3FS3A

Crystal structure of malaria parasite nucleosome assembly protein (nap)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
249
structure length
197
Chain Sequence
b'TDLTEEQKETLKKLKLYQKEYYDYESKFEYELFLLRQKYHDLYGPIYDKRREALVGAKIGTPNLPEFWLRALRNNNTVSHVIEDHDEEILVYLNDIRCDYIKGFILSFYFATNPFFSNSVLTKTYHMKVLLHTEATVIDWYDNKNILKKRDSFFHFFTSHKVEVAQLEMIIEGDYEVALTIKERIIPYAVDYYLGII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleosome assembly protein 1, putative
publication title Crystal structure of malaria parasite nucleosome assembly protein: distinct modes of protein localization and histone recognition.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Chaperone
total genus 65
structure length 197
sequence length 249
ec nomenclature
pdb deposition date 2009-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00956 NAP Nucleosome assembly protein (NAP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.90 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 3fs3A02
3GYWA 3GYVA 3HFDA 5DAYA 2E50A 3FS3A
chains in the Genus database with same CATH superfamily
2OJXA 1F34B 4LKMA 4O56A 4O9WA 2E50A 5DNJA 1FSUA 4WHKA 4YYPA 4NKBA 4X9RA 2N19A 4E9CA 4E67A 1HDHA 2I9ZA 3P34A 4RCPA 3GYWA 3ED4A 4LKLA 2VKZG 3P2WA 5DMSA 1E1ZP 3HFDA 4N7ZA 2OGQA 1A87A 4HCOA 1N2KA 1Q4OA 1E2TA 4H71A 4O6WA 4XB0A 4E9DA 1Q4KA 1AUKA 2UV8G 4X9WA 4G7NA 3C5LA 3LM3A 3LXQA 5J19A 4FDIA 5LHZA 4N7VA 1N2LA 1E2SP 4DFWA 4CXKA 4FDJA 3P37A 2QZUA 5DMVC 3FS3A 3RQ7A 4CYSA 4X9VA 3P36A 3HIHA 3Q1IA 4J7BB 4CXSA 1UMWA 5AJ9A 1E3CP 3P2ZA 4CYRA 1P49A 3GYVA 4WHHA 2I9XA 3HIKA 3FVHA 3P35A 4N9JA 2IA9A 5DAYA 4H5XA 4HY2A 4WHLA 3KDRA 3BZIA 1F32A 3HMJG 4NK7A 4RS6A 4HABA 4CXUA 1E33P
chains in the Genus database with same CATH topology
1E1ZP 3HFDA 5AJ9A 1E3CP 3LM3A 4N7ZA 3LXQA 4FDIA 4CYRA 1P49A 1N2KA 3GYVA 2E50A 4N7VA 1N2LA 1FSUA 1E2SP 1E2TA 4NKBA 4CXKA 4FDJA 4N9JA 4CXSA 5DAYA 2QZUA 3FS3A 1HDHA 1AUKA 3KDRA 4CYSA 3GYWA 2UV8G 3HMJG 3ED4A 4NK7A 4G7NA 4CXUA 2VKZG 1E33P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYW A;  3GYV A;  3HFD A;  5DAY A;  2E50 A;  3FS3 A; 
#chains in the Genus database with same CATH topology
 2OJX A;  1F34 B;  4LKM A;  4O56 A;  4O9W A;  2E50 A;  5DNJ A;  1FSU A;  4WHK A;  4YYP A;  4NKB A;  4X9R A;  2N19 A;  4E9C A;  4E67 A;  1HDH A;  2I9Z A;  3P34 A;  4RCP A;  3GYW A;  3ED4 A;  4LKL A;  2VKZ G;  3P2W A;  5DMS A;  1E1Z P;  3HFD A;  4N7Z A;  2OGQ A;  1A87 A;  4HCO A;  1N2K A;  1Q4O A;  1E2T A;  4H71 A;  4O6W A;  4XB0 A;  4E9D A;  1Q4K A;  1AUK A;  2UV8 G;  4X9W A;  4G7N A;  3C5L A;  3LM3 A;  3LXQ A;  5J19 A;  4FDI A;  5LHZ A;  4N7V A;  1N2L A;  1E2S P;  4DFW A;  4CXK A;  4FDJ A;  3P37 A;  2QZU A;  5DMV C;  3FS3 A;  3RQ7 A;  4CYS A;  4X9V A;  3P36 A;  3HIH A;  3Q1I A;  4J7B B;  4CXS A;  1UMW A;  5AJ9 A;  1E3C P;  3P2Z A;  4CYR A;  1P49 A;  3GYV A;  4WHH A;  2I9X A;  3HIK A;  3FVH A;  3P35 A;  4N9J A;  2IA9 A;  5DAY A;  4H5X A;  4HY2 A;  4WHL A;  3KDR A;  3BZI A;  1F32 A;  3HMJ G;  4NK7 A;  4RS6 A;  4HAB A;  4CXU A;  1E33 P; 
#chains in the Genus database with same CATH homology
 1E1Z P;  3HFD A;  5AJ9 A;  1E3C P;  3LM3 A;  4N7Z A;  3LXQ A;  4FDI A;  4CYR A;  1P49 A;  1N2K A;  3GYV A;  2E50 A;  4N7V A;  1N2L A;  1FSU A;  1E2S P;  1E2T A;  4NKB A;  4CXK A;  4FDJ A;  4N9J A;  4CXS A;  5DAY A;  2QZU A;  3FS3 A;  1HDH A;  1AUK A;  3KDR A;  4CYS A;  3GYW A;  2UV8 G;  3HMJ G;  3ED4 A;  4NK7 A;  4G7N A;  4CXU A;  2VKZ G;  1E33 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...