3FSAA

Pseudomonas aeruginosa azurin with mutated metal-binding loop sequence (caahaam); chemically reduced.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
122
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLEQYMFFCAAHAAMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-binding loop length and not sequence dictates structure.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Metal binding protein
molecule keywords Azurin
total genus 29
structure length 122
sequence length 125
ec nomenclature
pdb deposition date 2009-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fsaA00
4DP6X 2BWIA 1GW0A 1E67A 4GXFA 4P5SA 2EIJB 3NT0A 5I6OA 1BYOA 2X88A 3OQRA 4KNUA 2YARA 3MBWB 1E5ZA 2LLNA 2PCYA 1BEXA 3QQXA 1KV7A 3SBRA 1MZYA 2UXFA 1JZIA 2ZWNA 3FYEB 2PCFA 2IAAC 2GHZA 3TBBA 3QJUB 2GB2A 2PP8A 1TEGA 3ABKB 2FJSA 4E9VA 2J55A 1SDDA 1WA1X 2H5UA 5EHFA 2DV6A 5AKRA 4YL4A 3CVDA 5I6PA 3V9CA 1AS6A 2MRYA 3ABMB 3NJFA 4DP8X 4E9RA 1W6LA 4FAAB 3NYKA 9PCYA 4AX3A 2FTAA 3TBCA 4AI7A 1NIBA 4AZUA 1BXAA 1A3ZA 4YSTA 1PLBA 1J9SA 1GR7A 3PXLA 5F7BA 4YSAA 4GP8B 1GS8A 4KO6A 4GY4A 1AANA 1BQKA 4DPBX 1EHKB 1NINA 4A66A 3HEIB 4L0PB 5AFAA 1J5CA 1AG6A 4G7QB 1JXDA 1SHXA 2P80D 2VW7A 1JZHA 1NIFA 2Q5BA 1JZFA 2BP8B 3V9EA 4YSUA 2Y69B 3NJLA 4DP4X 2FQGA 2EIMB 1ET7A 4KOCA 3QJTB 1AZNA 1SF5A 2ZONA 3CDZA 1OOWA 4CSPA 4HZ1A 4DP2X 4X4KA 4A67A 2IWEA 4E9SA 2PPDA 4F7KA 2QT6A 3PAZA 1NICA 1X9UA 1IKOP 3NP3A 2J56A 3EHBB 3FU7B 4BXVA 1TEFA 1L9QA 1NIEA 4WTQA 2X87A 1ET8A 2ZXWB 4K9JA 1ILSA 2CCWA 2DYRB 5B7EA 3RYMA 1AS7A 1E65A 1WA0X 2TSAA 4HHWA 2XX0A 2GBAA 2JXMA 1CURA 1ILUA 5ANHA 2BWDA 5F7AA 4E9WA 2VMJA 7PAZA 2XVBA 5B1AB 1V54B 2BP0B 1HAUA 1GY1A 3MX0B 3C75A 2WSDA 3NJKA 1AZBA 1T5KA 3FSVA 1DZ0A 2QDVA 1NWPA 4TXVB 1J9RA 1X9RA 1OE1A 3N2JA 3ASOB 1ASQA 3HB3B 1ETJA 4G7RB 4HIPA 2OJ1A 1F56A 1JZEA 3IBOA 1WA2X 1CC3A 2XV3A 2IWFA 2IDQA 1A65A 1AACA 1ZDQA 2OV0A 2YAQA 4GP5B 3NSDA 3CZUB 3WKQA 1AQ8A 4G72B 3PAVA 3QPKA 1GYCA 3CVCA 1NTDA 1NWOA 2MTAA 5IY5B 1HFUA 4AKPA 1PAZA 1I53A 1BQRA 1EZLA 3CG8A 1OV8A 1ZPUA 4DPAX 2PLTA 3ZIYA 4BK5C 2GSMB 2XUWA 4YSSA 3X1BA 1V10A 2IDUA 2PPFA 3FQYA 2I7OA 1AR1B 3T9WA 3EH5B 3QJQB 2JFCA 4YSDA 1PZCA 1HAWA 2GI0A 4DPCX 2FQDA 2HX9A 2VW4A 1PLAA 4AKQA 1GS6X 4ZK8A 4GP4B 2DY2A 1QHQA 2IWKA 2JKWA 6PCYA 2PP9A 3ZBMA 3S8GB 3WNIA 1PNDA 2BW4A 1KGYE 1SF3A 2PP7A 3AG1B 2DWTA 1OCOB 2VM4A 1E30A 1OF0A 2YQBA 4F2EA 5B7FA 1UATA 5I6NA 2CUAA 4F2FA 3SBPA 4HCIA 1W6WA 4JHUA 1CUOA 3T6VA 3AG4B 5PCYA 3X1EA 3OMAB 3TU6A 2FQFA 3DIVA 5D4IA 4YSQA 1VLXA 4N4YB 1JXFA 3ASNB 5I5JA 1M57B 3H4HA 3FYIB 1XB6A 2YAEA 3NSCA 3OD3A 2B08A 3QJRB 3S3DB 1NPJA 2QPEB 1NIAA 4G70B 3FU7A 4KO5A 2XV2A 5B1KA 3S3BB 1N70A 1ID2A 2VM3A 5FC9A 2HX8A 4YVUA 1KDJA 3CDZB 4A2GA 1PF3A 4P5RA 4KO7A 3OM3B 2IH9A 2IH8A 1CYXA 2CAKA 2J57A 4A2EA 2H3XC 3FU9A 3UGEA 3PPSA 2VN3A 2YAOA 3NSYA 5LDUA 2XXFA 1OCCB 3WI9A 2RACA 3KW7A 3EH4B 4BXSV 2UX7A 5I5IA 3FS9A 4YSCA 1ET5A 2VW6A 3KW8A 1QLEB 2CALA 3BVDB 1BXUA 1ASPA 1FA4A 2W88A 2E86A 3GXUB 1RKRA 3SBQA 3QJVB 1URIA 4HHGA 3NJNA 2AZUA 1A4CA 1PY0A 2BZCA 4A2FA 4HCGA 1KCBA 2Y1AA 3AG2B 5AZUA 3UAAA 1BAWA 4YSEA 2IDTA 2UXGA 2WO3B 3T6WA 2FNWA 2BO0A 1PMYA 2BZ7A 5I28A 1FWXA 1J9QA 1IBYA 3NJGA 5D4JA 2ZOOA 8PAZA 4E9YA 4QKTA 4A2HA 3T6ZA 1AZCA 3DKHA 1BYPA 1NIDA 2DYSB 3IEAA 2EINB 1NPNA 5I6MA 4DP9X 1M56B 4NAJA 4KOBA 1RCYA 2TSBA 3PLYA 4GYBA 2XX1A 4MFHA 1IUZA 2XXGA 1GSKA 3OMIB 1ZV2A 2XLLA 3WG7B 1DYZA 3H56A 5B1JA 2CBPA 5TK4A 2R7EB 5I6KA 1KDIA 1L9OA 1TU2A 4NERA 2UX6A 1JZGA 3ZDWA 1ASOA 4JKNA 1JOIA 1KBVA 1TKWA 5I5MA 4UF7C 3ZX1A 1ZDSA 1AZUA 3IN0A 3G5WA 2XU9A 3N55A 1JXGA 2H47C 1J9TA 1B3IA 5I26A 4A2DA 2GC7C 1XMEB 3FSWA 2CJ3A 5TK2A 1PZAA 2HX7A 4KO9A 3FQ2A 4KNSA 5PAZA 2YAFA 4WKXA 3X1GA 4YVNA 4BWTA 4BDVB 2R7EA 1E5YA 1YLBB 4FA7B 1AAJA 1NZRA 1NDTA 4HCFA 1MDAA 2NRDA 2W8CA 3AG3B 3T71A 1IC0A 4YSOA 4E9QA 3UABA 1PLCA 1FFTB 2QPDB 2AANA 2VSKB 1XB8A 4M3HA 3FSZA 2HZHA 2FT7A 1PNCA 2YAHA 7PCYA 3L45A 1XB3A 2UXVA 2B3IA 3NP4A 3FPXA 3UACA 5B1JC 2HRHA 3ABLB 1L9TA 3NJMA 1OCZB 3WKPA 2IDFA 2HLEB 1RZPA 1KYAA 2WO2B 3UADA 2PPCA 4G71B 3TASA 1A8ZA 1V55B 1OCRB 4DP0X 2P80A 2FQEA 1AZRA 3ABGA 1R1CA 3NSFA 2FT6A 2BHFA 3PAUA 4HAKA 2FWLB 4YSRA 2HRGA 3FSAA 4E9XA 2YAMA 1GY2A 1AG0A 4DP5X 2OCCB 4UAHA 5E9NA 2Q9OA 1A4BA 5B3SB 2YXWA 2AVFA 1JERA 2PPAA 4N8UA 1AIZA 1KBWA 2XYBA 2N0MA 1J5DA 3ERXA 1L9PA 2GC4C 3EH3B 1ADWA 1WS8A 3WIAA 4DP1X 2AFNA 2YAPA 4BWWA 1AS8A 1WS7A 4AKOA 3JTBA 3X1FA 1SFDA 3TA4D 3WNJA 1OE2A 3H4FA 2DWSA 2BP0A 4RH4A 1A4AA 2YXVA 4UANA 1JVOA 2BW5A 3NJIA 1PZBA 3QJSB 1L9SA 3S8FB 1BXVA 3DTUB 4DP7X 1JVLA 2EIKB 1PCSA 4HALA 2EILB 2HXAA 3X2QB 3AW5A 1SFHA 3NJHA 4EF3A 4ENZA 5B1BB 4YSPA 1RZQA 1CYWA 1W8EA 3FQ1A 1ZIAA 4NB7A 4KNTA 3UAEA 3EF4A 4CSZA 4BDVA 2AZAA 2XV0A 4W1TA 3AY2A 2PPEA 1MG2C 2I7SA 5A7EA 3S3CB 5B7MA 2BP8A 3AZUA 3JT2A 4Q89A 4W9ZA 3IN2A 3GYRA 1SHWA 3CVBA 3SQRA 3NJJA 1QNIA 2GIMA 1GS7A 2UXTA 1ZIBA 2A3TA 4BWUA 1MZZA 1MG3C 2QDWA 4E9TA 3GDCA 2XWZA 3IE9A 1BQ5A 1IBZA 1JZJA 4G7SB 3OMNB 5I6LA 1N68A 2VSMB 3BQVA 5D4HA 1OE3A 4JHVA 3X1NA 4QLWA 1AOZA 1L9RA 1KCWA 1SNRA 2I85A 3T6XA 4PAZA 4A68A 3FU8A 1WAEA 2J5WA 1M9WA 6PAZA 4PCYA 2IDSA 4Q8BA 3FT0A 3FPYA 1SDDB 2FT8A 3U25A 1SJMA 4M4RB 3PCYA 3D12B
chains in the Genus database with same CATH superfamily
4DP6X 1S9XA 1JUFA 4NSKB 3FZUC 1IAKA 1OM9A 4P5SA 3UJJL 2EEBA 1LMKA 4R4FH 2BP5M 1RVFL 4RFOH 5AVUB 1HZLA 1UXMA 2OI9B 3NSJA 3CBRA 2D73A 4XAKE 4B95C 1SXSA 3VXQB 4KY1L 4FQ1L 5HJGA 1PZSA 2EUXA 1N9PA 3KEDA 2FSEB 4PYHA 3U7WL 5D7JD 2D2CC 4P3DA 2GBUA 2OXHA 3GNMH 3VWJD 1QKZL 4NKQB 3UZQA 5EPMA 4YMPA 2BJMH 4F57H 2E3VA 3IDUA 1OTTD 2WXMA 5E7BA 1KGCD 1ZEAH 2H5UA 1MFMA 3FN3A 3BAJA 3ZJAA 2XDHA 3QUKA 4PJHA 1EAOA 2EJ1A 4MA7L 2E7LC 4JUSA 3U4EA 4C56A 1TDQA 4NNXB 1WE5A 3IMRA 3CDGB 3AQDA 1NC4B 2EDJA 3O41A 1GR7A 1K9TA 2CHWA 2AEPH 3ZZQA 3VRJB 5I0VA 3PGFL 4K71C 1B88A 2NXZB 4GBXB 4OCYH 5D1ZI 2E9IA 4X7FC 2VR3A 4JKPL 5D55A 4OIBA 5HVGB 1ETB1 1JP5A 3EW3B 1B6UA 5AFAA 4U1NA 5EOTA 3MRCA 4MJIB 5HDRA 3BUYB 1AD0B 3DOSA 4OB5L 3C08H 4Y9GA 3WAJA 2EH8H 5DVPA 1HL5A 3QCVH 2RTTA 4WFED 4BH8B 4WI8A 1UWEH 2GUOA 3C6SA 4NO5A 1QSFA 1SY6A 3DO3A 5FGCB 1UA6H 4BH8A 5K9QG 3K8LA 1DBJL 4JO3H 1FE8L 3OKMB 5C08E 3UAFA 2VR8A 4NHUB 3X3GH 1NICA 3AUWB 1HINH 3DVGA 2W0KA 1XSKA 3BUYA 5ICZB 4MJIA 1ZOXA 3QEUB 4X9FA 1QFHA 3T8XA 1EBAA 1NIEA 1J0IA 4NRYB 4NWUH 1Q1PA 4K94C 5DJZB 1IGYB 3QUGA 4XP1L 4S0HA 1JD7A 5C0RH 5IBUB 2NUTA 1L5GA 4PS7A 1CD0A 3CDGA 1Q72L 5TE4L 3W9DB 3MRNB 5BNXD 1KF9B 1HAUA 3IGUA 1EAPB 2X9ZA 4OZIE 2VH5H 4DKAA 2VDLL 4PJHB 1HXMA 2D7OA 4FCHA 4F7EA 3IAPA 3OAYH 5EC2A 2WAHA 5E9AA 3RWJA 3TFKC 4H2AA 5I0DA 4L4VA 1O7VA 3EDJA 1IQDA 2BSCA 2QSCH 4JL1A 2E4FA 2AK1H 5D72H 1S3RA 4NN6C 3X17A 2IWFA 4L3ED 1NLDL 1KN4H 1I1AD 2VXQL 2AMUA 3HZ3A 5L88L 3AMLA 1Q90A 3IDYB 5HI3C 2ZX8A 1P2CB 3QZBA 4GBXD 4HLJA 4KRPD 5I1HL 1ID5I 2QADD 4KHTH 4LDOB 4WFGD 4XNUL 3VXME 3N0AA 3VWKB 5DQ9A 1MFNA 1RU9L 2EZ0D 2EYSA 3EBIA 4PVLA 2F8IA 2OYPA 1IGIH 1W72A 3FTSA 3GPEA 2EEFA 4W70A 4N5EC 2R0KH 3R0NA 3QUZA 2F74B 4ZFGH 3KBHE 1T0MB 1E2WA 1MIEH 1GMIA 3PWLB 1MCOL 1W15A 2NXYC 1MW1A 1ADQH 1E9PB 5LBGA 3HR6A 3SDAA 4BFOA 1BV8A 3SDCD 5GRVL 1MCFA 1KFAL 3PV6A 2IGTA 4GAYA 5JMOC 4XO5A 3GMNA 1GKOA 3ULSA 3DWTA 5JW5B 3S8GB 4HBCL 4UB0H 1PNDA 3EOAB 5C08B 1AZZC 3NFNA 4LVNB 4L1BA 2ZG2A 1MHHB 3MACL 3DPDA 3S2AA 1S7UA 1LO5A 1O9VA 1CXEA 3WKNA 3CMGA 1DZBA 4KK6C 1JYNA 2ADYA 1K8DB 2YMOA 4ZTOL 1MLBA 3WNOA 2IADB 3IK2A 3BKCH 4J3VA 3EAKA 3IAQA 4NQDE 1CGSH 1FZMB 3GFUA 4U0QB 5A16B 4KJYB 1QP1A 2WXFA 4EIUA 1WHPA 3VWJA 2BIQA 2OK0H 4PRPE 1TSHA 4JFDD 3K3QA 3LN5B 3D4CA 2LFGA 2WWKO 3GLZA 3O3AA 3WSQH 3IMTA 3L7FB 3QFJD 4YO0A 4LARL 4RMQA 1LP9A 3QYCA 5FC9A 4K7PL 1NGWB 2VM9A 4P9MH 2H45A 1P1ZB 3F12B 3MJWA 4HDIA 3MUHL 2H32A 4QT5A 1EQWA 5GZOC 3RL1B 1IEBA 4TUJB 5I1JL 4PBXA 5MI0C 4PJEE 4A2EA 4ZMZA 4JFFA 5F0MB 2DM7A 3IVKB 2BNRB 3PPSA 3NZHL 2V17L 1G7PB 3LKSB 2XXFA 3EDEA 3WI9A 2PXYA 4IOIB 2WKLA 4I3RH 3H54A 1QBML 2BDNL 2J8UF 4RGND 4BXSV 1PY4A 1SBSL 4TPRL 3VGAC 5HYSA 3P1VA 4J3XA 4OJYA 2D3JA 1QSVA 4LQFL 4YHOL 4PJ8C 4XAKD 4ATWA 2DWEA 3BPOB 4I89A 1FNFA 4QYAA 5HGAB 3NJNA 4L4TA 1DEEB 1KYDA 3VVVA 4P2RA 3FQXA 2KQMA 1X5ZA 3P2TA 2I07A 4X6EB 2UY7B 2UXGA 4DUVA 2EADA 3VFVA 3OKDB 1KJ3H 3G6AB 1P6WA 3OXSA 4OFYA 4NLAA 5K9JL 1AKJB 2IMNA 5EEXA 4D8PB 4OM1L 5A6IA 2P8LB 5L8LB 3RX9A 1PYWB 4OLXL 2HTLC 4N87A 4Z9KB 1NPNA 4MNGE 4KMTH 4XO9A 5BW7C 1BDYA 1F45A 2I60L 3HMWL 1AOHA 3T0EE 5DZVA 1NDGA 4FNSA 3KPRA 4G80A 5KYUB 4TVPE 2NY2B 1NMAL 4JZJC 3WELA 1NC2B 2CO1A 4H0HB 3G04A 3ZQ9A 4BZ1L 2H2SD 1T1XB 4WI2A 2APVA 3O81A 3KDMA 1FZOB 1SHSA 2R0ZL 5DJ6A 1E4XL 5GGTA 3SOBH 2G60L 2IO5A 3OB0H 3C5SB 1KBVA 3HKZA 5HYJE 4HD5A 5IUCA 1MCIA 3SDXE 1KG0A 3VXTB 3HS0C 3ZT5A 2J8UE 2J5LC 5J6GB 1AO7B 4TUUA 1NL0L 3DBXB 2PW2A 5LXGL 2QL1A 4J23A 4H8UA 5DK0B 4OLYH 2AJXL 3CAFA 3OHMB 1JYXA 5TDOB 4NC1E 2W81C 4HJGA 3ULUE 3V5KA 1H19A 3DJZA 2BVQB 1E40A 4YDKH 3BAXA 3WTYA 2Z0UA 3L48A 4IGBA 2YAFA 2X6MA 4WKXA 3LKPA 3BWUC 2R7EA 1IGIL 4X8JA 1R3JA 2YPLB 2B77A 5DHVA 3QDGE 4G8EA 2OMWB 3E2HC 3I6GB 3APMA 1Z6JT 4FQIH 3IFPA 2R2BA 4JM0A 4L23A 2PWDA 4QO1B 3ZKND 1QHOA 4J3WA 3ULUL 3TBTA 5JZ7C 1PNCA 3HG3A 1JNNH 1N8ZB 1OSZA 4N3TA 1NLDH 1T0PB 2ADFH 5IB4B 4QHPA 3BAEL 1CDGA 4DTGL 2R2CA 1KELL 3FT2A 4UT9A 1MWOA 1EJFA 2WVTA 3O0LA 2WO2B 4FX5A 2HRPL 5EIQA 3HTLX 1OK8A 5E70A 5E95B 1N3NB 2XT1B 2FQEA 2JKRM 1CD1A 3BPLB 4B7IA 4JO4L 1R1CA 2F5BL 5ID1A 3AITA 4IOFD 2FJHA 3UXFA 1D5ZB 4U1HA 3UMNA 1VZHA 2I27N 3PYCA 4WO0A 4J4PD 4DWHA 4QHKJ 3UPCA 3WS3A 1MNUH 4M8QA 1ZVNA 4HJUA 1A9BA 2G0LA 4MRCA 1CFNA 4TULL 3RLSA 1JHKH 3LRSA 4WWNA 1F11A 1EEQA 4CW1B 2YSSB 4PVMA 4HIIA 4NGHH 2W65B 3IJYB 4PU2A 4H25A 4XC1L 3O4LE 3QQ9C 5A6LA 2ADJA 2CH8A 4JL2A 5KSAA 1TO5A 4KV5E 2F61A 1P84J 4JO3L 2OMBA 3JYBA 3NQIA 3D0LB 3B2DC 4LVNC 4M4PA 3U79A 5I18L 2XN9B 4MAUL 5JPMB 1R3KA 1OAUH 4L9LB 3CZLA 4OB5H 4I0PB 1TJGL 3CXDH 4YAQB 4LCYB 1JF1A 2HFEB 5AVWB 2W5PA 1CICC 1L6PA 2FYYB 3N0PB 1I1YA 3FH5A 5F9WB 3TO4A 4XWGH 2P5EB 3NJHA 1ORQB 2IAMB 4JUTA 4GRWF 1OGAD 3L1OH 2ARJA 5C6WH 1GOFA 3VG9B 5GZOD 1BJMA 3HB3C 5IJVB 4IBUA 4NRZB 1Q8MA 2WNGA 3IF1A 4BH7A 3CUPA 1FV1A 1O6TA 4JK0D 1UB6A 5IQ9B 3S3CB 2BP8A 3QDJB 1D2PA 3ROLB 5IKCB 1VFAB 1GTFA 4P4RA 1MCSA 5DMGD 2WWMD 1A22B 5E8PB 1GS7A 3RTQB 3MYJA 4UTAH 1RQ5A 1T1ZB 4GAGL 4PJ8D 3S36X 3SDDA 4BELD 1RUKL 1AQHA 3JTTB 4LL1A 2Q10A 4Y4HA 1JZDC 4IQHA 2DI8A 4NZFA 3TYFB 4HIHA 1OE3A 2A6DA 1A7RH 3IDGA 4XNMA 1HHJA 4AUJA 5C8JB 4JQIL 4M6NH 5AZ2H 1KCSH 5ILTL 4M5ZL 1YEKH 2I26N 1D9KC 4NUQA 2YQ2A 5BS0A 4NQVA 1A3QA 1AHKA 2H26B 4IMLB 1SJMA 5FM4A 3TBWA 4WI6A 3O4LA 5JHLA 3OX8B 4WWKB 1KEGL 4JFSA 5HSFA 5BRZA 2Z34A 5C0AD 2B1AL 2VLJB 3AS1A 2ORBL 1Q4NX 3WLBB 2AK1L 1WVZA 4KNUA 2CJTA 5DK3A 4PR5B 3X11A 2LLNA 3QH3A 3QHFL 3QC5X 2CLVB 5I8EA 5KYXA 3QW9A 2EKSB 3QQ3A 3T4AA 2DYPD 1S9WB 3FQNA 3RZCB 4UTBH 1X5LA 5HHNA 3P4OA 2JMRA 3F2LA 5K9KA 4V11A 1AXTL 1RZKH 4LSSH 1KIQA 2GB2A 5KSUA 1JNJA 1BFOA 3RL2B 3AADB 3PXHA 2EC9U 4N86A 4BQ8A 4K0OA 2KI6A 3FTUA 5TTRA 1DANT 2NQDA 1WA1X 4ZPTA 3OR6B 4B97A 4HAGA 5TDPA 5BQDA 3HE7A 4FFZA 5AENA 5GGUA 4N2GA 3L4CA 1DQKA 1KGUA 3CXHK 5C09B 4FAAB 1JZ4A 3QULB 3L3DA 3ZTEA 1F3RB 4PLJC 3P77B 1Y18B 1BXAA 3Q1SL 4XB3A 1PLBA 2JJSC 1SVZA 5C0CE 2ITFA 4TNWF 5ITBH 1XGRA 1DBJH 2BVTA 4P3CH 3VFGH 2ZXEB 5JO5A 4UIKH 1IRAY 3RWGB 5AVRB 4O02B 5HXMA 4GG6B 1I3RB 3L3KA 1HI6B 2P80D 3BUBA 3ORJA 4NUJB 1Q0YL 4HX1B 2J25A 4OIFA 4XN9A 4NDMA 4TVPL 2F58H 2GHWB 3TA3C 4FMVA 2OL3H 3V5HA 3RFZA 3TEWA 3C09C 3N40F 2JSFA 1VA9A 1DQLH 2LLGA 2J1ZA 4L8CB 1HIML 2WQSA 3FO2A 3PJSA 3ZT7A 4CSPA 5H37G 1WCBB 4MZ3A 2A9MH 3B7SA 4OZ4A 3SKJH 3NK3A 3UTTD 4KI5C 4M7LL 5CZRA 4B9PA 1IBBA 3QBTB 3U9UA 3BH9A 4OFDA 1MJ7H 2NNAB 1IM9A 1AYRA 3T0BA 3HI6L 2ZNXA 5INCB 1UURA 2ZZUT 1G4MA 4NQDB 1ET8A 2FX8L 5BW7A 1HS6A 1S9VA 1UXWB 2DYRB 1D5BA 2D03L 2ZCKL 3VFTB 2TSAA 5IEHB 3RZCD 4Q9QL 4HUVB 2F53B 2JJUA 3K6IA 4R97C 2F0CA 1ILUA 1QWHA 1JZ8A 1WWBX 2VMJA 3QA3B 3DIFA 1BD2D 3WIFB 1BMGA 4N85A 1M05B 2V5MA 3SYPA 5KVEL 2X1OA 2VL5A 1T5KA 2ZP0T 3MRIB 4NT6B 1W0VA 1BPLB 1X9RA 2AV1A 1XTMA 3VXMD 3BKMH 1FLRL 4W6YB 5ICXB 4ZJ9A 4I0CC 3CN1A 4MYPA 1B4JH 2BIPA 3L81A 2YK1L 3VGBA 3HB3B 3TH3T 4ANUA 3U2SB 1IKNC 2G0KA 5HDBB 4JFFE 2F6AA 4UQDA 5DEJA 1CL7L 5B22A 4ZMTA 3N50A 4GQ9L 5EZIL 2IDQA 3MXWL 3MO1B 2JI1A 1K72A 1I9JL 1KT2B 3MRFA 5DMYA 4CSSA 3L3JA 3GBNL 5FUCE 1B4TA 1AP2B 2B59B 2QKIA 1HYSC 5JZ7D 4HUWA 1MH5A 2WQXA 1UOVA 4P59L 1GGUA 1QW9A 4RA3A 2NR6A 3IXTB 1EZLA 2CRYA 4XCCH 4AEHH 2MCMA 2N3JA 4YLCA 2GTZA 5DEGB 1BA9A 1EZVY 5I30H 1UWYA 5D7JC 2PPFA 4L4TD 2C9QA 3MV7D 5E8DL 5EU6D 3DUUB 1CFMA 1MH5B 4CVZB 1LD9B 1F4AA 3GJEA 5D96C 3B1TA 1AP2A 2QPUA 4QLRA 2X4NB 2G4GA 3LN4B 4OQTL 3BXNB 2VDOH 3UTSE 4XGZA 3TZVA 4G9FD 4X8XA 3ZHLA 2JKWA 3HMXH 3WO3B 2PO6C 3VFSB 1R47A 1NBVL 1H0DB 3U2JA 3OLEA 3U2SA 2F58L 1UADC 1VIWA 4JFFD 2IFFH 1MJ8H 1SLUA 5ALBH 1ZLVK 5CJ5A 4FLOA 2R9HC 2DQDH 4X80L 1MHEA 5KVEH 2TAAA 4UOQA 2AV1B 2EICA 3MA9L 1T21B 2ATKB 2W07A 2OXGA 3QQ9D 1A7OL 4FZ8H 3N9GH 5AUMA 3UAJC 1M05A 1MJJA 4XPFL 4F2FA 4AM0B 5MEOA 2ZCKH 4HCIA 1XEDA 1W6WA 1WITA 2F53A 3OKLB 4ACTA 4HUVA 2CXGA 3VFTA 5EF2A 4AEIH 1NBZA 3FU0A 4AENA 3RX7A 4LVHC 4NQDA 4Z5RB 2HCZX 5JXEA 1WHOA 2VOTA 2XWTA 2Y6SD 4LSVL 3UTPD 4Z0XB 1OW0C 5DI8A 1U6AH 1NCHA 3DXAE 3VSUA 5SWQB 4A7UA 2DDQH 2YR3A 3C12A 5I6XC 4H20L 1M1XB 4G6ML 1E4HA 2ZOLB 1GMEA 4A2GA 1P4BL 1PF3A 2FJGB 2XA8L 4N2NA 4AXWA 4F7CA 2W9EL 4FFYH 3LVTA 3IXTA 1KCRL 1S78D 2JB6B 3R19A 1M2VA 1U8OB 4RDBA 5EN2A 3ILQC 3UFIA 4IBWA 4YIQA 1MFVA 2IAMC 2QVMA 3HNSH 3MV7B 1I3GH 3EO0A 1NUDA 3QDGB 4GG6A 4DESA 1GKEA 5E6RB 3ZL4H 1NANH 4M1DL 4GQPH 4LRNH 1OZUA 2R83A 2XZQH 4YN3A 5A6MA 3O2DH 1KJVB 4NQSA 5D6CB 4KTGA 2MPAL 3BVDB 3P77A 3ZR5A 2W88A 3GXUB 2AZUA 2R4RL 4WRLA 3RPBA 1HE8A 3NIDF 5GGUB 2C9AA 4NT6A 1CGUA 3RBSA 2V5SA 4AJ0A 2WO3B 4HPOH 3ENEA 4XVSH 2F1AA 4MXQD 1FAKT 4X98A 3QDMB 3E8UL 1P7QD 4X9IA 5IEHA 1IBYA 1KIQB 4NO0D 4XCFH 1D5BB 3IWVA 1R46A 3M88A 5GGTH 1RUQL 4G8FA 5K9KB 5T5FL 1GGCL 5IJKC 1I7UA 5JIHA 2A74C 2AXFA 4OLZH 5E0QA 4LPYA 3SKUD 2EC9T 3BEWA 5EZJB 3QQ3B 4Y5YB 3BH9B 3T4AB 5C6PB 2EINB 2CLVA 2WYZA 1BBDH 2XPYA 3OJDB 3LKRA 1IM9D 1PX4A 1Z7JA 4PVBA 1HILA 3DECA 4GO9A 4P48A 4PV9B 4NXSA 1A9EA 5E8NA 3PJSB 2OKMA 4HF5H 5TK4A 4AJYV 3O4LB 4YK4C 3TBWB 4UM8A 3KPSB 1QTYT 1FO0L 3SJVE 2VDPL 2D0FA 3K6DA 4JQIH 4NDMB 5ELIA 4K8RD 4HX1A 5BS0B 3RFZB 3HHSA 3K4AA 1LEKA 2NW2B 3L3OB 1UOLA 1NEUA 2X4RA 4B0MB 3NPSC 1K6QL 4XNMB 2EABA 4HUCA 1JVKA 2Y7LA 3FZUD 4XVJL 2HTKC 5GRUH 1NOLA 3LJ3A 2IQ9H 1X5YA 5EDXA 1CBJA 2X38A 4J3OD 4LP8A 1EO8L 2ZKHL 1G0YR 4RAVA 4HGMA 4F8QA 1U8JB 2ZUWA 3QULA 2J8UA 1L0XA 1QMUA 3FB8B 4JG0L 4JFYB 2D03H 3HRZA 1I75A 3PGDB 4FNPA 4DT2A 2QHLA 3CHXA 2DKMA 3RHWF 5EWIH 4PREA 3LXCA 4P2AA 5I1EL 4WTZG 2DLHA 2EECA 1CGXA 5L2KB 3CMOH 1CT8B 4QJ4B 4MKTA 5JQHC 5T1LA 4JM2F 1RFDL 3IF1B 4NRZA 3SPGA 4AC2A 3V0WL 1EJ8A 3QIWD 3UTSA 2JWYA 3OL2A 4E9QA 1AGFB 1P84K 5KJ4A 4EQ2A 4KKQA 3UABA 1KNOA 2BWQA 5F3BA 3SQBA 3QVAA 2CE6A 2EKSA 3BWZA 4QR7A 1Q0YH 2HFEA 4JO1L 2Z8RA 4U1SB 2O5YL 5B1JC 2DJSA 5BO0D 4PLNC 3V2AR 3FHAA 1MRFH 1KELH 1O7DC 3P30H 32C2A 1OCZB 4N90E 3FO0H 4L8SA 2A6JB 2PPCA 3TASA 3QUMH 3HHMA 1INEH 4NQVB 4JRYB 3OJMB 2GFBB 3Q1SH 4CVWA 2A73B 2X1XR 3NSFA 2AK4B 4KY2A 5IFHH 2XQBH 3FB6A 3LQZB 2E7BA 3ALPA 4FQXC 2ENPA 5BS0D 3LQAH 2J44A 1T7ZA 3NN8B 4HLZH 4PJXB 3IGAB 1BG1A 4P2YA 4XBGB 3OWEA 4HIHB 3R7QA 4MD5B 3E2HB 5B3SB 2A9AA 1F42A 2XQYA 1CFNB 15C8L 3L5WB 1N59B 2ED8A 3RTQA 4Y1AA 1H8OA 1FGVH 5IVZA 3S36L 1TTCA 1KUMA 2GC4C 3EH3B 2W95A 5ADOL 1WPCA 5LNDA 1D5ZA 4U1HB 1CLCA 2FJHB 2PWEA 3RY6A 3QDAA 4FADA 1HOCB 3O8XC 1T1WB 3VE0B 2WP3T 3LEYH 3RVWD 4FG6C 1WS7A 1R3HB 2X4SA 1N3NA 1FV1B 1S6NA 3K74B 5FGSA 1ZVHA 2XIDA 3QUXB 1SYSA 2ORBH 3RFRA 1FQ9C 4X6DA 5J06A 1A7NH 4MCZB 2OJZL 3FT2B 3NTCL 4S1DC 3NJIA 3TNMA 1ORQA 2IAMA 3TO4B 5IB4A 3X1NA 1IGCH 2IF7A 1MRCH 2WLIA 4NQCB 3PXJA 4RAUA 1JF1B 1TZIA 2CO4A 3H3PH 4UT6A 1RK7A 3KH3A 4P2OB 5E99H 1ZSDB 3HNTL 1W16A 4PJBE 4DUWA 1UVQA 4K4KA 4WJKB 3K71A 1CB4A 4QO1A 4WEBH 4Q74A 4U6XA 1JGLL 2GCYA 2NYYC 3LIZA 3QDHA 4G6FB 1RZFL 4JAMB 4Z7VB 3LIUA 5E6UB 3DXAD 1YEIL 3TTYA 5F0LB 1Z9SA 4X8JB 4RZCB 2BIMA 4ZS6C 4RCAA 3DNKA 1IKFL 1FVDB 5MP6L 2CIKA 3AZUA 1RHFA 1F97A 4QTIL 5TDOA 2PYEA 3NJJA 2MNWA 5E6IB 4RFNB 1NFDB 2YSSA 2NTFA 4LMQE 4N2HA 4OCMC 1F11B 4YHNA 3TTSA 4D0DA 1BVNP 3MCKA 3CX5K 4KK5D 4F80A 5I23A 5J5EA 4YHIA 2JCWA 2QZQA 3IT8D 4M8QB 5DLMH 3CTTA 4U33A 5J6GA 1L3WA 1XCQA 1J0HA 1B3JA 1F4WH 1KG0B 2NXYD 1L9RA 2VXTH 1SNRA 2XWCA 4JJ5A 5TQ2H 5T1MA 2YUWA 4LCWA 3T6XA 5JTWA 4OJFH 4Y2LA 3ECWA 2J5WA 3DI3B 2R0LL 2WOYA 3DX6B 4N9OB 4XX1G 3BWUF 4GRWH 3LZFL 3UAJA 2W0PA 3G04B 4X7SL 4KRLB 5ACLA 4EZLA 5E9DD 5IMOA 3RIAK 2Z31D 2OMTA 5F6HI 1WK0A 3RRQA 3T65A 4HFWB 5KWYC 4TKWA 5I6OA 5EU5B 3CFCL 2A7BA 1XIWB 3PP3H 2BFVH 2FH8A 3RVXC 3TJPA 2UXFA 2WBKA 2QADC 5BRZE 1CBVL 3GLDA 3HFFA 2QQLH 1R5VA 1ZT4A 5HVHC 5IVXF 1FIGH 1JPSL 2D7MA 1YQ2A 4OW6A 1QRNA 5D1XC 3RUGB 1R3IH 3OXSB 1R3JB 2WLZA 2YPLA 1GZHA 3QARA 2NZ9D 4BA0A 5ES4B 1RIVL 5C0EB 5CAYB 3SE6A 5ISZB 1VEPA 3V79C 4NKIL 3V5KB 3FQXB 1FNSL 2MOQA 5KBPA 1RZ8B 3CCHB 1E50A 2J43A 3H85A 2X6VA 1LO0H 5FO8B 2V9UA 4AI7A 1C7SA 4NJAH 2BERA 4LLMA 1EHNA 1PKQB 5F89A 4DKFH 1AO7A 2AJYH 1GS8A 3R1GL 1XCTA 2ZYIA 3JV4B 5HYSB 5E99L 1ZLUH 2E7DA 1M7IA 3A6BL 3HEIB 1F4XL 3BAEH 1R5WB 3K72B 2WYHA 2K6YA 3I6LE 3IVKA 4P05A 4O51B 1JZFA 2E7HA 3HE7C 2FAUA 2YD7A 4DKDC 1J8HA 4EDWH 3VB9A 4QT5B 4R4NC 3TL5A 1ACCA 2XI9A 4N20A 3UBXG 1XMWA 4FQIL 4CA4A 3DPBB 4G80B 4MBOA 1BD2E 1NDGB 2JKIS 1PGRB 4JFDA 4CBZA 2AEQH 1S46A 3LPGA 2IOOA 3B7TA 5JW3L 1TEFA 1PYWA 1P7BA 3FXIC 4B60A 5BZWB 5C86A 1XIWD 2E7CA 2YRZA 1BQLH 2K9UA 1DQJA 4JEGB 1G7JA 4FTVE 4MNHB 5D2NC 3T0AA 1DJXA 5AW1B 4X50A 1ZV9A 3HNTH 2N56A 3EG9A 3QXAB 1SXZA 4Y2DC 1I3UA 1BIIB 2VLME 2DB8A 4HVBA 1GY1A 3QUMB 4PRNA 3WEXB 3MX0B 4XNUH 2GIXA 3AREB 2X5PA 4HUMB 5CGMA 4J12A 5K9QI 1YMMB 1UKQA 1DEEA 2QDVA 3CSTA 5HGAA 3SE4A 2V9QA 5ISZD 3THMH 1MF2H 2J2ZA 2Q7YB 4C57C 5E94A 3QAQA 5M7QA 4MZ2A 3LSOB 2N01B 1EAQA 1MCEA 3PDOB 4OF0A 1E4WL 1CC3A 3B8YA 3BJ91 4I2XB 1FDLH 4Z7UE 4KDWA 2YAQA 1DSYA 5B3JF 4YDLC 1IE4A 1A5FH 5EIVA 3AC0A 3AXLB 3PL6A 2F7OA 3SDAB 3L3HB 4MJ6A 4OTXH 3TM6A 3Q5YA 1BQRA 2DLTA 1VGKA 5TE4H 1FNGA 2PABA 2VJ8A 4CAGA 2IBBA 4O9HL 4X6BB 1DSFH 1OANA 2MEJB 5CBAA 1A1NB 2H0FA 2DS4A 4YO0B 3TN0B 1BPVA 2E59A 1L3NA 2Y1YA 3WXVH 5JIDA 2P3YA 3AU1A 2AQPA 2OTWB 3AXHA 4P2QA 3DDFA 4GFTB 4KX8A 1PZCA 1D3CA 1W2KT 4GI6A 2VERN 1KC5L 1P2CA 2WLHA 1G7HA 4URTB 3VW3H 3BN9D 2IWKA 3AAZA 4YXLH 6PCYA 1BQHA 1JFQH 2CA3A 5J56B 4HK0A 4A04A 2X4TB 4N2BA 1UD3A 3H3BC 1TTRA 2IADA 4QDGA 1YNKH 4YPGA 4PRDA 3QIUC 3Q7JA 3MLZL 4L4VB 5TQ0H 1DBKH 1U8IA 43CAA 1T7XA 2HUEA 1L7TL 3OAUL 5EC2B 4NKOB 4Y19D 1MN4A 1EZUA 1MQKH 5CJQL 1DVFC 4QJ3B 2R0LH 3MRBA 4ZS7L 4GIAA 1HDMB 2VDPH 3ARED 2WMPA 3JV6A 3VD7A 2VXVH 3DSFL 3NFNB 4PRPA 1P7KA 4C54A 2HFFA 3I74A 1CF8L 2CWRA 4GOSA 3ULSB 2WXGA 4ZMVA 5DRXA 5JHLH 3ECQA 4UNIA 2B5IC 3R18A 1DQVA 2Y7SA 3DROA 1IGTA 3GT6A 1TQTA 1PZ5A 3X3FL 2XVLA 3QJRB 4ZUVB 1AXSB 1FE8H 3HG1D 1NEZA 2XV2A 1QSFD 5D93C 1ADQL 2YN3A 2EDOA 2R56H 3QORC 4W4NA 3R4RA 1N70A 2H1LM 2J6EL 3QGVA 4IK7A 4XNZB 2QSVA 1W72B 4MMYB 3M8OL 4M5YH 1PD0A 3NCEB 3VO0A 3DO4A 1MI5A 1CGSL 4EVNA 3OM3B 1BOYA 2XBDA 3TF4A 4WEBL 3V4LA 1F6AA 1IAMA 1JZ3A 1EFXD 1SXAA 4MQXD 3GIVA 1HL4A 1UT2A 2DQJH 3H3PL 1JGUH 3MRCB 4RGMC 2VN3A 3FK3A 1OCCB 2RACA 1OAQH 2X6AA 1BLNA 3EBAA 1EUUA 3GBML 5I5IA 4PRPD 3CVHA 1IQDB 4WCYL 3GEFA 5BMFL 1KN4L 1G6RL 5KSAC 3CSFA 2QQNH 1MELA 3QZWB 4R7VA 4PEEA 4JHWL 2Z7UA 2AXWA 5CCHE 1ACXA 1NGYA 2XN0A 3QUKB 5F1NB 4V33A 3QI9A 1NGYB 4YSEA 1WFOA 1HYSD 3QWRD 4GSDL 4JY6B 3AT8A 4ZW8A 1T7WA 3VFWB 5ADOH 3IAGC 3ZDZF 3MRNA 3UZQB 2OJEB 3B34A 1U3ZA 4OZHA 4P3DB 3OB8A 1TPXC 3CSBA 4AGNA 1Q72H 1NCIA 4L4VE 4I9XA 3QZWG 3EYQC 3NCYS 2FLRT 3KWWA 3ZKMD 1Z3GL 1BYPA 3QEUA 1IB5A 4MLIA 3V8OA 4DP9X 3EO1A 3DVGB 1I8MA 1PQZB 3DJSA 1T1YA 3F7LA 4R7NA 3D30A 2ID5A 2XZQL 1E6OL 2LT9A 2XXGA 1GSKA 1JUFB 1QSFB 3HI1A 4J3BA 4NSKA 2XLLA 3C6SB 1DYZA 3W11D 1WGOA 1B0WA 4PLJD 3TJEH 4N0UE 1CFTB 2OCJA 3EJZC 3S9DB 1OK0A 1NEZB 4QXUL 2N4IA 4XXDA 4U1NB 4ZUVA 4F8PA 4NXKA 3ULVH 3OV6A 4CMMA 4UF7C 1IGML 1URLA 1IGTB 3B2VL 3BGAA 5JHMA 1TEYA 4EOWL 4LCWE 3VRJA 3T2LA 4JW3A 2X4UA 3IN0A 3UO1H 1IFGA 2NUPB 3U1SL 2EZ0C 1DR9A 1GJUA 5DHDA 3TEZA 2HFFB 1VSCA 4ZPVA 5HJDA 2EE3A 4G11A 4PRPB 2CIIA 2CO7A 2IANA 5JXAL 2ZTBA 2HJFA 4HQQL 2X70B 2Y7QB 1OWRM 5KAQF 5TK2A 4RFNC 2HX7A 2BSSA 4WW2F 2V2TA 2WQVA 4BE6A 1ED3B 1YN7A 2JJWA 4ONGL 3MBXH 3RPKA 3CQFA 2ZCHL 5KSAD 4X4MA 3FONB 4F15B 5D7IB 5FWQA 2VWEC 4MXVF 3G9VA 2IH3A 3OG4B 3A6OA 2OXHB 4WW2C 5B38G 1EHLH 5EU4B 4FXTA 4PYGA 4LNRA 2X4TA 4RMBA 5D1QE 3MXVH 4LLYA 3D0AA 3NIFF 3BPNB 1XH0A 3L6FB 3MLVH 5JA8B 3MREB 2EVFA 3QNZA 4YHZH 2VSKB 4LHQB 4Q56A 3D3VA 3DETC 1XB3A 1ORSA 1AKPA 4NENB 5LGYA 1JTTA 3T3PF 3FPXA 3BC9A 1IAII 4WHYG 4N0UA 1PIFA 2OTWA 4RRPM 3BI9X 1WBYB 1A1NA 2Z3FA 5J1AB 2K70A 3UADA 3C5ZC 3WL9B 1GZHC 5LWYH 4N2AA 3K81A 1YPZF 2NNXA 3PU7A 3F7VB 4OGYH 4U2ZA 3S8WA 3FQTA 3B3IB 1T4KA 3AJ7A 1E28A 1M42A 4YUEL 4YSRA 2HRGA 4MA3A 5EU7C 4I0PC 2AGJL 2ZKWA 4HV8B 1P4IL 3CFEB 4FC3E 4H7VA 4LDEB 4LSPL 5C0GB 1XX9C 3D06A 4LHUA 2F5AL 2QHRH 4YX2H 4XPAL 2XRAL 3FO9A 3TS8A 3CLEL 4H88L 4ZOEA 2PPAA 5CMAA 5EBWA 4IIZA 4OD3L 2RBLA 1J0JA 3EFDL 4I5BA 4QXWA 1JK8A 1O9WA 1C08B 1I7ZB 1XGPB 3BUIA 3N3EA 4JZNB 5C3IA 3ULVF 4I48A 1LQSR 3GSRA 1AGBB 4KDVA 4QRRA 4XPTH 3JTBA 3KPNB 3QEGL 4PRNB 3NIFB 1FL6A 1A4AA 1YN6A 4IHOA 3I3EA 1JPGA 4XNYH 4O02H 5DS8A 1ACZA 3GQFA 1NOFA 2WQUA 4LOEA 5CN2A 1LE5B 4HIEB 1G7JB 3ATAA 4KK6D 4M1DH 2D7NA 3DTUB 2NNFA 5DRZB 1QR4A 5DC4B 4AYMC 4LPUA 4P46D 3X2QB 2NY2D 3ZDYF 5CF3A 5IHBA 5I1IH 2QMJA 3SOTA 3X14B 3MNWB 5C07E 3HG1E 3RWFA 1I8LA 1Z9LA 3C6EA 4OV5A 4UMSA 2R0WL 3IXAB 4H20H 1CTNA 1GGTA 1DVZA 3U4BL 2Y4SA 3U82B 1WC7A 4TVSa 4Q89A 3KPRD 5E5MA 1DLFH 4P49A 1Z0NA 2K7QA 3FSOA 4ZMAT 3MR9B 4OD2A 5AALA 1QNIA 3F04A 5HYQA 3KXFD 1DQLL 2NXZD 1NGZB 4G5AA 4MCMA 1E8ZA 2BINA 1G7LA 4C83A 4PJ7B 3JV4A 1BQUA 3QJHB 5EO1B 3VYOA 5GSRA 1PKQA 4QOKA 4LOFA 5K1VA 3L9EA 4OIAA 5D1XE 1ADQA 5LO7A 2PKDA 1B2WH 3GM8A 1Z5LA 4Y9BA 1AY1L 1WV7T 2PUQT 5LBVA 3K0WA 5ITBL 2HMIC 3I75A 3D05A 3N43F 3GBEA 3U25A 4I4WB 3ZSSA 1DBAL 5B8CA 3WTXA 3T1FB 2H0JA 3ZDZB 4GAAA 4XWOD 5DJ0A 1WFIA 2Z8VC 2X88A 3RUGF 1YC7A 3SODB 2VDOL 5JPNC 5I1LA 3DVNB 5C0BD 4CU6A 3ARXA 1SN2A 3HG1A 4WSJA 4P4KC 4R26L 2COVD 1CXLA 4G8GB 4A55A 4LSSL 3QQ4B 4J1UA 4KX7A 4HKJB 1ESOA 3A23A 4OKDA 2IXQA 1G1YA 2D7QA 2F18A 2OMTB 1QUPA 5FYLD 3SYCA 4KUZL 3WO4B 3K5SA 1TEGA 1UQSA 1LNUB 5GGVL 5F3HB 1GGBL 3FRPA 4JRLA 2A83A 3DX6A 3LXAA 4MQTB 5I1AB 1OD9A 1G9ML 4FQQA 5EH1A 1OO2A 3P11H 4KK8C 4KH2A 5AWNH 1N64H 4Z7NB 4YSTA 3BE1L 5C0AE 1WFNA 2P1YA 3SE9H 4NJ9H 4LKXA 1FF5A 1CU4L 4AZ8B 4MMZB 4H1LB 1G94A 4ISVA 3L08A 2XACC 1N6QH 3QPQD 4QF1B 4JGNA 4JDEB 3VI3B 4LOVA 2CGZA 3DHPA 3BKML 3QIWA 1IQWH 1FVDA 2DTMH 4G1MB 4K8RC 3LEVL 2VERA 4Y7MA 3GSUB 1RAMA 1A4KA 5CIPH 1WO2A 3RKDC 4XBEL 1A6VH 3GM0A 4PG9A 4XMPH 4DN4H 1DCEA 3J27A 3ZMNA 1CDBA 4LLQA 4ZYKA 2A4ZA 5L9DL 4Q9QH 2AQQA 2GK0B 3K71B 2KT6A 5EB9A 5JDSB 3LMJH 1IKOP 4P2OA 3VXNA 1PW3A 3MBXL 4RRPA 3MRPA 4Z77A 2ZOUA 3IMBA 4ODHL 3PJLA 3E6HB 2WLIB 2LQRA 4JDZB 4NQCA 3T3PE 2VJXA 5EF1A 2Y2WA 1SY6L 2CCWA 1ZLWH 1NGXA 3GRWL 1Z9NA 1E65A 2FR4B 1LE9B 5KVEE 1PG7X 1COBA 1TQVA 5C0JB 5FDWB 3TA3A 4EN2A 4WLCA 1JPST 5BOZG 1J8HE 1V54B 1I7RA 1KFGA 1MQKL 1YYLL 3CH1A 4HC1L 3GMOB 5CJXA 1TJGH 1DDHA 3FQWA 5LQBH 2X2UA 4N5UA 2DL9A 3KYOA 2CO6B 1UH2A 1CWVA 1KYUA 5IVZB 2Z4TA 3MFGB 4UWQB 4Y4FB 3SN6N 3T2QA 4OZIF 3VW3L 3L5WA 2OMVA 3GMLB 4HFUL 2C1OB 4HETA 1ZWIB 2J88H 1AACA 4UDTB 4I13B 1E6OH 1GYCA 2IPTL 4XBGA 1QNZH 2WCGA 2V9TA 1W0YT 3IGAA 3QFJB 4HHAB 5M95B 2HN7A 1ZD6A 3B7RL 1JRHL 4UQAA 5DK2B 4LQ1A 2JIXB 3HRZC 3VFUA 4G1EA 2A73A 3A24A 4XO3A 5D96B 2C9VA 2GFBA 4U7MA 5E51A 4LSRH 4WWKD 3A4EA 4Q6YA 5FECB 1SVBA 2QR0A 3OJVC 5D5MB 3EGDA 1J12A 2VLJD 4BK5C 2V4LA 4JG5A 3DGGB 3ETSA 4MD4B 4G42B 1HH6A 4JPVL 5C92A 4Z8FH 3UZEC 2J1WA 4YE4L 4YSDA 4QMEA 4Y5VB 2YKLL 5FW6A 5MENA 4Y19E 3MVSA 2H6PA 1Z5YD 2W9DL 3F64A 4Y5XB 4XP6L 3TX4A 3KLSA 4JN1L 2DQTL 2CKBL 4GP4B 4Q9BA 2K4AA 1EH9A 3FOLA 3BGFC 3D7PA 3ZBMA 3QCUL 4U0RB 2F7PA 3MAWA 2P42B 1FL5A 3ILEA 4HD9A 3RI5F 5T1LB 4YS4A 7FABL 2EYRA 2VM4A 1E8YA 1OCOB 4HMCA 4PREB 3VDBA 1N5AB 1N8OE 3JBG7 1PEZA 3CSGA 4UOZA 4JR9H 3SBPA 5I66A 2DQUH 5ENWA 3F83A 4LASL 3TV3H 5D2LA 3T6VA 3EKCA 2P28B 1FL3A 3IPEA 5I8CB 4O02L 4J2QA 3TCLB 4KROC 4ONOA 5BXFB 2KZKA 4YBLC 4BJLA 4JFXB 1X5MA 1YMHB 1I4FA 1DBBH 1NPJA 1UM4L 2L04A 1HEJC 1ROCA 4G70B 2BOCB 3L3OA 4FNRA 3U6XA 4C56D 1OPGH 3VXRA 1NL0H 1ZVSA 5LG6A 4AVHA 3X3FH 4ZAKB 1Q9OB 3K6SB 3V6BR 5DXWA 1ID2A 1KTBA 3V0GA 4YDJB 2X2IA 2HKAA 1F86A 2Z31A 4P5RA 2ODIA 4N26A 4OI9A 2G60H 3WFHA 3CLEH 3EH1A 3HRPA 4IM8A 3A6BH 2NLJA 1C5CL 5F7NC 5TE7L 3ZE1E 2JKLA 2F54A 2H3KA 4K94H 5D7IE 4EI5D 3BEWB 5EF3A 1EDHA 2AXFB 2VZVA 5DUBB 4KTDH 5KVDE 3H42H 2JKJA 3TZVD 5ABDE 5DRWB 1SBSH 2P46B 2WXIA 2ZSWB 1HQ4A 4ZUTA 4KZ0A 3HS8A 1G1CA 4KI1A 2AW2A 2YBRB 4ZX4A 3MLSL 1M3JA 3QJZA 1LDPL 4HCGA 3DVFA 3H53A 3LHPH 5GS0H 3M17B 3SZKC 4WGVB 2CLRB 1LO2L 3BVWA 4DKTA 4K7PH 5CN3A 3UG3A 1WDAA 3WJMA 4ZTPH 1K5NA 4HGWA 4ORGB 2BHYA 3MLVL 1U8HA 4JKLA 1UCTA 4IKKA 3I2CL 2RAMA 1OTSC 4KQ4L 1DVUA 1EERB 2C8NA 1AZCA 1TJIL 3L1GA 3VDCA 4JGUA 3TVMC 2YQ3A 3HLAB 3V0IA 3GSXB 4G9DB 3B37A 4W9EC 4YLQT 3FC8A 5LCVA 3PQYD 1T03L 2ZAHA 2OSWA 5IESL 4MNQB 1YEJH 4G7YH 1T5XB 4XP5L 4PJGB 1JN6A 3BKCL 5IVXB 1CLZL 3UC0H 2B1HH 3U1SH 1M1XA 2ROXA 5EIIB 3S4SA 3GGWA 2NW3A 2OYMA 5CHNB 1L9MA 4KXZI 3ZDWA 1J18A 1GC1L 1CFVH 1HCFX 1BX2B 1ZGLM 5DI8B 5HGBB 1Q9WB 3LRHA 5LBSL 3VQLA 1A6TB 4E2OA 1D9KB 3NSXA 5D1ZA 2EDYA 3HPLB 4BRVA 4X5WA 5IJBC 1NCCL 3O45B 4X7TA 1ZMYA 3GZPA 5KS9E 2H0EA 2Q8BH 2A6KB 1AGDA 2Q86A 2QSQA 4JHBA 4PTTB 4EI5A 2Z7YA 1ECZA 1PFOA 5F9JB 2DJMA 3I9IA 1FGNL 2GC7C 2X6CA 5AUMB 2CJ3A 2E74C 1EJOL 2GAZA 4AVJA 5TE6H 4N8PA 4YGVB 3FQ2A 5CEZH 1WUNT 1BD2A 2FIRT 2A9NH 3D2UD 4MAYB 3B9EA 4IRZL 4BWTA 1N12A 3VD0A 4P2CG 4D7PA 4HCFA 1NZRA 1NDTA 1U3HC 2WBWB 3TVMB 3MJ8A 3ZR6A 2ZYSA 3T71A 3HAEA 5LXGH 4OFVA 3Q06A 1DL7L 2NT1A 1J0KA 5LGJA 1IGCL 1KIRB 2AANA 1JFHA 3BXNA 2IAMD 1QYGH 1Y7VA 2X4NA 4GAFB 3DSNB 4OLUL 1UB5B 2UXVA 4ZUUB 1U30A 2NSMA 1MI5E 1MWAB 2NY7L 1IL1A 2QADB 1E4XH 4OF6A 4XN5A 2R1XA 4JB9H 4LEBA 1GPOH 4AK2A 3QS2A 2DQTH 1Z2KA 3WKPA 2EH7L 2IDFA 2NY0D 4HZLA 2HFGH 3LX9A 4B5EA 4BZ1H 3VI4E 4FKEA 1U8KA 5E2VL 3WUWG 5JLZA 3MRJB 3OLDA 3GS0A 4NRXB 4JVUA 4QXTA 4DP0X 4DGYL 5KS9A 4L5FL 1HKLL 4WV1C 4JPVH 1LO0L 2C34A 3TN0C 2FWLB 2Q87A 1AG0A 2BSRB 2EIZB 2VQTA 4Z6AT 3LQAC 4TOYL 3L3GA 3ZE0F 4W4OA 1GYUA 2ZG1A 4HUNB 2GSIB 1YDPB 3DRTB 4K7PX 4M5YL 3QPXL 3ZZ1A 2VIRB 2XTLA 2OYLA 1G0XA 5JW4M 1NBYB 3EGXB 5I75C 2JF1A 5ICXA 5C08D 5C0AA 5KTEH 3CXHJ 4OFPA 3B9KB 1W0VB 2RFXA 4AQAA 3MRIA 1MAJA 1NBCA 4OM0L 3SE3C 4LP5A 2VL5B 4JY4A 4P23D 2L7UA 1JWSB 2RQEA 2NY5C 5JNYA 4MAYD 3WIFA 1BJ8A 1UD8A 2X4OA 4MVBD 1E6JL 1ZLVH 3BISA 4JE0A 3ETTA 4UANA 1JVOA 1HZHH 2MMXA 3E9UA 2EDRA 5BS0E 3DLQR 1H9DA 1HKFA 2EXYD 3Q2VA 2V17H 1IM9B 2HVJB 5SWSE 2W60A 2B4CH 3AU0A 3AW5A 3G6JA 4HUXB 1Q1JL 5BVPH 2YEZA 4EF3A 4Z0BL 4OZ4B 3N42F 3TFBA 1VERA 1S9KC 3BZ4A 4D9LL 1N7ML 4WU5A 1ZIAA 3FO2B 5D7KE 2WQWA 3D07A 2VUYA 4CSZA 2NY0B 2F1EA 2NY1B 3NBNA 4V1DE 2I7SA 2OMUA 2GPZA 3QUXC 4NUJA 5IQMA 2PR4H 3I2CH 1CFBA 4JFOA 3ESMA 4HC1A 3T0VA 4LCUA 1DQDL 4DN4L 1JDDA 2JTYA 5B39B 3EGSA 5GZOA 3LZLA 3HOGA 2EVIA 1RK0A 4K7PY 4ONHA 4QRTA 2Y36H 3BW9B 4KTEL 5CJOH 4Y5VC 1AD9A 1KXVA 1TJHH 2NY5L 3GUFA 3QZOA 4RGNB 5I6LA 5D4HA 4WI3A 4QHNA 3KLLA 2YPVA 1NCAL 4QRQB 4F92B 3IRCA 2E6QA 3G5YB 3T77A 2EEAA 3L4YA 6PAZA 4E0RA 3BP5B 4KVPA 1NCGA 3HE7B 2O61B 1I9IH 3UPRB 1A6UL 4FQXB 3GHPA 5CINL 5SX5H 3G5VB 3RURA 3OF6A 3SPCA 4M6ML 1KPUB 3R06A 3RVVC 1A7NL 5J11C 1EMTH 1HWGB 4DQOL 3E6FB 3JTSB 4RIRB 1L0YA 1IAOB 3FBQA 5HHNB 3MJ7B 2NY2C 4FQ2H 2OMZB 3QQXA 1S9WA 2NY3C 3ARGD 4GUCA 3MUGA 4KI5D 4NO0A 4PJBF 5KYXB 3SKMA 4B3VA 1MFAL 2ZWNA 2DH3A 2LAAA 1II4E 2HP4A 1RZJC 3L7EB 2IH1A 4WUUE 3U7WH 1MCJA 2C1PB 1FNEB 4Y88A 3ZL2A 4ERSH 2VXUL 1ZHLB 5FKPB 3OX8A 2IMMA 1YEDB 5AOZA 1L6XA 5D4QA 3VQ2C 1OPGL 1MCQA 2WKOF 4M4RA 2D31A 5GHWH 3SBWC 5E4IA 4JZOA 5CD3B 5K5YA 1XF2B 1BFVL 1YNTA 2J4WH 1EWHA 1HESA 5CUSH 2WLYA 4Y2OA 1XAKA 4LL4A 4BFJA 3ATDA 4NAQA 4IRZH 5CIPA 4BZYA 5ACMA 4E9RA 5E6SB 2AEIT 3O3BA 1CFQB 1KB5A 5J12B 1BJ1J 5INDA 1A7PL 2A6DB 4X4XB 4Y4HB 3RVTC 1AFVL 2XG5A 3N91A 4DPBX 4FJZA 5DDHA 4N8CL 3SY6A 5L4IA 5JXEC 4UV7H 3TH4T 4D0CA 2P48B 3QAZB 3S5ZA 3PF2A 3K4DA 1N6VA 1T83A 2GJZA 3E1ZA 1AC0A 4XMKL 3UBFA 1P4BH 2BP8B 3QDJA 3ROLA 1JWUB 3HVNA 4KQ0A 2VDLH 2NSQA 3KWVA 2VT0A 2X9WA 5SX5K 4KOCA 1Z9MA 3QJTB 4WGKA 5IMKA 3WEBA 2YPLD 2Z1PA 3SD2A 3S35X 4Z76A 2X05A 5IJVA 4GMSH 3IDIA 4GMTL 3U7AA 4PUBH 2AJYL 4G7VH 3JVFC 5KJRH 2CBMA 1QX1A 2Z0BA 4R84A 5SX4H 3EOTL 4Q7DA 3X12A 4ZFOB 1U8MB 1ECYA 4K9JA 3ARGB 4OKVA 4I0PA 2A99A 2HT3C 2GBAA 4D0BA 3GINA 1H6TA 3D3VE 3LZOA 1R3KB 3NABH 2DKUA 3MCLH 5J6SA 3EOYG 3O6FA 4ZTPL 3MOBH 3UCRA 4HWBH 3UAJD 4JPWL 3OKKB 2EH8L 4PD4J 1ZHKB 2IFFL 4XNQA 4BRJA 1H3PL 2Z93A 4D7BA 4F7PB 5HI5D 2D31B 3N2JA 4I87A 2V8LA 3BKJL 4OSUH 5IEKB 3PGCA 2CCLA 4ALAC 2ZNWA 2E75C 5J8OA 2W65A 2OJ1A 4D3CL 3MLWL 3LRSB 4N0CC 1GW6A 3DUSA 3NH7H 2ZUSA 1T0NB 3FBKA 1ZDQA 2OV0A 2JI3A 3FQRB 1FH5H 4TSAL 2WWMC 2W0LA 3TNNB 2EVJA 3UYPA 3BHBB 3WS3B 5DEFA 2VDKL 2YD5A 1NTDA 4NWTL 3US1A 4K23L 5ID1B 2FGWL 3RNQA 3DUHA 1SJHA 5IB5A 5HPOA 3E6FA 4AEFA 5TE7H 2YS4A 5KN5B 4L37A 1T2QL 1NOAA 3EZJB 2C9RA 2OULB 4YHML 2FL5B 3WD5L 2KLSA 4DCQB 5I1KH 2IBGA 3EJPA 1EDYA 4AE1A 1KTDA 2C3WA 4NIYE 4OQTA 1G9NL 5DQJB 4DERA 3MSPA 4XNBA 1EIBA 2WZ6A 4LCCA 4WWID 2ICCA 2MIZA 4DPCX 4I1NB 3DX1A 1ZLWK 3AGVA 3WIHH 2VCOA 4M1CD 1XF3A 2BC4B 3CXFA 3OSKA 4AUYA 3HUJF 3ZTCC 2NX5D 1MY7A 1E9QB 2QQQA 4LVHB 4MJ4A 4PPTA 3VDAA 4KZEH 1U8PA 5B39A 5BV7C 3FN0H 1KCLA 4JFOB 2CA4A 3C6LC 4L3CA 5FYKU 2OMUB 3ATEA 2Y06L 4LLDA 4XCYB 3I9AA 3LXUX 2YWYA 4C58B 2BVQA 3H7BB 3BT2H 4HISA 3I6KB 4HJGB 1G6VK 3WU1A 5DJXA 3H2PA 1P7QB 2DMCA 4HGKC 4PN6A 4HJ0C 1XZWA 3Q01A 4WVRA 4OBSA 4LLWB 3ZVVA 2JH2A 3RP1A 2M2DA 3TT3L 2NOYA 1FRGL 4P5TB 4XVTL 2GITA 4RETB 5JQ6H 2QPEB 1WH0A 4RQQA 2FBOJ 2IGFH 3PWPD 3VXOA 4JN1H 3MLYH 1HHKB 1R17A 5DQDL 1MCRA 2JJSA 1GGIL 3ESNA 3FB7A 3MRMB 4R7DA 1JK9A 4JDTH 1E43A 4KKNA 1JWSA 4HJSA 4YVUA 2F68X 3CK0H 3ZTNH 1SEBB 3MYZA 4ZMOA 5GGRA 1J7VR 4U7SA 1M7UA 2ZCLH 4PP2B 1GOGA 3LY6A 2PR9A 4HWEL 1NBYA 3KM1A 4F9LA 3GUTB 4A38A 5EOQH 1KY7A 2YGNA 2A6IB 1VEMA 4Z78B 2P8LA 4G6AD 3DV4B 3KGSA 5IHHA 3RG1C 4G8IB 2C7UA 4G6KL 3T4AC 2X6UA 1D6EB 2OPCA 5E1HB 3S5LG 3OKDA 2K0RA 3TBYA 2WTRB 4BQ6A 4PJAB 1A4CA 1OP3K 1JWMB 5K69A 3Q2NA 2O5YH 2YUZA 1DTUA 3LDBC 3PNRB 5FO9B 4XMUA 5ESVA 2Z8SA 5M94B 5LHDA 5EORL 3C5JA 2VTFA 4N24A 2EO9A 1AJ7H 2DWEB 3BDYH 2ESVB 5DHMC 2QVIA 1TZAA 2PO6D 2I24N 2DYPA 3BEVA 4K9EC 1DFBH 1KPVA 1DLFL 5FM5M 2VLKD 4M7JH 4IOIA 4FABL 1W80A 2F15A 3IKCB 3BSGA 4I1PA 3IEAA 4G83A 4JPQA 2VO5A 3VQMA 4XP9H 4M61B 4PS3A 2ZXBA 3ZRCC 2PYFA 1NUFA 1WZ1H 3HAEB 5J3HD 1UYWL 3RL1A 5FYJU 5JORA 1W0WA 4X6FB 4JRYD 5LVEA 2ZKMX 5I1IL 1FBIL 2CBPA 4LBEA 1LP9B 5KYYA 3CFJB 1A7RL 4P5MA 2DTSA 1FP5A 4M29A 4S10A 4XVJH 4DW2H 3VTAA 3SQOL 4DFIA 3ZX1A 4OF3A 4PMFA 4XWOC 1ACYL 2CHNA 5HDQH 3QEHB 4OLVH 1JPTL 3KDPB 4QRPA 4FG0A 3EYOA 2Y7OA 5EG6C 1UJTA 2PTUA 3DRQA 3MRRA 3N04A 4LDLB 3L9YA 4P99A 4TLSA 4EEEA 2B2XH 4CADB 5J13B 1QBAA 5HI5C 2IV8A 4NYLA 3P0VL 1CZ8L 1E5UI 3EFOA 2A38A 3BGMB 3UERA 2B4CC 2GEQA 2R27A 3NEOA 5H37H 4FA7B 4RSYA 1S7TA 2UY6B 3FMGH 1GGCH 4X6CA 3TO4D 3EBHA 1IC0A 2HKFH 5IMLA 2MWCA 1UWGL 3GSXA 4G9DA 3HLAA 3WTTA 3NAAH 1DBKL 3G08B 1EXUA 1ND0A 4DAGL 1S8DA 2WKGA 2LU3A 4UQ3B 3WHXA 1P5UA 2ETWA 4PWEA 3QJOA 1OTSD 1YEEH 3CVIL 3I02B 3VSTA 2VN6A 3KGRA 2E9BA 5AEAA 5LWYL 2HT4D 3GKWL 3EXLA 1K5NB 4HGWB 3ARFD 5HD8D 4GRWB 3W39A 4YFLI 1EDQA 1P1VA 4U49A 1RPKA 2JTDA 3U0WH 2N7SA 4FNQA 1NCBH 1A6PA 5D7SH 2FT6A 2WN3A 4FXKA 4HWBL 4WF7A 2OFQA 4P4KA 2NY4B 4DKEH 2YBRA 1CTMA 1U2HA 2NQ3A 2WXQA 3U1QA 2OCCB 5DURD 3POCA 5CO1A 2BRQA 2BY3A 3Q6GH 4JRWA 5CEYB 3DMMD 3L4ZA 4TN9A 4AIEA 2ZSWA 2BHZA 4ZUTB 5JIQA 4O2CA 5SWZB 4DOHB 2FATH 4N8UA 4DEWA 2VNCA 1Q38A 4TL4A 1BVZA 3UGUA 5I24A 1YYMH 5JHDD 2DZEA 5I71C 2EDNA 3APCA 3QG6A 4HQQH 3VFMA 2NLJB 4WUUB 4PUBL 5A2KH 4HIQA 5CZKA 1HXMB 5I9QC 5IOPA 4POZC 2Z31B 5DD3H 1IAIM 1SFDA 1HVXA 5HGDA 5IW3A 4P5KA 5GSVB 4RFEA 5DFVC 3W11C 4G6KH 5HBBA 3D4ZA 3OGCB 2VISB 3IU3A 4ODBD 3RVUC 1ZVSB 2WBJA 5AW9B 3V0HA 2B15A 1IGYA 3DYPA 4YZFE 4WO4B 4NRYA 1JVLA 4WTXA 4Z7WB 4N8CH 2DWXA 4HALA 1Z32X 1NKRA 5ICZA 1RJLA 1NFDE 1FL3B 4ENZA 4GG8A 4WW2A 1NFIB 2M1KA 1AMYA 4APXA 2K3HA 1CYWA 1W8EA 2J6EA 1IV8A 1Q94B 1PEWA 2HSIA 3VRLE 5EU3B 4XZUA 5BPPA 1X9QA 1R33A 4KZEL 1BVKB 2ZE0A 3BN3B 1R0AL 4AEEA 5DQDH 2G30A 1LL1A 2WK2A 3C9NB 4XOBA 4JBSA 5D7LB 1QOKA 5C0CB 2COQA 2NY6B 4GH7B 4W9ZA 3V0VA 4LCVA 3T3ME 2BHUA 4ALAL 1FL5B 4M5TA 3JWNE 1BVNT 4LL9A 2VLRB 1H8NA 1MG3C 2QDWA 4LLUA 4YNYA 5FHBH 4XN1A 3O41B 4XRCA 4S1RH 5CBEB 3LS4H 4WI0A 3WD5H 2H6PB 3BPCA 3BYTA 3LRMA 2JI2A 2WBJD 3Q8FA 2BIIA 3ATFA 4KFZC 5F9OH 3R1GH 4XAWL 2IDSA 4IW4C 2ZX6A 5ICYB 1FC2D 4UOW1 3HAEG 3WGVB 3T0EB 3O6FD 2X4PB 5GZNC 3V6ZA 3FN0L 4TSAH 4I3SH 4XMVA 5DC2A 2EIJB 3F3HA 3B83A 2GSGA 1G9NC 3QISA 2BOLA 4BFNA 1CDCA 2WXLA 5MEPB 1VKXB 1GHFL 1KV3A 2IOMA 3MBWB 2HN7B 4IU2A 5MHSE 4AYFB 4LCIH 3A21A 1RPUA 3WIHL 2EO1A 2N0KA 5JW4N 4WO4D 1H3PH 2DEXX 3WEOA 5L8KB 3GJFK 3LPWA 3PWVB 4HJ0D 4OZFA 2J6EH 4Y4FA 5E03A 4MMXA 4JQVA 1SYVB 2XWBA 4YHMH 4PP1D 5HYJA 4MWFB 3GSOB 5AVQB 4ATTA 2J55A 5CZXC 4K3GA 1NBQA 4IMKC 4M56A 2DV6A 2WW8A 3CVDA 5DVLA 5T1KA 3MRGA 2YGPA 1FFQA 2ERJC 1XSIA 3CJJA 5CEXA 2R59A 4JPSA 2MQ3A 4TS6A 1TVDA 4X7SH 3S88H 2VN7A 3M1BA 2NR6C 5JIPA 2DRUA 1A3ZA 3QCTL 5FDWA 2EXWD 4MS8C 3ESVF 3N41F 2A9ML 4GP8B 4KO6A 1TITA 1OGTA 5F6HJ 1S5HA 2C7FA 4GMSL 4JFHD 5FUCC 4A63A 5IW6B 5MEQA 4H26B 3EYUH 4Z77B 2YA2A 1SHMA 2V3DA 2ADFL 4PJ5A 4CN1A 5DZJA 1KGIA 3CQPA 3LB6D 5DWUL 3QIBB 1MHCA 3VFPB 1BM3H 5F7MC 7TAAA 2OMXA 4EKJA 3CSYA 4PG9B 3FT3A 3QORA 3ULVC 2WZPD 2BY2A 4KK5C 1E9OA 4QRUA 3GSUA 3Q13A 2OX5B 1GZPB 5ANMA 2H0PA 4WNJA 3O2DA 2WZAA 4JDEA 1J5IA 1SJEB 5DA4A 4HKZB 4MCNA 4MJ5A 1I8KA 4LLVA 4FJ6A 4ISVB 1KOAA 3BSHA 4EI6B 3HKFA 5ACZA 3W81A 4P2QE 4XMWA 1XF5A 3ZHFA 1TSRA 2MCPL 1EVUA 4Y4KC 2VKWA 4ZTOH 4CVXB 2DIBA 3L9RA 5ANHA 2A0LC 5GS1C 1A6ZA 2XVBA 3ARDD 1WIUA 1P9MC 4F91B 4IRSC 1KB9J 5D1XB 4LCCC 4XN7A 4FQQB 5GS0D 3A0OA 2X89A 1AGCA 4XH2B 4FHBD 3Q43A 3SIKA 4I7ZC 1DZ0A 5H2BA 4LU5H 1OLLA 1JPFA 3AGWA 1OTTC 2CBOA 5FGRA 4EZKA 2GTWB 5BOJA 1WSST 3J8F7 1ES0B 1FDLL 3GB7B 3FAWA 4ZRGA 1KZQA 5DZNA 1CN4A 3BH8A 1XO8A 3QHFH 4MQSB 4NIKB 4R4BA 2XY2A 1U95A 2F54E 1N0LB 2CG9X 2Y1ZA 2FD6H 4OZGE 3CIAA 4OLUH 4MDRA 3O3DB 5I1LB 2ZAIA 5IY5B 2UWEA 1SZNA 1B9ZA 2XZAH 4JGMA 4LIQE 4UINL 4TNVK 3ZSTA 1LK2A 5HHOD 5TH2A 3MJGX 3W0WA 3DK2A 4NQEB 1KCSL 1PZDA 4G8GE 5ILTH 2PCPB 5B8CB 1LEIA 2BNRE 4O58L 4UCFA 5IHLB 5L7XH 2HH0H 4AMKL 4ANWA 4XHJC 4PJAE 3M6DA 1EFXB 1V10A 3I75B 2PCPA 4BGDA 5CEZL 4MA1B 3KBEA 3PREA 5D1ZC 2ZX5A 1C9SA 4HWZB 5DC9B 3W82A 1IARB 1LK2B 1MIML 2AXGB 2BPBA 2O5XH 1CI5A 1HAWA 1QO3A 2A77H 4AKQA 4NQCD 4AV5A 5BUPA 4UTCA 1M9SA 3F7PC 4TLTA 5EO1A 1K85A 2L7JA 2PP9A 3GI9H 1AQKL 2AJSL 4R4BB 3UH8A 5L4JA 4OGAC 3JVGA 3DURB 1SF3A 5LBSH 4MXQC 4I88A 1GZQB 4MD0B 1CF8H 1VF5C 1D7BA 3NZ8A 4CC4A 1R34A 2YQBA 4F2EA 5KYWB 2VXVL 3DSFH 1GZQA 3O6KL 2B1HL 5IHWA 5IGXL 3DURA 2NZ9C 4JLRB 1JAEA 3HNVH 4ZW5A 2CD0A 2H32H 1TQCB 4Z95H 3X14A 1R4XA 5KBKA 2FIKA 3X1EA 5JUEL 1X5XA 1OAUL 5CJOL 4JPIB 5ACZB 1JFQL 3HC4H 5I5JA 2UV3A 4EI6A 1FG2B 1I8KB 3H7LA 5DR5L 1EGJH 3SPJA 1JI2A 2DLFL 2EDHA 5HI3D 3V0FA 1LE5A 3HBPA 2DF3A 1B90A 4N2DA 5HHOB 1U3NA 1R6VA 3W2DL 4DVBA 5I15H 1TQUA 5JA9A 1YUHB 3MJ9H 4WGWB 5F96L 2NNCA 2VC2B 1TTAA 2F19H 4EZJA 3QIBA 1WG3A 4LEXH 2VZSA 2HJKB 3O6MH 5CCKH 5FR3A 2UWEB 2K6ZA 4B9FA 5LDUA 3QPQC 5CD5D 2AVGA 5DJCA 1F6LL 1HKLH 5F7UA 4DGYH 2J1KA 3H42L 1QLFB 4IBTA 2ICWA 1BBDL 4HBCH 4LHUB 2BS8A 4MX7B 4MA7H 4QCIB 1JPEA 5J6HB 5E2VH 3WTWA 1NCWH 2EIDA 4KI5F 2VN5A 3GB7A 4AJVA 5ITFA 4I9WD 1JNHB 1MXDA 4KVCH 5CWSB 5DUPL 3JWDC 5EC1A 1UT9A 2GQHA 1FZKA 2ZCZA 4JB9L 3RNKA 5DD6A 3B3IA 5ETUB 3A4DA 3KYKL 1UUSA 3ZE2F 2LU5A 1NA8A 3F7VA 4GI8A 5D1XA 2W0FB 5CLTA 3KPLA 3ULUH 2R0KL 1T89C 1THAA 3HW7A 1AYOA 2D0GA 4KKCC 2YOAA 4QUOA 2AERT 5D4JA 8PAZA 4F20A 4BYHA 4E9YA 1GGYA 1LO4H 5I74B 3U36A 1BF2A 4NENA 1ORSB 1UH4A 4MJ5B 3D3VB 4YHYB 3QNZB 5ANMB 4I3SL 3ZYIA 4NAJA 2OX5A 4GG6F 1VKXA 3K5RA 3OMZA 3DX7B 4W9KC 4HUUA 3BMWA 1EJOH 4LNRB 1X7QA 1IUZA 2AV7B 4DSYA 1ZV2A 1N0XL 1MPAL 5B1JA 1TZHA 5T3ZE 2Y3NA 3LCYA 2CJSA 1BAFH 2DEWX 2WB7A 5D72L 3BIAX 4CUCA 3T0EA 3MLPA 2G2RA 1IEHA 1ED3A 1YN7B 1NCUA 4L4JA 2MKWA 4EPSA 5J12C 2IDCA 2Y7QA 3ZHDA 5F1IA 3TT1H 2OMYA 3WLWD 2DWDA 3WIIL 3IFOB 5DHVH 2FEJA 5IR1A 3MRDA 1R3LB 5DD1H 1BQHG 3T2NH 2H2PD 2NUPA 1TMCB 4B50A 3ZKXB 2VH5L 1NEZG 4XRCB 1FN4A 3C5ZA 3EYUL 1AZUA 1J1PL 1A25A 3EYFB 1F3DH 4MSWB 4Q52A 1B3IA 4BFGA 3JYCA 3GBLA 4B27A 2N59A 3MI6A 3QFDA 5IESH 3MRGB 1ZHNA 1PZAA 2O5ZH 5A2JH 4KNSA 2JVUA 5TE6L 4AGOA 1CK0H 3GSOA 2WOBA 3C2AH 4MZRA 5EBMA 1XGTA 1T22A 3S96A 2AI0H 5IG7B 2MHAA 4OZFB 3X3GL 4E5XB 3WAKA 3ZDYE 3UEZA 1C5DB 5A2FA 1SDYA 1CLVA 4R7XA 3UTQA 1X5IA 2Q0ZX 1ITBB 1NFIA 2AS5M 2XNAA 1PQZA 2WXRA 1I8MB 4P46B 4YXKL 1RJLB 1LDSA 4X99B 4XNAA 1YY9D 4CKQA 2HMID 1CTOA 4HS3A 4CC0A 1V8HA 3NCJH 5E1GA 1KTCA 5MEPA 2VLRE 3H6JA 1HHGA 1VACA 1HNYA 1T6BX 1NBVH 3UACA 2Y07L 3PWJA 3DI2B 4OZHB 4JKPH 2YMXH 1SUHA 2HLEB 3BWAA 3PRZA 4RGNC 3ETBF 2VQ1B 3VFWA 4J39A 3W0WE 2AEPL 25C8H 4LQFH 5ICYA 3FL7A 4BZ2A 1YEJL 1IT9H 1HT6A 1K3IA 2BNRD 3DIDA 1FG9C 1QBMH 2BDNH 2YD1A 1WWAX 3JZYA 3VXRD 2CXKA 2I25N 3UOAB 3ZKMC 1GY2A 5I30L 4OZGA 1XGUB 3MLXH 4GEJA 5DYOB 4E41A 3CPLB 1ZEAL 3K1KC 1HSAB 5I1JH 1BLNB 4LLUB 3ZN6A 3LKNB 3N1GC 4X4ME 1BP3B 1SN0A 2Z64C 2AXJA 3ERXA 1JF6A 2Z6FA 4X0NA 2H6UA 5C0CA 4GKZB 1F6AB 1UG9A 1YPZE 5EZIH 5CP7B 3LD8B 2GIYA 5KVFH 3UMTA 2DQFA 4LCIL 4JFVA 3VH8G 1MRDH 3GPSA 1FC1A 1A6VL 2P43B 4XMPL 5DHXB 1WP6A 1ZTMA 3BUPA 1ACYH 3FUKA 4MNGA 4ODVH 2O6FA 3CFBB 4UQCA 3IJ8A 3MPCA 1K6QH 3H55A 1QTPA 1ICTA 1PG7W 4PLKC 4K2UL 1VFUA 1AXSA 1F1GA 1TFPA 2FB4L 3BFWA 5DS2A 1QR1B 3K80A 3LRKA 4YOKA 2GJ6B 3PQYB 1OTUC 1FO0H 3F65A 4Y8AA 3MLTA 1TG8A 4DN3H 2ZWKA 3MZTA 4X9HA 4N3UA 1NC2D 5B1BB 2OL3A 1I1AC 3MACH 4GW4A 2XFXA 3LS4L 5D9SB 3OGCA 3WMPA 4EUPG 1IBHA 3BUQA 3FQ1A 4WKZA 1L6ZA 5F7DB 5FHBL 1P7KB 2UY6A 3L8QA 4UZSA 4C55A 3VXMA 3IDNA 4DETA 1ODUA 1HDMA 4U6VL 5H4YA 4C59B 1D6VH 5B7MA 2WYIA 4FABH 1EEYA 1U92A 4IU3B 5EZLB 4JHAH 3QG6B 4U1LB 43CAB 4NYLB 3FCGA 3GYRA 3CVBA 4AYEC 4P07A 4PRDB 2ZXQA 1VENA 3DARA 3E8UH 4OAWB 5ADPL 3I9GH 3MRRB 4XVOA 1JZ5A 3ESOA 1OAYL 1OAXL 3NZSA 3EYOB 2OL3L 4QRPB 5DYFA 3SBWA 2KPNA 1JZJA 2X3CA 1FO0B 3AROA 3K2IA 3OMNB 4ANKA 3BQVA 3PFUA 4XE0A 3NVQA 3D18A 1QWUA 4J27A 5D7JB 4QLWA 2YPKB 3E7JA 3HZKA 1QSED 2CO3A 4LSRL 2WVSA 4PWIA 4XPBL 1UASA 3QEQB 1RU9H 2E9JA 2Y6SC 3CH8A 4LLAA 1M9WA 1WT5C 3KR3L 3O8XA 3PHAA 3LQAL 4OT1L 1VPOH 4D9QE 5CBAB 3GHEH 4P23A 5GXBB 5E8EB 5HVWA 3I50L 3H1ZA 5DFAA 1TETL 4GKSA 3U6RA 1E67A 2NMSA 3QUML 4P57A 2ALAA 3OR7A 3NT0A 5GGQL 3L3HA 1FCGA 4MTMA 3FO0L 3WGUB 1TTBA 2ZCLL 3P30L 4M7JL 1KXVC 5LUMA 1AY1H 1S8DB 2XPZA 3D9AL 4JM4H 5G4OA 5BV7H 1ZLUK 2YRPA 1J1XL 4DFHA 1T6VN 2LGNA 2W9EH 3FYEB 3JSSA 4FFYL 1U8LB 2YKLH 2X0UA 3FUJA 3V6OA 4APQC 3SGDH 1KPVB 1CVSC 2YO3A 3BEVB 1PDKA 3PDOA 1EFQA 1YMME 1IM3B 2X9XA 2GKIA 3CFUA 3SKNA 1S7TB 2EDEA 1CXHA 3F62A 3AB0B 2J2ZB 3WN5C 3V0WH 1F41A 3TO2A 5DSCA 5KANI 5C0RL 1YMMA 3MRHA 4D2NA 3ABMB 1JWMA 3CMOL 4OCXL 2CRMA 4FN0A 5FCSH 3QUMA 5TD4A 4TQEL 5CZXD 4GUOA 3K4ZA 1WBZB 3QXAA 4HS8H 1GRWA 3C09B 3FUDA 1LXMA 4D9QD 2VABB 4AC4A 3O4OC 2YHGA 5HGGS 4OJEH 1EO8H 2X1QA 5JHAA 3PP3K 2Z92A 3B9KD 5I8OH 2CMRH 5E1AB 5KG9A 4PMEA 3IRPX 4P5MB 2RH0A 4Q97A 2VLLB 3L16A 4YSUA 5HHVL 4P2QD 4N2LA 3EO9L 2EIMB 1ET7A 3F8UB 4Y19A 4KWUA 3KWUA 4DP2X 5JORB 3T4YA 5I9QB 1BM7A 1IZJA 1DN0B 1J8HB 2IGFL 4DK5A 4EIBA 5GRYA 2N7BA 2PYFB 1FBIH 2G75A 1CLOL 3FTZA 3GRWH 4K73A 4M61A 1M6OB 4XVTH 3S3SA 5CEZE 1DQIA 1SY6H 3EHBB 2J20A 6FABL 4RQQB 3D25B 3VXOB 2XC8A 4OCNC 1M7IB 4P5TA 4NS0A 2Z91B 4OVUA 1XCTB 4TUOB 3V7MA 1JBJA 4F5CA 2CPUA 4LLWA 5E6YA 5KVDH 3FQ4A 5HYFA 4HKXA 1P4IH 2X28A 3BT2L 4R4ND 3KCPB 4PI2A 5F7YC 5ESVB 2EUVA 1RZ8A 3CCHA 1WD9A 5DJDB 4NBZB 4PRAA 3LEVH 1IT9L 3KG5A 2CRZA 4QRBA 4UQ2A 4L3CB 1O6SA 5HHOE 3TBYB 1B0GB 1KBGL 4BFBD 4GQ9H 3OGOE 3N1FC 4G8IA 3BAYA 1ASQA 1QRNB 5FK9A 1VFBA 2X40A 4QOKD 1CU4H 3DV4A 1S7XB 2R29H 4WENB 4X9GA 3GS7A 4CC1A 3S34L 1NDMA 3NIGE 5K9OA 2XN2A 2K78A 2BC4A 3WCYA 5DZAA 2WV3A 1CXFA 3OHXC 4OR1A 3WYRA 2VDNL 2ZP8A 2EDFA 4HA1A 4FLQA 2XKNA 3HNSL 1X4YA 1SEBA 2EACA 4KROB 2X12A 3ROOB 1GGBH 4J3OC 4DPAX 1JK9B 2PLTA 3WN5B 1N4XL 4A37A 5KSBA 2W1NA 3KE0A 4L37B 4ZDHB 3FQYA 2ZOWA 4L1TA 5FUOL 5DMIH 3T9WA 1U8CA 1S7SA 4EI5C 4D94A 2JFCA 3IMSA 2XZCL 1V3LA 2K4WA 1V3KA 5KJRL 3ZTDC 2IBZX 4R9HA 3ARBA 2MCAA 3ECUA 2DQMA 5B3JE 2XTSA 1RD6A 2X7LB 2XXMB 4FTVD 1UKSA 2VW4A 4Z7NE 2FHFA 3D9AH 3EHBD 4A7TA 4N25A 3TNNA 2Z65C 4LT7A 4IBZA 4PW9A 1C8QA 1TVBA 4LZKA 3NA9H 2WLNA 3TGXA 4PJDA 2X2JA 4NZJA 4BQ9A 3TJHD 4ZXBA 4PBVC 5IQ7L 4D0DB 2NTFB 2H7WA 2XKSA 4KQ3H 4JG1L 5CCGE 5IEKA 1EGJA 2R15A 3MOBL 4F7PA 2EDQA 3H7BA 3AG1B 4XBMA 2P7TB 2ROYA 4OT1H 1DE4A 1SRDA 1YA5A 3PAYA 1QVOB 3CZKA 5J1SC 4PD4K 4PJ6A 5DHYA 3DTXA 3IJHA 4MDIA 4RRPG 3B7UX 1OW0A 1ZXQA 5D5MF