF2 A;  3LVM A;  2YKX A;  3ATH A;  3NU7 A;  2D66 A;  3B1D A;  4PIW A;  1GCK A;  3I16 A;  3VK2 A;  1SZS A;  1UU0 A;  2FQ6 A;  2EPJ A;  4JF0 A;  1QZ9 A;  2DR1 A;  3WX9 A;  1BT4 A;  1ELQ A;  4M2J A;  1UKJ A;  2C7T A;  1FG3 A;  3RBF A;  4JEY A;  4M2K A;  1W23 A;  3FVX A;  4EMY A;  3NYU A;  1AHF A;  3B1E A;  1IX6 A;  4M2M A;  4F5K A;  1YJS A;  5M49 A;  3GJU A;  3KGX A;  4XJM A;  5E4Z A;  5E5I A;  1QGN A;  3JTX A;  1LK9 A;  1D7S A;  2HOY A;  4W91 A;  4DGT A;  4LW2 A;  2AY8 A;  5M46 A;  1X0M A;  4KXK A;  1S0A A;  2BI5 A;  1M32 A;  4WXB A;  4F5F A;  4ADE A;  3BN1 A;  4JE5 A;  3I4J A;  1BJO B;  4KAM A;  3GBX A;  1RV3 A;  4WYD A;  2AY1 A;  1I48 A;  3CQ4 A;  4W5K A;  2AAT A;  3W1H A;  2DGK A;  3T32 A;  2ZC0 A;  1AKC A;  1IBJ A;  1N8P A;  2AEU A;  1AY4 A;  2JJG A;  1H1C A;  2GQN A;  2VGS A;  2ZYJ A;  4N0W A;  4B9B A;  2DGL A;  3EIB A;  3TQX A;  3HLM A;  3HT4 A;  4WLJ A;  1ECX A;  3A9Z A;  1GC3 A;  1D7U A;  1EQB A;  2VGT A;  1D2F A;  3AEN B;  3AEJ C;  3E2Z B;  3TFT A;  2BYL A;  4UQV A;  4K2I A;  3JZL A;  3MAF A;  2D63 A;  4H51 A;  1YNU A;  1GEY A;  4ITG A;  2QB2 A;  3ZRP A;  1S06 A;  3FVU A;  3QBO A;  4PFF A;  2O1B A;  1W7M A;  2FYF A;  2VMZ A;  2OGA A;  4L0O A;  2ZY2 A;  4TV7 A;  2ZY3 A;  4ZSW A;  1QJ5 A;  3WGC A;  2Z61 A;  1CS1 A;  3K7Y A;  2YKU A;  2R0T A;  3TAT A;  1RVY A;  5IWQ A;  2ZY5 A;  1ARS A;  1S08 A;  5G4I A;  1X29 A;  1AJS B;  1SPA A;  3AEM A;  3D6K A;  4IYO B;  3K40 A;  4WB0 B;  4XAU A;  2F8J A;  2BHX A;  4CBS A;  1LC8 A;  3A8U X;  1LS3 A;  2R2N A;  1G4V A;  1AX4 A;  3EI5 A;  2V1P A;  3GWP A;  1W7L A;  4OTL A;  2BIA A;  4K2M A;  1BJ4 A;  5FT4 A;  2JJH A;  1SVV A;  1TOK A;  1E5F A;  4AO9 A;  1WYT A;  1XEY A;  4A0R A;  1BKG A;  2AY4 A;  2D65 A;  1CQ6 A;  1Y4I A;  3QPG A;  4HF8 A;  1T3I A;  1AAM A;  5G4J A;  4RIT A;  1J04 A;  2BIG A;  2TPL A;  3A9X A;  2WK9 A;  3OP7 A;  1WKH A;  2OAT A;  3PAA A;  5BJ3 A;  3G8M A;  1C0N A;  3MC6 A;  3LVL B;  2GMU A;  3PJ0 A;  1LC7 A;  2BI1 A;  1C7G A;  3CQ6 A;  5EUE A;  4WP0 A;  2X3L A;  1IX8 A;  3VOM A;  3BS8 A;  2YCT A;  4NOG A;  1D7V A;  2AY6 A;  4RLG A;  5EAA A;  1PFF A;  4CXR A;  1SF2 A;  3COG A;  2BWO A;  2VMU A;  3GZD C;  4R2N A;  1DJ9 A;  2AEV A;  1MDZ A;  1LW4 A;  1CQ8 A;  3LWS A;  4A6R A;  1WYU B;  1H0C A;  1AHY A;  1S07 A;  1W7N A;  3BWO A;  3NUB A;  3PDB B;  2AY3 A;  4LW4 A;  2BI3 A;  2CJG A;  5F8V A;  2Z1Z A;  3GSB A;  3QHX A;  4BQ0 A;  4MSO A;  2OGE A;  1YJZ A;  1YJY A;  3FDB A;  3AV7 A;  3R9A A;  3GR9 A;  4TN4 A;  1ASE A;  5JAY A;  2OKJ A;  4IY7 A;  1ZOD A;  3N5M A;  5C6U A;  4XQ2 A;  3AEN A;  1ASG A;  3ASB A;  3DXW A;  3E2Z A;  1ZC9 A;  4GE9 A;  4JEW A;  4ZDO A;  2WKA A;  3PGY A;  4F5J A;  3I5T A;  1TPL A;  3LVJ A;  3DXV A;  1C9C A;  2D64 A;  2JIS A;  2ZJG A;  1M4N A;  2E7I A;  3FQA A;  3OKS A;  2VLH A;  4J8L A;  1FC4 A;  1O61 A;  2E54 A;  4MQQ A;  4GE4 A;  2Z20 A;  4W8I A;  4E3Q A;  1ASL A;  4XJP A;  4RJ0 A;  1DFO A;  1AHX A;  1X2A A;  2VMX A;  3WY7 A;  3RBL A;  5G0A A;  2E7U A;  2CTZ A;  2YCN A;  5J8Q A;  4Y0D A;  4F5G A;  1O62 A;  3JWB A;  3RCH B;  1AJS A;  2R5C B;  4IYO A;  4WB0 A;  4OYT A;  2CJH A;  1B5P A;  1Z7D A;  2BWP A;  4AO4 A;  4E1O A;  1GEX A;  2BI2 A;  4K2B A;  5D95 A;  2AY2 A;  4ATQ A;  1V2E A;  4CXQ A;  3CBF A;  3MAU A;  3RUY A;  2W7L A;  2VMQ A;  1KMK A;  4OBV A;  5D5S A;  1M6S A;  2CAN A;  1ART A;  1VJO A;  3GZC A;  2VMY A;  4QGR A;  3DZZ A;  2VIA A;  1PMO A;  1XI9 A;  3FSL A;  4R5Z A;  4WXG A;  4AH3 A;  1M0N A;  2HOR A;  4RKD A;  3DOD A;  2JJE A;  1CL2 A;  1G4X A;  3G7Q A;  4OT8 A;  2QA3 A;  1AHE A;  3EI8 A;  4AZJ A;  3GET A;  3WKR A;  4KYO A;  1ARH A;  2V0Y A;  1G7W A;  4ADC A;  5M4D A;  4F5M A;  3E9K A;  2QMA A;  2VMS A;  5AX8 A;  4EB7 A;  4GDY A;  5M4B A;  3EI6 A;  3AAT A;  1CQ7 A;  2ZY4 A;  2OKK A;  4R5F A;  1P3W A;  3LVK A;  2W7K A;  1BJN A;  1IVR A;  2W8W A;  3IHJ A;  1WYV B;  1GC0 A;  4GEB A;  2CY8 A;  2W8U A;  4RM1 A;  3DU4 A;  2RFV A;  4A0F A;  1BS0 A;  2Z1Y A;  5EIG B;  2GB3 A;  3LY1 A;  1RV4 A;  2CH1 A;  4ZAS A;  3DYD A;  1TAR A;  1GC2 A;  5EFS A;  1AMQ A;  1DGD A;  1OHV A;  1YOO A;  2W7E A;  3FCR A;  3NUI A;  4ATP A;  4DQ6 A;  1KKJ A;  4GRX A;  3L44 A;  4AOA A;  1B5O A;  4ZDP A;  2QLR A;  3BCX A;  4TMR A;  3VP6 A;  2HP2 A;  3EZ1 A;  3DC1 A;  3WCO A;  1JF9 A;  5LH9 A;  2AY7 A;  3PIU A;  1RVU A;  2VMR A;  3TFU A;  1DTY A;  5FT6 A;  3W1J A;  4XJO A;  1ASD A;  3F0H A;  4RAE A;  4Q6R A;  3WZF A;  3NX3 A;  3P6K A;  3PD6 A;  5G09 A;  2VGW A;  2G6W A;  4OMA A;  2Z9V A; 
#chains in the Genus database with same CATH topology
 2EO5 A;  1JG8 A;  2O7C A;  1ZOB A;  2FN6 A;  2W7F A;  2XH1 A;  4BA4 A;  4A00 A;  4UHN A;  1ASB A;  5DX5 A;  5G2Q A;  1DJU A;  1MDO A;  2W7D A;  2Z9U A;  2W7J A;  2OQX A;  3AEP A;  2W8J A;  2W8T A;  2ZSL A;  3ZRR A;  2ZP7 A;  4A6U A;  1ARI A;  3FZ7 A;  1ORD A;  4ADD A;  1JS3 A;  1PG8 A;  1AKA A;  2EZ2 A;  1MLZ A;  2CFB A;  3MAD A;  2BIE A;  2R5C A;  1B9H A;  4F5I A;  3F9T A;  4Y0H A;  1ASN A;  1EG5 A;  3B46 A;  3AEO A;  4W1W A;  2HOZ A;  4RKC A;  3H7F A;  4I8A A;  4F5L A;  1BJO A;  3FTB A;  3F6T A;  4ZWM A;  3AEM C;  8AAT A;  3EZS A;  2FNU A;  2Q7W A;  2ZSM A;  3VK4 A;  4WXF A;  3JU7 A;  2YCP A;  3ZZK A;  2D7Z A;  2W7G A;  2D61 A;  2X5D A;  2VMP A;  1CZE A;  1BJW A;  1KKP A;  1X28 A;  3G0T A;  4ITX A;  7AAT A;  4JF1 A;  2CJD A;  3UE8 A;  5F9S A;  1SFF A;  3FVS A;  4XK1 A;  5I92 A;  3FDD A;  3BWN C;  2XBN A;  3ELE A;  2EH6 A;  4MQP A;  4MKK A;  4ZAH A;  4U2H A;  4E77 A;  3RQ1 A;  4MKJ A;  3USF A;  3MKJ A;  4XJL A;  1SZK A;  2BKW A;  2Z9X A;  2VMW A;  4ZWV A;  1AMR A;  4RIZ A;  3ZRQ A;  1YIY A;  1M0O A;  4P3M A;  4JEX A;  3MC6 C;  3PPL A;  3HVY A;  3NTJ A;  1OXO A;  1JS6 A;  4ZM3 A;  3UAK A;  1WYV A;  1W3U A;  2C44 A;  1TAS A;  2VMV A;  3FRK A;  3QGU A;  2EZ1 A;  4PFN A;  4U1T A;  4W1V A;  4ZLV A;  4A0G A;  3NNK A;  3E2Y A;  1QJ3 A;  5G2P A;  5HHY A;  2HUU A;  1IUG A;  5EQC A;  1CZC A;  2WK7 A;  3W1I A;  1IAX A;  4BA5 A;  2CST A;  1TOE A;  1VEF A;  3FD0 A;  4J5U A;  4Q31 A;  3KE3 A;  4WYE A;  2FKI A;  4WYF A;  2DKB A;  1B8G A;  3FZ8 A;  4ZSY A;  1MLY A;  2QBT A;  1AJR A;  3DR4 A;  4LNL A;  1S09 A;  1C7N A;  3LV2 A;  1TOI A;  1WYT B;  3NRA A;  5EUN A;  3RI6 A;  2EYQ A;  3E6G A;  4JEZ A;  4LC3 A;  2X5F A;  3DRD A;  4IXZ A;  1B9I A;  4OCA A;  2GMS A;  1D7R A;  1I41 A;  1BQD A;  1AIA A;  1ASF A;  2ZUK A;  3AEJ A;  3WGB A;  5HXX A;  1ARG A;  3MEB A;  3ELP A;  3CAI A;  2YOB A;  1AIC A;  2W7I A;  1C4K A;  2HZP A;  2JJF A;  3AOV A;  4EFF A;  3A2B A;  4EU1 A;  1N2T A;  2DGM A;  4F5H A;  1LW5 A;  1MAQ A;  2FNI A;  4Q75 A;  3N7N A;  2FM1 A;  2VMO A;  2YRR A;  5FT8 A;  2EGY A;  2HUI A;  4O6Z A;  1KL2 A;  4XEW A;  3ECD A;  2VGV A;  1CJ0 A;  2D5Y A;  4P7Y A;  2GSA A;  4RJY A;  3FZ6 A;  3N0L A;  3N75 A;  4WBT A;  3E77 A;  2BI9 A;  4WD2 A;  2C81 A;  4CVQ A;  3FFH A;  1PMM A;  1YAA A;  3HDO A;  3K28 A;  3P1T A;  4DBC A;  1GDE A;  4IXS A;  4UHO A;  4JEV A;  1ASM A;  2D7Y A;  1GEW A;  1GD9 A;  3EI9 A;  1SZU A;  3B1C A;  4GSA A;  4IXO A;  1WYU A;  2DKJ A;  2YKY A;  1AKB A;  3CQ5 A;  3H14 A;  3PDB A;  4WYA A;  4ZDL A;  4F4E A;  3ZZJ A;  4ADB A;  5FT5 A;  4WYC A;  2QB3 A;  1M0P A;  3HMU A;  3NYS A;  4E3R A;  1AMS A;  4ZM4 A;  5TF5 A;  1QIS A;  4A0H A;  4R8D A;  1C7O A;  2W7H A;  2AY5 A;  1I29 A;  5DB5 A;  2ORD A;  2VIB A;  2VMN A;  3JW9 A;  1AMA A;  1ASC A;  3PA9 A;  4W1X A;  2VYC A;  1KAF A;  1WKG A;  2YHK A;  2VI9 A;  4CBR A;  3A9Y A;  2PB2 A;  2PB0 A;  3FFR A;  5HDM A;  3NDN A;  1M0Q A;  2CB1 A;  4GE7 A;  2YRI A;  4OBU A;  1DJE A;  4UOY A;  5DJ9 A;  4MQR A;  3FKD A;  1I43 A;  4Y0I A;  4BHD A;  2PO3 A;  5K8B A;  4FFC A;  3NYT A;  3GZD A;  1DGE A;  1TOJ A;  2X8U A;  4FL0 A;  3KKI A;  1IAY A;  4WLH A;  2HOX A;  2NMP A;  3BCB A;  3PDX A;  3TCM A;  2G7J A;  4EB5 A;  1G7X A;  3LG0 A;  4IX8 A;  4AZK A;  4ISY A;  1FG7 A;  1TOG A;  1OHW A;  1OAT A;  3RCH A;  1AY8 A;  3WKS A;  4OC9 A;  1IX7 A;  2O0R A;  5EAV A;  9AAT A;  3MBB A;  1N31 A;  4WYG A;  3BWN A;  4UHM A;  5E3K A;  2AY9 A;  1V2D A;  3VAX A;  1ASA A;  2HUF A;  4IW7 A;  3EI7 A;  3QM2 A;  1YIZ A;  5BJ4 A;  1DKA A;  3WCN A;  1MDX A;  2VGU A;  3E2F A;  4LNJ A;  4A6T A;  1V72 A;  3QI6 A;  1O4S A;  1U08 A;  1UU2 A;  3VK3 A;  3KGW A;  2CIN A;  3BCA A;  3BV0 A;  4JE5 D;  1TAT A;  3JWA A;  4MGR A;  2BYJ A;  4N0B A;  1LKC A;  1J32 A;  1E5E A;  1EJI A;  3EUC A;  3MAF B;  1AAW A;  4A72 A;  1UU1 A;  3WLX A;  1QIR A;  1O69 A;  1ELU A;  3HL2 A;  3Q8N A;  2BWN A;  1GC4 A;  2E7J A;  1MAP A;  3L8A A;  1MGV A;  3HQT A;  1WST A;  1GBN A;  1AHG A;  2VMT A;  1B4X A;  1AIB A;  1BQA A;  1OHY A;  2VI8 A;  3BB8 A;  3BC8 A;  3FQ8 A;  1CL1 A;  3ACZ A;  4PVF A;  3ISL A;  1AY5 A;  2Z67 A;  3UWC A;  3AEL A;  3R4T A;  4B98 A;  1KL1 A;  5LHA A;  2VLF A;  3HBX A;  3DR7 A;  2WK8 A;  1LC5 A;  3ASA A;  3AOW A;  4LNM A;  1OXP A;  1QIT A;  1V2F A;  1VP4 A;  5EIG A;  3FQ7 A;  4Q76 A;  1Z3Z A;  4HVK A;  2JG2 A;  3EIA A;  3M5U A;  3NU8 A;  2R5E A;  3II0 A;  2W7M A;  4BMK A;  2VGZ A;  2C0R A;  2CH2 A;  2JGT A;  3QN6 A;  5DJ1 A;  3B8X A;  2DOU A;  5EUD A;  2A1V A;  1M7Y A;  5KTB A;  2HP1 A;  1IJI A;  2W8V A;  1BW0 A;  3PD6 B;  4MY5 A;  2KFP A;  2YKV A;  1KMJ A;  2Z9W A;  3IF2 A;  3LVM A;  2YKX A;  3ATH A;  3NU7 A;  2D66 A;  3B1D A;  4PIW A;  1GCK A;  3I16 A;  3VK2 A;  1SZS A;  1UU0 A;  2FQ6 A;  2EPJ A;  4JF0 A;  4H63 Q;  1QZ9 A;  2DR1 A;  3WX9 A;  1BT4 A;  1ELQ A;  4M2J A;  1UKJ A;  2C7T A;  1FG3 A;  3RBF A;  4JEY A;  4M2K A;  1W23 A;  3FVX A;  4EMY A;  3NYU A;  1AHF A;  3B1E A;  1IX6 A;  4M2M A;  4F5K A;  3N4S A;  1YJS A;  5M49 A;  3GJU A;  3KGX A;  4XJM A;  5E4Z A;  5E5I A;  1QGN A;  3JTX A;  1LK9 A;  1D7S A;  2HOY A;  4W91 A;  4DGT A;  4LW2 A;  2AY8 A;  5M46 A;  1X0M A;  4KXK A;  1S0A A;  2BI5 A;  1M32 A;  4WXB A;  4F5F A;  4ADE A;  3BN1 A;  4JE5 A;  3I4J A;  1BJO B;  4KAM A;  3GBX A;  1RV3 A;  4WYD A;  2AY1 A;  1I48 A;  3CQ4 A;  4W5K A;  2AAT A;  3W1H A;  2DGK A;  3T32 A;  2ZC0 A;  1AKC A;  1IBJ A;  1N8P A;  2AEU A;  1AY4 A;  2JJG A;  1H1C A;  2GQN A;  2VGS A;  2ZYJ A;  4N0W A;  4B9B A;  2DGL A;  3EIB A;  3TQX A;  3HLM A;  3HT4 A;  4WLJ A;  1ECX A;  3A9Z A;  1GC3 A;  1D7U A;  1EQB A;  2VGT A;  1D2F A;  3AEN B;  3AEJ C;  3E2Z B;  3TFT A;  2BYL A;  4UQV A;  4K2I A;  3JZL A;  3MAF A;  2D63 A;  4H51 A;  1YNU A;  1GEY A;  4ITG A;  2QB2 A;  3ZRP A;  1S06 A;  3FVU A;  3QBO A;  4PFF A;  2O1B A;  1W7M A;  2FYF A;  2VMZ A;  2OGA A;  4L0O A;  2ZY2 A;  4TV7 A;  2ZY3 A;  4ZSW A;  1QJ5 A;  3WGC A;  2Z61 A;  1CS1 A;  3K7Y A;  2YKU A;  2R0T A;  3TAT A;  1RVY A;  5IWQ A;  2ZY5 A;  1ARS A;  1S08 A;  5G4I A;  1X29 A;  1AJS B;  1SPA A;  3AEM A;  3D6K A;  4IYO B;  3K40 A;  4WB0 B;  4XAU A;  2F8J A;  2BHX A;  4CBS A;  1LC8 A;  3A8U X;  1LS3 A;  2R2N A;  1G4V A;  1AX4 A;  3EI5 A;  2V1P A;  3GWP A;  1W7L A;  4OTL A;  2BIA A;  4K2M A;  1BJ4 A;  5FT4 A;  2JJH A;  1SVV A;  1TOK A;  1E5F A;  4AO9 A;  1WYT A;  1XEY A;  4A0R A;  1BKG A;  2AY4 A;  2D65 A;  1CQ6 A;  1Y4I A;  3QPG A;  4HF8 A;  1T3I A;  1AAM A;  5G4J A;  3N4X A;  4RIT A;  1J04 A;  2BIG A;  2TPL A;  3A9X A;  2WK9 A;  3OP7 A;  1WKH A;  2OAT A;  3PAA A;  5BJ3 A;  3G8M A;  1C0N A;  3MC6 A;  3LVL B;  2GMU A;  3PJ0 A;  1LC7 A;  2BI1 A;  1C7G A;  3CQ6 A;  5EUE A;  4WP0 A;  2X3L A;  1IX8 A;  3VOM A;  3BS8 A;  2YCT A;  4NOG A;  1D7V A;  2AY6 A;  4RLG A;  5EAA A;  1PFF A;  4CXR A;  1SF2 A;  3COG A;  2BWO A;  2VMU A;  3GZD C;  4R2N A;  1DJ9 A;  2AEV A;  1MDZ A;  1LW4 A;  1CQ8 A;  3LWS A;  4A6R A;  1WYU B;  1H0C A;  1AHY A;  1S07 A;  1W7N A;  3BWO A;  3NUB A;  3PDB B;  2AY3 A;  4LW4 A;  2BI3 A;  2CJG A;  5F8V A;  2Z1Z A;  3GSB A;  3QHX A;  4BQ0 A;  4MSO A;  2OGE A;  1YJZ A;  1YJY A;  3FDB A;  3AV7 A;  3R9A A;  3GR9 A;  4TN4 A;  1ASE A;  5JAY A;  2OKJ A;  4IY7 A;  1ZOD A;  3N5M A;  5C6U A;  4XQ2 A;  3AEN A;  1ASG A;  3ASB A;  3DXW A;  3E2Z A;  1ZC9 A;  4GE9 A;  4JEW A;  4ZDO A;  2WKA A;  3PGY A;  4F5J A;  3I5T A;  1TPL A;  3LVJ A;  3DXV A;  1C9C A;  2D64 A;  2JIS A;  2ZJG A;  1M4N A;  2E7I A;  3FQA A;  3OKS A;  2VLH A;  3H9X A;  4J8L A;  1FC4 A;  1O61 A;  2E54 A;  4MQQ A;  4GE4 A;  2Z20 A;  4W8I A;  4E3Q A;  1ASL A;  4XJP A;  4RJ0 A;  1DFO A;  1AHX A;  1X2A A;  2VMX A;  3WY7 A;  3RBL A;  5G0A A;  2E7U A;  2CTZ A;  2YCN A;  5J8Q A;  4Y0D A;  4F5G A;  1O62 A;  3JWB A;  3RCH B;  1AJS A;  2R5C B;  4IYO A;  4WB0 A;  3N4R A;  4OYT A;  2CJH A;  1B5P A;  1Z7D A;  2BWP A;  4AO4 A;  2WB6 A;  4E1O A;  1GEX A;  2BI2 A;  4K2B A;  5D95 A;  2AY2 A;  4ATQ A;  1V2E A;  4CXQ A;  3CBF A;  2QSR A;  3MAU A;  3RUY A;  2W7L A;  2VMQ A;  1KMK A;  4OBV A;  5D5S A;  1M6S A;  2CAN A;  1ART A;  1VJO A;  3GZC A;  2VMY A;  4QGR A;  3DZZ A;  2VIA A;  1PMO A;  1XI9 A;  3FSL A;  4R5Z A;  4WXG A;  4AH3 A;  1M0N A;  2HOR A;  4RKD A;  3DOD A;  2JJE A;  1CL2 A;  1G4X A;  3G7Q A;  4OT8 A;  2QA3 A;  1AHE A;  3EI8 A;  4AZJ A;  3GET A;  3WKR A;  4KYO A;  1ARH A;  2V0Y A;  1G7W A;  4ADC A;  5M4D A;  4F5M A;  3E9K A;  2QMA A;  2VMS A;  5AX8 A;  4EB7 A;  4GDY A;  5M4B A;  3EI6 A;  3AAT A;  1CQ7 A;  2ZY4 A;  2OKK A;  4R5F A;  1P3W A;  3LVK A;  2W7K A;  1BJN A;  1IVR A;  2W8W A;  3IHJ A;  1WYV B;  1GC0 A;  4GEB A;  2CY8 A;  2W8U A;  4RM1 A;  3DU4 A;  2RFV A;  4A0F A;  1BS0 A;  2Z1Y A;  5EIG B;  2GB3 A;  3LY1 A;  1RV4 A;  2CH1 A;  4ZAS A;  3DYD A;  1TAR A;  1GC2 A;  5EFS A;  1AMQ A;  1DGD A;  1OHV A;  1YOO A;  2W7E A;  3FCR A;  3NUI A;  4ATP A;  4DQ6 A;  1KKJ A;  4GRX A;  3L44 A;  4AOA A;  1B5O A;  4ZDP A;  2QLR A;  3BCX A;  4TMR A;  3VP6 A;  2HP2 A;  3EZ1 A;  3DC1 A;  3WCO A;  1JF9 A;  5LH9 A;  2AY7 A;  3PIU A;  1RVU A;  2VMR A;  3TFU A;  1DTY A;  5FT6 A;  3W1J A;  4K05 A;  4XJO A;  1ASD A;  3F0H A;  4RAE A;  4Q6R A;  3WZF A;  3NX3 A;  3P6K A;  3PD6 A;  5G09 A;  2VGW A;  2G6W A;  4OMA A;  2Z9V A; 
#chains in the Genus database with same CATH homology
 2EO5 A;  1JG8 A;  2O7C A;  1ZOB A;  2FN6 A;  2W7F A;  2XH1 A;  4BA4 A;  4A00 A;  4UHN A;  1ASB A;  5DX5 A;  5G2Q A;  1DJU A;  1MDO A;  2W7D A;  2Z9U A;  2W7J A;  2OQX A;  3AEP A;  2W8J A;  2W8T A;  2ZSL A;  3ZRR A;  2ZP7 A;  4A6U A;  1ARI A;  3FZ7 A;  1ORD A;  4ADD A;  1JS3 A;  1PG8 A;  1AKA A;  2EZ2 A;  1MLZ A;  2CFB A;  3MAD A;  2BIE A;  2R5C A;  1B9H A;  4F5I A;  3F9T A;  4Y0H A;  1ASN A;  1EG5 A;  3B46 A;  3AEO A;  4W1W A;  2HOZ A;  4RKC A;  3H7F A;  4I8A A;  4F5L A;  1BJO A;  3FTB A;  3F6T A;  4ZWM A;  3AEM C;  8AAT A;  3EZS A;  2FNU A;  2Q7W A;  2ZSM A;  3VK4 A;  4WXF A;  3JU7 A;  2YCP A;  3ZZK A;  2D7Z A;  2W7G A;  2D61 A;  2X5D A;  2VMP A;  1CZE A;  1BJW A;  1KKP A;  1X28 A;  3G0T A;  4ITX A;  7AAT A;  4JF1 A;  2CJD A;  3UE8 A;  5F9S A;  1SFF A;  3FVS A;  4XK1 A;  5I92 A;  3FDD A;  3BWN C;  2XBN A;  3ELE A;  2EH6 A;  4MQP A;  4MKK A;  4ZAH A;  4U2H A;  4E77 A;  3RQ1 A;  4MKJ A;  3USF A;  3MKJ A;  4XJL A;  1SZK A;  2BKW A;  2Z9X A;  2VMW A;  4ZWV A;  1AMR A;  4RIZ A;  3ZRQ A;  1YIY A;  1M0O A;  4P3M A;  4JEX A;  3MC6 C;  3PPL A;  3HVY A;  3NTJ A;  1OXO A;  1JS6 A;  4ZM3 A;  3UAK A;  1WYV A;  1W3U A;  2C44 A;  1TAS A;  2VMV A;  3FRK A;  3QGU A;  2EZ1 A;  4PFN A;  4U1T A;  4W1V A;  4ZLV A;  4A0G A;  3NNK A;  3E2Y A;  1QJ3 A;  5G2P A;  5HHY A;  2HUU A;  1IUG A;  5EQC A;  1CZC A;  2WK7 A;  3W1I A;  1IAX A;  4BA5 A;  2CST A;  1TOE A;  1VEF A;  3FD0 A;  4J5U A;  4Q31 A;  3KE3 A;  4WYE A;  2FKI A;  4WYF A;  2DKB A;  1B8G A;  3FZ8 A;  4ZSY A;  1MLY A;  2QBT A;  1AJR A;  3DR4 A;  4LNL A;  1S09 A;  1C7N A;  3LV2 A;  1TOI A;  1WYT B;  3NRA A;  5EUN A;  3RI6 A;  2EYQ A;  3E6G A;  4JEZ A;  4LC3 A;  2X5F A;  3DRD A;  4IXZ A;  1B9I A;  4OCA A;  2GMS A;  1D7R A;  1I41 A;  1BQD A;  1AIA A;  1ASF A;  2ZUK A;  3AEJ A;  3WGB A;  5HXX A;  1ARG A;  3MEB A;  3ELP A;  3CAI A;  2YOB A;  1AIC A;  2W7I A;  1C4K A;  2HZP A;  2JJF A;  3AOV A;  4EFF A;  3A2B A;  4EU1 A;  1N2T A;  2DGM A;  4F5H A;  1LW5 A;  1MAQ A;  2FNI A;  4Q75 A;  3N7N A;  2FM1 A;  2VMO A;  2YRR A;  5FT8 A;  2EGY A;  2HUI A;  4O6Z A;  1KL2 A;  4XEW A;  3ECD A;  2VGV A;  1CJ0 A;  2D5Y A;  4P7Y A;  2GSA A;  4RJY A;  3FZ6 A;  3N0L A;  3N75 A;  4WBT A;  3E77 A;  2BI9 A;  4WD2 A;  2C81 A;  4CVQ A;  3FFH A;  1PMM A;  1YAA A;  3HDO A;  3K28 A;  3P1T A;  4DBC A;  1GDE A;  4IXS A;  4UHO A;  4JEV A;  1ASM A;  2D7Y A;  1GEW A;  1GD9 A;  3EI9 A;  1SZU A;  3B1C A;  4GSA A;  4IXO A;  1WYU A;  2DKJ A;  2YKY A;  1AKB A;  3CQ5 A;  3H14 A;  3PDB A;  4WYA A;  4ZDL A;  4F4E A;  3ZZJ A;  4ADB A;  5FT5 A;  4WYC A;  2QB3 A;  1M0P A;  3HMU A;  3NYS A;  4E3R A;  1AMS A;  4ZM4 A;  5TF5 A;  1QIS A;  4A0H A;  4R8D A;  1C7O A;  2W7H A;  2AY5 A;  1I29 A;  5DB5 A;  2ORD A;  2VIB A;  2VMN A;  3JW9 A;  1AMA A;  1ASC A;  3PA9 A;  4W1X A;  2VYC A;  1WKG A;  2YHK A;  2VI9 A;  4CBR A;  3A9Y A;  2PB2 A;  2PB0 A;  3FFR A;  5HDM A;  3NDN A;  1M0Q A;  2CB1 A;  4GE7 A;  2YRI A;  4OBU A;  1DJE A;  4UOY A;  5DJ9 A;  4MQR A;  3FKD A;  1I43 A;  4Y0I A;  4BHD A;  2PO3 A;  5K8B A;  4FFC A;  3NYT A;  3GZD A;  1DGE A;  1TOJ A;  2X8U A;  4FL0 A;  3KKI A;  1IAY A;  4WLH A;  2HOX A;  2NMP A;  3BCB A;  3PDX A;  3TCM A;  2G7J A;  4EB5 A;  1G7X A;  3LG0 A;  4IX8 A;  4AZK A;  4ISY A;  1FG7 A;  1TOG A;  1OHW A;  1OAT A;  3RCH A;  1AY8 A;  3WKS A;  4OC9 A;  1IX7 A;  2O0R A;  5EAV A;  9AAT A;  3MBB A;  1N31 A;  4WYG A;  3BWN A;  4UHM A;  5E3K A;  2AY9 A;  1V2D A;  3VAX A;  1ASA A;  2HUF A;  4IW7 A;  3EI7 A;  3QM2 A;  1YIZ A;  5BJ4 A;  1DKA A;  3WCN A;  1MDX A;  2VGU A;  3E2F A;  4LNJ A;  4A6T A;  1V72 A;  3QI6 A;  1O4S A;  1U08 A;  1UU2 A;  3VK3 A;  3KGW A;  2CIN A;  3BCA A;  3BV0 A;  4JE5 D;  1TAT A;  3JWA A;  4MGR A;  2BYJ A;  4N0B A;  1LKC A;  1J32 A;  1E5E A;  1EJI A;  3EUC A;  3MAF B;  1AAW A;  4A72 A;  1UU1 A;  3WLX A;  1QIR A;  1O69 A;  1ELU A;  3HL2 A;  3Q8N A;  2BWN A;  1GC4 A;  2E7J A;  1MAP A;  3L8A A;  1MGV A;  3HQT A;  1WST A;  1GBN A;  1AHG A;  2VMT A;  1B4X A;  1AIB A;  1BQA A;  1OHY A;  2VI8 A;  3BB8 A;  3BC8 A;  3FQ8 A;  1CL1 A;  3ACZ A;  4PVF A;  3ISL A;  1AY5 A;  2Z67 A;  3UWC A;  3AEL A;  3R4T A;  4B98 A;  1KL1 A;  5LHA A;  2VLF A;  3HBX A;  3DR7 A;  2WK8 A;  1LC5 A;  3ASA A;  3AOW A;  4LNM A;  1OXP A;  1QIT A;  1V2F A;  1VP4 A;  5EIG A;  3FQ7 A;  4Q76 A;  1Z3Z A;  4HVK A;  2JG2 A;  3EIA A;  3M5U A;  3NU8 A;  2R5E A;  3II0 A;  2W7M A;  4BMK A;  2VGZ A;  2C0R A;  2CH2 A;  2JGT A;  3QN6 A;  5DJ1 A;  3B8X A;  2DOU A;  5EUD A;  2A1V A;  1M7Y A;  5KTB A;  2HP1 A;  1IJI A;  2W8V A;  1BW0 A;  3PD6 B;  4MY5 A;  2KFP A;  2YKV A;  1KMJ A;  2Z9W A;  3IF2 A;  3LVM A;  2YKX A;  3ATH A;  3NU7 A;  2D66 A;  3B1D A;  4PIW A;  1GCK A;  3I16 A;  3VK2 A;  1SZS A;  1UU0 A;  2FQ6 A;  2EPJ A;  4JF0 A;  4H63 Q;  1QZ9 A;  2DR1 A;  3WX9 A;  1BT4 A;  1ELQ A;  4M2J A;  1UKJ A;  2C7T A;  1FG3 A;  3RBF A;  4JEY A;  4M2K A;  1W23 A;  3FVX A;  4EMY A;  3NYU A;  1AHF A;  3B1E A;  1IX6 A;  4M2M A;  4F5K A;  3N4S A;  1YJS A;  5M49 A;  3GJU A;  3KGX A;  4XJM A;  5E4Z A;  5E5I A;  1QGN A;  3JTX A;  1LK9 A;  1D7S A;  2HOY A;  4W91 A;  4DGT A;  4LW2 A;  2AY8 A;  5M46 A;  1X0M A;  4KXK A;  1S0A A;  2BI5 A;  1M32 A;  4WXB A;  4F5F A;  4ADE A;  3BN1 A;  4JE5 A;  3I4J A;  1BJO B;  4KAM A;  3GBX A;  1RV3 A;  4WYD A;  2AY1 A;  1I48 A;  3CQ4 A;  4W5K A;  2AAT A;  3W1H A;  2DGK A;  3T32 A;  2ZC0 A;  1AKC A;  1IBJ A;  1N8P A;  2AEU A;  1AY4 A;  2JJG A;  1H1C A;  2GQN A;  2VGS A;  2ZYJ A;  4N0W A;  4B9B A;  2DGL A;  3EIB A;  3TQX A;  3HLM A;  3HT4 A;  4WLJ A;  1ECX A;  3A9Z A;  1GC3 A;  1D7U A;  1EQB A;  2VGT A;  1D2F A;  3AEN B;  3AEJ C;  3E2Z B;  3TFT A;  2BYL A;  4UQV A;  4K2I A;  3JZL A;  3MAF A;  2D63 A;  4H51 A;  1YNU A;  1GEY A;  4ITG A;  2QB2 A;  3ZRP A;  1S06 A;  3FVU A;  3QBO A;  4PFF A;  2O1B A;  1W7M A;  2FYF A;  2VMZ A;  2OGA A;  4L0O A;  2ZY2 A;  4TV7 A;  2ZY3 A;  4ZSW A;  1QJ5 A;  3WGC A;  2Z61 A;  1CS1 A;  3K7Y A;  2YKU A;  2R0T A;  3TAT A;  1RVY A;  5IWQ A;  2ZY5 A;  1ARS A;  1S08 A;  5G4I A;  1X29 A;  1AJS B;  1SPA A;  3AEM A;  3D6K A;  4IYO B;  3K40 A;  4WB0 B;  4XAU A;  2F8J A;  2BHX A;  4CBS A;  1LC8 A;  3A8U X;  1LS3 A;  2R2N A;  1G4V A;  1AX4 A;  3EI5 A;  2V1P A;  3GWP A;  1W7L A;  4OTL A;  2BIA A;  4K2M A;  1BJ4 A;  5FT4 A;  2JJH A;  1SVV A;  1TOK A;  1E5F A;  4AO9 A;  1WYT A;  1XEY A;  4A0R A;  1BKG A;  2AY4 A;  2D65 A;  1CQ6 A;  1Y4I A;  3QPG A;  4HF8 A;  1T3I A;  1AAM A;  5G4J A;  3N4X A;  4RIT A;  1J04 A;  2BIG A;  2TPL A;  3A9X A;  2WK9 A;  3OP7 A;  1WKH A;  2OAT A;  3PAA A;  5BJ3 A;  3G8M A;  1C0N A;  3MC6 A;  3LVL B;  2GMU A;  3PJ0 A;  1LC7 A;  2BI1 A;  1C7G A;  3CQ6 A;  5EUE A;  4WP0 A;  2X3L A;  1IX8 A;  3VOM A;  3BS8 A;  2YCT A;  4NOG A;  1D7V A;  2AY6 A;  4RLG A;  5EAA A;  1PFF A;  4CXR A;  1SF2 A;  3COG A;  2BWO A;  2VMU A;  3GZD C;  4R2N A;  1DJ9 A;  2AEV A;  1MDZ A;  1LW4 A;  1CQ8 A;  3LWS A;  4A6R A;  1WYU B;  1H0C A;  1AHY A;  1S07 A;  1W7N A;  3BWO A;  3NUB A;  3PDB B;  2AY3 A;  4LW4 A;  2BI3 A;  2CJG A;  5F8V A;  2Z1Z A;  3GSB A;  3QHX A;  4BQ0 A;  4MSO A;  2OGE A;  1YJZ A;  1YJY A;  3FDB A;  3AV7 A;  3R9A A;  3GR9 A;  4TN4 A;  1ASE A;  5JAY A;  2OKJ A;  4IY7 A;  1ZOD A;  3N5M A;  5C6U A;  4XQ2 A;  3AEN A;  1ASG A;  3ASB A;  3DXW A;  3E2Z A;  1ZC9 A;  4GE9 A;  4JEW A;  4ZDO A;  2WKA A;  3PGY A;  4F5J A;  3I5T A;  1TPL A;  3LVJ A;  3DXV A;  1C9C A;  2D64 A;  2JIS A;  2ZJG A;  1M4N A;  2E7I A;  3FQA A;  3OKS A;  2VLH A;  3H9X A;  4J8L A;  1FC4 A;  1O61 A;  2E54 A;  4MQQ A;  4GE4 A;  2Z20 A;  4W8I A;  4E3Q A;  1ASL A;  4XJP A;  4RJ0 A;  1DFO A;  1AHX A;  1X2A A;  2VMX A;  3WY7 A;  3RBL A;  5G0A A;  2E7U A;  2CTZ A;  2YCN A;  5J8Q A;  4Y0D A;  4F5G A;  1O62 A;  3JWB A;  3RCH B;  1AJS A;  2R5C B;  4IYO A;  4WB0 A;  3N4R A;  4OYT A;  2CJH A;  1B5P A;  1Z7D A;  2BWP A;  4AO4 A;  2WB6 A;  4E1O A;  1GEX A;  2BI2 A;  4K2B A;  5D95 A;  2AY2 A;  4ATQ A;  1V2E A;  4CXQ A;  3CBF A;  2QSR A;  3MAU A;  3RUY A;  2W7L A;  2VMQ A;  1KMK A;  4OBV A;  5D5S A;  1M6S A;  2CAN A;  1ART A;  1VJO A;  3GZC A;  2VMY A;  4QGR A;  3DZZ A;  2VIA A;  1PMO A;  1XI9 A;  3FSL A;  4R5Z A;  4WXG A;  4AH3 A;  1M0N A;  2HOR A;  4RKD A;  3DOD A;  2JJE A;  1CL2 A;  1G4X A;  3G7Q A;  4OT8 A;  2QA3 A;  1AHE A;  3EI8 A;  4AZJ A;  3GET A;  3WKR A;  4KYO A;  1ARH A;  2V0Y A;  1G7W A;  4ADC A;  5M4D A;  4F5M A;  3E9K A;  2QMA A;  2VMS A;  5AX8 A;  4EB7 A;  4GDY A;  5M4B A;  3EI6 A;  3AAT A;  1CQ7 A;  2ZY4 A;  2OKK A;  4R5F A;  1P3W A;  3LVK A;  2W7K A;  1BJN A;  1IVR A;  2W8W A;  3IHJ A;  1WYV B;  1GC0 A;  4GEB A;  2CY8 A;  2W8U A;  4RM1 A;  3DU4 A;  2RFV A;  4A0F A;  1BS0 A;  2Z1Y A;  5EIG B;  2GB3 A;  3LY1 A;  1RV4 A;  2CH1 A;  4ZAS A;  3DYD A;  1TAR A;  1GC2 A;  5EFS A;  1AMQ A;  1DGD A;  1OHV A;  1YOO A;  2W7E A;  3FCR A;  3NUI A;  4ATP A;  4DQ6 A;  1KKJ A;  4GRX A;  3L44 A;  4AOA A;  1B5O A;  4ZDP A;  2QLR A;  3BCX A;  4TMR A;  3VP6 A;  2HP2 A;  3EZ1 A;  3DC1 A;  3WCO A;  1JF9 A;  5LH9 A;  2AY7 A;  3PIU A;  1RVU A;  2VMR A;  3TFU A;  1DTY A;  5FT6 A;  3W1J A;  4K05 A;  4XJO A;  1ASD A;  3F0H A;  4RAE A;  4Q6R A;  3WZF A;  3NX3 A;  3P6K A;  3PD6 A;  5G09 A;  2VGW A;  2G6W A;  4OMA A;  2Z9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...