3FRYA

Crystal structure of the copa c-terminal metal binding domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
73
structure length
73
Chain Sequence
GDSVEKIVLELSGLSCHHCVARVKKALEEAGAKVEKVDLNEAVVAGNKEDVDKYIKAVEAAGYQAKLRSSAWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and interactions of the C-terminal metal binding domain of Archaeoglobus fulgidus CopA.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
molecule keywords Probable copper-exporting P-type ATPase A
total genus 12
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2009-01-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3fryA01
2HQIA 4U9RA 2W4DA 2ZDOA 2HFOA 3I9ZA 2N7YA 3BR8A 1YJTA 2LXFA 1K0VA 3UDCA 1Q4RA 2L3MA 4A48A 5IXUA 3HF5A 3HHLB 1AW0A 3CJKB 1OQ6A 3BF4A 1TL5A 4OJGA 4Q2MA 1RJJA 5T7LB 5B0CA 4F67A 1Y0HA 2BYCA 1YJUA 2FTRA 2RSQA 2XMUA 5B0AA 2BJDA 1P6TA 1CC8A 1Y3JA 2FB0A 4HI2A 2ZDPA 4NL5A 1FE0A 1CC7A 5B0GA 4FNHA 3HHLC 5B09A 1TUVA 1JWWA 3TNVA 2AP6A 5B0BA 1FVSA 1CPZA 3HFKA 2KKHA 3KG0A 1OPZA 3BDEA 3BN7A 3HHLD 3TRGA 3QMQA 1P8GA 4HI1A 4NPOA 1S6UA 1URRA 2ROPA 4OJHA 3T9NA 1VQSA 2N4CA 1X8DA 4OJ1A 1Q53A 4Q2LA 4DL0C 5A6WA 3HHLA 4EFAC 2K1RB 3CJKA 3K7RA 2OMOA 1X0PA 1XBWA 2RMLA 2OP5A 2OKQA 1YG0A 1Q8LA 2PD1A 3LO3A 1S6OA 2N4DA 3BM7A 1Y9OA 2W4CA 1N5SA 1YRXA 1FVQA 2G9OA 3BB5A 4YDXA 2ASYA 3E8OA 2XMTA 4A4JA 2OFHX 2OD6A 2RU9A 1X7VA 1SB6A 3DCAA 1LQ9A 3F44A 4YEAA 2AJ1A 3WDOA 4Y2MA 1SI9A 2HIQA 4ZA1A 2LDIA 3IWXA 2VV5A 1R6YA 5B0FA 1OQ3A 3BGUA 1SQEA 1FD8A 2XMJA 3VTIA 2QLWA 2ACYA 4DN9A 2IYGA 2OAUA 1KQKA 2K7JA 4HH1A 2K1RA 2K2PA 2IYIA 3FMBA 4ZOSA 1AFIA 1VQYA 1Y3KA 1AFJA 5F0WA 5B0DA 1TL4A 1GXTA 4OJ3A 3FRYA 1KVIA 2XMVA 1U7LA 1TR0A 4Y2IA 2IFXA 3LGNA 2QIFA 1V3ZA 2BUNA 2Q3PA 3KKFA 3TOQA 2GCFA 2FHMA 2OD4A 1APSA 5K9FA 1IUJA 2GGPA 3DXSX 2BBEA 2HLTA 1MWZA 5F0UA 2EW9A 2AJ0A 2LQ9A 2XMMA 1YJVA 2W4PA 4OIXA 2XMWA 1FEEA 1FESA 2HLUA 3IWLA 3KG1A 2CRLA 2K7KA 4A47A 4HL9A 5A6PA 1N5VA 2JDJA 1KVJA 5KAKA 2QLXA 2QYCA 2ROGA 1TZ0A 4QOTA 3MCSA 1JK9B 3FGVA 4A46A 5B0EA 4DPOA 3MZIA 3GZ7A 1ULRA 1Q8BA 2HFNA 1OSDA 2KT3A 5T7LA 1YJRA 2GA7A 2ROEA 1N5QA 1FE4A 2OFGX 1MWYA 1WD6A 2KT2A 2GGPB 1QUPA 2VH7A 2FIUA 3HX9A 3HDSA 2GV1A 3KNGA 3LGMA 4HH0A 2GO8A 5B08A 2AW0A 2KYZA 1N5TA 4Y2KA 4FNIA 2GFFA 2LQBA 2PGCA 1W2IA 2XMKA 2BJEA 3QGPA 1GXUA 2RILA
chains in the Genus database with same CATH superfamily
5DM6Q 1WOPA 2BQ3A 3LP0B 4DV4J 3Q86A 1SC3B 2VBWA 2VPZB 2JZ5A 3C6TB 3K0JA 3AD7C 1RT6A 4ID5B 3R6LB 3VQSA 3K5MA 2IDEA 1UVIA 3UO0A 2HHQA 5CYJA 2XMAA 3GONA 1YZ7A 4O44A 4PG4A 4MTPA 5B0CA 3P5BP 4YMEA 2IVYA 2CAJA 1RLDA 2FTRA 2KVQE 2XMUA 3FFIB 1GH8A 2UU9J 3SCKE 1UJ6A 4FF4A 3EE3A 1RI7A 4P10A 4K4WA 3G86A 3R9LA 3T5LA 1S9EB 1DQ9A 1Y7PA 3MFHA 3LAMA 3CW2C 4XO0A 1U49A 3DOKA 3EPGA 1X5PA 1BC6A 2VG7B 4FYXB 3UCGA 3BQ1A 9ATCB 4NPOA 1UFLA 2BABA 1T3OA 2DNMA 1X60A 4NOHA 1R0BG 1VISA 5ETLA 5I3UB 5HBMA 4UTGA 2HVIA 1LWEA 3AODA 3CCMS 2CG8A 3VGVA 3MUVP 4C11A 2C3PA 4PWWA 3R7SB 1VBXA 3CCWA 1FTRA 1TV6A 2V8DA 2Z57B 3D4JA 3GJRB 1KTQA 3HVTA 3MEEB 5FDLA 3HVWA 4F3QA 1ZZNA 1YRXA 3O5TB 2B0GA 4PXBA 5DETA 2W25A 4F2SA 5IS2A 1VHFA 4DV0J 2IM1A 3CEDA 3FZBA 2OIHA 1TKZA 1WOSA 2DNZA 4BHQA 3HXMA 3ENVA 1SB6A 2BE2A 3F44A 4O3OA 1UVNA 2OPQA 1K8AT 5AE3A 4Y2MA 2HSEB 2VV5A 3OTDA 4WXOA 1WC5A 4Q44A 1IR1A 4DF4A 3V4IA 2YWHA 3LF0A 4N76A 4G6VB 3I5CA 5KFMA 4PYDA 2K2PA 2QZ8A 2F63A 3HSGA 3UE2A 3BBCA 3BH6B 1GXTA 1U2FA 4ZPVR 3Q24A 4CYUA 4ELUA 4OJ3A 3DRXA 1ELOA 3KLHA 2J7KA 3N79A 2HHVA 1BLUA 4DXLA 3V2UC 1AT1B 4FBTA 1SH2A 4RBTA 2AHOB 4ZP8A 1APSA 1MMDA 3AQPA 3D6FB 4CO3A 2MKIA 1Z2LA 2IDLA 1V3SA 3IC1A 3MMCA 1N32F 1OYEA 1KOHA 3AD8C 2KFNA 4EZ9A 4R0JA 4HYKA 2M52A 3KDNA 1RT7A 4Q43A 3LOUA 1DFDA 1RABB 3BREA 1HR0F 2QLFB 2I5JB 4J90A 3C46A 2DO0A 3I4HX 1UEUA 1XK8A 1NPPA 5C42A 1IKXB 4C3KA 1TZ0A 2CDRB 5E3AA 1WDTA 5CH7B 3QFHA 1CSJA 4QW9A 4ZPTR 2DGVA 4EUVA 3CCTA 3OBIA 4TYBA 1G6BA 2B43A 1IBCB 1TL1B 4M63A 1UJ5A 1WG5A 5F8HA 2AZ3A 3BSOA 4F3MA 1NSPA 3HX9A 1BQXA 3I0RB 3RB4A 2J6UA 2LP4A 3AHPA 4QU7A 2A2DA 3ZZUA 4KSEB 4CLYA 1JB0C 1TKTB 1QAIA 4MAKA 3HVAA 5AT1B 5C7PA 5FLXY 4NCBA 3HM9A 3NNHA 1WI8A 5A0YB 1UFWA 5DRKA 3U7JA 3GSIA 2C42A 2ZZMA 2D41A 3FEXB 4GVBB 2P9GA 2AJFE 2YNFA 3C14B 4QPTA 4DX5A 3O3LA 5IZHA 2IMOA 1VQMS 4OJGA 3M6VA 3I0SA 5IV4A 4FYVB 4DV1F 4DFKA 1Z4UA 4CLWA 3I55S 4DBQA 4IH5A 2AGPA 1OY8A 3QJLA 1P1LA 2NR0A 1RWKB 2BACA 3RB6A 2IA0A 3MEKA 1UWBB 3MM6B 1BUXA 3Q89A 2FVQA 1URNA 4ZVUB 5F8JA 2B8QA 3KG4A 4OZ5A 1TKTA 3HHLC 1JNZB 4PABA 2P6SA 4OHXA 3HVTB 1JWWA 4OYBA 3K89A 2GIRA 4X62J 1HWUA 2I38A 2ZH5A 1S4FA 2JVOA 2MQMA 3O2IA 2QRRA 5GAEI 2HHWA 1RAGB 3OSNA 1J27A 1SXLA 1S0VA 4P2SA 1LWCB 2H65B 1S1UA 3M6UA 3TA0A 3LTOA 4J9PA 3KDOA 2K1RB 1X9WA 4QW8A 4PQUA 1SQGA 2W9BA 1LOUA 2VFRA 2RMLA 1NZAA 4MFBA 4Y3CA 4QR1A 2HW3A 1S1VB 2BKPA 1FDBA 3DLLQ 5C5JA 4LRAA 4LT6A 4IO9Q 1N34F 1XWLA 3W9IA 4EBDA 2AYMA 2RDDA 4A4JA 4WKYA 2UV8G 1LWEB 2CVEA 2HNYA 1RXOB 1MN9A 2AJ4A 2LKZA 3DCAA 3MMCB 1RHRB 3HVRA 2DJWA 4QJVA 2MKYA 1M5PC 2R8KA 2WW8A 2F4VJ 4IO1A 2N7CA 1KWMA 3BJYA 2FVSA 1K44A 3FK4A 4P2FA 4X64F 1IJEB 3BGUA 3OFHA 3VTIA 3RYLA 2W8KA 4HH1A 2CJBA 3Q22A 4RJVA 2CNLB 4DPWA 1AFIA 2VUGA 1SQFA 1UW4A 2W2OP 5HANA 1AFJA 1WF2A 2V4RA 1VK3A 3AFGA 1HQUB 2VC0A 4PZVA 2MSTA 2PMZD 3SXLA 1DTTA 3T9ZA 3KFWX 2JL9A 4WU3A 4Z7CA 2O5DA 1U7LA 4UY8T 3ZZTA 2H4WB 3OT9A 2ZH2A 4DMZA 1VQKS 3I5BA 2FHJD 3DDNA 1VC5A 4W4MA 3JYTA 1NJZA 4NLVA 5F8GA 3RU0A 4CNYA 2CPXA 1MSWD 8AT1B 3JQJA 3TZZA 2JLGA 4JB8B 2MDAA 4L73A 4QIWD 2CQBA 1RT5A 3VHQA 5AE1A 2BA9A 4J9MA 3BSCA 4B3OB 1GMUA 4B02A 5KFQA 3Q8YA 4KGXB 3PYDA 3BSAA 2M7SA 2BM0A 3UNGC 1EQ0A 2YKOA 1SJFA 2DH7A 2V94A 5A6PA 1HNZJ 2HMIA 2DB1A 1RTIB 3H42A 1VMBA 1RKIA 2QSWA 3CJ4A 2VDIA 2RU3A 4DDFA 1CS4A 2V9KA 3KUEA 5KFTA 2KG0A 1HIYA 2H51B 1FWPA 2RIJA 3UD3P 3GIJA 3TANA 1T02A 3R6GB 4IFYB 1S6PB 3FCVA 2CUYA 2EFVA 1EETA 1R27B 4J9QA 2HAFA 1RT1A 3FCHA 2CQ3A 2OPSB 3LWMA 3G4SS 1RYSA 1YHQS 2ZD1A 2XC9A 2ZFHA 4N41A 1FX4A 1TL3B 4J9VA 4JI8F 1IJFB 5HVFA 5KFPA 5HO4A 2HYIB 2Q6CA 4R0EA 4AXJA 4LF8J 1CEZA 4JI1F 2E9ZA 1DURA 1DZ5A 3DLKB 3PFEA 2HBQB 5I42A 3NLCA 2XMKA 2ZUGA 5E3PA 4ZVFA 1WORA 1FEHA 4OX9J 2UUAJ 2WK4A 2KO1A 4IH7A 1YJTA 3MM9A 3FSIA 2IAJA 3GWCA 3AJ2A 2GHVC 2LXUA 4M5LA 3J81j 4JYAF 1FXLA 5C24A 3HHLB 5IM0A 2BR0A 4RW8A 2YQ1A 2XYPB 3IS9B 1LW0A 3PFOA 4PG7A 3UR0A 3JSMA 4FS1A 2C1EB 2X1FA 2AYEA 4KPYA 3EDRB 5D6GA 1JIHA 3R2CJ 4YB1P 4AD6A 2R4FA 1S1WA 3ILJA 3ZTPA 2XS2A 4DR7F 2EFOA 2MZQA 2H9ZA 5KT4A 4OYOA 1DY3A 1RADB 2QFIA 3VQTA 2I9SA 4YHHJ 3WHIA 1TKZB 3CDBA 3CMQA 3G2XA 4NLTA 3SCLE 4DQRA 4FXDA 1E6VA 1C0TB 4RW8B 1R0AB 3C16B 1X4EA 3QMQA 2G2ZA 2JWNA 1N48A 1NB2A 2B56A 3VALA 1T94A 2P6TA 1QVGR 3V4IB 3MECA 4X64J 1RT6B 3ZFVA 3IBWA 4OJ1A 2GJIA 2IJRA 3OW2R 2JFKA 3HK2A 3BH7B 3GU0A 3TAMA 1GX6A 2RRNA 2X3DA 3C19A 4RL1A 2QN6B 2FZCB 3VV2B 2OP5A 3SQGB 1ZBTA 2VFVA 4C8NA 2VKZG 1UPPA 3EPIA 4P71A 1VC0A 4J5OA 4M5GA 2LEAA 3P5TL 1S6OA 4C0BA 2R7QA 3MMAA 2KFYA 3SI8A 4QPXA 4F4AA 1TL7A 2HGNA 1N4LA 3NBPB 1YVFA 2J9DA 3U1LA 1YBUA 3AQOA 3QIDA 3POTA 4DX6A 3WC2A 1HQEB 2KN4A 1LWCA 3G96A 4GO7X 3THVA 4B17A 2YKNB 4DUYJ 2C2OB 3BKTA 1CLFA 2Y1RI 1WF0A 3QRPA 1X4AA 4RKUC 5F8LA 3ZZOA 2AYGA 1OQ3A 1FJCA 1EKSA 1RT7B 1NH8A 1FHTA 4DN9A 3I31A 5AJ3J 4A8KA 5BYQA 3DRYA 4HT7A 3SIPB 3CCES 2HHHF 5HSPA 4M5KA 4A8FA 2V63A 1R3NA 2IYIA 2ZM6F 3NKYA 1OY9A 1VQYA 4OZ3A 3QT8A 3ISNC 1HNZF 3DRRA 2UXDF 3EVOA 1IN0A 3L7PA 4YQWA 1RCOB 2OTLS 2QL9B 2WHOA 3PRBA 2P9EA 1FWKA 2AX1A 1KVIA 1N52B 3PJ9A 2AKWB 3KLFB 1RAOA 1KQSR 2VBXA 3ILIA 2GCFA 4RU2A 2V2VA 1U25A 1YBAA 3NY0A 1CJUA 3D3BJ 4P7TA 4ECYA 1YSJA 3D9BA 1NO8A 2CWXA 3FJ2A 2YVSA 4M8LA 4CTAA 3CJRA 3CVKA 4X2BA 1PBUA 1SL2A 1RTZA 2WOMA 3CIZA 3Q8VA 1S1TB 2W4PA 4ZPWR 5L9XA 1U1NA 2F8EX 2UVRA 4G3IA 1U0HB 3TQ1A 4I6AA 5F3TA 4TU7A 1XR6A 2YQ0A 2NZ4A 2DGUA 3IRXB 2CVIA 5LJ5Y 2JDJA 2JH3A 3P45B 4DUZJ 1SUQA 1G4CA 1U24A 3PDNA 3QWPA 4IOAQ 4WF9Q 1HNIB 2KT5A 3M2VA 3CJQA 4LBHA 4AE5A 1ZM9A 5IFMA 3PHTA 2RRBA 1VQOS 1S97A 1VQ6S 2DNKA 1T0TV 1RBOB 2QSFA 2WONB 1L3KA 5CA5A 2DNGA 4LQ9A 3EJMA 4X4RA 1J5EF 2CNOB 4DFJA 3DU5A 5FD1A 1B64A 5C42B 3F0NA 5G0RB 1SJQA 3R1HA 3DRSA 5DDPC 1B0PA 2DNQA 4WU2A 1FT8A 1U09A 1HNIA 1C4AA 2DCLA 3CDAA 3WX4A 1FJ7A 3T5KA 4IFVB 3OHBA 4EBEA 1BWVA 1ZYQA 2WVBA 4PCQA 1B0TA 3QSYB 2D3O1 2HFOA 2IRXA 2FJDB 3MI7X 4WYWA 1FK9A 3BR8A 1IM4A 2HBYB 4ICLA 4MYUA 3D54A 4ZVGA 5KG0A 1OMSA 1Q4RA 1RP5A 1SH0A 3LUYA 2DR9A 1JLEA 2UUTA 2GQCA 3O1LA 4I0WA 1AW0A 4QYZJ 2WVDA 3E01B 3OLBA 5CYQA 4JV5F 4DR1F 2CNKB 2CPIA 4ZN1A 3CJTA 4WP8A 1UETA 2L08A 2ZKUA 3DMJA 3FQLA 2EFGA 4QBUA 4RWWA 3P96A 3C66A 1PBAA 5C2GA 1QTMA 3VAJA 4O3SA 1S1XA 2JLFA 5J2PB 1YKWA 2KU7A 3TVZA 4ID5A 4RR5A 2EEYA 3M8ZA 3ZTQA 3D1QA 5KFSA 3MPWA 3W64A 1QD1A 3PW7A 2DPIA 3HHLD 3R1LA 3GJQB 4ZN3A 4DV2F 2FJVA 4F0HA 1F5AA 5KG6A 2B4VA 2N4CA 1Q8IA 2G0CA 2J7WA 2MJNA 1NJIT 4Q8FA 1SKUB 1WG4A 1TUWA 4K4TA 1TU0B 1HHSA 4DR5F 4MIWA 3CWJA 3PV8A 4UF4A 4JOUA 4DL4A 4HHJA 1AA1B 1YRTA 1IKVA 3OHAA 1S79A 1WOOA 3T19A 5H9FK 4ED5A 4FZVA 1BGXT 4PUOB 4F04B 3EZUA 2R7VA 2LU1A 3PHEA 4M5HA 2ZJPQ 3UR3C 4KGZB 5D0HA 2F4VF 2GJ2A 5I3UA 2OFHX 5THWA 3DOKB 3AY0A 2DGOA 2IM3A 3CO9A 1UA0A 1Q5YA 1REGX 2BANA 2BEFA 2BVZA 3DRPB 5AXLA 3QGIA 1YK9A 3E51A 5A8WA 2BDPA 1ZA2B 2G0JA 3SSQA 3M2UB 2Y1LB 3R7NB 5ITHA 3R3TA 5IT9Y 3TEGA 4FF3A 2V4JA 4ZOSA 3EVWA 2IA6A 2W01A 2ILYA 2H3EB 1FRIA 2RS8A 1NLKL 1O5JA 3DHWC 3P3DA 3KWMA 4DU7A 1T05B 1JNRB 3RR7A 3KMQA 3MPVA 2EKYA 1I94J 4MKYA 1QTNB 1TR0A 4F3OA 1DRZA 1V3ZA 1VRUB 3HPOA 1RT4A 4QIGA 3V6JA 1REVB 2EK1A 3KTQA 3A4TA 3DLJA 3R8YA 2KZZA 3A3NB 4IG0B 2AU0A 1U1QA 2JEIA 3HT0A 4KQZA 3JSRA 2OPRB 2YXLA 3DDKA 2V2ZA 4X4PA 1W7WA 4MH8A 5ETQA 2OEMA 5FIIA 2AJ0A 3V6KA 3BBFA 4BWJA 2VG6A 4KO0A 3SDEB 4DR2J 2R7TA 1V6HA 2XMWA 2CQDA 4UY85 4LFAF 1X4GA 2AT1B 1V5VA 2V34A 3KG1A 3KLFA 3K5LA 5F8NA 1RA6A 1VRUA 2CXEA 2ILZA 5EX3A 3NNCA 3BQ0A 2A10A 4IDKB 4Y00A 2QYCA 1TAQA 4ED4A 2DR8A 2HRTA 1T05A 5JVHQ 1JKHA 1JK9B 3J7YU 5B0EA 4J9SA 4NLQA 2GVZB 4JI5F 2HNDA 4X65F 2Y0SD 3RGIA 1VBKA 5LSLA 4EZ6A 1NK6A 2VA3A 4ANEA 2B7BB 3TJAA 2YPYA 1YBTA 3GV5B 1QUPA 2OMLA 3W62A 3LGMA 3RAQA 2HMIB 2Z56B 4JP8A 1WEYA 3G71S 4F50A 3QZ7A 1XC9A 1NMEB 1KBRA 5KG1A 3DXBA 5D4NA 4WTOB 2K8GA 3BPSP 4DEZA 1JJ2R 2LYVA 2N3LA 4B3RF 3CB4A 5EX0A 2ZITA 1RT1B 4IOCQ 3OXGA 5IC6B 2N7YA 2G2YA 3ILOA 2QLJB 2WONA 2WZ1A 1NZ8A 2XLKA 2Q43A 3FEZA 4S0MA 4UW2A 4EU0A 5CYMB 3R5AA 1D9FA 1KS2A 2HFVA 4ZP6A 3L95X 3GQCA 3O8WA 4RUBA 4LMZA 4AL6A 3DLBA 2CZ9A 4HI2A 2X1GA 2DHXA 4DV7J 4ELTA 2FHJA 1HPZA 1R0CB 1B0VA 3K2YA 2JHEA 2B5JA 1WEXA 3I9V9 4JI2J 4DCOB 3OTOF 2NYHA 1YJWS 2PEBA 3FCWA 1QAYA 3CULA 2Z58B 3IXQA 5KFXA 5F8MA 4BCAA 4ED8A 2V8HA 3TUZC 1ZM3A 2ROPA 3KLIB 4RNHA 2XEXA 2QMUB 5E3RA 4OYPA 2OUGA 2VOOA 5AXNA 4JI0J 4KFBA 1UTAA 5KFYA 3WQPA 3PYEA 2V4JB 4PWUA 3EM1A 4FF2A 4DPXA 3T6JA 2AX0A 2C2MB 3MDFA 4HHUA 2XBPA 3LO3A 1OY6A 4ZVHA 3HJVA 1VQPS 3OUYB 4C8LA 3SV4A 2HNZB 1MG7A 2Y3YA 5ETVA 1JJ4A 1F3VA 1ZOTA 1Q1KA 1OIAA 5LXYA 4YR3A 1NH7A 1HHQA 2RRAA 4I1TA 1NUEA 1WACA 1U47A 2M88A 4M95A 4ZA1A 2R9LA 2QO3A 2OSRA 2ZWOA 5L9NA 3JAMU 3K8WA 4J91A 4DV6F 4MK7A 1X0FA 1TK5A 1BHNA 3EXYA 3FBFA 3MAQA 2M8DB 4DQQA 4WK3A 4U7UD 1VOMA 4OHVA 4B3SJ 2E5GA 1UAWA 3NBPA 2CYYA 1RWPB 1S48A 2B6AA 4OV1A 1H38A 4ZLJA 4FDFA 1WC0A 3JQKA 4X84A 5F0WA 3UQSA 5CD4H 2LECA 1RWNB 2KJWA 5GADI 5A8KA 2DEIA 2VPYB 2YKMA 5D4OA 1BQNA 4WE1B 2HS0A 2BUNA 4FKYA 2CQCA 3M6XA 4RW6A 3W60A 1HW8A 4DJBA 5JUMA 5MLCV 2UUCF 4F26A 3G8SA 1HNVA 2P8IA 1T9XA 2FPHX 4W98A 4OHYA 3ZTRA 3M6WA 1KFSA 3VWSA 3TAQA 2DNLA 2HWHA 2DKOB 2GS8A 3LANA 2KVIA 4RW9B 3ITHA 4XTTA 5F0UA 4QWDA 2XO7A 3K58A 4KTQA 2ZH1A 2XS7A 3CTRA 4L74A 1GTHA 2RD5C 4H4KA 1LKZA 2VD3A 3L7OA 4DZDA 1TK8A 3LP1B 2Y8WA 4M5DA 4OI4A 1S5ZA 1B70B 2DISA 3W66A 5GMKa 4B3MJ 3LALA 1AROP 4H4KC 1HBUB 1NDPA 3OR2B 3DRRB 5KFBA 4RNFA 4DV0F 3CUNA 2CQHA 3R5DA 3T1AA 3ENWA 1ULRA 1U6BA 3KJVA 1WC6A 3NAIA 5DS7A 5T7LA 1NK0A 2B9YA 3KOAA 1X4CA 4WXWA 3A8EA 2FJXA 5D15A 1KR4A 1MWYA 3MM9B 4NA2A 2J0SD 4I2QB 3BDPA 2MGZA 4C98A 3H90A 1IBLF 1T7PA 2K3IA 3Q2SC 1JLFA 1N36J 5JJBA 1X4DA 1CS4B 1IBKF 2Q66A 3NOGA 5ETNA 1M1HA 1KONA 2AW0A 1BQMB 1HBOA 2V2KA 9RUBA 1YTYA 4CCHA 2BZ2A 3TVYA 1KD1T 4HKQA 3FC9A 2NSBA 3IG1B 3OFGA 2ZKTA 1GMVA 3TJ8A 2E5LJ 1PJ7A 3K5OA 2HQFA 5B0AA 4LF9J 3GTYX 2P9CA 4XPCA 3OR2A 4IQMA 4DSFA 3NRBA 2QV6A 1VQ9S 2WVEA 3U1NA 3BV8A 2L48A 2KXNB 4N47A 1Y0HA 2FYXA 4NZ6A 1KSPA 1UVLA 4V19J 4WWSA 4PQAA 1RZMA 4RX6A 3OL7A 3I96A 2ZH7A 4OV6A 3GR1A 1IM6A 4MT1A 4OYXA 3Q2TC 1FRXA 1SV5A 2YX1A 2H5EA 1NK4A 3AT1B 1XJWB 3C6TA 2YWEA 4DV3J 1DHMA 1QE1A 1EHWA 3N6LA 4KRWA 2KKHA 1RDRA 1R7IA 2ASDA 5HLFA 1S77D 4K4UA 2MKKA 4RNNA 4WYLA 1VQSA 1S59A 4CRJA 4F4XA 1O6XA 2DCUB 3CGIA 3QAUA 1I94F 2B7CB 4DR4F 4WIIA 2BE9B 4KBIA 2W2PP 2Z2LA 1Q5VA 3HHLA 3PM9A 1U8SA 3MGJA 4G1PA 1NU4A 2LLZA 4OYAA 2AEFA 3GPAA 4O3NA 1WKLA 3HZGA 4YB6A 2OKQA 4LRBA 3QT6A 4ZIWA 2IRUA 4DL6A 1F1BB 4XK8C 1NDLA 4HDHA 3W9HA 1FKAF 3D6TB 2W4CA 4UT4A 1WF1A 3EGZA 2ZBCA 1H6KX 4MK9A 1WHVA 2BW2A 4N7TA 1M5OC 2B3TB 4LF6F 2GIFA 2JX2A 4TVAB 4C8ZA 4XAKA 2PSZA 1KN6A 2VB6A 3G6VA 3PEJA 1VQ7S 5KG3A 3F56A 1IQTA 2DXFA 2NS1B 2VA2A 1Z1ZA 1FKOA 4C11B 2C3UA 3I32A 5D4PA 3GG0A 3OXFA 1FDNA 3R5BA 1AUSL 3HSDA 3M8QB 5KFDA 2LXIA 3NS7B 5DQGA 2XCAA 1DBDA 2I5JA 2WB1D 2CPYA 4USKA 1JJHA 4K8RA 2WSFC 3TAMB 2R7SA 1Y5IB 2YNHA 1Y3KA 3ZZ0A 4JI1J 4X4NA 2E1PA 1RGVA 2CPEA 4TLRA 1JKHB 2BJ1A 2D9OA 2J7UA 1PJ6A 2AIRB 5DO2A 1U0HA 4EI2A 2C2RA 4ZVPB 4OYIA 1D8ZA 2IFXA 2LVWA 3KKFA 4NLGA 4J9NA 1C4CA 2DK2A 1TMJA 3M8SA 3TA1A 2JEGA 4LR7A 4LF5F 1HLWA 1YJ9S 1CJVB 2MSSA 4U7UK 3PO4A 2JLEA 2JVRA 4I4BA 4CLPA 2HLTA 1IBKJ 1B7YB 2AYBA 1JXEA 2YKQA 1G3OA 3LPEA 2CPJA 2MXYA 3TZXA 4YS2A 1KOOA 1ZM4A 5K8MA 1N6QB 2IBKA 2EPIA 5IQQA 3FKBA 4TU9A 1U1RA 1N33F 2M0GB 1JLQA 4GVLA 2K7KA 3TW0A 1OJ4A 4F7VA 3MURP 1RT4B 1S0NA 4JI8J 1OO0B 4X4TA 4LBIA 3JTPA 3LP0A 3OQ2A 3M8RA 4Y2AA 4IRDA 2IAJB 1JLAA 4OQJA 1FCAA 2BJ9A 2CPDA 4CTAB 1MLAA 3MZIA 1OPIA 4HR2A 4LSNA 1V3RA 7FDRA 1TK0A 3MD1A 2HPUA 2GNKA 3I0SB 4PG5A 5CXTA 1RTHB 4ILLA 2XI3A 1N0VC 2WBRA 3OVAA 1R8HA 4I2PB 4GVBA 3M32B 5KG7A 1JLGA 1RWWB 4PG8A 3DYAA 2VJVA 3MPDA 1WEZA 3TUPA 2HK3A 3DHXA 2KHCA 4GKKJ 3J7A1 3IA0A 3M8PB 4WZQA 2QFJA 5EGYA 1U1PA 2XZTB 3VGSA 1N5TA 3I6PA 4FKXA 4FNIA 4MK8A 4NYPA 1UEVA 4P6QA 2YKAA 4JI6F 1P9YA 3UW1A 2DNRA 3ZC4A 1HYSB 2G2OA 1FKPA 3TZYA 3BZQA 4WCEQ 3J80Y 1ZTTA 5LMUF 3QQCD 1DTQB 4KKOA 4ENOA 1NDKA 2DXEA 1RKJA 3W63A 1K0VA 5KFLA 5KTQA 5HBMB 3MMJA 3HF5A 3I87A 4PPZA 5DQIA 3Q8SB 3D67A 4ANDA 1HI0P 2AJ2A 2HQCA 3BPDA 4ZJQA 3QRQA 3SYZA 4LFBF 2GVDB 1YJUA 2DHHA 3CE8A 5BR8F 2Z2YB 4YR2A 3W1YC 3PACA 3GILA 3PW4A 3W2WA 1HNWJ 3D6HB 3KK1A 1VS3A 1N33J 4LF6J 4I64A 5LSOA 2DNHA 4FS2A 4CH7A 3BO2A 1OWXA 4F0KA 1D0EA 1O8BA 2F9DA 1RU2A 5B0BA 3S1TA 3D6MB 4RO0A 3UDVA 3CC4S 2MHNA 4XDCA 2GHWA 4KB7A 1S6UA 3LWLA 1VJQA 1HL6A 2GJFA 1URRA 4LRFA 3TUIC 5L8RC 1S1WB 1Q53A 3UN3A 2DR6A 2V8GA 2HQDA 4EFAC 3CC2S 4UUXA 2O66A 1PO6A 1XBWA 4ETZA 5F41A 2R7WA 5A8WB 5CQGA 1Q8LA 1S0MA 1MW7A 5DG9A 3KLGA 2CPFA 1PILA 3BM7A 4OYMA 3LP2B 2JRSA 1FVQA 2G9OA 3DOMA 3NGDA 3VAKA 1SH3A 2B4UA 2CPHA 2QJ3A 3PX4A 1T9TA 2Q1LA 4K4VA 1RT2A 3AB2B 2YWFA 3OFEA 3R5JB 4DSKA 4XDDA 4JI3F 5U47A 1WC3A 2FLLA 4ZPBA 1BQNB 4MKVA 4WE1A 1NK5A 3IWXA 3MCNA 2DGQA 5B7WA 3QT5A 4DSIA 3R7BB 4ZLPA 4DFPA 3KLGB 1S99A 1SPBP 1Y11A 2HVDA 2OAUA 4O0NA 1YITS 2QLBB 2ZBIA 2HVEA 2POKA 3BEGB 3U02A 4C0OC 2XNQA 2K1RA 5HP1A 3OVBA 3SEOA 3IGNA 3TAPA 3M7VA 1WUUA 4Y34A 4C8MA 1UVJA 4CDIA 2C3OA 3OTCA 4GKJJ 1RWVB 3AA9A 2BJ3A 3FRYA 3BGFA 3GLJA 1MMLA 1PCAA 1SKWA 4P72A 3TOQA 2LEBA 2H5JB 2IC3A 2PMWA 1NK9A 4I68A 2H1YA 2W7AA 4Z7YA 1IQZA 5K9FA 3IN5A 2HWTA 2KDOA 2X7IA 2GGPA 3M32A 2R2UA 1RSCA 2WSCC 2UV8A 2GMJA 3L09A 3VVUA 2EW9A 4EMDA 2XQCA 4DV4F 2MZTA 3PIPQ 3UCUP 4NLUA 1CULA 3ET6A 3S7RA 3KJVB 1GMWD 2HFSA 1WJ9A 4ZDNA 1EP4A 3HT3A 2D3OR 2UXBF 3FUYA 3HLUA 2EK6A 3SSSA 5IT4A 2YH1A 1B7FA 1ZM2A 3OPKA 5D78A 1FRHA 5EUHA 5M2RA 4FBUA 2FHKA 2V5HG 2VPXB 4FP9A 1UZDA 1YX2A 2W7OA 3FBBA 1FK9B 1GNKA 1F9EB 1CJVA 2HQGA 5J2QB 4DV5J 5J1EB 2F4FA 2ZNZA 2DTJA 4KGVB 5HK4A 3BYPA 4A46A 3GSDA 1A6LA 3DLKA 4CT8A 4ZP7A 2FZKB 2KL8A 3J7Z5 3N9UC 1OSDA 2UUAF 1RE1B 2FY1A 2DO4A 1UW9A 4L3NA 4X4QA 4DR6F 1UEKA 1LFPA 5H9EK 2V69A 2GV1A 4DG1A 5GAHI 3FSYA 3TX8A 4E2FB 1PC4A 4QWBA 1F9HA 4DR4J 5D8HB 2QL5B 1KLMA 1N36F 1ZAXA 2GFFA 2MQLA 4HTIA 3ISND 5ETTA 3QLHB 5A76A 1V5IB 1RTIA 1HMVB 1U6FA 2GMHA 4AL5A 3ZZYA 1MROA 2FJWA 3H0PA 5A8RB 3KK3A 4FF1A 1HBMB 3QIPB 4P74A 5LM7E 5IXUA 3DDIA 3H4DA 5H9FJ 4WTYA 5BYSA 5KFFA 1OQ6A 2D9PA 4AXIA 4EEYA 2A6OA 1DLOB 1L3UA 2EFNA 3B54A 2WW4A 1S7IA 2HFUA 2ZZTA 4NL5A 1Q95G 2RDIA 3NCRA 1IKYB 4RBUA 4C3MA 5L1IA 4DV1J 1HBNB 2MY7A 4OI3A 3G6XA 4JI6J 1LV5A 2P2CB 4A8XA 3WIVA 2L9NA 1UWAA 1GMWA 2HG4A 2ZBPA 4KGMA 1NKEA 4UQTA 3S6EA 3E01A 3H7HB 4PKDB 1LWFB 4ALZA 4Q5VA 1C1CB 2WSEC 2V67A 4HI1A 2F5GA 4Y2CA 4OI1A 3RBZA 4NXNJ 3QO9B 3GV8B 1D09B 3T9NA 4ZVTB 5ETKA 2HBRB 2CWKA 4U6PA 3PKYA 2LQ5A 3FRZA 4XPEA 1J2VA 1BY9A 3AXMA 3D0IE 4OX7A 5A2QY 2FJBB 3BGRB 4F0MA 1FDDA 1HARA 2YNHB 1ZA1B 1H72C 3NG8A 1FX2A 2FZGB 3P4UB 4P2MA 5CYQB 3CNQP 2NZCA 4NCGB 2HRUA 2YQ3A 3N6MA 3TVKA 4C0HA 3BS9A 3CCZA 3FMWA 3M8QA 4C4WA 4A8SA 4LF7F 4DS5A 1EKRA 1VLYA 1TP7A 4MIBA 4I7FB 2B51A 4Q45A 4K2JA 4FYDA 1S4EA 1S6QA 3HD1A 1PAEX 2XMTA 4OYWA 2OD6A 3UN2A 3NP5A 4GC6A 4PXDA 2FJAB 5KT2A 5KFOA 2AJ1A 3US5A 3WDOA 2EXUA 1ZPVA 3W2VB 4RW7A 3MEEA 5FDLB 2IVFB 3KHLA 2XTJP 2BM1A 2K7JA 3H59A 3IRXA 1DJ0A 1VIXA 1WC4A 2DBBA 2A2CA 1YZ6A 2YWWA 3FQKA 5KT6A 5KFKA 4HTJA 2VZ9A 3G6ES 2RHQB 4DWIA 3AXKA 3DRPA 1UZHA 2QIFA 3BR9A 3LP2A 4RW7B 5DDQC 4YY3F 5DDRC 1VQLS 4I7FA 2FVRA 2F1FA 1TL1A 3UDLA 4ZMMA 2XY7A 3DKDA 1IKXA 4ZVOB 2KG1A 3KHRA 5DZ7A 4ZKAA 3DXSX 2XULA 4F4WA 5BJRA 1NPKA 2E5JA 1P27B 5J2MB 4WP3A 3TUJC 1QDUB 3IM8A 1I51B 3BYRA 3OR1B 4QR0A 4DV7F 2PE8A 3UFCX 2A0FB 2KM8C 2VF3A 1T9VA 2PI4A 1F2GA 5IQ6A 4Z2XA 2M8HA 3UVJB 2R42A 3HJFA 3W65A 1KEKA 1H2VZ 1PJ5A 3ZNUA 2HVHA 1HQUA 1NEEA 3CCJS 1UVKA 2FLPA 2YTCA 4ED3A 3N5FA 2I8EA 3B6BA 4I69A 3CD7A 1AUDA 1N5QA 3JTNA 1NK7A 4PRFA 1NHKL 4DCPB 3PIOQ 3H4BA 1YGYA 1VIOA 2QA2A 2RQMA 4RW9A 3W5YA 2F8MA 2KZMA 3VZIA 4X4SA 2FY8A 4USHA 1XTZA 2ACMA 3GMGA 2OHDA 1TFWA 3NGUA 4IR1A 3DOLA 2KYZA 1HR0J 3NOCA 5T41A 2YX7A 3NL0A 1FXRA 4B08A 4QCLA 2PN6A 4IFYA 2LDYA 4DOZA 1YDLA 3MAAB 4NLSA 2ZDOA 3GFZA 2IMWP 4PEOA 2W9CB 3MECB 2DY9A 3MTJA 5DGAA 4NLXA 1NHVA 5GAEU 4P52A 3CCQS 3OLAA 1TUGB 1XMQJ 1YJNS 3QYYA 1RCXB 1X4HA 2XWYA 3M4XA 5T7LB 2CIMA 4ZVQB 2BOAA 4OHZA 1RTJB 1KFDA 4AYBD 4F67A 2G4BA 2Y9HA 4YOEA 2HRYA 1SC4B 1HD0A 4GO5X 1P1TA 1Y3JA 3JS9A 3PCOB 4I2QA 3MR7A 4CWBA 3IAS9 3JAMY 3HP6A 3D0GE 1N56A 3MD3A 1TKDA 4YDDB 2E5HA 1PYTA 4K0KF 4KHPJ 4QWAA 4FNHA 4DX8H 2CDQA 1TUVA 2YWGA 3AJ1A 2AP6A 3P6YC 2P5VA 2X1BA 2YPZA 1YLXA 3IR5B 5KFCA 3BN7A 5KOWA 3PX6A 3BKFA 4X4VA 2ABYA 4EO6A 4EWTA 5EHHA 4QQBA 1GEHA 4OI6A 1S6QB 5EDWA 4WJBA 5HJYA 3D1HA 4CM0A 2HBZB 3UD4P 3DC2A 1NAQA 1SBRA 2XY5A 2DYAA 2B6AB 1ICEB 1X5OA 2B8PA 2OMOA 3CO0P 4NZ7A 4O4RA 4UOHA 5HL7Q 1M5VC 2E9RX 1YG0A 2V6AA 2Y1JA 5KT5A 2O1PA 5KFGA 1Y00A 2Y1IA 1NK8A 5H1SV 5E5NA 4M5MA 4MIAA 4USUA 4CM2A 1DAXA 5IC4B 2IC3B 3M30B 3R97A 3GCWP 1WHWA 3CCUS 2DRBA 2QL7B 4Q0BA 3LPYA 4LF4J 3JQMA 3LA0A 3VAFA 2YH0A 1UCNA 5D0GA 3K8VA 4B9UA 5J2MA 1SI9A 3VF0B 2UVWA 3MTKA 2OJ3A 5I4MA 4O4GA 1VRTA 3PYFA 4F4KA 3EGWB 5G4DA 3Q83A 2XHWA 3D3CJ 4DZ6A 3BO4A 4M1KA 2OTJS 2E66A 6AT1B 2VU5A 5D77A 4K4XA 5CCLA 4NLRA 3T5HA 3M9NB 3R27A 3ZXWA 4O3PA 1U8WA 5SUHA 3GIIA 5B0DA 3TZWA 2DHGA 4USWA 4KY3A 3OL8A 3BGOP 5DQHA 3CF5Q 2LMIA 2H48B 4RLEA 1RAIB 4NYOA 4CQ1A 4ED1A 1LWXA 4LSNB 4OZJA 3MXHP 3TJ9A 4UOCA 4TY9A 2IM0A 3EZOA 5GAGI 2FHMA 1RAAB 3K17A 3PZPA 2DIVA 1KRPA 1S0OA 3N01A 1SL0A 3GYXB 2GHPA 2R3VA 4DI6A 2HQ3A 1KHWA 2BBEA 1CJKA 4ECTA 4OHWA 3BN4A 4CLUA 4BLGA 1UKUA 3MR2A 4LFCJ 2J8AA 5CZVA 1NDCA 2WTFA 4QYZK 4QWCA 4DUYF 3NGTA 4NRUA 1KVJA 5IV3A 3Q8UA 2V8VA 2VG5B 4YP3A 4J9RA 2R8JA 1GX5A 3AJDA 4B3RJ 3DLGB 2YX4A 1DTTB 1CJTA 2QMXA 2RAQA 3A13A 3FGVA 2MB0B 3D2WA 2UU9F 2KT3A 4QR2A 3SDEA 3G87A 3EMTA 3W9JA 2JC1A 1FE4A 2ZM6J 1U1LA 2EI5A 1HNVB 1SIWB 2OFGX 2KXHA 1S76D 1FI4A 6FD1A 2DRAA 1A0OB 2GGPB 4QWEA 2VH7A 4WBFA 4RW4A 1JLEB 1RLCL 3MUTP 5EWFA 2E1RA 1R31A 1RHQB 2ZUAA 2R7RA 3U1MA 1JXLA 4NLPA 1PAUB 3HD2A 1VI7A 5F9NA 3C6UA 4CO2A 3QBCA 4USTA 4ITSA 3CD6S 4G1QB 2XI2A 4HACB 5K14B 2HQIA 5IT0A 3PYGA 2OPSA 3TI0A 2E1MC 2LEPA 2FVPA 2B4OA 1N5YA 1ZH5A 1ROFA 3AOCA 1E6YB 1EX8A 2COLA 3EWGA 2RS2A 1R8AA 2EC2A 3ONQA 4EK2A 4RPFA 4WKRA 5K5MA 4L3KA 4PG6A 4V19X 5AXKA 3VR1A 2EFQA 1RJJA 2W9BB 2WAQD 1H2TZ 2PIIA 4QIFA 5LT5A 1T9YA 2ZHAA 2DY1A 3V81A 2KTQA 4ZK7M 4GKKF 5K20B 1RWOB 4I2PA 2FB0A 3CCSS 2WVFA 3RRKA 5D3GB 2JEJA 1RACB 4DQPA 4MJKA 2G1DA 2B4PA 1FE0A 2FC9A 2NLWA 5E0OA 4PQUB 1Q86T 4F2RA 4C9DA 4ES3A 3MOZA 2PFFB 3GJSB 5B09A 1VQNS 4F8RA 1IBMJ 1OPZA 1HD1A 3G8QA 1KNZA 2PC6A 2BJ7A 2PI5A 1RAEB 2NXUA 1RQ0A 4OJHA 3UD5A 1LW2B 5A6WA 4NLDA 5C24B 1GFWB 3GIMA 4O44B 2LFVA 3QATA 1KQFB 2D3UA 2LU2A 4CNZA 2HEKA 2CZVC 1VHIA 1CQNA 2A3JA 4KHMA 1HHTP 1QAJA 2HGMA 3N4WA 2O3DA 2VL1A 4NA3A 2N4DA 4ZCLA 4RW6B 1N5SA 3BB5A 5J2PA 5J1NA 3OV7A 4ECZA 4JV5J 3HMJG 3E8OA 3H5YA 4HLBA 1QE1B 3IWNC 5EN1A 2OPRA 4OMFG 4USIA 4YEAA 3VGTA 1HI8A 2WVCA 2ZNYA 3QZ8A 2XLJA 2E5IA 4P7VA 2RKIA 3NS6A 2JJ4D 4JV2A 2G0IA 3A1YG 2ATCB 2FJEB 3HSJA 1IKVB 4ANCA 1BWEA 1U6ZA 3F73A 3N0VA 3IR6B 2IYGA 3KMSA 2HK2A 5I3PA 2F40A 2RH3A 5ETMA 3FMBA 4OL8A 1RAFB 4OX9F 1HQEA 5FJ4A 3KUGA 2ZVSA 4KYZA 5DDOC 1TL4A 4ZPDA 1S1VA 2YKPA 1AZSA 1KKHA 2Q3PA 3OUYA 2J0WA 2BKOA 1SC6A 1HBUA 4CO1A 5E2QA 1ZPWX 5F9LA 1SVDA 1WG1A 4TY8A 3J80U 1S57A 2GC8A 2OELA 1IBMF 1MWZA 1WSVA 2HHSA 2MYFA 2I6WA 1Q16B 3LH2S 1FJGF 5C25B 3W2VA 1RTHA 3EUNA 1XR7A 1D9AA 1FESA 2XZWA 5GMDA 2ALYB 2RB7A 1KP6A 4ER8A 4ECXA 2C28A 2MKHA 1KC8T 4DR2F 1XR5A 1G7CB 3PG9A 4LFAJ 2Z2ZA 1XNRF 2MHEA 5KAKA 2VJUA 2QTWA 2CJXB 4NI2A 3ENAA 4CYUB 3GZ7A 4TKTA 1F6TA 4P2XA 2UXDJ 1NHUA 1S1TA 1YJRA 1ZAWA 2WB4A 3KJQB 1RHUB 4J9UE 2KXFA 4R8UB 1DQ8A 4DCJB 4YR0A 2V4QA 3WX8A 4ICLB 1WELA 1XIQA 4PR6A 3B8HA 4H4MB 1FDAA 4ZPAA 1HBNA 3L3CA 1Q0NA 1IWGA 2DHSA 1FD2A 4FXVA 1WTFA 3CDWA 2GO8A 3O44A 2MQ8A 4IOBA 2AWZA 3KUHA 5D0EA 4Y2KA 2GIQA 3U27A 2Y8YA 3MM5A 3EICA 4I67A 5KFRA 2BJEA 1U02A 3QGPA 1GXUA 3G82A 4LUBA 3KHGA 2WRMA 5DJBA 1C0UA 4U9RA 1LEOA 3W2WB 4DUZF 5EWGA 3GE9A 3NGRA 2KH9A 4MKAA 2J6SA 2VONA 1Q7LB 2L3MA 1FNMA 1LK7A 2FGOA 2ADCA 2ZC3A 2AGQA 1PG5B 1HA1A 2O67A 2VG7A 3W8PA 1J5OA 2HS3A 2LQJA 4NE9C 1QJHA 8ATCB 3RBDA 2CADA 3MM7A 2BYCA 1D1UA 1F2HA 1FFWB 1QVFR 5ADZA 1K1QA 4J9KA 4OZLA 1XMOJ 2VODA 2OEJA 4DG1B 3SCIE 1FWLA 4ELVA 1HMVA 1G2EA 4MMOA 4X4OA 4ID8A 3ZZPA 4DQIA 2HHUA 4Q0BB 4C97A 2ZHOA 3UI3A 2D69A 4NCGA 3MM5B 4H54A 1PYSB 1UL3A 4KIAA 4HACA 5K14A 2F7VA 2RKIB 5DLFA 5HMZA 2W1BA 4RU9A 2XCPA 5HMXA 1U0SA 2XO6A 4IUFA 1X8DA 4PWDA 2A6MA 3P8BB 3HHNB 4DV3F 2YNFB 2Q79A 3B4MA 2AF6A 3C14A 2R2SA 3T1YF 1SJ3P 5LMNJ 1KDNA 2CPZA 5KG2A 2BQRA 3RB0A 4U95A 3KYLA 1GT8A 4N77A 1RAHB 2ZOMA 4QIVA 3JSYA 2MQOA 2ADBA 3DLHA 1E6VB 1HW9A 5HQ8A 3M1VA 3KLHB 4DR1J 2R7XA 1KLNA 5ETRA 3PW0A 5HATA 4KH1B 1T03B 2AZ1A 2BRKA 3IR7B 3L7UA 1SJ4P 2W24A 4OFZA 4TY8B 4BC9A 4CO0A 4DSLA 4ZVRB 1QY7A 1VYAA 1EIYB 2QG9B 3DI6B 1ZETA 1VBZA 5JVGQ 2XMJA 1FD8A 2PA8D 3QSIA 1L5UA 4PWDB 2UP1A 5DGBA 4DV2J 1A9NB 1FRMA 2QC3A 2OI2A 3I4PA 5CZXA 3CMAS 4K4ZA 1CJKB 4EYHB 4E98A 2DNNA 4R25A 2LA4A 3SZ2A 4ZS6A 1F3FA 3BKUA 3OR1A 5KT7A 3A3OB 2GVZA 4KJIA 3M05A 1WHYA 2E7XA 5CHCB 1VCTA 4D3HA 5E33A 3T41A 4PUOA 1VQ4S 1RHKB 2HHPA 4CH0S 2OD4A 2VFSA 2YNGB 4ZJOA 5GAHU 2V0NA 4OZNA 2UXCJ 2EKNA 1RT2B 2YWKA 3T3FA 2JOQA 1NRKA 2VKRA 1RWUA 3PJWA 1F5BA 2VQFF 2XNRA 3MOJB 4Q7AA 5HVHA 2EBEA 1EETB 2DT9A 1RT3A 1S49A 3DI6A 3HKZD 4LF8F 2APOA 4NLOA 2DPJA 4C8OA 4A8YA 2J0XA 2CRLA 2KRRA 3EVMA 3T1YJ 4A8WA 1DQAA 3Q8QB 2ASJA 3J81Y 2DGXA 2HKEA 4ECUA 4ES2A 4Y28C 3OXLA 4QOTA 4NX9A 3GG1A 3CSKA 5KT3A 2OPPA 3FBEA 1X5TA 2D1CA 3BGLA 1M90T 3MCOA 4IRKA 1CULB 2C2DA 1XNQF 1LW0B 1ZS6A 1RAJA 3MR3A 4ZHRB 3JSMB 2XSFA 2VDHA 1F5CA 1Y10A 3LQVA 4D3GA 3V6DB 1CJUB 3H40A 4B9NA 5MAOA 1KVKA 2DITA 2NYIA 2I1RA 4G1IA 2QA4S 2DVIA 5LXRA 4L72B 4E0DA 4EYIB 1LNQA 1WC1A 2MKJA 3KNGA 3V4MA 5LSRA 1XMOF 4ECSA 4K7QA 2B5JB 3IO1A 1M1GA 5J2QA 4LVNP 5CYMA 4O3QA 2C22A 2RUGA 2CQ1A 3CDEA 1NB7A 4JI7J 3H25A 2GVDA 3D0HE 4U96A 3CCVS 3A12A 1W2IA 1N8RT 1U26A 1VK8A 1QLNA 4CLFA 3KK1B 2M70A 2ZWPA 4ZCIA 1N88A 3UDCA 4H4OA 1TELA 1XEZA 2OPPB 3DGPB 2DNYA 3I0RA 3IGVA 5GMEA 3UPFA 2MQPA 4JI5J 3W5XA 2LA6A 3HO1A 1LWFA 4NLWA 3DOLB 4PPDA 5BYRA 1UVMA 1YRUA 2NUHA 2JC0A 3THPA 4BC7A 2B9XA 3OTBA 2HAIA 4IG3A 3PVXA 1YI2S 1Q81T 2J76E 3M8WA 2H5IB 4CP5A 2IBOA 3C8YA 4O3RA 1UMJA 3NWRA 2ZBRA 1DTQA 4KKOB 1U2RA 3HI9A 4NXMJ 5D4LA 3VCDA 3SQOP 3FBCA 1CC7A 3PNIA 4C7QA 1GXLA 2AMCB 4CLKA 4DFMA 2EBGA 1BQMA 1HBOB 3A8IA 3H8YA 5HQMA 1YIJS 2E9TA 1GTEA 4FPIA 3MFIA 4Y65A 4ZLNA 3OL6A 1PSDA 1FF2A 2JFDA 4U8YA 3MMBA 4LSLB 1XMQF 2LQ8A 2EVZA 2VBYA 3H5UA 5HROB 1HNWF 2A18A 4OLPA 5A8RA 1T03A 1VLOA 3HHEA 3JB9k 4IQXA 5KOXA 5AJ3F 4AL7A 2HHHJ 1CVJA 1W25A 5DG7A 5HN0A 2W8LA 2V2QA 1MWQA 1C1BA 4ILMA 3ZO7A 2HURA 3MEGA 5L39A 3OJSA 2XSJA 3MUMP 1K47A 1FNOA 1RBAA 1UA1A 2C2KB 1R8BA 1RISA 1AXQA 2KB2A 3W5ZA 2ZH6A 5DG8A 1C1CA 4ZVSB 2VIHA 1REVA 1MU2A 5FLXU 3OTEA 4ED6A 1OS5A 2ASYA 5K8OA 1EB0A 4JI4F 3J81U 1X7VA 3ZNJ1 3BGRA 3NGKA 3MWBA 2VFTA 2Y0BB 2DRDA 3OTOJ 1R6YA 4IH6A 4E8UA 5EWEA 5HROA 1FXDA 3CIMA 1UJ4A 3CCRS 3M1VB 2KRBA 4ERDA 1ITPA 1M0SA 3FEYB 3QNWB 2RF2B 1B4SA 2OO4A 2YNIB 1RWXB 1MU2B 2NPIA 4JBCA 3N6NA 4ZLLA 5F3ZA 2R8GA 4K50A 4UZBA 2QGFB 1T9WA 2XG8A 2GZOA 1M5KC 4IRCA 2DHAA 5AXMA 3CJ8A 2XSJB 4MFBB 5HMWA 3JSBA 3ETOA 1H0HB 2EG1A 2XMVA 4Y2IA 1FKOB 4QZVB 3KLVA 4G65A 2MTLA 4MYTA 2BMBA 2QMWA 4DPUA 5HQLA 4Q8EA 3RBXA 1XNQJ 2PO4A 4NEYA 2E1AA 1HNXF 2JSXA 4NXNF 3GJTB 1S9FA 2O01C 3K5PA 3CD0A 1J5EJ 3G9CA 1UFKA 3SMZA 2MGZB 5ETPA 1R8CA 3IBCB 4CIOA 3X3UA 2XMMA 2WBMA 3MCMA 3OSPA 2OH2A 3PRVA 4NRTA 1UPMB 2EC0A 2HZVA 3JTOA 3QPIA 3KJNB 4L76A 2CQPA 3QGHA 4O23A 4A47A 1RA7A 2BRLA 4OZ2A 3QT7A 4RNMA 1QSSA 3BQ2A 1N5VA 1JLCA 4H4MA 4HDGA 4B3TF 4LF7J 2R7UA 1HKAA 5E3QA 2W9CA 2MLZA 2ZHBA 3ZTOA 3ADAC 4B9LA 3B4DA 2SXLA 3GB0A 4A8MP 2J6TA 4RUCA 4B3OA 3RTVA 4NLYA 1K0TA 2UVUA 7AT1B 4FYYB 4CT9A 2UUCJ 4IR9A 2CFXA 4C2MA 1TKXB 1T9UA 3JYTB 2E7WA 3W8GA 3OL9A 2D7SA 5L46A 1NKCA 2XS5A 1VQ5S 1TAUA 1IKYA 1AB8A 3VAGA 1Z2ZA 2FIUA 3HDSA 3ITHB 1FERA 3TA2A 4F25A 1S1XB 3SBMA 4CO4A 8RUCA 3VAIA 1TFYA 3E2EA 2VOPA 1N6QA 5J1EA 5B08A 3TARA 3LW5C 1XQIA 1OYDA 2DGTA 1S7HA 4NASA 4ED2A 1PYOB 4DLGA 4OX8A 2NUUG 4ILRA 2CJ9A 4R8UA 1HPZB 1N0UA 2YBVA 2N82B 3CMES 1HWIA 1SKRA 4NCAA 3NNAA 4CLSA 1S12A 5M2UA 2OGUA 4NI2B 1L3SA 1BE4A 2CQ4A 2CA9A 1NPRA 2J5AA 3CJKB 1TL5A 1BMQB 2KI2A 4B3SF 1NJXA 1HYSA 5RUBA 2Z30B 1ZTWA 1BD6A 3SQGA 3WBZA 1IXKA 1TV6B 4USJC 2ZD1B 3D5MA 4ECVA 1P6TA 4W90B 1FKPB 2M9KA 4DX7A 2IVMA 1I1GA 4OI2A 2IM2A 3CT9A 5G0RA 3ZZZA 3M8PA 3KK3B 1K1SA 2XY6A 2IY5B 4JI4J 5LOQA 1RK8A 2NXCA 4HVZA 3HFKA 2QA4G 2QX0A 3HHKA 1TL7B 3MM7B 4FVMA 3Q8PB 4CZCA 3UNYA 3PR4A 4BS2A 2GMLA 4DL0C 3TO8A 4F36A 1PC5A 3K7RA 4ETXA 4LFCF 2NXEA 2R2TA 5L38A 4GC7A 2Z2MA 2I2YA 4QIEA 3C15B 3FFIA 2PD1A 1WI6A 3FNNA 3HFZB 2ASLA 3KNAA 4YUDA 2MLYA 3DMJB 2AD9A 4WK1A 3R5GA 1SV5B 1SJRA 2V68A 4DHVA 4TU8A 1M1KT 1PKUA 4TNOA 3PW2A 4RBVA 5KFWA 1T11A 2VPWB 2K06A 4LRCA 2CKWA 2LDIA 4DL3A 2IIHA 2DH9A 4DN0A 4JV0A 5KFUA 3W3SA 3UDEA 5L1JA 4DSJA 3PEHA 4IG0A 1IVZA 1KQKA 3GCXP 2WCXA 1RU1A 5ETSA 3DLEA 4URGA 1LFWA 1LK5A 3GP9A 3MEDB 4LVOP 5C25A 1M5SA 2UZAA 4J9OA 1V9OA 4KHPF 5IOLA 1RWMB 4ES1A 2OPQB 2BE7D 3ZZRA 1KHVA 3TQEA 3BBBA 4X65J 5HI7A 2FQQB 1I6JA 3J7AN 3SFUA 4X4UA 3DM2A 3IFEA 1FA0A 1HWLA 4I6YA 3LGHA 1NCLA 3K5NA 2DD8S 3T1HF 3UCZP 2BE2B 2FD2A 1R89A 4DS4A 4LF2A 4BBYA 3UN5A 1VJWA 4OIXA 1VRQC 4O4GB 3MPUB 5L1KA 2F9JA 2EG2A 3WIUA 3CJ3A 2MPUA 3IG1A 3RJMB 3S01A 3A8KA 1WKKA 1TTHB 4EBCA 4HL9A 2OSQA 5DM7Q 2IPOB 4P73A 4RW4B 5BXIA 4C6AA 3EGVA 3PXGa 2QLXA 5K8PA 1JLFB 1H3DA 3ZTSA 2ZOGA 3MF5A 3CXCR 4DR3J 3HCXA 3AD9C 2FC8A 1IKWA 3NAHA 1D8YA 5KFJA 3ISZA 3GYGA 1IR0A 1FFGB 2E1CA 2HFNA 3L9ZA 3MM8B 4LF5J 4DV5F 2GA7A 1RUSA 2ZZNA 1M5HA 2FLOA 1EQMA 4DL5A 3HZEA 2BXJA 5GVQA 4XIUA 2L9WA 2MKSA 3F41A 3NWGA 4KT0C 2XLIA 1U48A 4WP9A 1WSRA 4KPCA 5E7OB 2XYGB 2AJQA 3IS9A 4N56A 1QAXA 3M9OB 1JLAB 1P9QC 4DU8A 1XN9A 3VVTA 2MZJA 2LQBA 4NYZA 4LRDA 2G13A 2RILA 4DR5J 2QT7A 2C2NA 3IBFB 3MMBB 3MPYA 4LSLA 4WFAQ 5CD4A 3I9ZA 4DL7A 1N34J 2XB2D 2ERRA 2RNEA 3K59A 2UXBJ 3DLGA 2GO9A 4ED7A 3VZHA 1X31C 1CQMA 3BF4A 1N32J 4Q2MA 4ATNA 4JV1A 1C1BB 4USVA 2RSQA 1RBLA 3GIKA 1EAYC 3NXZA 4NMLA 2FVCA 1NSQA 3QLHA 2EFPA 3D66A 1RYRA 2ZDPA 1JLGB 1S1UB 2J9DE 4ZP9A 2MJUA 2QEXS 3G6YA 1H73A 3TR5A 2KFZA 3DGPA 2NREA 3TNVA 3TEHB 4K5SA 3D68A 4U7CA 3QWUA 3KG0A 4WFNQ 3BDEA 2MZRA 4AQYJ 4WFZA 1D9DA 3V81B 3DOMB 2DR5A 2CJAA 1HI1A 1QUVA 1MROB 4DV6J 2V50A 2DR7A 4CLTA 1I3OB 2QYGA 4LQ3A 4LREA 3QGGA 4EGLA 3CJKA 2W2QP 1KQGB 2VFUA 5T14A 2W9AA 1S9GB 1X0PA 3B78A 3O6QA 4L75A 2HGLA 3TX0A 5L1LA 3SV3A 3C3LA 2QA1A 1C0TA 2ALZA 2NSCA 1Y9OA 4LIWA 3Q8RB 2H54B 3EX7B 2RF2A 2VASA 3NEKA 4HT5A 3ILLA 3KLIA 3GFYA 4I6WA 1HWKA 4DPTA 2RE1A 2E5LF 5HAOA 2MZSA 1R43A 3FSXA 2HVZA 3KK2A 4K59A 5I3QA 2XGPA 1R0AA 3H2LA 4LF9F 2VG6B 1O51A 4CLLA 5B0FA 2PFDA 4KGKA 2C2EA 4ZPCA 1SQEA 2DH8A 1H7XA 2ZVIA 3MHYA 4RUHA 4KAIA 3RAMA 4DPYA 4LF4F 4OX6A 2HHTA 3HHDA 3AOBA 1S9GA 2UUBJ 4NA1A 3MR6A 1WNEA 2HIYA 5CAAA 3J7ZT 2HNYB 4TXSA 4UUWA 1IKWB 1Y4ZB 1HNXJ 3ELHA 2MY8A 3CD5A 4LR9A 4WFBQ 3LGNA 4J9LA 1RTDB 4CO5A 4DSEA 3V6DA 1Q7YT 1D3WA 4K4YA 1WHXA 2CQGA 2DIUA 4LFBJ 4B9MA 4FYWB 1VGYA 3GYNA 1LXJA 1TL3A 3NS5A 4FPRA 3RUBL 1L3TA 2U2FA 1MMNA 2C3MA 3G8TA 2HNDB 2JNJA 1NBEB 1YJVA 3IAM9 2ZH3A 4LF1A 1U1MA 4B3TJ 3QJJA 4C8KA 5HMYA 3J7YI 2HLUA 3IWLA 3NGSA 3QJPA 1RTDA 5LL6d 1AZSB 4LBPA 2VQEF 3DLEB 2M4MA 2J9EA 4YHHF 3VAHA 4CH1A 1NJYA 2UVVA 2ROGA 1B99A 3WZ0A 2CZ4A 4HEA9 1KTVA 4X66J 3AB4B 4DPOA 4C48A 4Y0FA 2ZBQA 3M2RA 3H98A 2MQNA 1JXVA 2K3KA 1TVRA 3G82B 4J37A 4QYRA 3WC0A 3ENQA 3MAAA 1T3NA 1RHMB 1JJCB 2UUWA 4YB5A 4R5PA 1DARA 4A8QA 1JLQB 4FN5A 1WD6A 2CJQA 2KT2A 1N5YB 4DQSA 1FNXH 3OVSA 5LMNF 1H7WA 4KV8A 4GMKA 2BJ8A 4KR0B 3SCJE 4HH0A 2D3ZA 4KO0B 1FTCA 3L4BC 1X9SA 4OLOA 2N3OA 1EJ7L 1T8EA 4K4SA 5IT9U 2NCKL 3D28A 5SZTA 2YY3A 2RHSB 2CQIA 4YDXA 1Y5NB 3D1OA 4L6V3 5E41A 5HLFB 2F65A 3CJ5A 3UVJA 3Q0AA 2CG4A 2E29A 2MZ1A 3I56S 2DNOA 1TQLA 2LXFA 4A48A 3PX0A 2Q6BA 4KV8B 4NXMF 3DU6A 2MKCA 2RDJA 2GW8A 2QE5A 4DR7J 5C2CA 1K73T 4Z37A 1W26A 1SC1B 1R6VA 2GQQA 3JXOA 3GR0A 1K9MT 1JMTA 2GAGC 5A0YA 2CQ2A 5KFNA 1VBYA 3HSZA 3QRRA 3RW6A 2HZCA 3V5RA 1FFSB 3EXCX 5J1PA 1EARA 5J2NA 3AAWB 4I56A 2ZJRQ 3RRHA 2CJYB 5KFVA 1GQEA 3E3XA 3POTB 2FLNA 2HFZA 5B0GA 4RZRA 4YN3B 1CPZA 3TRGA 4UQGA 3MMAB 1U4BA 1QSYA 1C0UB 1NSKL 1RTJA 3KJFB 1Q82T 4K2XA 2UXCF 3DN9A 2F8HA 3LAKA 2G1HA 4RUAA 2I0XA 5KFZA 5A8KB 5KG5A 4BWMA 5KFIA 2AEJA 1C2PA 3HKWA 1YWXA 2J9CA 3TYTA 1QSLA 4B9VA 4OI0A 2ZE2A 4TQRA 2F3JA 1OSCA 5CCMA 3CC7S 1H74A 2KHDA 1PGZA 3C16A 3A3PB 5JXSA 2X51A 2FDNA 2CNNB 2Z0GA 4WPAA 3DM2B 1F0XA 4IKAA 4K5RA 1JLBB 4DLEA 1MN7A 4JYAJ 3ICLA 1NM2A 2YKMB 3OD2A 1VC6A 1RT5B 4OZ1A 2HIQA 2Z4PA 3PY8A 2WOMB 1SIZA 3I82A 3MEGB 1EP4B 2XM3A 4U8VA 4K0KJ 1QM9A 3QFWA 1FRLA 2ACYA 2B9EA 2RQKA 5LJ3Y 2LCWA 2IJFA 5ETOA 1B3TA 4AT1B 2BKNA 3RG6A 1RHJB 3M30A 2NXNA 1U1OA 1FJGJ 2DGWA 2B9WA 2FUG9 5KG4A 2XYHB 4A8OA 3GFXA 2AEMA 2M5YA 2L9DA 2VG5A 3NCQA 3CPWR 4ZITA 4NWBA 1WWHA 4X66F 4EO8A 3RAXA 3HFVA 4LR8A 2MLXA 3A8JA 2XWXA 2E44A 1O0PA 2XGQA 1JLCB 2VHGA 3M2UA 4TN2A 3T5JA 3EDQB 3NCPA 3KLEA 2DEJA 2PMHA 1ACMB 5HJXA 4OZ0A 3H2UB 1U2CA 5HP1B 2GX8A 3RRGA 3HULA 5DLGA 4ZCKA 2MEWA 1XERA 3I5AA 1PIEA 2AGOA 3M2VB 3PJXA 5KFAA 5CABA 4U67Q 1TVRB 2A1BA 2RT3A 4LSZB 1ZZFA 3PR5B 1VQ8S 4B3MF 1FEEA 2V8PA 2V9WA 3M9MB 3B82A 3IM9A 1NXIA 3TWZA 1S10A 3VAMA 4F4YA 2YNIA 3GFHA 4NMXA 4NZ0A 4P75A 3RB3A 1FRJA 1Q79A 1YJ7A 2OEKA 3C2PA 3MCSA 4GRSA 1S72S 1HBMA 1HFEL 3IP0A 3QIPA 3V6HA 1KLMB 1Q8BA 1VDHA 4UOGA 2DNPA 4G1QA 4ZCMA 2ROEA 3SFGA 4URQU 2MMYA 4WIQA 3CJSA 2BW7A 1IBLJ 1XNRJ 1JQGA 4IG3B 4M5DB 4OYZA 4YY3J 1MNEA 1TMMA 1FO1A 3IRWP 1NSAA 5J2NB 4ECQA 2VICA 5K8NA 4P9SA 3UWTA 3EYZA 4WFYA 1SUQB 3CDUA 4ZJLA 2GQ2A 3PO5A 1Y5LB 3ETMA 3AOAA 3H2VE 1WTBA 4C8YA 3LP1A 2CQ0A 4RWXA 2PGCA 3SSRA 4TYAA 3ULHA 4B9TA 2IRYA 1WDDA 4AUKA 2R2RA 2W4DA 2ZH8A 1SL1A 3QO9A 3CJ2A 3PTWA 4KE5A 3TP2A 3VGUA 2AV5A 4FXWA 1NKBA 2L41A 2BOPA 2RVJA 1EZZB 1SKSA 3PKMA 4KH0B 1HWJA 2H4YB 4WZMA 2FGCA 3RW7A 1XMBA 5KFHA 4DL2A 1BXNA 1U45A 3DGVA 7FD1A 2R7OA 1TKXA 4ZVEA 2R8IA 2VQFJ 4USMA 3H5SA 2KM8B 3NMAA 1YQHA 3MAHA 3EGNA 4MKBA 2BJDA 3PRDA 1CC8A 2PA3A 3CJ0A 3THTA 1SJ1A 2NPFA 5M2PA 5IM0B 5IWAJ 2W7PA 2W2MP 4DUTA 4AFFA 3NMRA 4M5JA 4AQYF 2ATLA 4JI0F 2ZC4A 2ZE2B 4RNOA 3R2DJ 5GAGU 3C15A 4IYQA 5I42B 1FVSA 4LIRA 2C2ZB 4ED0A 6FDRA 4JI3J 1A7GE 1P8GA 2M2BA 4PXCA 1DLOA 3EZ5A 1T95A 2HNZA 5JMNA 2RQCA 2UUBF 2U1AA 2PDAA 2BQUA 2ZJQQ 1N54B 3RR8A 3AA8A 5GADU 1E6YA 1H98A 2X3GA 4YB7A 4M5IA 4Q2LA 3W61A 3S8SA 5D3GA 1R8PA 5HVGA 1J5OB 4UOFA 1ZAVA 1LXNA 3DNCA 2RUSA 2R8HA 1RB0A 1NNDA 2KYXA 2VBZA 5KFEA 2D74B 1VRTB 2FHOB 3P49B 1X4FA 1GK8A 4ECRA 4JI7F 4V1Ak 3GV7B 2W2NP 3GIRA 4M94A 4GKJF 2PEHA 3Q23A 1S9EA 3N28A 2MQQA 4KHRA 3MEDA 2J8SA 3MR5A 1L3VA 3K57A 1X5SA 1SCJB 2RJZA 2RU9A 2XZDB 3IMQJ 1LQ9A 4YFUA 2J0QD 1HQ2A 3RBEA 3W7BA 1AYEA 3PW5A 2NXJA 1VR6A 2ZOFA 3M8YA 2IJNA 3RZAA 2QLWA 4J7CA 2C3YA 1LW2A 3BSNA 1G1XA 4KFBB 1JX4A 4URSA 3OJUA 4X62F 2IHR1 4KC5A 1CG2A 4N5SA 4NEZA 1H2UX 3T1HJ 3ET6B 4N8OA 1JLBA 5H9EJ 1RT3B 3FZ2A 3KHHA 3KK2B 2BANB 1FJEB 1CBKA 3X1LB 2BV3A 5IWAF 1UP1A 3MM8A 4DR6J 1FRKA 2DGSA 1WKJA 4Y6IA 4ZHRA 4PYAA 4HHHA 4R5PB 3KXDA 1IUJA 2E7VA 1VFJA 2XHCA 4F02A 1CJTB 2YKNA 2X1AA 4M5NA 1IWAA 1X4BA 2DXDA 3M2RB 5LMUJ 1Q8KA 2LQ9A 1S6PA 2ZH4A 4PAAA 4DR3F 4WFXA 2VQEJ 4BDPA 2HS4A 3BO3A 2VC1A 4TQSA 1U1KA 3CCLS 2HHXA 4CI0B 4IFVA 5D0RA 3H5XA 3DYAB 2YNGA 4JI2F 2HWIA 5E3CA 5BR8J 4W92B 3KLEB 3T6BA 3D7SB 4CLZA 1F60B 2M3DA 4TLQA 4DF8A 3DRSB 1NJWA 4QU6A 3C6UB 4LJMA 1F9FA 1Q78A 2BX6A 4ZIVA 5DZ6A 3FDSA 2HZAA 4C3LA 5A2QU 2AQ4A 2NQPA 2OLWA 2RQ4A 2KJVA 4FVCA 5AE2A 4F4ZA 1I5OB 2Z8QA 4H4OB 2EWHA 3QAEA 2CJKA 1UWBA 3MM6A 4IDKA 3OFFA 1W2BR 4JUZA 3FVYA 1IR2A 4PXEA 4UZCA 2JEFA 3R5CA 1GAOA 3H20A 2GAHC 2PT0A 2ZEJA 3AH6A 3N5BA 4N8NA 2ZH9A 1X9MA 3DFEA 5F8IA 4O0IA 4B9SA 4ECWA
chains in the Genus database with same CATH topology
5DM6Q 2BQ3A 3LP0B 2VBWA 2VPZB 2JZ5A 3C6TB 3K0JA 1RT6A 4ID5B 3K5MA 3VQSA 1UVIA 2HHQA 5CYJA 4O44A 4PG4A 4MTPA 5B0CA 4YMEA 2IVYA 2FTRA 1GH8A 2XMUA 3FFIB 3SCKE 1UJ6A 4FF4A 1RI7A 4K4WA 3G86A 3T5LA 1S9EB 1DQ9A 1Y7PA 3MFHA 3LAMA 4XO0A 1U49A 3DOKA 3EPGA 1X5PA 1BC6A 2VG7B 3UCGA 3BQ1A 4NPOA 1UFLA 2BABA 1T3OA 2DNMA 4NOHA 5I3UB 5HBMA 2HVIA 1LWEA 3CCMS 3MUVP 4C11A 2C3PA 1VBXA 3CCWA 1FTRA 1TV6A 2V8DA 3HVTA 3MEEB 5FDLA 1KTQA 4F3QA 1S10A 1ZZNA 3HVWA 1YRXA 3O5TB 2B0GA 4PXBA 5DETA 2W25A 4F2SA 5IS2A 1VHFA 2IM1A 3CEDA 3FZBA 2OIHA 1TKZA 2DNZA 4BHQA 3HXMA 3ENVA 1SB6A 2BE2A 3F44A 4O3OA 1UVNA 2OPQA 1K8AT 5AE3A 4Y2MA 2VV5A 3OTDA 4WXOA 4Q44A 4DF4A 3V4IA 2YWHA 3LF0A 4N76A 4G6VB 3I5CA 5KFMA 2K2PA 2QZ8A 3UE2A 4ZPVR 3Q24A 1GXTA 1U2FA 4ELUA 4OJ3A 3DRXA 1ELOA 3KLHA 2J7KA 3N79A 2HHVA 1BLUA 3V2UC 1SH2A 4RBTA 4ZP8A 1APSA 1MMDA 3AQPA 4CO3A 2MKIA 1Z2LA 1N32F 1V3SA 3IC1A 3MMCA 1KOHA 2KFNA 4EZ9A 4R0JA 4HYKA 2M52A 4Q43A 1RT7A 3LOUA 3BREA 1HR0F 2I5JB 3C46A 2DO0A 3I4HX 1UEUA 1XK8A 5C42A 1IKXB 4C3KA 1TZ0A 5E3AA 5CH7B 1CSJA 4QW9A 4ZPTR 2DGVA 4EUVA 3CCTA 3OBIA 4TYBA 1G6BA 2B43A 4M63A 1TL1B 1UJ5A 1WG5A 5F8HA 3BSOA 4F3MA 3HX9A 1BQXA 3I0RB 3RB4A 2J6UA 3AHPA 4QU7A 2A2DA 3ZZUA 4KSEB 1JB0C 1TKTB 1QAIA 4MAKA 3HVAA 3NNHA 4NCBA 5FLXY 3HM9A 1WI8A 5A0YB 1UFWA 5DRKA 3U7JA 2C42A 2ZZMA 2D41A 3FEXB 2P9GA 2AJFE 2YNFA 4QPTA 5IZHA 3O3LA 2R7XA 2IMOA 1VQMS 4OJGA 3M6VA 3I0SA 4DV1F 4DFKA 1Z4UA 3I55S 4DBQA 4IH5A 2AGPA 3QJLA 1P1LA 2NR0A 2BACA 3RB6A 2IA0A 3MEKA 1UWBB 3MM6B 2FVQA 1URNA 5F8JA 3KG4A 4OZ5A 1TKTA 3HHLC 1JNZB 2P6SA 4OHXA 3HVTB 1JWWA 2GIRA 1HWUA 2I38A 2ZH5A 1S4FA 2JVOA 2MQMA 3O2IA 2QRRA 5GAEI 2HHWA 3OSNA 1SXLA 1S0VA 4P2SA 1LWCB 3TA0A 1S1UA 3M6UA 4J9PA 2K1RB 1X9WA 4QW8A 4PQUA 2W9BA 1LOUA 2VFRA 2RMLA 1NZAA 4MFBA 4Y3CA 4QR1A 2HW3A 1S1VB 1FDBA 3DLLQ 5C5JA 4LT6A 1N34F 1XWLA 4EBDA 2AYMA 4A4JA 4WKYA 2UV8G 1LWEB 2CVEA 3DCAA 2HNYA 2AJ4A 2LKZA 3MMCB 3HVRA 2DJWA 4QJVA 1M5PC 2R8KA 2WW8A 4IO1A 2N7CA 3BJYA 2FVSA 4X64F 1IJEB 3BGUA 3OFHA 3VTIA 3RYLA 2W8KA 4HH1A 2CJBA 3Q22A 1AFIA 2VUGA 1UW4A 1AFJA 1WF2A 2V4RA 1VK3A 1HQUB 2VC0A 2PMZD 2MSTA 3T9ZA 3SXLA 1DTTA 4IO9Q 3KFWX 2JL9A 4WU3A 2O5DA 1U7LA 4UY8T 3ZZTA 2ZH2A 1VQKS 4DMZA 3I5BA 2FHJD 3DDNA 1VC5A 1NJZA 3JYTA 4NLVA 5F8GA 3RU0A 4CNYA 2CPXA 1MSWD 2JLGA 4QIWD 2MDAA 4B3OB 2CQBA 1RT5A 5AE1A 4J9MA 2BA9A 3BSCA 4B02A 5KFQA 3BSAA 2M7SA 2BM0A 3UNGC 2YKOA 1SJFA 2DH7A 2V94A 5A6PA 2HMIA 2DB1A 1RTIB 1VMBA 1RKIA 2QSWA 3CJ4A 2RU3A 4DDFA 5KFTA 2V9KA 2KG0A 2RIJA 3UD3P 3GIJA 3TANA 1T02A 4IFYB 1S6PB 2EFVA 1EETA 1R27B 4J9QA 1RT1A 3LWMA 3FCHA 2CQ3A 2OPSB 3G4SS 1RYSA 1YHQS 2ZD1A 2XC9A 2ZFHA 4N41A 1TL3B 4JI8F 1IJFB 5KFPA 5HO4A 2HYIB 2Q6CA 4R0EA 4AXJA 1CEZA 4JI1F 2E9ZA 1DURA 1DZ5A 3DLKB 3PFEA 5I42A 3NLCA 2XMKA 2ZUGA 5E3PA 4ZVFA 1FEHA 2WK4A 2KO1A 4IH7A 1YJTA 3MM9A 3FSIA 2IAJA 3GWCA 3AJ2A 2GHVC 2LXUA 4JYAF 1FXLA 5C24A 3HHLB 5IM0A 2BR0A 4RW8A 1IBKF 3IS9B 3PFOA 1LW0A 4PG7A 3UR0A 3JSMA 4FS1A 2X1FA 2AYEA 4KPYA 5D6GA 1JIHA 4YB1P 2R4FA 1S1WA 2XS2A 2EFOA 2MZQA 2H9ZA 5KT4A 3VQTA 2I9SA 1TKZB 3CDBA 4NLTA 3SCLE 4DQRA 4FXDA 1E6VA 1C0TB 4RW8B 1R0AB 1X4EA 3QMQA 2JWNA 2B56A 3VALA 1T94A 2P6TA 1QVGR 3V4IB 3MECA 1RT6B 3ZFVA 3IBWA 4OJ1A 2GJIA 3HK2A 3OW2R 2JFKA 3TAMA 1GX6A 2RRNA 2OP5A 3SQGB 1ZBTA 2VFVA 4C8NA 2VKZG 3EPIA 1VC0A 4J5OA 2LEAA 3P5TL 1S6OA 4C0BA 2R7QA 3MMAA 2KFYA 3SI8A 4QPXA 2HGNA 1N4LA 3NBPB 1YVFA 2J9DA 3U1LA 3AQOA 3QIDA 3POTA 3WC2A 1HQEB 2KN4A 1LWCA 3G96A 4GO7X 3THVA 4B17A 2YKNB 1CLFA 2Y1RI 1WF0A 1X4AA 4RKUC 5F8LA 3ZZOA 2AYGA 1OQ3A 1FJCA 1RT7B 1NH8A 1FHTA 4DN9A 3I31A 4A8KA 2HHHF 5BYQA 3DRYA 4HT7A 4A8FA 3CCES 1R3NA 2IYIA 2ZM6F 3NKYA 1VQYA 1HNZF 3ISNC 3DRRA 2UXDF 3L7PA 1IN0A 4YQWA 2OTLS 2WHOA 3PRBA 2P9EA 2AX1A 1KVIA 1N52B 3KLFB 1KQSR 2VBXA 2GCFA 4RU2A 1U25A 1YBAA 4ECYA 4P7TA 1YSJA 1NO8A 3FJ2A 2YVSA 4M8LA 4CTAA 3CVKA 4X2BA 1SL2A 2WOMA 3CIZA 5L9XA 1S1TB 2W4PA 4ZPWR 1U1NA 2UVRA 2F8EX 4G3IA 3TQ1A 4I6AA 5F3TA 4TU7A 1XR6A 2NZ4A 2DGUA 3IRXB 2CVIA 5LJ5Y 2JDJA 2JH3A 1SUQA 1U24A 3PDNA 3QWPA 4IOAQ 4WF9Q 1HNIB 2KT5A 3M2VA 4AE5A 5IFMA 1ZM9A 2RRBA 1VQOS 1S97A 1VQ6S 2DNKA 2QSFA 2WONB 1L3KA 5CA5A 2DNGA 4LQ9A 4X4RA 1J5EF 4DFJA 3DU5A 5FD1A 1B64A 5C42B 5G0RB 1SJQA 3R1HA 3DRSA 5DDPC 1B0PA 2DNQA 4WU2A 1FT8A 1U09A 1HNIA 1C4AA 2DCLA 3CDAA 3WX4A 1FJ7A 3T5KA 4IFVB 3OHBA 4EBEA 1ZYQA 4PCQA 4FBTA 1B0TA 2HFOA 2IRXA 2FJDB 3MI7X 4WYWA 1FK9A 3BR8A 1IM4A 4MYUA 4ICLA 5KG0A 3D54A 4ZVGA 1RP5A 1Q4RA 1SH0A 3LUYA 2DR9A 1JLEA 2UUTA 2GQCA 3O1LA 4I0WA 1AW0A 3E01B 3OLBA 5CYQA 4JV5F 4DR1F 2CPIA 2MXYA 2ZKUA 1UETA 2L08A 3DMJA 3FQLA 2EFGA 4QBUA 4RWWA 3P96A 3C66A 1QTMA 1DFDA 3VAJA 4O3SA 1S1XA 2JLFA 5J2PB 2KU7A 3TVZA 4ID5A 3D1QA 5KFSA 3MPWA 3PW7A 2DPIA 3HHLD 3R1LA 2FJVA 4DV2F 1F5AA 5KG6A 2B4VA 2N4CA 1Q8IA 2G0CA 2J7WA 2MJNA 1NJIT 4Q8FA 1WG4A 4K4TA 4DR5F 1HHSA 4MIWA 3CWJA 3PV8A 4JOUA 4DL4A 4HHJA 1YRTA 3OHAA 1IKVA 1S79A 3T19A 4ED5A 4FZVA 1BGXT 4PUOB 3EZUA 2R7VA 2LU1A 3PHEA 2ZJPQ 3UR3C 2F4VF 2GJ2A 5I3UA 2OFHX 5THWA 3DOKB 3AY0A 2DGOA 2IM3A 3CO9A 1UA0A 2BANA 2BVZA 3DRPB 5AXLA 3QGIA 3E51A 5A8WA 2BDPA 3SSQA 3M2UB 5ITHA 3R3TA 5IT9Y 4FF3A 2V4JA 4ZOSA 2IA6A 2ILYA 1FRIA 2RS8A 1O5JA 3P3DA 3DHWC 1T05B 3KWMA 3RR7A 3KMQA 1JNRB 3MPVA 2EKYA 4MKYA 4F3OA 1TR0A 1DRZA 1V3ZA 1VRUB 3HPOA 1RT4A 4QIGA 3V6JA 1REVB 2EK1A 3KTQA 3DLJA 2KZZA 4IG0B 2AU0A 1U1QA 2JEIA 4KQZA 3JSRA 2OPRB 3DDKA 4MH8A 5FIIA 2AJ0A 3V6KA 4BWJA 2VG6A 4KO0A 3SDEB 2R7TA 1V6HA 2XMWA 2CQDA 4UY85 4LFAF 1X4GA 3KG1A 3KLFA 3K5LA 5F8NA 1RA6A 1VRUA 2ILZA 5EX3A 3NNCA 3BQ0A 2A10A 4IDKB 4Y00A 2QYCA 1TAQA 2DR8A 1T05A 5JVHQ 1JKHA 1JK9B 3J7YU 5B0EA 4J9SA 4NLQA 4JI5F 2HNDA 4X65F 2Y0SD 5LSLA 4EZ6A 1NK6A 2VA3A 2B7BB 3GV5B 1QUPA 2OMLA 3RAQA 3LGMA 2HMIB 1WEYA 3G71S 4F50A 3QZ7A 1XC9A 5KG1A 3DXBA 5D4NA 2K8GA 4DEZA 2LYVA 2N3LA 4B3RF 3CB4A 5EX0A 2ZITA 1RT1B 4IOCQ 3OXGA 2N7YA 2WONA 2XLKA 2Q43A 3FEZA 4UW2A 4EU0A 5CYMB 3R5AA 1D9FA 1KS2A 4ZP6A 3L95X 3GQCA 3O8WA 4LMZA 4AL6A 3DLBA 4HI2A 2X1GA 2DHXA 4ELTA 2FHJA 1HPZA 3K2YA 1B0VA 2JHEA 2B5JA 1WEXA 3I9V9 3OTOF 1YJWS 3CULA 1QAYA 3IXQA 5KFXA 5F8MA 4BCAA 4ED8A 2V8HA 3TUZC 1ZM3A 2ROPA 3KLIB 4RNHA 2XEXA 5E3RA 2VOOA 5AXNA 4KFBA 5KFYA 2V4JB 4PWUA 4FF2A 3T6JA 2AX0A 3MDFA 2XBPA 3LO3A 4ZVHA 1VQPS 3OUYB 4C8LA 3SV4A 2HNZB 1JJ4A 1ZOTA 1Q1KA 1OIAA 5LXYA 4YR3A 1NH7A 2RRAA 4I1TA 1WACA 1U47A 2M88A 4M95A 4ZA1A 2R9LA 2QO3A 2OSRA 5L9NA 4DV6F 3K8WA 1TK5A 4MK7A 1X0FA 3EXYA 2M8DB 3MAQA 4DQQA 4WK3A 1VOMA 4OHVA 2E5GA 1UAWA 3NBPA 2CYYA 4OV1A 1S48A 2B6AA 1H38A 5F0WA 4X84A 3UQSA 5CD4H 2LECA 5GADI 2KJWA 5A8KA 2VPYB 2YKMA 5D4OA 1BQNA 4WE1B 2HS0A 2BUNA 5JUMA 2CQCA 3M6XA 4RW6A 4X4PA 1HW8A 4DJBA 5MLCV 2UUCF 4F26A 3G8SA 1HNVA 4OHYA 2FPHX 3M6WA 1KFSA 3VWSA 3TAQA 2DNLA 2HWHA 3LANA 4RW9B 4QWDA 2KVIA 3ITHA 2XO7A 5F0UA 3K58A 4KTQA 2ZH1A 2XS7A 3CTRA 1GTHA 2RD5C 4H4KA 1LKZA 2VD3A 3L7OA 1TK8A 3LP1B 4M5DA 4OI4A 2DISA 5GMKa 3LALA 1AROP 4H4KC 1HBUB 3OR2B 3DRRB 5KFBA 4RNFA 4DV0F 3CUNA 2CQHA 3R5DA 3T1AA 3ENWA 1ULRA 3KJVA 3NAIA 5T7LA 5DS7A 1NK0A 3KOAA 2B9YA 1X4CA 4WXWA 3A8EA 2FJXA 1KR4A 1MWYA 3MM9B 4NA2A 2J0SD 4I2QB 3BDPA 2MGZA 4C98A 1IBLF 1T7PA 2K3IA 3Q2SC 1JLFA