3FSAA

Pseudomonas aeruginosa azurin with mutated metal-binding loop sequence (caahaam); chemically reduced.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
122
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLEQYMFFCAAHAAMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Metal-binding loop length and not sequence dictates structure.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Metal binding protein
total genus 29
structure length 122
sequence length 125
ec nomenclature
pdb deposition date 2009-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fsaA00
2XXGA 1FFTB 2IDFA 4UF7C 1NICA 2IAAC 3OD3A 2DWSA 4A66A 3FU9A 3FQ2A 1AS8A 1TKWA 5I28A 1CC3A 8PAZA 1A4BA 5I6PA 3OMNB 1GS6X 2BP0A 1B3IA 1J9TA 2FTAA 3NJLA 2QDVA 2PPEA 1EHKB 5I5IA 1ZV2A 3S3CB 1PZBA 5AFAA 2WSDA 3S8GB 1MDAA 1BXUA 4E9TA 1V55B 3GDCA 1AZUA 1TEGA 4BDVB 2CCWA 3IBOA 4QLWA 4YSTA 1AAJA 1SHWA 4P5SA 5AZUA 2YAOA 4KNTA 3S8FB 2BWIA 1NIAA 1ZIAA 3CVDA 1A65A 1MZYA 4GP5B 3SBPA 1L9RA 2AANA 2UXFA 1AQ8A 1KDJA 2YAPA 5B7EA 5E9NA 1ADWA 4QKTA 5AKRA 1KCBA 2FQGA 3QJQB 1BQRA 4DP1X 3TU6A 5F7BA 2OV0A 1NIEA 3ABLB 2VM3A 3FU7B 2IWFA 1NDTA 5D4JA 2W88A 3CVBA 1WS7A 3X1BA 1OCOB 2HLEB 2XX1A 3IN2A 4YSOA 9PCYA 1AG0A 2VN3A 1SF3A 3NJHA 4YSAA 1MG2C 1SDDA 4KO6A 4HHGA 2J55A 1BYOA 3PAZA 1OCRB 1W6LA 2XLLA 2VSKB 3SBRA 1AS7A 2P80A 3UAAA 2J5WA 2FT7A 4JHUA 1KDIA 3D12B 5B1KA 2HZHA 4A67A 3NJFA 4A2EA 3AW5A 1L9PA 3EH4B 4FAAB 2FWLB 1JZHA 4CSPA 1MZZA 3L45A 1PZCA 2IDTA 1V10A 3T6ZA 3H56A 4DPAX 3T6VA 4HCGA 1GYCA 4N8UA 4A2GA 1GSKA 5I6NA 1DYZA 1PLCA 1JXGA 3WIAA 7PCYA 1IUZA 4GYBA 1M57B 5I5JA 1ETJA 2VW6A 3IE9A 3SBQA 2GC4C 2AFNA 2B3IA 3NT0A 1AOZA 4UANA 4F2FA 3NJJA 1ZDSA 2BZCA 1RZQA 1E65A 1WA2X 2VW4A 4W1TA 3UACA 3NP4A 4PAZA 4DP4X 2AZAA 3QPKA 4DP8X 1N68A 1VLXA 2UXTA 2MRYA 1GW0A 4G70B 1IBZA 2IH9A 3FQYA 2UXGA 1OOWA 3ZX1A 4AZUA 5FC9A 1KCWA 2JKWA 1ILSA 2PP8A 2UX6A 3ZDWA 3WKPA 2BZ7A 3AG4B 3X2QB 1ASOA 1NZRA 1ASQA 4NB7A 2XU9A 2H47C 3NJIA 4W9ZA 4YSPA 1TEFA 5I6MA 4Q8BA 1PAZA 3PAUA 4KOBA 3NJNA 1OF0A 3TASA 1KV7A 2OJ1A 1NIBA 1J9QA 2I7OA 2IDQA 1J9RA 1PNDA 2X88A 2FT6A 3FPYA 2ZWNA 2DYSB 2QPDB 3MBWB 3FPXA 4KNSA 3WG7B 1QNIA 1HFUA 4BK5C 4DP6X 3X1NA 3NSFA 1L9TA 3V9EA 1EZLA 1ET5A 4HCIA 2HRHA 1RZPA 3NJGA 5TK4A 4BWWA 5LDUA 2XWZA 5I6LA 2Y1AA 1GY1A 2PP7A 4DP2X 1MG3C 1BXAA 1PF3A 4G7QB 3WI9A 3CVCA 2PPCA 1CURA 2J57A 4DP5X 2XXFA 3OM3B 2B08A 4YSUA 4E9YA 1NIFA 1SHXA 1BQ5A 2GI0A 2XV0A 2A3TA 3FSAA 5I6KA 3U25A 2ZOOA 4RH4A 3FS9A 3UABA 1CYXA 3RYMA 2CUAA 3GXUB 1T5KA 3EF4A 2BHFA 1V54B 2HRGA 2H3XC 1KGYE 5B1JC 5PAZA 2LLNA 1KBWA 1JXFA 4UAHA 5A7EA 2ZXWB 1J5DA 4E9RA 4AKQA 1PMYA 1WA0X 2GB2A 1GR7A 4A2FA 3T9WA 2PLTA 1AZCA 1PNCA 5F7AA 3ABKB 3CDZA 3UGEA 4BWTA 2DY2A 2GIMA 1ET8A 1OE2A 3MX0B 3OMAB 4MFHA 1E5ZA 3H4HA 3NSDA 4M4RB 2VMJA 5B1JA 4ZK8A 2BW4A 3AG2B 1ZIBA 7PAZA 3FSZA 1BEXA 1PLBA 1J5CA 3UADA 2QPEB 2ZONA 2AZUA 2PPAA 4YSQA 4M3HA 2I7SA 3QJRB 1JZEA 4WTQA 4A68A 2EIJB 2EINB 4HAKA 2E86A 2Q9OA 4E9VA 1OCZB 1QLEB 5B7MA 4HALA 3C75A 3ZBMA 2XYBA 1GS8A 2EILB 3FU8A 5IY5B 4F2EA 3AY2A 2HX8A 6PCYA 1PLAA 2YARA 1IC0A 5PCYA 3OMIB 4X4KA 4KO7A 4PCYA 3NSCA 1YLBB 4DPCX 1URIA 4GP4B 3NJKA 1DZ0A 4E9XA 4ENZA 3QJTB 3EH3B 5I26A 3AG1B 3ABGA 3FSWA 3WNIA 1E67A 1M9WA 3GYRA 2CAKA 5I6OA 1XMEB 2YXWA 3WKQA 1WS8A 2DV6A 2IH8A 2H5UA 3CDZB 4GP8B 1AIZA 3FYEB 3TBBA 1BAWA 1AR1B 2BO0A 1ILUA 1N70A 2HX7A 2R7EA 2TSAA 3ASNB 4HZ1A 1AANA 1A4CA 2HX9A 3X1GA 1A3ZA 3ASOB 1QHQA 3BVDB 1NPNA 1J9SA 2XX0A 1IBYA 4P5RA 1OV8A 3ERXA 4KNUA 2GHZA 3FT0A 3N2JA 3ZIYA 5D4IA 1JZIA 2OCCB 3FSVA 2EIKB 1BQKA 2VM4A 4YSRA 2EIMB 3TA4D 6PAZA 1FWXA 2YAFA 1W6WA 3DKHA 4HCFA 2NRDA 1ZDQA 4JKNA 1KYAA 1WAEA 1SFDA 1JERA 1GS7A 4G7SB 2XV3A 4NERA 5B7FA 1CYWA 2YXVA 2N0MA 3TBCA 4YSDA 4YL4A 2IDUA 3T71A 2IWEA 1NWPA 2IWKA 4YSSA 2GBAA 3HB3B 1KBVA 1TU2A 1JXDA 2GSMB 3EH5B 2JFCA 1PZAA 1AZNA 3V9CA 2QDWA 2CJ3A 1JVOA 1HAWA 1AACA 4WKXA 1W8EA 1FA4A 2P80D 4G71B 1WA1X 2TSBA 4JHVA 4YVNA 2YAMA 4E9SA 5B3SB 3S3BB 3G5WA 2RACA 1E5YA 4AKOA 1SF5A 1XB6A 2R7EB 3AZUA 4HHWA 1RCYA 1AS6A 1RKRA 3BQVA 3X1FA 2JXMA 2YAHA 3CG8A 3DIVA 1GY2A 4CSZA 1SFHA 2PPDA 5D4HA 1JZJA 2XVBA 2BP8A 3NSYA 4GXFA 2DWTA 2XV2A 3JTBA 3JT2A 1UATA 4A2DA 2FT8A 4E9QA 1A4AA 2I85A 1F56A 4DPBX 4L0PB 1BXVA 3QJVB 1ID2A 1M56B 4G72B 4KO5A 3T6XA 4BXVA 4YVUA 2PCYA 2FQEA 1AZRA 3ABMB 1NWOA 4TXVB 2W8CA 1I53A 3PLYA 3IN0A 3CZUB 5ANHA 1HAUA 1X9UA 3SQRA 4BWUA 1CUOA 2BP0B 4NAJA 1BYPA 1R1CA 2CALA 1AZBA 3KW7A 4G7RB 4Q89A 3NYKA 2YAQA 2PP9A 4AKPA 2FQFA 1PY0A 3PCYA 3N55A 1SJMA 1NIDA 4HIPA 4KOCA 2VSMB 2WO2B 2DYRB 3DTUB 2X87A 4N4YB 4AX3A 1JOIA 2BW5A 1ET7A 3QJUB 1ZPUA 2BWDA 3QQXA 1AG6A 4DP9X 2XUWA 4BXSV 4EF3A 2UX7A 2FQDA 4DP7X 2MTAA 2PPFA 1IKOP 1X9RA 4YSCA 2UXVA 4BDVA 4FA7B 2VW7A 1OCCB 4YSEA 4KO9A 2HXAA 3OQRA 5TK2A 2FJSA 2IDSA 3AG3B 1JVLA 2J56A 2QT6A 1NPJA 1ASPA 1NINA 2CBPA 2GC7C 5B1BB 3PAVA 3X1EA 4DP0X 1JZFA 4K9JA 2PCFA 2BP8B 3HEIB 3NP3A 2Y69B 3NJMA 1A8ZA 1L9QA 1L9OA 4E9WA 2AVFA 1XB8A 3PXLA 1OE3A 1E30A 2YQBA 3PPSA 3QJSB 3UAEA 5I5MA 1JZGA 1L9SA 1OE1A 2YAEA 3EHBB 3T6WA 3FYIB 3KW8A 1SNRA 3H4FA 1NTDA 5B1AB 2WO3B 3IEAA 3FQ1A 1SDDB 3S3DB 3FU7A 1PCSA 2FNWA 2Q5BA 5EHFA 4AI7A 1XB3A 4A2HA 4F7KA 4GY4A 3WNJA
chains in the Genus database with same CATH superfamily
2ZWSA 1CB4A 4JGNA 4Q9CA 3SJVD 1QW8A 4Y4HB 5HHXL 4L3EA 3UTTD 2VZ1A 5I0YA 1RLBA 3J2PA 2ITDB 2A1WL 2OTWA 1SJEA 5HI5C 3Q6GH 2XQBL 3HC2A 2G30A 3FUIA 3NJLA 3QEUA 4QWWD 3FFCE 1YUHB 4YHKH 1AY1L 1CQYA 2YUXA 4EZMA 3QWRA 1A7QH 5T5FH 2ZUYA 2NDGA 2OJZL 3P9WB 1ZMYA 4FFYL 1J05A 3UG5A 3R7QA 2AXHA 2HKFL 2AEPL 2DQFB 2DWEA 1F41A 3RPIA 1MVUA 2IBZX 3DX8B 1NGYB 2B1OA 1INEH 5HHQA 1B2YA 5CJOH 4IJ3B 2HLFC 3T0EA 3L17A 3MLZL 2IV9A 2VTFA 4P5SA 1HH6A 5AZUA 1TZOA 3P4LA 1NIAA 3QUXC 1R3IL 2UWEA 2VLLA 3H9SB 1IGCH 5C07D 4Q56A 2D0FA 3K71A 1MN4A 1A8JH 2MCPL 1YQVL 3GZOA 5GS2D 1JAEA 3C9NA 2DYPD 5E99L 3UBXG 3CC5B 3HHSA 2YAPA 5K9JH 4RAUA 1FDLH 4NZJA 1KCVH 4LCWA 3I3DA 5KYWA 5IW3A 5IMKB 2XY2A 2KZ1B 2XPGB 3BEWB 3L3JA 4ZD3L 5I8KH 2NY1D 3LD8B 4CN1A 4JKWA 1EHAA 1BQRA 5EU3A 4NNPL 1KIPB 1U8HB 5JIKA 3TOPA 2DH3A 3RPBA 3U2IA 2X4RA 3SGDI 4CA4A 5L8JB 2D3JA 3EH1A 1OSYA 1CDGA 3KPRB 1QFOA 3WJJC 4MZ2A 2IGTA 5FDYA 1NFAA 2CO4A 2CR3A 3TXAA 3FOLA 3DVIA 3P0VL 2W07A 3N9GH 2V0AA 4H7VA 5I71B 5KSUA 1LL1A 1BD2E 2XLLA 3ATDA 2ZXQA 4WW2C 2W59A 3ME0B 4FKHA 4FCHA 2J5WA 4JHUA 5I0WA 3CXDL 4L1BA 2IEPA 2Y25A 4AE0A 5AW3B 5TPWH 4OIIH 1FVDB 4U1SB 5CXPA 1T1XB 2FBJL 1ZT4B 3CN3A 2R56H 2RHEA 5LDSA 2FJGA 5E1QA 3MU3A 4NP4L 4TNFA 5D2LA 1K6QH 2H0JA 3T6ZA 4OZGE 4KZEH 2VDPH 1A4KA 4R3SA 5DJ0B 2GITB 3UTSE 4WO0A 1PZ5B 1RURH 3WIAA 1M57B 1JGLH 1OM3H 3HNTH 3JQOB 1P84K 3IE9A 2ENJA 5AAPA 4JFHD 3MOBH 4RWHA 3US1A 4Q9RH 4I0PC 4M02A 4IEFB 2X70B 1RVFL 4NJAH 4JKPH 1J7VR 4OCXH 4PAZA 5AAWC 4LCYA 5JYMA 4F9LC 1AHMA 4BZ2A 2HA1A 4NENB 5D7IB 4PH8A 4ESKA 1Z9PA 4HOXA 2NW3A 5CP3H 4QRQB 3EDKA 1CR9H 3VD1A 2PP8A 4JLRA 2DQDH 2P1YA 1ZA3B 3AG4B 4G42B 4YLBA 4LCUA 1EXUB 2Q6WB 1CD8A 2XG4B 3PABB 4NDMB 3EGXB 3QNZB 1AQKL 3SKOB 2BERA 2OXHA 1ZOXA 3OHMB 1Z2KA 3JV6B 4QMEA 3ALPA 3QFDA 1LP9E 4EDXB 1J9QA 1AHKA 4JFUA 1ZLWK 5FM5O 3F12A 4JK0D 4D0CB 1BJ1H 2V3EA 4HDIB 4HXBH 2E8ZA 5JXEC 3NFSL 2MOQA 5ANME 5IESL 3FPXA 3L5WA 2WLMA 4AYMC 4YDJA 5JIDA 5JOEA 1RUAH 5HY9B 3ARDA 1UJ3A 3RHWK 1HHKB 3VUAA 3ZE0F 3S5ZA 3MJ7B 1DVFC 1QFUH 3C09B 3HG1A 2IPKB 3CTTA 3V9EA 4X80H 4XPBH 1ET5A 3TLRA 3PWJA 1WD8A 3HE7D 5TK4A 1YEEH 1JWSA 4EKJA 5I16B 1NGZB 3OKMA 4OGXL 3N0AA 4HBCL 1KGCD 3L16A 4P0DA 2DAVA 2BDNH 3BKMH 4ZAKA 4GMTL 3ZKSD 2O5XL 3CUPA 4ZS7L 3Q05A 2O5ZH 3LY6A 4M1GL 2ZOUA 4QHMA 3RVUD 1BQLH 2WXNA 4G8EB 2X0UA 3A4AA 3CIQA 3OJDA 3OKLB 1NIFA 5HPMA 3Q6FB 3BN9D 2VC2L 2XKSA 3L6FA 4J39A 3K2IA 3R8QA 1SN0A 1NGQL 4GG8B 3FS9A 1WP6A 3I3EA 1CL7H 3WUZA 3VFPB 1BFOA 2CUAA 3S6CA 4LIQH 1T5KA 1SXBA 1YEIH 4M93C 3EO9H 3OMZA 2ISDA 1JPTH 1KGYE 3D05A 3ENEA 1NMBH 4KHXH 4ODWA 4KNQA 1X5IA 1KBWA 3S5LA 3FMGL 4XXCC 4E9RA 1J1OL 1NMAH 3D51A 2WBWB 3FAWA 1F42A 4P3WA 3SYQA 1RIVH 4A2FA 4O51A 5FK9B 1UD8A 5KSAA 2A7BA 1TCRB 2F7QA 4DVRL 3EDEA 2XETA 4N2EA 2E7LC 2HYMA 5F7DA 3RFZA 4M7KL 2EAEA 1BM7A 3QDGE 3NIDF 5LGYA 3TJHD 4RGOH 1Q9OB 4QJ4B 2KH2B 1IBHA 3NDYE 4BH7B 4JFPA 2VUKA 2H0EA 3EOAA 1RH8A 5ESVA 2R1YA 1PLBA 1U8IB 3F7RA 4HPOH 1TNMA 4OLVL 2WMPA 4H8WC 2Q86A 3ARQA 1QR4A 4NRXA 4OGYL 4Y9FA 2K6WA 1I4FA 4BFRA 3W5MA 2CM5A 1V3LA 4LL9A 1RZKH 4ZW8A 3ZOAA 2NDFA 4Q6KA 4YSQA 4RGNB 4NIYE 5I1HL 4TTGA 2MMXA 4IRSB 4MA7H 1LILA 2IMMA 4OV5B 1WUNT 1BEYH 2FYYA 5I23A 1EO8L 4R97B 4P9HC 4XOEA 2PXYA 4R90H 3TBWA 2XJKA 1I7UA 3BUTA 2VXVH 2L04A 1ZLVH 4A7UA 3EJZD 2VWEC 5CCJA 3QQ9C 3AY2A 1BZEA 1I8UA 2AAAA 3DJRA 1RULL 5E5UB 4OZHF 3V5KB 1CI5A 2WXPA 4KV5E 3QXWA 2W0FA 1AXSA 3T4YB 1RHFA 1W72A 2E59A 3NSCA 4OCSL 3W57A 1I8IA 4X2UA 3BSHA 2GVYA 2FO1A 2DEYX 4IBLT 4Z7NE 3BHBA 1CDBA 4MAYA 3WAJA 3OAYH 2OBGA 4G6JH 1G94A 1G6RH 4I3SL 3RVWD 2H45A 4Y1AB 5KBDA 1UWYA 4UDUA 4BFBD 1P4BL 4Y2LA 1GVIA 5DURB 4BZ1L 1FFOA 3MRPA 3I9IA 4NUMA 4N20A 2O6FA 4LOUC 5IVNA 4GINA 5CU9A 1OGAA 4HUUA 3MRNA 2A9DA 2F1EA 3QXAB 4G8GE 4RAVB 3H7BB 1NBZA 1KLFB 3KH3A 3A6CL 1FC1A 3WGVB 4IDJL 3KHQA 5BOPA 4K73A 1JHTA 3MMEA 2PYEA 1FBIH 3WE6A 4AJYV 1IBGH 4WTXA 5DFWH 2CGZA 4ZO8A 2E75C 2V9TA 2QSCL 1NAMH 1TIUA 5E08L 2R8SH 1SYSA 3IFPB 5CJQL 3NCEB 5DI8B 2ROXA 4YIQA 1FWXA 5HJ3A 3HRPA 1T6VN 1YDPA 3P11L 2AQRA 3IE4A 2GJ6D 4I3RH 1WAEA 1X5AA 3T0AA 2H6UA 1IIIA 5EZPA 3D07A 4QO1A 2CM6A 2V5RA 3N6YA 2V7HB 2W95A 5BV7C 4FQXC 1IGJA 2YXVA 4LXFA 3SCMA 1N64H 3PGCB 4FNPA 1X5XA 2FBOJ 2ZWYA 1UFUA 1U33A 5IUCA 5KUKA 4KRNA 2ILLA 4QRUA 4UOJA 4PJHF 3IT8D 1HS6A 2AQQA 1MFVA 3KL3A 1SM3H 2X44D 2YD7A 2P42B 4LAQH 3E9UA 2YD1A 2NY0B 5CZXC 1AACA 3FO2A 2VSDA 4FQLH 1FA4A 1AR1C 2V5MA 3FCUB 4ZFQA 3D25B 4QJ5B 1IC4L 4MHHG 1FCCA 2E7HA 5JHMA 3O8XC 4LDCA 3F58H 1JMZA 4NBZB 2XZAH 2JKTM 3M46A 1OKEA 3U9PL 3CFKA 4APXA 4X5WA 4P59H 2BZDA 4IS6A 2BNRA 4YE0A 1GOGA 1XB6A 5LGHL 4AEIH 2GABA 1A1NA 4FG6D 2NNXA 3MGOA 1HIML 1AS6A 1G7QA 1JI2A 3IS1X 2H1PL 3D7PA 4AQ1C 1UC6A 2OKMA 2WQUA 4XP4H 5T1JA 1EFXA 5HHMB 3DJSA 4KX8A 1IM3B 4FQCH 1E4XH 2BP8A 1NDGA 3C5SA 3RVVC 1D9KD 3H53A 5E4OA 3KLLA 2AP2A 5J1AA 5DJ6A 1VKXA 4BZYA 2ZYSA 4E9QA 4XAKE 4P9MH 1ED3B 1ZD6A 4FFYA 1ID2A 2EYSA 5TE6H 5I17B 3FT4B 1IFHH 1JWUA 3U6RB 2DLFH 2M26A 1J8HB 4TLTA 2W8CA 2CK2A 4N8VB 5TTRA 5DD3H 3ZTNH 4YHPB 4YHOL 3MUZ1 4R0LB 5EU4A 3ROOA 4L1LA 2J1WA 5AL0A 2ALWA 3CFQA 3W2DL 4K5NA 4QAWA 3RNKB 1TU2B 5T3XD 1LDPL 1K72A 4PJ8D 3L4ZA 4ZSOB 3PQYE 1R5IA 2J43A 1DBBL 3R1GH 4KTYA 1KLGA 3TA3A 1IEBA 3CDGA 3B7TA 4RBPH 3MV9E 5MENA 3MPCA 3LVTA 4U1HA 5SWQA 3ZE1B 4AX3A 2EADA 3F7LA 3V8OA 2EXWC 2VERA 2Z35B 4Z5RB 1TTRA 5AYUH 2Y6SC 1ZE3C 2CJUH 4YHIB 4MMZA 3UEQA 5BQDA 4GAJL 4PG2C 3GXIA 4JZJB 1E4HA 2JB5H 2I60L 3T1WA 2YD4A 1Y6MR 3O4LA 3KPOA 5EUOA 3SEPA 2O5YH 5KBKA 4FL4C 3I9AA 2MTAA 1GZPB 4L23A 1X9RA 1N5YH 4XRCB 3DMMD 3TL5A 1QYGH 4G6FD 4JMXA 1OCCB 5GGTH 3FRPA 3DA0A 1KEGL 4JB9H 2FX8L 2JV6A 1QHOA 1PY9A 3KWVA 3LKPB 4FJYA 3CBRA 5F8QC 4KJYA 4E0RA 4ODHH 1L5GA 1CTNA 3MJWA 2GC7C 5KN5A 5B1BB 2P5WE 1QRND 2E8YA 3WL9A 1EBPA 4HIHB 1KGIA 2C9UA 1D7FA 4LBEB 1NGXA 2AI0H 2BNQE 4LLMB 2X89D 1F45A 4MJIA 1SJHB 3UBXB 3DVGA 3L3OB 4PB0L 3GXDA 3T6WA 4YHNA 5DMIL 5E2WH 2EO1A 3GGWB 1U3NA 1PX8A 3IXAB 2F58L 3MLUH 4HS3A 1ESOA 1K5WA 2D7TH 4G7VH 1I7ZA 4I0KA 2X6UA 4P2QD 1ZCRA 4PCTA 3RUGA 3H0TA 4X5LA 3S3DB 1RERA 4B9KC 2FNWA 2GTZB 1EVTC 3VXMB 5AL8A 5F3BA 2CHXA 3VE0B 1KJVB 3AS0A 3K72A 1LNUA 2R1WB 2C3XA 3OR7A 5LCVH 2J1KA 1A6WH 5MEPB 2QVMA 4Z3EA 1TYRA 5H35B 1AS8A 4OB5H 3T0EC 3KPSE 4JM2B 2BP0A 1BLNB 3KGSA 4WFGD 5DHEA 1C5DA 5DMYA 1N6QL 1TMCB 4OLYL 4YXHL 1AKJB 4NQEE 4I1NB 2DH2A 4X4ME 2ZJSH 1U92B 3EJYC 2BOBA 5KSVB 1UA7A 4P5TD 3KGUA 3QIBD 4YO0B 2DQTL 1MDAA 3S8GB 1BXUA 1ES0B 1TDQA 4RGMC 4X6DB 5L2KD 2JI1A 4YHMH 1MJUL 4EUPA 3VCLA 1QMUA 5CBEA 4BEIA 2LU7A 1IKNC 4KNTA 3SBWA 4Y5VB 2I9LA 4XMLH 2N7BA 2XBTA 4R7DB 4U1JA 3MRHB 1YG9A 5CHNB 2PCXA 3CVDA 1P7HL 1JJUA 1XH3A 4OZ4B 1OANA 2MNWA 1JK8B 3L5JA 4UCFA 3V6FB 2X28A 3EGDB 5D1XE 2Z4TA 2OW7A 1AQ8A 4DQOH 2Q7AA 5F1IB 4ICWA 5E4EB 2QGDA 3QDME 2CRZA 2F9BT 2VDNH 3V2AR 3MCKB 4JO2L 1S7QA 4AGLA 1IGFH 1BAFL 4XNBA 2K0RA 3P3TA 1LEKB 3SE8L 2VN7A 3IVKB 1RP8A 2IWFA 3DK2A 2OZ4L 5D1QA 4WK2B 3DGGB 4JM4H 1CVRA 1QVOA 2HLEB 5ICYA 2XX1A 3B2DC 3LS4L 1PGRB 3BQUA 2IJ0C 2NXYD 5JW3L 4H8WH 4ZOBA 3MBEB 1MG2C 4CN4A 5TDNA 4LMQI 1YAZA 3VXRB 5KSBF 4K23L 4WZ9A 3WHXB 5GS1A 2QPUA 5C0AD 2J5LB 3T3MF 2CKNA 1FNLA 2P80A 5C0GA 1U2HA 2A73B 3QIUD 1EJOL 4Y5XB 1U8CA 3X3GH 1KJ2H 1ORQA 4HK3N 2AK4A 3D9AL 4P9HH 4XC1L 1NCTA 5IREA 4FAAB 1MZZA 2OJEB 1LMKA 4JAMA 1YPZF 2G3XA 3GSOB 4I48A 2BIIA 1XZWA 3HNVH 4OIAA 4XN8A 1ZKAA 2Z7UA 3PWPA 3ZHNA 1FE8H 2GEQA 1ETJA 2HTLD 2V4LA 1S5IH 2AQNA 3D08A 4RNRB 5EEZA 2Z91B 3RDTB 2J88L 1ZLUK 1XIWC 2NNCA 1ACZA 4NQUA 5EFIA 1BQSA 2ZCKH 3WJLC 5C0RH 1LK3H 3UG4A 2GG1A 4PRPD 4F15B 3CFUA 2WBJA 3ARZA 3BAEL 3KYOB 4P2RE 3NGBB 4OKDA 5F1NB 1AHWA 1E7VA 4X7DC 1PZ3A 2VERN 4NFCA 1J8RA 3SDYH 1GGTA 2DMHA 1JPST 2XPZA 1YMMD 3JZYA 1HJCA 3LIZL 2ZYRA 5LAPA 1YN6B 1DN2A 5DGRA 5IBTH 2CA3A 4ODSH 2D7PA 5FW7A 1BZOA 3DTXA 3CSYB 5SWZE 3SDDA 4AL8L 3X2QB 3QDJE 4WAFA 3W11C 5JW4R 1BBDL 1JPSL 4X6FA 4OLWH 3ARDC 4MASA 5EU6E 5F9OL 5IMOB 3GBEA 4KK9D 1R46A 3LIUA 1ACYH 1Y18A 2B0SH 5LGJA 3KCPB 1PAZA 4WENB 5KWYC 3SYAA 2XFGB 3DGCR 2GW5A 3O3EA 4K8RC 3RKDC 4OCNC 4YLQT 1A9BB 1SVZA 1U91A 3EO0B 4UWQB 3WSQH 4ZAKC 4H25B 1IGMH 4CC4C 4J1UB 2CU9A 3LVEA 2V17L 3UPRA 1QNIA 1AFVL 7TAAA 3S34H 4J3OD 5HI3D 1EVUA 1DN0B 5BV7H 3BGFB 4MHHI 3FH8A 2NY5C 4LLYA 2LQRA 3IB4A 4PP1D 1EHLH 1PBYA 1MJ7H 2QGBA 5K1VA 4M6OH 1EEZB 3ZL4H 2XWZA 4DW2L 1INQA 3MDJA 3NCBB 1ZPLA 4FYRA 4M5ZL 1XGPB 4ALAL 3T2QA 4BRVA 4LNVA 5DA0B 3QCTL 2NY3B 4YX2H 5J13C 2X6VA 2OSLA 4PJGA 5AOKA 2KL6A 3UYOD 4D9LL 4YSUA 1BQ5A 5HHVL 4X7TA 1N5AB 2B5IC 4DN4L 3UTQB 3V4VH 5EO0A 3G6AB 4JANB 3TP4A 1PG7X 2FNBA 2ICEB 4AV0A 5KSAC 4LOFA 5AENA 1O6VA 2ZAHA 3K4DA 1I7RA 4QRRE 1TO5A 2F5AL 2ZT9C 4B7IA 5C7XL 5D7JD 2H0FA 1FIGL 2J6EH 3AMKA 2ICCA 5GQBA 3O6LL 4LGPB 1SJXA 5HGGS 5CN2A 2D31A 4O02B 1YEKH 2WJ7A 1EPFA 4KAQL 3U4BH 4GH7B 3CZJA 5CF3A 3C6LB 3UGEA 4YDZA 3ABKB 5HDBF 5HHNB 5CM1A 2ZCLH 4F8TA 5JDJA 5I8CB 4J3TA 3G6JE 2I5YL 1FNGA 4MFHA 4LESA 5A2IH 2PXYC 2BIPA 3AG2B 2AMGA 3P40A 3APFA 3ARFB 5AKVA 1EJ8A 3VI4E 4TRPL 4PP2A 5FYJL 5CR8A 4L9LA 7FABL 2CKBA 2YBRA 4M3HA 5JZ7D 2VISA 4A68A 2J4WL 4EAEA 5JO5A 2PCPB 4Y9EA 1IARB 4YHLH 4D9RD 2HTKD 5C86A 3JWOC 3B3IB 4LSVH 1D5MB 3UTZB 3AXLA 4IRZL 1YHPA 1JPFB 5A2KH 4F37F 1OVZA 2HLAB 4F7TB 2UY7B 4UBDD 1ZE3H 5D9SA 3SQBA 3BE1H 2R4RL 3P2TA 4ZX5A 1DFBL 4GLRH 3SKNB 4KKZA 1FFQA 3I84A 3UCRA 3CMGA 2Y9RT 3QGVA 4D7BA 4JRXA 1V7ML 1ZLSL 4D0BA 3G9VA 5LG6A 1I8MB 3WFBL 2FO8A 3RBSA 3DX6A 2WVTA 1T7WA 4DPCX 3FU6A 1N0LB 5IBUG 1MF2L 25C8L 5C0CA 1OSPL 3GS0A 2DI9A 5I73B 1HQ4A 4HLZG 4UV7L 5C3TA 4XCFL 3N04A 3GYRA 1UD5A 1UXMA 4MJ6A 4W9HC 1G7IA 5DUBB 3DDGA 4IRJA 5C2BL 5KZCD 1CGXA 2DEXX 5F6HJ 3I02B 1KWKA 4ZUWA 1PVHA 4WI2A 4DFIA 5KUMA 3LKQA 3TEUA 3F84A 1S9XA 2A4CA 3D52A 1B0GA 2NR6A 2VLJE 3ETBJ 3H6AA 3EGSA 3TCXA 4U7SA 3TIEA 3VFNA 2AK1H 1NPNA 4ZXBB 3P4NB 3DURA 4EN3A 4ZQKA 1QTSA 3SCMC 2Y1VA 3FT0A 3IFLL 1UB5A 3CN1A 4FP8L 1URZA 5FEBA 4OZGF 2EIMB 5FA4A 1LO5B 2FATL 3MI6A 2EH7L 4J8QA 4ENED 3DKHA 4CADB 1M05A 3TT1H 4YLCA 2LU3A 3VXUD 5I1KH 1XEUA 2HT4C 2PW1A 1NBVL 3MNMA 1KTJA 4R4ND 3NZHL 4J3XA 2HJFB 1T3FA 4U7MA 1WCBB 2HT2C 1D6EB 4NQDE 1QSFD 1TZGH 3QARA 4YBQC 2VL5B 4YL4A 3Q3GA 1F90L 5I75B 3TH3T 2WZPA 4X4XA 3RGVB 1O5DT 1JXDA 2BFGA 2GSMB 4HEMA 2JVUA 4RMRA 4G8IA 4ANVA 2CDGA 4B9JA 4MMYB 5FIEA 1JYNA 1S7RA 3K6SB 4FLQA 1TVBA 1MEXL 4DSYA 3LEVL 3ZE2E 3PGFL 1INDH 2E27L 5DHVA 4PGZA 3ZQWA 4Q0XL 2TSBA 2EDMA 2KLTA 5DC4B 3WTSA 5LAXB 2FD6H 4YFEA 2NX5E 3FQUB 4HK0A 3K1DA 4HHAB 3L9RA 3WFZA 3VI3A 4PRNA 3KYKH 5FXCH 2Y7SA 3PDOA 5IFJB 5IZ7A 1V3KA 3G5WA 4LCIH 1CD0A 4JFDD 2ZP8A 4OZHB 5EZLB 5FF6B 5JLZA 4JJOA 5DZNA 4MNQB 4JPKL 3ARWA 1W9XA 1LP9F 4IGBD 3B2XA 2EICA 1D5BA 2FZ3A 1HCFX 5H94B 3PJNA 4WO4D 2IH1B 3SQOH 1BQHB 4M6NL 5BS0E 1DEEB 3PWNB 5KJRH 1N59A 2JXMA 2YAHA 3UYPA 2G9HA 3FF7A 1PDKA 2YKKA 3BIKA 4C54A 2R0LH 3ARGA 1DJWA 2BIOA 4HWUA 1FPTH 1CI3M 4N3UA 2OQJB 4JPQA 4OY9A 1IGIH 2G0KA 3QEGL 1T5WB 3EO1A 4JG1H 4LRIA 4PRDB 1F56A 3H42L 5KAQF 3OC5A 1HXMB 3TA3C 1M56B 1F11B 4YDKH 5CFHA 5CEYA 5LJYH 4PY8J 3ABMB 3WTVA 4MZRA 4M7LT 3O0RL 3FQNA 3CFTA 1FNHA 3D4GA 4OCRL 3TJEH 5EEWA 4KROB 4MMZC 4NN6C 3M1CA 1ZHLA 3JWNE 3MRLA 4K5MA 4WFHD 3GI9H 3CFNA 2KPWA 4GUOA 1IT9H 1QTYT 2OP4H 4M3JA 1ZT7A 4LSRH 3H3KA 3Q06A 2O6CA 5DVOA 4B0MB 3L9EA 3RTQC 1VFAB 4UU9B 1KLUA 3LEYH 4BZ2H 2YD2A 1SJMA 4HIPA 1P7KB 4NQVA 1NBQA 4WI9A 5EBMA 4H0HB 1IFGA 4MYWB 4XCYA 2D03L 3QZMA 1G7HB 2WGXA 1Q9LB 3I50H 4DUXA 1XF2A 2GCYB 5IVZB 1D6VL 5I1LA 4PJ7E 1IMHC 4ZUSB 1XAKA 1J0YA 4I9XA 1E43A 2HVJA 4GMSL 4NRZB 1W16A 3H2PA 1ECZA 3F04A 3HG4A 5E00B 5FGSA 4UQ2A 4YNYB 2G60L 3X3FH 2XN2A 3QJOA 4AVKA 1HEHC 3QHZH 2BSEA 3KHOA 3CCHA 5EEUA 2BOCB 3DO3A 4UT7L 3KPPA 5ECJE 1R17A 2K3HA 1DBKL 2XN9A 1H3VA 1HWWA 1O6TA 5FO9A 1JVLA 2IANB 1UKTA 3L2MA 4OJFL 4ODXA 4DP0X 5TGBB 5K9OB 2E0PA 5DDHB 4DKEH 2AVFA 1M42A 2WB7A 3P0GB 4LSUL 5IWLA 1XF3A 2UUDH 5EIIA 1JP5A 4PJXA 2LGNA 4RZCB 2QQLH 2ZG1A 4K8RH 5JOPD 1TLKA 3H4FA 2F8OA 2ESVB 4KI5C 4C57C 4QYAA 5IB2B 1BA9A 1MI5A 5IFHH 4BKSC 1MRDL 3MLXL 3FUNA 3P02A 4OLEA 5D8JL 1U8MA 1DUYA 1YC7A 3N1FC 4FX5A 4KJWD 2EKJA 5G55A 4KQ4L 5C0JB 2ZOLA 3P3YA 3BISA 1R24B 2VXSL 2XXGA 1CF1A 2A6KB 2ZKXA 4UILH 2NY5H 2BLFA 3CX5J 4UF7C 1N4XH 5E70A 4U1IB 1MFCL 3MA9H 4U7KA 4N2IA 3QCUL 4ONHA 2Y1YA 3DHJA 4XX1E 2X6MA 5KVDL 3T8XA 1EAQA 3UCQA 32C2A 3O45A 3GNML 4KV5F 4XO8A 5EUKB 3LXUX 3SBWC 1NC2D 1F86A 2EH8L 1FYTA 1UCBL 3JWDL 2VCOA 3O6MH 1L7IL 3QNXB 5SWSA 3S3CB 1A7OL 4Z7NF 1RJZA 4NM4L 1P4LA 5CSZA 5DQDH 1MHPL 1ZHBA 3ZDYE 5B21A 3VFVA 5K69A 4OGAD 2EE0A 4Z7OB 3GEFA 3IBOA 4QLWA 1AAJA 4OJDH 4WWKC 3NCMA 4PRIE 3S8FB 3PIQB 3QUYD 2HG5B 3V4PB 5BZWA 3NZUA 1Q8MA 3HPJB 5D1QC 3GSNH 2E9WA 3LQZA 4GP5B 3DLQR 4QRBA 3RWDB 2JKIS 5DK0A 5FB8B 1XH1A 4UQEA 3AROA 3BQUC 3LPOA 2JJSA 2G75B 2IG2H 4B9IA 1FO0B 3G3LA 4OM1H 5AOLA 4MS8C 1C8PA 3PL6B 1FC2D 2OMWA 3IYLW 4PJ5D 5GS1C 4L8BA 1E8YA 1KCBA 1G9MH 3BGMB 4XT1C 2C9XA 3WV0A 1LO4L 1B2WH 1THAA 2XNAB 1OB0A 3MRDB 3X14B 4KRPC 4GQPH 1NDTA 4KKCD 3WKML 5ACLA 2EKSB 1PYWB 4GW5B 4I7ZC 4APQC 4MCYA 4P3CL 2GUOB 4X4YB 3QZLA 3U4EB 4FZ8L 3D48R 2FEEL 1AQHA 1MWAA 2HPOA 4N28A 4JRWA 4FQ1H 1W6LA 4OGZA 4WDIA 1A6VL 4JDZA 4Y4KD 5CUSH 4HA1A 2EVJA 1NDMB 2QHRL 3P9LB 1KDIA 3O3DB 2V7NB 4EOWH 2HZHA 1W72H 1XTMA 1A02N 4ZPTB 2R2HA 2HKHH 3HRZA 3WXVL 1R19A 5DCCA 4RA0C 4ORGA 3HJ0A 3JWOH 3BD5A 3NZSA 5TE7L 4NBXB 1ZLDA 4HFUL 1WPCA 1YUHA 2HJLA 1JGEA 5FAAA 4Z0BL 1P7BA 3O6FC 5GGRA 2JKLA 3CPLB 4P23D 3OXSB 3TCLB 4DT2A 3FFCA 1FH5L 5J57B 3DX4A 2DQFA 3DXAB 1UZ8A 2F7OA 1S3KL 2QFPA 3DX8A 5DK3A 3V6BR 4ZG1A 1ZDSA 4HUXA 4N0FA 1FJ1B 1RZQA 4NSKA 4W1TA 4Q6IB 3H9SA 3TF4A 5AVVB 3P3RA 3ZU8A 1HC1A 1QPKA 4Y8DC 2X4UA 5GJTL 1IBZA 3FQYA 4IOSD 1VADB 4ODVH 3ET9F 4XCNB 4IK7A 3MJ8B 2FH8A 4MQ7B 3BEWA 5GZNA 1MCOL 3WELA 1A9EB 3FCTA 2P8LB 3V7MA 3K6FA 4HOWA 3QUZC 4JPIA 3HW7A 4M6ML 4W9ZA 3HZVB 4XP6H 3S88H 1MREL 3I6KB 3FB8B 1UQSB 2AF2A 3KPRA 4LGRB 1J0IA 1QUPA 5E9DB 4CU8A 1MJJB 4L5FL 4LPWA 2E76C 5IQ7H 1MFAL 4ABQA 1C7TA 1R5VA 2LU4A 4YXKH 3EYVB 2RR3A 1KOAA 4FFVD 4ZX3A 4DP6X 2R2BB 2NNAB 3BD3A 4TTDC 4Q7DA 4GUPB 4XVSH 5IFAH 4AE1A 4U1SA 4D9QE 5KSBB 1ZHNB 4P49A 3NH7L 4UV4L 3OSKA 3L5XH 5FPIA 1RJYA 4IBQA 1RMFL 4QD2E 4YEEA 1WISA 1M2OA 2LAGB 3QA3A 5ISZE 1L3NA 1X5HA 3KH4A 3PV6A 4JRLA 4PFEA 3U0WH 4MDIB 4EZLA 1SUHA 5HHXH 1N8ZA 4PSRA 2YD5A 2R69L 1F5WA 1MRFL 1YPZB 4MSWB 4OZGA 2A1WH 3ULUD 1BZ9A 2XQBH 3UTSA 5D2NC 2J6WA 3OX8B 3P4MA 4IEFA 4RH4A 1BMWA 3WNOA 3TN0A 3FL7A 1AY1H 2LHAA 5IROC 4WI6A 2WIIA 1ULVA 2OJZH 2ZSWA 1UXLA 1E4JA 2D8KA 5IF0A 1LXMA 4AZ8B 3HC0B 1SRDA 1UH4A 4FFYH 4NENA 2MNUA 5DJCA 5C9KA 4P4RA 3X12A 1MCJA 2AEPH 2OR9L 2EDFA 4AQEA 4JFEB 4G42A 1X5KA 3DVNA 4P57B 3VFSB 3MLZH 2XN1A 4RVBA 5IB4B 2O61B 4BWTA 3IJSA 1U3JA 3QNZA 1R3IH 3TBTB 3CE1A 2DOCA 2FHBA 4FDWA 1IEAB 4Y8AA 2MCPH 3BLKA 3L9BA 5IGXH 3JV6A 1YQVH 3K46A 4WIQA 2ZAIA 3OZLA 5E99H 4XMZA 2EO9A 3B5TA 2VR5A 4OCLC 5DMKB 3UADA 2QKIC 3C2AL 3IXTB 2G3MA 4K7FB 4ZD3H 4XMKL 3VXSE 2AGJL 1HHKA 2ZX6A 4NNPH 1DTUA 3B8YA 4QXTA 5E1GA 4CMMA 1D2PA 3OQ3B 5E94B 3RWGB 4QHPA 1HVXA 1HSAB 4DK6A 4JL2A 2E86A 2Q9OA 5J6GB 3C2SA 3B5HA 3QT2A 5DRXA 4WK4B 2XTJC 4JW3A 2G5BB 1EO7A 3ZBMA 4JFFE 3TV8A 3GSRB 3APMA 5GGVL 3OXRA 3IJHB 4AEEA 4N90D 5EO1B 3CXDH 2W9DL 3VFTA 1K2DB 4IRJC 3VXTA 4PCYA 2FBJH 1P5UA 4JJ5B 1ZS8A 4O5LH 4B5EA 5AVYB 2CLZA 1KIQA 4GG8A 4NQCD 4MD4B 4W9CC 4AGMA 4NP4H 3EH3B 3E2HC 4CN6A 2R29A 3Q01A 3F8UB 5TH2B 3M86A 1XF4A 4FXTA 4MYPA 4EN3C 1BF5A 5LHDA 2OX5B 3GBML 3H9HB 2DV6A 4PW4A 5IV2B 3JV0A 2GJZB 1HI6A 2DEWX 5IJVB 1FV1A 1ILUA 4H4NA 2AS5M 3H8NA 1NOLA 4NZFA 4MA3B 3DV6A 1RVFH 4GQZA 4U33A 2WTPA 1A3ZA 3MLVL 5I1GL 1ZWIA 4QF1B 3L7EB 1R3KA 4AGOA 2NTSP 3HVNA 1LYQA 4F8NA 1KPVA 1N3NB 1Q9OA 2EIKB 1OGSA 1A21A 4BH7A 2XWCA 3FCGA 4LP5A 2DM4A 5HDBB 5C07B 3FTYA 1XR9A 2YAFA 2QADC 3D3VA 3QZBA 4HV8B 5L6YL 4TL5A 4NKIL 4EUPH 1I9EA 2DYPB 3BMVA 2ZXCA 1NBYA 4NOBA 1HHJB 1F02I 2ZKHL 1MOEA 1T2JA 4IRSA 2Z92B 2DBLL 4OV5A 3WN5A 3FT3B 4XNZC 1S7VB 1GZHA 2NY1B 1GPOL 4PV9B 5L7XL 4BKLB 5A7BA 3QISA 2GBAA 1R75A 3NFSH 4GXUM 2DWXA 2BY3A 2JSFA 5IESH 4HYTB 3IU3A 3C60A 4AIXA 5JHDD 1AZNA 1NCBL 2VQTA 4J3OF 2DLIA 5HJBA 1X5FA 1P9MA 4J3SA 3NFPB 3FQRB 3G5VA 3QS3A 4Z3TA 3SDCD 3G5YA 5DVLA 4Y16A 3OHXB 4AUJA 4OGXH 4PRHD 4HBCH 3TWYA 1UWXH 5A6MA 1X9LA 3KBHE 1HEZB 4GMTH 2O5XH 4QDGA 5C0DA 2KZWA 4R7NB 4LRIC 4M1GH 2W80C 3AZUA 2CHZA 3GSUB 2VT0A 5E56A 2GBTA 2A9ML 2VC2H 4PMFA 4GRLD 4J4PD 4WV1B 1NGQH 2YSSA 1E9QB 3QXAA 1X5ZA 3BRDA 1DQJA 3H7BA 2J8UE 2B14A 5SX5H 1KLFA 2APFA 4R83A 7CGTA 3A6OA 1T22B 4A2DA 2YC1B 1SN2A 1EAOA 3GRGA 4TVPD 1NUNB 3IFOB 3T6XA 3OSVA 5HDWA 3QP3A 4AMXA 1SEQL 1JV2B 1J1OH 3UZVB 4LEEA 2CO7B 1KYDA 2HFFB 1E3ZA 5CD5D 4KVNL 3EF7A 2R9HD 3WIIL 4DVRH 5I30H 1PQZB 3GO1L 4KJQD 3DPBB 5K39A 2NMSA 5IJCC 4M7KH 4MD0B 2V7HA 4UM8B 5A2BA 3KW7A 2YAQA 3ULVD 1BVOA 4N2DA 1FZMB 3STBA 3GC3A 3GTTA 2JJUA 2EE9A 3LN4B 3KGTA 3JUYA 3QIWA 5CIPA 4OLVH 3VJ6B 2WLLB 1YMHB 4OGYH 2RD0A 3PHAA 1LMIA 5K9KA 2B1AL 2VDKB 1J5OL 4QHUA 3K4ZA 5I1HH 2RJMA 4KTDL 3QZWG 4IBYA 3B56A 4DP7X 1AO7E 4H2CA 3S37L 1EO8H 3APCA 4N2KA 1C12B 1N12A 3VFOA 4ANUA 3D25A 5IWLC 1SXSA 4K7PX 5F7YC 5D1ZD 4I4WA 1I8LA 4IIZA 5TK2A 5ESQA 4XH2B 4F58L 3I6LD 3G6JF 4MAZA 4F57L 3WTUA 5DQ9B 3HE7B 4DTGL 2O93L 3P73B 4N26A 4WUUE 2PCFA 1RULH 4FGMA 2EO7A 4X0NA 3VI4F 1BWMA 3CHRA 1A0QL 4OCSH 5ESAB 3CFMA 4F1ZA 5F1SA 5LWYL 2WXFA 2OK0L 4QRPE 1LP9B 5AVSB 4H5SB 3QULA 4XI5C 1CLCA 4I3SH 4L4VE 3JSSA 1Z5HA 2Q5BA 1P4BH 4B50A 4BZ1H 4A2HA 1WH0A 2Q3AA 3RU8L 1OOAA 1MCFA 3B37A 1FHNA 4KTGA 5GGSB 2EUWA 3CIAA 1M3JA 4FQQB 2YFOA 3J7HA 1N2RB 4YHPA 4AL8C 2P5ED 2ZE0A 3KYAA 1SXCA 2DQUL 4NN5C 4R6UA 4R0LA 2X42A 1BJ1J 3FQ2A 3WIFA 3BSZA 1CC3A 4U0QB 3A6CH 3KLAA 1ZSDB 4IDJH 3RNKA 4OZIA 2YXMA 2FB4L 4I89A 3L1GA 1FG2A 4ZSOA 3BVWA 1JGDA 3DUUA 3FTZA 4W4OC 3ZPDA 4L1DA 5E9AA 4X6EB 2QSCH 2VMDA 5L2JA 5E08H 4LAJH 5EH1A 2DIAA 5CJQH 1ZA6B 4P3DA 2WSDA 4ISVB 1QATA 3ISYA 4RFOL 3LSOB 2JJSC 4Z5RA 4Z7WF 3IAQA 3BPLB 1SOKA 3P11H 3RIKA 1VRSA 1OGTB 2OSYA 4J3OG 4N2LA 3KWUA 5DRNA 3TONA 4JZJA 4N24A 5CD3A 1ZEAL 5I18L 2NQ3A 2YAOA 4Z7QB 3KL0A 2Y5TB 3HA0A 1ZIAA 3LDBC 4L4TE 4XRCA 5D5MB 1DVUA 2HVBA 1SQMA 5C0BE 1NEZG 4U1MB 1YY9C 4IU3B 3ZSTA 2JIXA 3P9MA 2Y7OA 2KQMA 1G87A 2XACC 3WLBB 4ALAC 5D7SL 2VN4A 4UZUA 1T7XA 2X4SA 3ZRFC 2FH6A 2ZUXA 3MRKB 4HIHA 2C3VB 3GLAA 2WJ5A 5D7LE 1WWCA 1SJHA 2VJ8A 3DOHA 3QDGB 3HRZC 5CZRA 4NUQA 3GGWA 1MCSA 4UTBL 3U9PH 4PWGA 2BNQA 1Q38A 1XD0A 3SDAB 2XHNA 1J0HA 1KELL 2HMIC 2GTZA 4KKBD 2ZP0T 2EEFA 5DSCA 2GYSA 1HIMH 3B1TA 3HS0A 4MXQC 1EERB 3VE0A 2F68X 1U8LB 2X53A 5JORB 2H1PH 4EE2A 1DSWA 4A2EA 3EYQD 1MLCA 3MRRB 2IXQB 4E68A 4K71B 3ZE2F 5H35A 1MCKA 1JZHA 4Y2DD 4JM2A 4OT1L 1H5BB 4OFIA 1BLNA 2XV6B 1YNTF 4LQFL 1S9YA 1P1VA 1FL3B 1IAOB 2FEDC 4PJDE 1BM3L 1D3CA 2IFGA 5D93B 2ZPKL 5DEGB 5FM8A 1SLUA 3W5NA 4IBWA 3KD4A 3OV6A 2F7RA 3CZKA 5BMFL 3ZRCC 3WEXA 1JDAA 4AIZB 5I5JA 3LNIA 2EP6A 1W80A 2NY6B 4X6DA 2L7EA 1M7DB 3J27A 3FXIC 3NFNA 4ODUB 4B60A 4F8QA 3W2DH 3LD8C 2Q3ZA 3CQPA 1LDPH 1HH9B 4Y5VA 3NG5A 1DBBH 5LBGA 1GGUA 3MRHA 2VUOA 4HIJB 4OZFB 4DP8X 3TO2B 4DGVL 2DLGA 1IV8A 3V6FA 2V9RA 2Z93B 3ZX1A 4NP9A 1XGTA 1M2VA 3TNNA 2FHFA 3K8LA 5F1IA 1UA3A 4GAJH 4G8GB 2JK5A 2MQGA 1NC4A 5I71C 5JW5B 1OAKL 2F19L 4UDTB 2H32B 5D1XA 2XU9A 1U9KA 5AOZA 1OSZA 1GTFA 3LZFL 1J0ZA 3QDAA 1R3JB 3QDMA 4YSPA 1TEFA 3IVKA 4LIQE 5D96C 3CXFA 1KEGH 4LLDB 4XO9A 3D85D 2FX8H 1QRKA 4PJEF 2IOMA 3T8VA 5DMJB 1MY5A 5D7EA 2W0KA 1R33A 3KWXA 2FWOA 3VXRA 4IBVA 2QPDB 1BHGA 3WHXA 3EBIA 4M4RA 4Y9GA 1K8IA 2FEJA 3WU1A 5ERWB 2A9BA 3MUHL 4JS7A 4PB0H 4BQCA 3BUQA 2WVVB 1Z7JA 4PJ7F 5CILL 4X7CC 2HFGL 5DMIH 5ICXA 3BAIA 1JHKL 2F58H 4M7ZC 4RSYA 1UKSA 2OJEA 4Y4FD 4BSJA 2GK2A 4L8DB 3A47A 5EU7E 3S97C 1M9SA 5FYLL 1E4WL 1EAJA 4NZDA 1BFVL 1D9KB 9CGTA 3MQIA 2B08A 4HUKB 2NLJB 3P77B 3TT3L 2XV0A 1XD1A 5C08E 2A3TA 3GJFB 2BNUA 4UQDA 4OVUA 3UXFA 5I9QB 1N6QH 1T04A 1VJSA 5TDPB 3RYMA 4PLNC 3KYOA 1M7IB 3EF4A 2VDLL 4OLYH 5EIQA 4YXHH 1WC7B 2C26A 4RMBA 1M4KA 1QFWI 3DX7B 2F53E 3GMLB 2DQTH 4UAHA 4GKNA 5EF3A 1YN6A 4PJ8B 3L3KB 2A0LD 2YD6A 1JHLL 3CSYA 5JPMA 1OEZW 1MJUH 2X1PA 2ZXDA 4X9YA 4NZTL 3RA7L 3ARBD 4X5QA 3GSWB 2DY2A 4X6BB 3C09C 3NSXA 4HETA 5I82A 3KCPA 3V4PL 3WENA 4HSAC 5KTEL 1QBAA 4ZFGL 4JVUA 1TQSA 3K8MA 3ZKNC 3EO0A 5IHUL 1NEZA 4C56E 7PAZA 2BVOB 3AM8A 3C8KA 4Y89A 4RISL 4H25A 4CMHB 1KZQA 1FO0L 3MRFB 4G6FB 2NUTA 4TPRL 4JO2H 1CGWA 1XH0A 2RIKA 5KBNC 3BKJL 1BAFH 2BSRA 3EADA 3SE8H 4WTQA 2QTVA 2VR7A 1WG3A 5EMYA 3HB3C 3ZDYF 2OZ4H 2VDOB 1P5UC 1CGTA 3ZJAA 4KQ3L 4MVBD 2VXQL 3MV9B 5DC9B 1CICD 3LS4H 3ESNA 4ZJ9A 3RY4A 2GEEA 4HALA 1PW3A 2W0LA 4MBRA 2XYBA 4DUVA 1WD9A 1IQDB 4OJAA 1XGPA 4K23H 1MCQA 3AGWA 1WHPA 5K93A 2PABA 5C0FA 1LM8V 6PCYA 2WBKA 1NL0L 1HXYB 4LF3A 3L95B 4N87A 1J18A 4P2QB 3TFKC 1EJOH 2Y6TE 4LSQL 3D06A 4YBLB 3D9AH 4XC1H 1E6JL 3UTQA 2AJZB 3RNQB 4P04A 1WLHA 3ESVF 4E9XA 3WJMB 3D69B 1JE6A 1JK9B 3B34A 5CWSB 5IOPB 1OF2B 1TLMA 2XKNB 4Z7VE 1XL4A 2IF7A 2TAAA 3UMTA 2P5WB 3S48A 3F65A 1CCZA 5INDB 5IHZA 2XZCL 4EI6B 2YXWA 2F08A 2VDMB 1RPUA 4NQXA 2MH4A 1WZKA 4Y0GA 5CNHA 4AT6A 4PG9B 2J88H 4FHBD 4HZ1A 1KB5B 1AQDB 4P5TB 3QIBB 1DVXA 4HS6A 3F7KA 4GT0A 5DA4A 5HHNA 3JYBA 3KM2A 1JZ8A 4IRSC 3BAEH 4YPJA 5I8CA 5L2KB 3ERXA 4R97C 1GGBL 4XC3L 3DJTA 4N1HB 2WNWA 5LBSL 2WUBL 3LIZH 5DZLA 4Z77B 3K7UA 3MACL 2Y2YA 4XOBA 1FNEB 4AL8H 1BBDH 4GSRA 1JPSH 3D2UA 3LXBA 5F9OH 3KPSB 4XBGB 3BZEB 2HLFD 4RA3A 4Z6AT 1H0DA 1XGZA 4U6VL 1CYWA 3BDYL 4OH2A 4XE5B 5TD4A 3CLEH 3D4ZA 2IWEA 5JPNA 2BS8A 3B3IA 5HVFB 3PXHA 5EEXA 1JPFA 4F7TA 2UY7A 3QEQE 4I1RA 1OLZA 1AQMA 2G5UA 1MCHA 3IRPX 4JCMA 4MWFA 3RX8A 2V17H 1ZLWH 4QPEA 1AFVH 1EFQA 4R2GD 3V9CA 3WAKA 3NCJL 1HQRA 2NXYB 1XXFC 3NQKA 1I8MA 5J11B 2YUVA 4F80A 1VIWA 3VXNB 1AIFA 2BHYA 4JRYE 3RPKA 5C0AB 2Z8WC 2XY1A 4M5TA 4DW2H 4POZD 3MYJB 2R1XA 3V0VA 3QIUB 5E6IB 1QW9A 4M5ZH 3AMLA 4ALAH 4XP1L 4KK8C 4YR6A 1WT5C 1BIIB 3AREA 3JWDC 2AQSA 2IPTL 4FMFA 2VR3A 2AQ2A 3EHBC 1O0VA 1BF2A 4I1PA 5EOTB 1IVLA 3DSNB 2TRHA 2OMZA 1ZVYA 5DUBA 5G5DB 4D9LH 3FU5A 5I5RA 4TQEL 3GJFK 5HHVH 4UNIA 3I02A 3UTPD 4DN4H 3BGAA 3ZMEA 4FYTA 5J6SA 1R47A 2H2PD 2PKDA 3US0A 2IPUG 3REVA 1BZ7B 2F5AH 1L0PA 5C7XH 4NUGL 1FIGH 3ES6A 2VLKE 4DPBX 1PZSA 2VGLM 3W3BA 2VLJA 1GRWA 1HX0A 3O6LH 3QIWC 4PRPB 3I75A 1DEDA 3T4AB 3NVQA 5FCSH 5AW4B 2AAVA 1ZLEA 1HNFA 4KAQH 4CVXB 3QH3A 2OPCA 1GHFL 3ILQC 1YMMB 3KYMA 4CKQA 5EO9A 4M62L 1AGBA 5HGBB 5F0MB 1WCBA 2I5YH 3SY6A 4HX1B 2H3NB 2LE9A 3F6IA 5T3ZL 3GB7A 3CFIC 3RRQA 3CHPA 1MHCA 2QV4A 2VL5A 4QHNA 4Q74A 4QUOA 1I8LC 3LHPL 3RGVA 3OF6A 3DTUB 4TRPH 1F4XL 5FYJH 4J7RA 3O2DL 4A6YL 4LPUA 4Y2OA 4DGIL 4KC3B 7FABH 4J8RB 2ZWKA 2FL5A 3QJUB 2YPLD 5BUAA 1U8PB 3ZT7A 1T5XA 4EIUA 2V8MA 2J4WH 2ATPA 2JELL 4QRSA 1IKOP 5FV1L 4Z7AA 3AS2A 4PJ9D 3LYRA 2ZP9A 1P7QD 3LZPA 1HWHB 4IRZH 5E2UL 2DBJA 5IFJA 4X9HA 4XBPB 1PKQE 2FJSA 4KDWA 5SWZB 4XN5A 2R4RH 4LSPL 2EDEA 3EBHA 1DFBH 5H94A 1FLRL 2Q7YA 3I6SA 5AD0A 2AXGB 3OPUA 1BQHA 3RWCA 5IMLB 4KZ0A 1V7MH 1ZLSH 3WFBH 2B1HL 1QD0A 3PXLA 3RIAF 3RP1A 5CGYD 4JDTL 4ZUUA 4R0LC 1MF2H 25C8H 1OSPH 4ZUVB 3W1ZA 1UXSA 4UV7H 1IQWL 4XCFH 1QLFB 3KXFE 1T5WA 2D7OA 4DPRA 1PCSA 4FQPA 4MJJA 4PRDA 4OKVA 3P4OB 1HXMA 2F74A 3NK4A 4TOYL 1M1SA 3L4XA 5C2BH 2FO4A 1TQTA 2FR4A 3R7RA 5FGCE 3C5ZD 1NICA 4IMKA 3OLDA 4H26B 4JZJC 2OR7A 2AQ3A 1MQKL 5IKCA 2QVIA 2OSWA 5DD1L 1HHGA 3CSPA 2CIIA 4DVBA 5KJ7E 4LSSH 1ZV2A 2NT1A 3IFLH 4OFQA 5E7FA 4FP8H 2N59A 3MZTA 1EIBA 4FXGA 4GIAA 3PE9A 2FATH 3MFGB 2EH7H 4WHYH 1T1YB 4FABL 1KBGL 3QO0B 1JUFB 4KTEH 4ANXA 2GCYA 3Q2WA 1J9CT 1NBVH 3BH9A 5ABAA 3S3PA 3NZHH 3FQXB 3N0PB 4QRRB 1ZVHA 3TBVA 4PHXA 3SGKA 3GHEL 1DVTA 3L3OC 2VWEE 1IAIL 4HIEB 2OCFD 4PJIA 3GSXB 2DI8A 5E8OA 5KVEL 4PJ7A 1IVTA 1N10A 2BOCA 2UXFA 3NCYP 1P6FA 1K8DB 5HHOE 4Y5YB 2CUIA 3AWEA 3V8CA 3HZYA 1K4DA 1MEXH 4Y4HD 4A2LA 3MBXL 3LEVH 2ADIB 5C09E 3WFEL 1D5IL 1LVEA 3HS0C 2B59B 3PGFH 2E27H 4JR9L 3MR9B 1LWRA 3E7JA 4Q0XH 1P1ZB 4MTMA 5GRXG 5SX4I 3WS6A 3AU1A 3G6JB 1KN2L 1RUML 2W88A 2VRQA 3QDHA 4AQAB 2NZ9C 4J3WA 1T4WA 5IB2A 4JM2C 4YSOA 4PLJC 4JPKH 3VI4B 4DJMA 4EN2A 1KY7A 4ZUTA 1J5HA 3MV11 4M6NH 4ZDHB 4PREA 2VSKB 4FNQA 2V9QA 3QXDA 3QYMA 3IETA 3QXTA 4XCEB 2A6KA 1DQMH 2EECA 4B6ZA 1JCVA 4FNRA 4PS8A 1HZLA 1E9PA 4PTUB 5L9DL 4JPSA 4W6XB 4P46A 1BXXA 1QSEE 2V37A 5KZCB 4I3GA 2IDTA 5F6HI 3QEGH 1EDQA 4Y5VC 1EGJL 4UUJB 3H42H 1A7BA 1GYCA 2ED6A 4FFWD 4ELMA 4PCSA 2VIRA 3DYMA 5BZXA 1U8KA 1ETZB 5ETUB 3O0RH 4HWNA 3PP4L 4OCRH 5E4EC 1S9WB 3M1BA 4MNHB 3NT0A 2DJUA 4UANA 3KPMA 3NRFA 2L8AA 1P2CA 4X6CE 3PIQA 4QOKD 4Z7WB 1FQ9C 3VXUB 2J8UF 5HDQL 2YRZA 3KCWA 3RWDA 4KGLA 5IG7A 1EZUA 1JRHI 3B7YA 3D18B 4PRIA 3MRQA 1IM9A 2D03H 4K5LA 1A3QA 35C8L 2G75A 1QSFB 4LVHB 2UX6A 3ZDWA 5F7EL 3LZQA 3LPGA 1D6VH 1ASOA 4AXWB 2VDKL 3TO4D 5F9DC 3ZTCC 1FFNA 2J5LC 2P48B 1DBML 4GMSH 4L8SA 3B9KD 4GQ9L 2G60H 1MLBB 2H1LM 1DLHB 5GHWL 1KB9J 2D2OA 2RQEA 5F7LB 3BWZA 2WVUA 3RX7A 3TASA 4MQXD 4UT7H 2SEBA 1DBKH 4LKXA 2GUOA 1EAPB 4X4YA 5TDOB 3U4EA 1AH1A 4OJFH 3GXMA 2ZWNA 3MV8D 3PU7A 3F01A 5DZVA 1UACL 3LZOA 3NACL 5DD6A 1CDIA 1G6VK 3HTLX 4JFDB 2C3HA 4NZRL 1QKZL 1TJIH 4PJFF 4NQDB 3IDNA 4LSUH 3RWIB 5L4FA 3POHA 4IGBB 2ATKB 3S7GA 1EZLA 3MGTA 4HWBL 4WO4B 5IW6B 2VQ4A 4I5BA 4K3JL 2F54E 1CVSC 4D7PA 2Q2LA 3S35X 2Z6FA 4J6IA 1T89A 3MLXH 2EXYD 3MV7A 5D8JH 4HEPA 4NJ9L 4KQ4H 4D9RE 1RK1B 3PY9A 4IW4C 4JJHA 3OXSA 2AEQL 2VXSH 3KLDA 4YEFA 1JD9A 4U6XB 3ZXAC 3VWJA 1MFCH 4LDLB 2J71A 4UTAA 1VFBA 1XFPA 3QCUH 3ZKMC 5KVDH 1MQ8A 2ZOOA 1FJ1A 3GNMH 4PY8I 2EH8H 3Q48A 2ARJA 1UCBH 3I2CL 5I1EH 3JWDH 4OD2B 1L7IH 1A7OH 3T5WA 1OGPA 2FLMA 2H9GA 2FSEA 1KWGA 3PPEA 5BS0B 4NM4H 2K78A 2VJXA 4MD5B 2HN7B 5CEZD 4L37A 4AQZA 2ZXWB 4U6HB 1MHPH 1VADA 4S1DC 1YEFL 4L29A 4XPHL 4XCNA 3QW9A 3ARTA 2Y5QA 4LBAA 2EZ0D 2Y0SA 4HU8A 1PY4A 3GI8H 1KG0A 5EN2B 5D7KD 1LE5A 1MCCA 3BGFC 3HZVA 3MX0B 4JE4B 4ELDA 1UGKA 4XPAL 4XWOC 2OXGB 5TPWL 4ZK8A 4YWGL 4LCVA 5B3JE 1Z9OA 2J20A 3FSZA 1JS4A 3UPCA 5E9DA 4EIZC 4HPYL 1UT1A 2WCPA 4L3EE 5F1OB 4AYFA 5DJXB 2NY3C 3IDYB 2Z31A 2C1PB 4LQ1A 3TJPA 1LO4H 2FVNA 5HDLA 4PJEB 3EYVA 4PVLA 3V0WL 2R83A 3HG3A 2R2BA 1FL6A 4M9OA 3WKMH 1D5XB 1T0MB 2BFVL 3R06B 4GUPA 1OM3L 2OL3B 5JMRA 2V3FA 3D39E 1ZHNA 1RV6X 4IK6A 1UM6L 5FKPA 4W81A 1KT2B 4DF9A 4P3CH 1OCZB 3ZKXC 1AJ7L 2N0KA 2ICEC 2UYLB 4K07A 2AC0A 2KPNA 3CLWA 4XX5A 3RI5F 1RZ7L 4Z3HA 1KNOB 1A6VH 4QEGA 4WNQB 1TCMA 2QHRH 1NKRA 4PU2A 1E5CA 3T0EE 2BM3A 2CBMA 2CR6A 1WVZA 4PUBL 3WXVH 2QEJA 1A6AB 5ISZA 3Q9QA 5TE7H 1CD9B 5EBLA 1DZ0A 3BFOA 4HFUH 4U0RB 5AZEL 1CT8A 3AT8A 2Z8VC 4X4ZA 1U3HB 2D3VA 2WQAA 3HC3L 3OC8A 3OKOB 2I25N 3VDAA 4DK3A 4Z0BH 1RHHB 4AZ8A 3HC0A 3QWRD 3U83A 1I1AD 4HUVA 3KBFA 2ZX8A 5FUCC 1VZHA 1FH5H 2ZF9A 4NO5A 4RGND 4FJZA 1XF1A 1S3KH 3MUGB 3RDJA 3ARFC 2BO0A 4E42B 4LB8A 2JQMA 4P57A 3VXPB 5FO7B 3TF7C 4HUWA 2O61A 1XGQB 3TBTA 2OTPA 5CP7B 1ZLUH 3MRJA 1IEAA 2QGEA 1NCHA 4G9FE 2GHZA 4MX7B 4HCRL 5GJTH 1TTFA 1LEGB 2VM4A 4F9PA 5DMKA 4XZUB 1NCCL 3EOYG 1Z9SA 3QUYB 4UAOB 4GIPD 4A6YA 6PAZA 1BG1A 3SGJA 4AGQA 4LCWD 3LH9A 1MCOH 3DETC 4CJ0A 2F8VA 2K1MA 1SYVB 3Q5OA 4ZS6C 2MPAH 2CNYA 4M6MH 5HI4D 1BQLL 2XZQL 3VWKD 1BIHA 1YCSA 5D2LE 2W65A 2AV1B 3LKNA 3MNZB 4PTTB 3ZYOA 4DFHA 1HSAA 4HJGB 4PJ5B 4AYBA 1MREH 5J6GA 3VXSA 2XWTB 1GYWA 5K1JA 2LOEA 3RB5A 1M1XA 5CAYB 5GXBB 4KXZI 3FTSA 4L5FH 2YD8A 3GSRA 3VACA 3DI3B 1MFAH 4ZNCD 1KXTB 4M61B 1RLWA 4KVPA 5LKNA 1B90A 1EV2E 4YDIL 4R8WL 5D7HA 5DHYA 4EKXA 1RJCA 2P8PB 3U1QA 3BVNA 3OZ9H 4JJ5A 5J3HD 3NH7H 4UV4H 4HWZB 3I9PA 1DE4B 2WOYA 2Y2TA 5B3SB 2ZG2A 1RMFH 5MERB 4KKRA 2YEVB 3SJVA 3DV4B 3VGEA 3UTTA 1E5YA 4ZXBC 4D0DB 5HYSG 1G1OA 1SF5A 3EG9B 1QZNA 1OTTC 3M7FB 1PJ9A 1SXAA 4B9FA 1GW6A 2R69H 1MRFH 2GJZA 1XGUA 3E80A 2F7PA 3MCYA 3X11A 4P23B 3H9YA 4TQIA 1Y6NR 1E5BA 2I9TB 2FT8A 1DBJL 3SYCA 2P49B 1LD9B 4NGHL 2NZ1A 5I75C 5C0EA 2OR9H 2PCYA 2NY0D 4GBXD 5T3XL 1GIGL 1H6EA 4TXVB 1M53A 3RGVC 1ZVSB 2G4EA 2I07B 3HG1E 2H2SD 5E8EA 2FGWL 3BDBA 2IGLA 5EB9A 1KUMA 2DYPA 5A16A 4PS7A 1W8NA 2WGNB 1R3LA 5DUJA 5IBLC 2CPCA 2KC0A 2WQSA 4A2MA 4L4JA 4I2XE 3IGLA 1PY0A 3MRMA 4PV9A 4HOZA 1SEBA 1NLBL 3J07A 1EEYA 2R51A 2I32A 4JFZH 4M6AA 5E8PA 4N4YB 3C2AH 3OG6B 4X0KB 5E03A 4XMKH 4LASL 2AGJH 4FE9A 4MZIA 3QQXA 1AG6A 4Y19D 1IM3D 2W92A 4ZFOB 4WU5B 4XZ4A 5CLXA 2JCCB 1F3RB 4A55A 4HUCA 3QVAA 5BXFA 4DKAA 4YDLC 1L9NA 1ID5I 1UWGL 3VG9B 3DOSB 3WNKA 3VYNA 3KDMA 1FF5A 5D70L 3VD7A 3C8HA 2IDSA 5AUMA 3AG3B 2J56A 4UIKL 3N41F 5GGVH 5CN3A 1QQDB 4QT5A 5J06A 1I3GL 1NM4A 5EBWA 2COQA 2GKIA 2DMBA 5DYOB 2W9DH 3F6LA 2MQ0A 1A8ZA 1S7TA 3I85A 3TWCL 2AJXL 3HAEB 3LH8A 3S96A 1F4WL 3UDWA 1RZFL 3F3HA 1TSHA 4IMKC 3PPSA 3QJSB 4NPJA 4PGBA 4KROC 3LCYA 1NANI 2APVA 3PJLA 2RFXB 2H4EA 2WO3B 3E6HA 4NO0B 4I8DA 5FR3A 2YC1A 1G7MA 4UQAA 3QEHB 1SLVA 3HI1B 3LN5A 3AC0A 3ZDXE 4XMPL 5FO8A 3GBMH 1EBAA 3G08B 2R23B 2QVTA 3BP4B 4JFTA 4F7MA 4IHBA 1NJ9B 3PS6A 1AXTH 1YC8A 5IVXA 3CDCA 2HFFA 2JF1A 4PGCA 3WUWB 1TKWA 5FCUL 1MCNA 4LLVA 3MLVH 3PXJA 3DPBA 2YD9A 1ZGLB 5I1GH 2DS4A 4JKMA 2VAJA 2DQHL 3SGKC 5DLML 2PF6A 4AQ8A 1FZMA 2VM9A 4HISA 3RWHA 1F4AA 3ZO0A 3LN4A 3TM6A 3E3QC 5FYKD 2QHLA 5EZJB 4Z7VF 4F7CB 5AFAA 3FONB 4TS6A 3HE6D 1ND0B 4LHUG 3SIKA 5DK2A 5L6YH 4NKIH 4QLRA 3U2SA 1CE1L 1AP2A 2ZKHH 3M88A 1QASA 1BX2A 2DBLH 1SN5A 1E6OL 2X9YA 3N06B 4HH8A 4O2FA 3WS6C 1U8NA 3H9ZA 1GPOH 5L7XH 1TO4A 4OGQC 1QFWL 2DQGL 1M71A 2PXYD 3QRFM 4P4KA 5B38B 1CFBA 1AO7A 4XH2A 2DLTA 3AT0A 3EXJA 1EZVX 4A7SA 1DP0A 1IC1A 1MW1A 2O1AA 2FECI 5GISL 1XSIA 5DJZA 1Q4NX 1DCEA 2AKRB 4UZGA 2APTA 3TVMB 2WAQA 5D4JA 2A6JB 5ESAA 5ADOL 1JMXA 2PYEE 2WINA 4HWBA 1HNGA 2GSGB 2VLRE 2BSTA 2WLIB 3NABL 2XQYG 1Y7VA 3FTUA 3STLB 4ELKB 1QI3A 1AKJD 3LPWA 5E95B 3VFWB 1KIUA 1MY7A 4TUOA 4MAYD 3P3SA 5ACZA 2Z1KA 4P07A 2BK8A 2XA3A 3CPUA 4GRWB 4WW2F 5F7WC 5F93C 3S4SG 3WN6A 4P2OA 2A9MH 4FHJA 5GJSL 4PVBA 2K8MA 2QMJA 3HZ3A 4FQIH 4L4VA 3PJSA 5HD8D 3NJFA 3WKNA 5FOBA 1U4FA 3H54A 3J8F7 4KKAD 3VB8A 1OGAD 5JQ6L 4MJHA 1XCQB 3GMOA 5DJ8A 3U1PA 4MS6A 1HCYA 4JFFB 2P3YA 3ULAB 1KXHA 4HCGA 2OZNA 1AD0B 4X6EA 4JZNA 2AHIA 1H3XA 5I0VA 1SEQH 2NUPB 3G9AB 5LXGL 5GGTL 1IUZA 2G0LA 2H8PB 4N8CL 1H8LA 2IAMA 3LSOA 2ARWA 3CHXA 4TNVK 5C0NC 2YEZA 2GC4C 1MFMA 4KVNH 3PUCA 1IJNA 2B3IA 3F5WB 3PL6C 1FVCB 3WIIH 3NJJA 3KS0J 2AQTA 3OJVC 5D1ZI 4LEOA 1R9FA 1AR2A 5KS9B 4TLKA 2OR8A 1W0WB 2VW4A 3W9EB 4ABVA 5D5MA 2AMUA 4F7PA 2AI0L 5MI0B 2QLVB 1KBBA 2VN6A 2BNRE 3MBED 4H1LB 2G2RA 1OTUC 3LB6D 5IMMA 1GW0A 1HOEA 4ZMNA 3VXOB 5I1AA 5DVPA 5F7KC 1BBJA 2OULB 4L4TA 2FX9L 2B1AH 1J5OH 5C0BA 3E38A 3HNSL 2WBXA 4KTDH 1XR8B 1ASQA 1B6DA 3MRKA 3MRBB 5DJ2B 3KAAA 3IJEB 3S37H 4LVNB 2AXFB 2FIKB 3W37A 2X4TA 3HBQA 3PAUA 4JVWA 5JHDB 1XGRB 3CSBA 5AALA 3S2CA 4IQHA 4F58H 4F57H 4TYUA 4XO4A 3EBGA 3W0WD 4DTGH 4GW4B 2OMTA 3SDCB 3W39B 1KFGA 4PRHB 4HXAL 3RDTD 1A0QH 1J1XL 1N19A 2BRQA 4GRMB 1WTGT 4LLUA 5CP3A 5LWYH 2Q7NA 3MRRA 2OK0H 2CLVB 2C7FA 3D5OF 1U6AL 3QWNA 1QR1B 1H5BA 1UUNA 5MENE 4JN1H 3QR2A 3RX9A 4Q6IC 2PP7A 3K6OA 1KZYA 1B9KA 43CAB 4XMLL 1XDTT 1QX1A 1ZSHA 4NC1C 4XVJL 3RU8H 4CSTA 4B9CA 3DC0A 4N2FA 5EUOE 4E9YA 3MLWL 3QB7C 2DQUH 2ZOKA 4PJDA 4ODUA 2VDNL 1UXWB 1NCWL 1UEMA 3A23A 3B5GA 3U79A 2FB4H 3GD1C 3D0VA 3IBEA 5E6UB 3EYOA 4IU2B 4S0HA 1E5AA 3MTXA 2DWDB 2GJ6A 3LKSA 4HIJA 4OZFA 4HCRA 5DJAB 5FOJA 3TA3D 3MNDA 1FVEA 4RFOH 4WW1A 1JNHA 3UJJL 5AAMA 3LQMA 3QORA 4MJIE 1LWHA 4YAQB 5D6CA 5AVTB 4LGSB 2J8UB 4D94A 5F6IB 1ZEAH 1H3WM 2O5NA 3QG6B 4UDTA 2H32A 4Z7UB 5I18H 5IB5B 3CZGA 3VVWA 2YPKB 3CDZA 3HMXL 5EIVA 4PRBB 3O4LD 3WNNA 2CUMA 3RGBA 1R3JA 1O7SA 1RZJL 3RUGE 5I76A 3H4HA 4TUJB 5HGHA 5K59E 1ZIBA 2XXMB 3H2WA 2XKUA 1IBFA 2ICWB 5D7SH 4BQ8A 4FYSA 1ZY9A 1YEGL 3H7LA 1FZKB 5D1ZB 3QQ3A 4HH9A 4K0OA 1CLYL 1TETH 4KI5E 3C6SB 5ERWA 3QJRB 3VD9A 2ATAA 4X8JB 4S0TD 1WBYB 2Y23A 4ZW6A 5KBLA 4UTBH 4IOFD 2R2EB 1QLEB 1FFPB 1T66D 3RIAK 3DRTB 4PJFB 1N0XL 1KELH 3FU8A 4F2EA 2WWMC 1OM9A 1G7PB 2MIZA 3C6LD 5CZVL 4WSKA 4X9BA 3OKKA 1DSFL 4ODSL 2WXQA 3GJFA 1AGDB 3B2UD 4OT1H 5EORL 3SZ6A 4ZX4A 3DHMA 5KW9L 4LQFH 4OFYD 2N7SA 3BPOB 3DIFB 1UD3A 2P5EB 3Q2CA 3U30B 1WIPA 1Z32X 5CGTA 1M7IA 1BM3H 3UP6A 5FA3B 2ZPKH 5CLTA 3WKQA 5BMFH 1FNFA 3ECWA 3MO1A 4J6RL 4BK4A 4F9PC 1EWHA 4LL1A 4PBWD 2RCSL 2EIZB 4MJ4A 2NPLX 1BV8A 2X3BA 4QRPB 2R7EA 2TSAA 4FD0A 5D1QE 5GSVB 5HYSB 1RJLA 4BCXA 5E5MA 2UZPA 15C8L 4PJBF 3X1GA 3GKZA 1U30A 1IBYA 1F2QA 4AWJC 3V6ZA 4DGVH 1LO2L 3QS2A 3H3BC 5T1MA 4GG6F 2WYTA 1DJXA 2FYVA 3DMMA 4XB7A 2X4PB 1LK2B 1I9RL 3BEVA 1WCQA 2AK4E 3CU7A 1F3JB 4PJ6A 1G6RA 1OAKH 2F19H 2EUZA 2VXTL 2WZ6A 2DTML 4YX2L 1SFDA 4K3EL 2EDBA 4BFIA 4DEPB 4XTRC 3LZFH 5AG9A 2CE6A 4G6KL 5H37G 1TTBA 4GIOA 3MNWB 5B7FA 1CL7I 1CDJA 1QLRB 4LZKA 1QRNA 3GZKA 4M48L 4X98B 4IHOB 4X6CF 1IB5A 3T71A 5JHAA 1NWPA 3EUDA 5CCKL 4JVPA 2X89A 3CAFA 1QABA 1CFVL 1AD9A 4PN6A 4G8FA 4XN2A 3EZJB 3UP1A 1HDMA 4NQTA 3HLAA 3FK3A 4AEHL 2MKWA 1UB6B 3GXNA 2YZ8A 3L95A 1I7TA 1MUJB 3L5IA 3HOGA 4HBQA 4P2QA 1NFDB 4QWWC 1NAMA 2P80D 1JPGB 4G71B 3DECA 4JZOA 5CILH 2HFGH 1JHKH 4NOFA 4E9SA 2NXZD 3GIVB 2W60A 3WJMA 4NHUB 1OARL 2V5YA 1JK9A 3D69A 3DIDA 3GMMB 2JB6A 4H0IA 1NCJA 2ZCLL 5FYLH 4H8PA 1E4WH 2A99A 4LKCB 3ZUNC 1F6FB 1BFVH 5INDA 4Y2DB 3RZCD 5CCGE 4PJAB 3PWPD 4JFSA 3Q43A 1S9KC 4EI0A 3ESOA 3TT3H 3QQ4B 5DFVD 5LG1A 4KH2A 3IDIB 1QZ1A 4OTXL 1AQDA 1MELA 4KHTL 5D71L 1KFAL 1QFHA 2PR4L 3HI6L 3JTBA 3TCTA 5KG9A 2XQ0A 2CBQA 5E2VL 3GM0A 2WBJD 5F7HA 4H8QA 4BXVA 2NY1C 1D5ZB 4Z77A 4LSVL 3A3YB 3IN0A 4PLOB 2WXOA 3BRGC 2WNXA 4NZTH 3RA7H 3WXWL 2NTFB 1TZHB 2WQRA 1H15A 3SDDD 2KDYA 4F20A 3BE1L 4JQVA 4XBGA 5BRPA 1GMIA 4B41A 3BZEA 1CUOA 3N42B 3W82A 3V4PH 3SHSA 3IKKA 3UX9B 5KTEH 4AKPA 1OAYL 4ZFGH 5BW7A 1CFTA 4NO2B 3LPPA 1NIDA 3OHXC 1A66A 5IHUH 1GCFA 4JY6A 4PJGE 3ZHDA 4RISH 4JKLA 2DYRB 2I24N 1FO0H 3E1ZA 1QBLL 2WVSA 5DEFB 3D85B 2DKUA 5E6SB 3BKJH 3MJ9L 4P06A 4WW2A 1WZMA 3FB7A 3US9A 4LLQB 1I82A 3QEQA 5DVNA 4KQ3H 3VXNA 3UDWC 2VXQH 4WV1C 5C0AA 1QPXA 2OL3L 4BDVA 3MOAL 1JZ2A 3VSTA 4Q9QL 1WGOA 2YA2A 4U1KB 2W94A 3MROB 4X83A 5EWIL 2P44B 4MCZA 5ICZB 1UWFA 4PRAB 4R84A 4N1CA 4N0CD 1ACXA 3AB0B 1NL0H 5LBVA 5D2NE 5EOTA 3KL5A 4Q2ZB 4Y4FB 2Y69B 4LSQH 3L4YA 5JQIB 2X7LA 3EJUA 3QBTB 1NCAL 4OI8A 3AQXA 1E6JH 1E30A 2GAZB 2YQBA 4YFDB 1S8DB 1FFRA 3UAEA 5I5MA 2EVGA 4I0PA 2QSVA 5DZPA 1BZ7A 4CVZB 4S2SA 1AMXA 3OB0K 3ZVVA 3FQ1A 2XZCH 4AQ8C 2QJDA 1A6TB 2EVIA 5B39A 5GGTA 1KPUB 3RTLA 4PRPA 1VERA 5CEXB 1I1CA 2EACA 2MQCA 3VD5A 2IDFA 5INCB 1T20A 4CVXA 3BAJA 2ALAA 3BAKA 4YZFE 2A6DB 3K74B 4NYLA 4P99A 1YMMA 4Y88A 2BX5A 1A4BA 3LNHA 3OMNB 4ZYKB 5C8JA 1NCGA 1FN4A 5E8NB 2UWEF 4JNXA 1C08A 3V5DA 4DOHB 1Z5LB 1GGBH 2AXJA 2Z0BA 4HX1A 2H3NA 2CRIA 3L1OL 4LCCA 4NKQB 2WUBH 1BLIA 2A4ZA 3ARBB 5LBSH 5I5IA 1HYSD 3MACH 1S9VA 4BIKA 2AW2A 4HZLA 5FKAA 3D4CA 1PL3A 3QJHA 2FLRT 3B3BA 1K9TA 4TL4A 4CU7A 1Y07A 3I74A 1EJ6A 3HE7C 2XTJE 5JR1L 1QBML 1E4XI 3U7AA 1IL1A 2ESVD 1DVFA 2KQNA 3BDYH 2HAZA 4MLIA 5C0CE 4B9GA 4BH8B 5LCVA 5I15L 1EHXA 2MCAA 1WBXB 5M94B 5IR1B 3RVUC 2FIRT 3PV7A 4JY4B 2PO6D 3B9EA 5ES4B 4QTHA 1S5HA 3FB6B 2O6EA 3HR5A 3BN9C 4Y7MA 4UNUA 3CNKA 3D50A 1UCTA 3BIBX 2EDYA 3BIAX 3CSTA 1CICB 4V1DD 2HPTA 3TZVD 5J9PB 1JTPA 4JG1L 3ZDZE 3TEWA 2OAAA 1EXHA 5DT1L 4XVUD 3RWJB 1CGUA 4AGNA 3CWGA 1GKEA 3TU6A 5HYQA 5EU5B 4BGLA 3T3PE 4JRXD 1DO5A 2F5BL 3N41B 4EMZA 5DS8B 3HS9A 4MCNA 1OCOB 1WZAA 1NGWA 5D2LF 4C56B 4ZI8A 4XP1H 3FO1B 4ZUVA 3FCSB 2CRMA 4U6YB 2E4FA 3U46B 2IPTH 3WEAA 4UQ3B 1BMGA 1YEDB 3P4OA 2J55A 4FCAA 3WFCL 1XCXA 1HZHL 3U6XA 1IC7L 3GBLA 3LH2L 4TQEH 3O9WB 5IVOA 5B8CB 5D72L 1MRCL 2P52A 3CFCL 3QFJD 4XXCA 4AM0B 5D7JA 1JZ5A 3D12B 3KXFA 3TFBA 5DJYA 4H26A 3TJHC 1Z1WA 3WDJA 4BQ9A 3ALWA 4NUGH 2YUWA 2NR6D 2E7LA 1YAIA 1VB9A 4HEME 3CV5A 4JFYA 5DQJB 2ZD0A 1E2VA 4FLHA 5DD5L 1MFEH 5HYJE 1NA8A 4XN4A 2J12B 2DMKA 4Y9BA 5BRZD 1R34A 1KCRL 3EW3B 4K3DL 1GHFH 5DXWA 1CF8L 4M62H 2UVFA 2Q8AH 1WZ1L 3LHAA 3FQXA 5AVZB 3VI3E 4FI8A 3QC6X 2A83A 3EJZC 4DCQB 5T3ZH 3II2A 4L3CB 4NRYA 4JPWL 3MA7A 3GSXA 2F7IA 3BO8B 3LHPH 3V0IA 2LFEA 4XVOA 2UXGA 3MFFA 1F4XH 2EVHA 5IEHA 2WPGA 4G1MA 3O2DH 4A6YH 4E41E 1OP9A 1ILSA 2C1OB 3JTTA 4X9GA 4XGZB 5IFHL 4O2EB 3OLIA 3ALXA 2BSCA 1N18A 2JELH 1YY8B 5BZDB 1UD2A 3MNVA 3LEXB 4GG6E 3RVWC 3FT2A 4R2GB 3QFGA 4I18A 4K71C 5C09A 3TGXA 5E2UH 1CBJA 2F61A 2UZXB 4HKZB 4QAMB