3FS3A

Crystal structure of malaria parasite nucleosome assembly protein (nap)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
249
structure length
197
Chain Sequence
TDLTEEQKETLKKLKLYQKEYYDYESKFEYELFLLRQKYHDLYGPIYDKRREALVGAKIGTPNLPEFWLRALRNNNTVSHVIEDHDEEILVYLNDIRCDYIKGFILSFYFATNPFFSNSVLTKTYHMKVLLHTEATVIDWYDNKNILKKRDSFFHFFTSHKVEVAQLEMIIEGDYEVALTIKERIIPYAVDYYLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of malaria parasite nucleosome assembly protein: distinct modes of protein localization and histone recognition.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Chaperone
molecule keywords Nucleosome assembly protein 1, putative
total genus 65
structure length 197
sequence length 249
ec nomenclature
pdb deposition date 2009-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00956 NAP Nucleosome assembly protein (NAP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.90 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 3fs3A02
3FS3A 2E50A 5DAYA 3HFDA 3GYWA 3GYVA
chains in the Genus database with same CATH superfamily
4N7ZA 3LM3A 4X9VA 5AJ9A 1E2SP 4X9WA 1N2LA 2OGQA 1F32A 2I9ZA 5DNJA 4J7BB 4WHLA 4CXSA 1E33P 4HABA 4X9RA 3FVHA 1Q4OA 3P34A 4DFWA 4NK7A 2VKZG 1P49A 3FS3A 4NKBA 4XB0A 4FDJA 3KDRA 3Q1IA 1HDHA 2IA9A 4YYPA 1F34B 5DAYA 3HMJG 5LHZA 4HY2A 3P2WA 4FDIA 1E3CP 3P37A 3HFDA 4N9JA 3GYWA 3C5LA 5J19A 4CXKA 3P35A 4WHHA 2N19A 1FSUA 1UMWA 4LKMA 1A87A 4CXUA 3GYVA 4CYRA 4E9CA 2UV8G 2I9XA 3HIHA 4WHKA 1Q4KA 2E50A 3P2ZA 4CYSA 4O9WA 4E9DA 4H71A 1E2TA 4N7VA 4HCOA 3P36A 4LKLA 4H5XA 2QZUA 4RCPA 5DMVC 1N2KA 5DMSA 3BZIA 4O6WA 1E1ZP 4G7NA 3ED4A 3RQ7A 3HIKA 4O56A 1AUKA 4E67A 2OJXA 4RS6A 3LXQA
chains in the Genus database with same CATH topology
1E2TA 1P49A 4N7ZA 4N7VA 1FSUA 3FS3A 4NKBA 4FDJA 3LM3A 3KDRA 4CXUA 3GYVA 1HDHA 4CYRA 5AJ9A 1E2SP 2QZUA 2UV8G 5DAYA 3HMJG 1N2LA 4FDIA 1E3CP 1N2KA 3HFDA 4N9JA 4CXSA 3GYWA 1E33P 1E1ZP 4G7NA 3ED4A 2E50A 4CYSA 4CXKA 4NK7A 1AUKA 3LXQA 2VKZG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FS3 A;  2E50 A;  5DAY A;  3HFD A;  3GYW A;  3GYV A; 
#chains in the Genus database with same CATH topology
 4N7Z A;  3LM3 A;  4X9V A;  5AJ9 A;  1E2S P;  4X9W A;  1N2L A;  2OGQ A;  1F32 A;  2I9Z A;  5DNJ A;  4J7B B;  4WHL A;  4CXS A;  1E33 P;  4HAB A;  4X9R A;  3FVH A;  1Q4O A;  3P34 A;  4DFW A;  4NK7 A;  2VKZ G;  1P49 A;  3FS3 A;  4NKB A;  4XB0 A;  4FDJ A;  3KDR A;  3Q1I A;  1HDH A;  2IA9 A;  4YYP A;  1F34 B;  5DAY A;  3HMJ G;  5LHZ A;  4HY2 A;  3P2W A;  4FDI A;  1E3C P;  3P37 A;  3HFD A;  4N9J A;  3GYW A;  3C5L A;  5J19 A;  4CXK A;  3P35 A;  4WHH A;  2N19 A;  1FSU A;  1UMW A;  4LKM A;  1A87 A;  4CXU A;  3GYV A;  4CYR A;  4E9C A;  2UV8 G;  2I9X A;  3HIH A;  4WHK A;  1Q4K A;  2E50 A;  3P2Z A;  4CYS A;  4O9W A;  4E9D A;  4H71 A;  1E2T A;  4N7V A;  4HCO A;  3P36 A;  4LKL A;  4H5X A;  2QZU A;  4RCP A;  5DMV C;  1N2K A;  5DMS A;  3BZI A;  4O6W A;  1E1Z P;  4G7N A;  3ED4 A;  3RQ7 A;  3HIK A;  4O56 A;  1AUK A;  4E67 A;  2OJX A;  4RS6 A;  3LXQ A; 
#chains in the Genus database with same CATH homology
 1E2T A;  1P49 A;  4N7Z A;  4N7V A;  1FSU A;  3FS3 A;  4NKB A;  4FDJ A;  3LM3 A;  3KDR A;  4CXU A;  3GYV A;  1HDH A;  4CYR A;  5AJ9 A;  1E2S P;  2QZU A;  2UV8 G;  5DAY A;  3HMJ G;  1N2L A;  4FDI A;  1E3C P;  1N2K A;  3HFD A;  4N9J A;  4CXS A;  3GYW A;  1E33 P;  1E1Z P;  4G7N A;  3ED4 A;  2E50 A;  4CYS A;  4CXK A;  4NK7 A;  1AUK A;  3LXQ A;  2VKZ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...