3FS3A

Crystal structure of malaria parasite nucleosome assembly protein (nap)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
249
structure length
197
Chain Sequence
TDLTEEQKETLKKLKLYQKEYYDYESKFEYELFLLRQKYHDLYGPIYDKRREALVGAKIGTPNLPEFWLRALRNNNTVSHVIEDHDEEILVYLNDIRCDYIKGFILSFYFATNPFFSNSVLTKTYHMKVLLHTEATVIDWYDNKNILKKRDSFFHFFTSHKVEVAQLEMIIEGDYEVALTIKERIIPYAVDYYLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleosome assembly protein 1, putative
publication title Crystal structure of malaria parasite nucleosome assembly protein: distinct modes of protein localization and histone recognition.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Chaperone
total genus 65
structure length 197
sequence length 249
ec nomenclature
pdb deposition date 2009-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00956 NAP Nucleosome assembly protein (NAP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.90 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 3fs3A02
3GYVA 2E50A 3FS3A 3GYWA 3HFDA 5DAYA
chains in the Genus database with same CATH superfamily
3C5LA 3KDRA 3ED4A 4H5XA 4X9RA 4CXSA 1FSUA 5DMSA 3P37A 4E9DA 4RS6A 3GYWA 4LKLA 5J19A 3GYVA 4FDJA 4DFWA 1E3CP 4O56A 5DAYA 4X9VA 4CXUA 1AUKA 1F34B 4HCOA 4CXKA 3HIHA 3Q1IA 4WHHA 4O9WA 4X9WA 3P2ZA 4E9CA 4WHLA 1P49A 1UMWA 4LKMA 1Q4OA 3LM3A 3HFDA 2VKZG 1E2TA 3HIKA 5LHZA 1E33P 5AJ9A 4XB0A 4CYSA 2UV8G 4N9JA 4HABA 3FS3A 3RQ7A 1A87A 2N19A 2I9ZA 3FVHA 3HMJG 4H71A 2I9XA 4RCPA 2QZUA 3P34A 3BZIA 4J7BB 4NK7A 4O6WA 3P35A 3P36A 4CYRA 4WHKA 1F32A 2IA9A 1N2KA 5DMVC 4N7VA 1Q4KA 1HDHA 2OGQA 2OJXA 1N2LA 4NKBA 3LXQA 4FDIA 4G7NA 5DNJA 2E50A 3P2WA 4HY2A 4YYPA 1E1ZP 1E2SP 4N7ZA 4E67A
chains in the Genus database with same CATH topology
3KDRA 4CXKA 3ED4A 1N2KA 4CXSA 4N7VA 1FSUA 1HDHA 3HMJG 1P49A 1N2LA 4NKBA 2QZUA 3GYWA 3LM3A 3HFDA 3LXQA 2VKZG 4FDIA 4G7NA 1E33P 3GYVA 2E50A 4FDJA 4N7ZA 4NK7A 5AJ9A 4CYSA 2UV8G 1E3CP 4CYRA 5DAYA 4N9JA 1E1ZP 3FS3A 1E2SP 4CXUA 1AUKA 1E2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYV A;  2E50 A;  3FS3 A;  3GYW A;  3HFD A;  5DAY A; 
#chains in the Genus database with same CATH topology
 3C5L A;  3KDR A;  3ED4 A;  4H5X A;  4X9R A;  4CXS A;  1FSU A;  5DMS A;  3P37 A;  4E9D A;  4RS6 A;  3GYW A;  4LKL A;  5J19 A;  3GYV A;  4FDJ A;  4DFW A;  1E3C P;  4O56 A;  5DAY A;  4X9V A;  4CXU A;  1AUK A;  1F34 B;  4HCO A;  4CXK A;  3HIH A;  3Q1I A;  4WHH A;  4O9W A;  4X9W A;  3P2Z A;  4E9C A;  4WHL A;  1P49 A;  1UMW A;  4LKM A;  1Q4O A;  3LM3 A;  3HFD A;  2VKZ G;  1E2T A;  3HIK A;  5LHZ A;  1E33 P;  5AJ9 A;  4XB0 A;  4CYS A;  2UV8 G;  4N9J A;  4HAB A;  3FS3 A;  3RQ7 A;  1A87 A;  2N19 A;  2I9Z A;  3FVH A;  3HMJ G;  4H71 A;  2I9X A;  4RCP A;  2QZU A;  3P34 A;  3BZI A;  4J7B B;  4NK7 A;  4O6W A;  3P35 A;  3P36 A;  4CYR A;  4WHK A;  1F32 A;  2IA9 A;  1N2K A;  5DMV C;  4N7V A;  1Q4K A;  1HDH A;  2OGQ A;  2OJX A;  1N2L A;  4NKB A;  3LXQ A;  4FDI A;  4G7N A;  5DNJ A;  2E50 A;  3P2W A;  4HY2 A;  4YYP A;  1E1Z P;  1E2S P;  4N7Z A;  4E67 A; 
#chains in the Genus database with same CATH homology
 3KDR A;  4CXK A;  3ED4 A;  1N2K A;  4CXS A;  4N7V A;  1FSU A;  1HDH A;  3HMJ G;  1P49 A;  1N2L A;  4NKB A;  2QZU A;  3GYW A;  3LM3 A;  3HFD A;  3LXQ A;  2VKZ G;  4FDI A;  4G7N A;  1E33 P;  3GYV A;  2E50 A;  4FDJ A;  4N7Z A;  4NK7 A;  5AJ9 A;  4CYS A;  2UV8 G;  1E3C P;  4CYR A;  5DAY A;  4N9J A;  1E1Z P;  3FS3 A;  1E2S P;  4CXU A;  1AUK A;  1E2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...