3FRWA

Crystal structure of putative trpr protein from ruminococcus obeum
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
IRTEEVDHLFEAILCLKNKEECYTFFEDVCTINELLSLSQRFEVAKMLTDKRTYLDISEKTGASTATISRVNRSLNYGNDGYEMVFSRMKEKET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Trp repressor protein
publication title X-ray crystal structure of putative TrpR protein from Ruminococcus obeum.
rcsb
source organism Ruminococcus obeum atcc 29174
molecule tags Structural genomics, unknown function
total genus 33
structure length 94
sequence length 94
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01371 Trp_repressor Trp repressor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.10 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A TrpR-like 3frwA00
1TROA 1RCSA 1TRRA 3WRPA 3SSWN 1WRPR 1WRTR 3SSXN 1WRSR 1MI7R 1JHGA 1ZT9A 2OZ9R 3FRWA 3KORA 2XDIA 1CO0A 3G1CA
chains in the Genus database with same CATH superfamily
4YQCA 4YQQA 1UALA 4YQAA 4YVIA 3FRWA 4YQPA 3AXZA 4YQTA 3WRPA 4YQ6A 4YQKA 4YQOA 1P9PA 1RCSA 4YQ9A 4YPWA 4YQ3A 1WRPR 3KNUA 1WRSR 4YQNA 4YQGA 5D9FA 4YQ7A 4YQBA 4IG6A 4YQ8A 4YPXA 4YQ4A 4YVJA 4YVHA 1TROA 1TRRA 3KY7A 3IEFA 4H3ZA 3SSWN 4YQ0A 1WRTR 3SSXN 4YPYA 1JHGA 3KORA 1ZT9A 2OZ9R 4YVGA 4YQSA 2XDIA 4MCDA 4YQJA 3QUVA 4YQDA 4YQ2A 4YQRA 4H3YA 1UAJA 4YQLA 1UAMA 4YVKA 4YQ1A 4MCBA 1OY5A 1MI7R 4MCCA 4YPZA 1UAKA 1CO0A 4YQ5A 4YQIA 3G1CA
chains in the Genus database with same CATH topology
1TROA 1RCSA 1TRRA 3WRPA 3SSWN 1WRPR 1WRTR 3SSXN 1WRSR 1MI7R 1JHGA 1ZT9A 2OZ9R 3FRWA 3KORA 2XDIA 1CO0A 3G1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TRO A;  1RCS A;  1TRR A;  3WRP A;  3SSW N;  1WRP R;  1WRT R;  3SSX N;  1WRS R;  1MI7 R;  1JHG A;  1ZT9 A;  2OZ9 R;  3FRW A;  3KOR A;  2XDI A;  1CO0 A;  3G1C A; 
#chains in the Genus database with same CATH topology
 4YQC A;  4YQQ A;  1UAL A;  4YQA A;  4YVI A;  3FRW A;  4YQP A;  3AXZ A;  4YQT A;  3WRP A;  4YQ6 A;  4YQK A;  4YQO A;  1P9P A;  1RCS A;  4YQ9 A;  4YPW A;  4YQ3 A;  1WRP R;  3KNU A;  1WRS R;  4YQN A;  4YQG A;  5D9F A;  4YQ7 A;  4YQB A;  4IG6 A;  4YQ8 A;  4YPX A;  4YQ4 A;  4YVJ A;  4YVH A;  1TRO A;  1TRR A;  3KY7 A;  3IEF A;  4H3Z A;  3SSW N;  4YQ0 A;  1WRT R;  3SSX N;  4YPY A;  1JHG A;  3KOR A;  1ZT9 A;  2OZ9 R;  4YVG A;  4YQS A;  2XDI A;  4MCD A;  4YQJ A;  3QUV A;  4YQD A;  4YQ2 A;  4YQR A;  4H3Y A;  1UAJ A;  4YQL A;  1UAM A;  4YVK A;  4YQ1 A;  4MCB A;  1OY5 A;  1MI7 R;  4MCC A;  4YPZ A;  1UAK A;  1CO0 A;  4YQ5 A;  4YQI A;  3G1C A; 
#chains in the Genus database with same CATH homology
 1TRO A;  1RCS A;  1TRR A;  3WRP A;  3SSW N;  1WRP R;  1WRT R;  3SSX N;  1WRS R;  1MI7 R;  1JHG A;  1ZT9 A;  2OZ9 R;  3FRW A;  3KOR A;  2XDI A;  1CO0 A;  3G1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...