3FSAA

Pseudomonas aeruginosa azurin with mutated metal-binding loop sequence (caahaam); chemically reduced.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
122
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLEQYMFFCAAHAAMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Metal-binding loop length and not sequence dictates structure.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Metal binding protein
total genus 29
structure length 122
sequence length 125
ec nomenclature
pdb deposition date 2009-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fsaA00
2YAOA 1M56B 1WS7A 1GS6X 2I7OA 3NSCA 4HHWA 5I6MA 2YAPA 1MG2C 2QT6A 2I7SA 1SFDA 1X9RA 1ZPUA 2CJ3A 4E9XA 4BDVA 3V9CA 1PZCA 3GDCA 2YAFA 3NJNA 5B1BB 3WIAA 2GSMB 2W8CA 1XB3A 2CALA 2X88A 1ET8A 1E67A 4DP8X 1ASQA 1AQ8A 4KO5A 2X87A 2XV0A 1UATA 3WNJA 3JTBA 3NYKA 5B1AB 2BP0B 3GYRA 1BYOA 2E86A 2UX6A 2ZWNA 1V54B 3N55A 1OCRB 1AZUA 3AZUA 2H47C 4GYBA 2HRGA 3AG3B 1NDTA 4KO9A 4A2DA 1KCBA 1NZRA 1L9TA 3KW8A 2GC4C 3FSVA 3T9WA 2IWFA 3IN0A 2HX7A 4DP6X 1XB6A 2XUWA 4X4KA 5ANHA 1ILUA 2PPEA 4E9YA 3C75A 1CYXA 2DYSB 3AG2B 5A7EA 2R7EA 4YVUA 4F2FA 3FQ1A 3NT0A 2IDSA 2VW4A 3EHBB 1E30A 5I5MA 4HHGA 2BW5A 4W1TA 2FJSA 2HXAA 7PCYA 3T6VA 1PLCA 1BYPA 1JZFA 2PPDA 2QDVA 4AI7A 1NIAA 2YAHA 2YAQA 3FSZA 4NAJA 1BEXA 3T6WA 2A3TA 2EINB 3TASA 1SNRA 1NINA 2WO2B 1CC3A 4DP7X 1W8EA 4AKQA 1SJMA 2CUAA 2PP7A 1M57B 1L9PA 4FAAB 1GW0A 1AACA 1ET5A 1WS8A 3TBBA 2EIMB 4BWUA 3NP4A 1X9UA 4YSEA 1OCCB 3FPYA 1TU2A 2BWDA 4K9JA 2AZUA 4MFHA 2DWTA 1AR1B 4HCIA 1KDIA 2UX7A 1PZBA 2BHFA 5PAZA 4HCFA 1SHXA 3T6ZA 3WKPA 1HAWA 2FNWA 2BP8A 1DYZA 1ET7A 1NIEA 1MZZA 3UGEA 4E9RA 3QPKA 4E9VA 2IH9A 2DV6A 3IEAA 1QHQA 2FQEA 4YSSA 4PAZA 2YAMA 1ETJA 4ZK8A 5B7FA 2VMJA 3ABMB 2P80D 1AZBA 1L9SA 2BO0A 3FT0A 1E5ZA 1L9RA 4DP2X 3PAVA 1BXVA 3PAUA 2BWIA 4AZUA 2UXVA 4EF3A 1OE3A 1J9TA 2DYRB 1ID2A 1KDJA 1PCSA 2GBAA 3ABLB 3NJFA 1AIZA 1SDDB 3QJTB 4G7QB 4DP9X 2IWEA 1IC0A 1JZJA 2J56A 4TXVB 2VM3A 2WSDA 1URIA 3MBWB 4DPAX 2NRDA 1YLBB 2AANA 3OMNB 3H56A 2EIJB 3UADA 2PPAA 1HAUA 2I85A 2B3IA 2DY2A 4HIPA 2YQBA 1AZRA 3CVBA 4HCGA 4UAHA 3AW5A 3OQRA 1SF5A 1NWPA 2IDQA 5F7AA 5I28A 1ZDSA 1M9WA 3CDZB 4YL4A 1W6LA 4E9WA 1GR7A 3OM3B 1I53A 1EZLA 1WAEA 4YSTA 5I26A 1A8ZA 2YXWA 4KO7A 4GY4A 1JVLA 1XB8A 1IBZA 2BZ7A 4WKXA 3G5WA 3FU7B 2EILB 4M4RB 1J9QA 7PAZA 1PLAA 5I6LA 4F7KA 1HFUA 4QLWA 1AS7A 2VW7A 3NJLA 3CVDA 1ADWA 3WNIA 1N68A 3EH5B 2CAKA 4JHVA 3SQRA 4QKTA 5AKRA 6PCYA 2VSMB 3U25A 3AG4B 3NJMA 3FU8A 1EHKB 1MG3C 1PNCA 1PAZA 3PAZA 2LLNA 4E9QA 4BWWA 3X1EA 2XX1A 2OCCB 2IAAC 2AVFA 4AX3A 1J5CA 2ZONA 5I6KA 2DWSA 2XLLA 3D12B 2CCWA 3NSFA 3BQVA 5AZUA 3SBQA 1V55B 3QJRB 1IBYA 1E65A 2ZOOA 4A67A 5B1KA 4DPBX 1AANA 3NJGA 1QNIA 1IKOP 1TEGA 2XYBA 3JT2A 3TBCA 3CZUB 1NICA 1NIFA 3ASNB 2OJ1A 3FQYA 4BDVB 2IDFA 1A4BA 1JZIA 1L9OA 3OMAB 3QQXA 4NB7A 3UAEA 1ZDQA 2GHZA 2QPDB 3PPSA 1AAJA 2HX8A 3X1GA 3SBPA 4A2FA 4RH4A 5FC9A 4G7SB 5B1JC 4DP5X 3PLYA 3X2QB 4BXVA 1TKWA 3MX0B 1BXUA 6PAZA 2BP0A 3DIVA 3FU9A 1AS8A 2IDUA 3FSWA 2OV0A 2ZXWB 1E5YA 1KV7A 4GP8B 2B08A 3ZX1A 3IBOA 1NIBA 4WTQA 4BWTA 3ZBMA 2N0MA 1J9RA 1R1CA 1KGYE 2UXTA 3GXUB 2XVBA 3PCYA 3H4FA 4AKPA 1PNDA 1PLBA 3AY2A 1NPJA 1CYWA 1GY1A 3ABGA 5IY5B 1MDAA 2W88A 2XV3A 2XXGA 3H4HA 5F7BA 2XXFA 2FQGA 4N8UA 2PLTA 3KW7A 3CVCA 4W9ZA 2R7EB 3BVDB 2FQDA 4G70B 1JZHA 1NPNA 1SF3A 1GSKA 1TEFA 1WA0X 2PCFA 4KNUA 3S3BB 3FSAA 1NIDA 5I5IA 3PXLA 1JOIA 1BQ5A 2EIKB 4A2EA 4DP4X 3NP3A 2VM4A 3WKQA 1AS6A 2Y1AA 4F2EA 5AFAA 4Q8BA 2TSAA 2UXGA 3S3DB 3EF4A 3NJKA 3FS9A 3EH4B 3N2JA 3HB3B 1ZIAA 1N70A 4JKNA 1JXDA 1JZEA 1NWOA 4BK5C 3DKHA 1NTDA 4UF7C 3TU6A 1BXAA 1JXGA 1OE2A 2AFNA 1JERA 4N4YB 3ZDWA 1ILSA 3FYIB 1MZYA 1CURA 2IDTA 1OV8A 4Q89A 2HRHA 3NSYA 1FFTB 2QPEB 3IE9A 1DZ0A 1B3IA 3IN2A 2Q5BA 2WO3B 1BQRA 3NJIA 4YSRA 1F56A 4YSUA 5B7MA 4GXFA 2IH8A 1QLEB 3NJJA 4G71B 1XMEB 5EHFA 2FT8A 5I5JA 2YAEA 3L45A 2BP8B 3OMIB 1IUZA 2FTAA 1GYCA 2GB2A 4G7RB 3SBRA 1VLXA 2VSKB 2AZAA 2JXMA 2XU9A 3FQ2A 1WA1X 2J55A 1A3ZA 5D4HA 5B7EA 3V9EA 1SFHA 4AKOA 4NERA 2FQFA 1KBWA 2CBPA 1BQKA 3OD3A 1V10A 2GI0A 5I6OA 2J5WA 4HZ1A 5D4JA 1KYAA 4BXSV 3ASOB 4PCYA 4YSPA 1SHWA 3WG7B 1FA4A 2HLEB 3WI9A 5B3SB 1GY2A 1J5DA 1SDDA 2PPCA 3UAAA 3QJUB 1FWXA 4A2GA 2PPFA 1AG0A 2BW4A 2Q9OA 3NJHA 4M3HA 4YSQA 2TSBA 1AG6A 3X1BA 1JVOA 2XV2A 3UABA 4A68A 1AZNA 1ZIBA 4ENZA 3T71A 1GS8A 5LDUA 3ABKB 1PF3A 1WA2X 1OCOB 3S3CB 3FPXA 1AZCA 2FT7A 2MTAA 3FYEB 1RCYA 2XWZA 3S8FB 1RKRA 4DP0X 1W6WA 3NSDA 4YSDA 2HZHA 1J9SA 3RYMA 5D4IA 1PY0A 4KNTA 1GS7A 4L0PB 3AG1B 1A65A 3TA4D 1L9QA 5TK4A 5I6NA 3X1NA 4P5RA 2PP8A 3CDZA 1ASPA 1PZAA 4DP1X 2H3XC 4UANA 1BAWA 2XX0A 3DTUB 2HX9A 1OOWA 1RZPA 3CG8A 2RACA 1A4CA 4E9SA 3ERXA 4GP4B 1PMYA 2PCYA 4HAKA 4JHUA 3EH3B 3FU7A 3QJVB 4KNSA 3ZIYA 3QJQB 4FA7B 3S8GB 4G72B 1OF0A 1CUOA 2YXVA 1T5KA 4KOCA 4DPCX 4A2HA 2QDWA 1JZGA 4A66A 1JXFA 2GIMA 4YSOA 2YARA 2PP9A 4KO6A 2IWKA 2GC7C 4E9TA 3X1FA 2FT6A 2H5UA 1AOZA 2JKWA 1KCWA 5PCYA 4CSZA 4P5SA 2VW6A 2J57A 9PCYA 2P80A 5TK2A 2BZCA 3QJSB 1OCZB 1ASOA 4YVNA 4CSPA 2FWLB 1RZQA 4YSCA 3T6XA 3HEIB 2JFCA 5I6PA 2Y69B 4GP5B 2UXFA 4KOBA 3UACA 1KBVA 2VN3A 4YSAA 2MRYA 5E9NA 5B1JA 1ZV2A 4HALA 1OE1A 8PAZA 1A4AA
chains in the Genus database with same CATH superfamily
2YAOA 2EEBA 4NUQA 3SKJH 4WLCA 4XI5D 2ICEB 1JD7A 1F8TL 2WPGA 3O4LB 1UASA 4BFFA 2R4RH 4KUCD 2F54A 3MRCB 3UG5A 3B9VA 3FMGL 3CBJB 1CDHA 1X7QB 1Y18B 2ZNWA 1A7BA 5B1BB 3OXSB 1EZVY 1CFNA 1LP9E 3BUQA 1ZMYA 5C0BB 3BPNB 2NY2C 3QZBA 2XQBH 4HWBL 3KPRB 4PTUA 5TD4A 2ZWNA 3UZVA 3QO0A 1B2WL 2R51A 3MGTA 1Q9WB 3GZKA 3FUDA 3TV8A 4N2MA 2WBJB 4LEXH 4U0QB 1DANU 2ZYHA 3P2DA 3OF6D 5D7KD 2Q8BH 1UT9A 5HHQA 5DHDA 4ODTL 4XP9L 1X4ZA 5IB4B 1BQLL 1N8OE 2XWBA 3D87B 4UM8B 2L3BA 4CUCA 4IBLT 1XSJA 4KJPD 3FQWA 5EUKB 5LGJB 1XDTT 4PRPB 4WUKL 2GBTA 3AADB 4KPHH 1BX2A 1IBHA 2BVEA 1DUZA 4YMPA 4MNGB 2DQDH 2R23B 5DUPH 2VZ3A 4JG1H 2E0PA 4X7FC 4Y16D 3P73B 1A8JH 4ZO6A 1MW1A 1P4BH 1I85A 3RWJA 5I1GH 2JIXA 2WINB 1FN4B 4PV1C 4RGOH 2FX9H 1NGQL 2ZF8A 1OTUD 2C3VA 2DBLL 2PWEA 2FEDD 5I71C 4ZFOA 4UQEA 4KRLB 4IRJB 3BEVB 3KM2A 5C6TH 1JZFA 3T0EE 2BK8A 4LVNB 2CO6B 3HZMB 2B77A 2NNAB 5JW3L 2V9RA 5EU5B 3S5LA 2Z8VC 1KTLB 5GRVL 4PRAB 3RNKA 3MKGA 5IQ7H 2XA3A 4WEMB 3MLUL 5I1KL 2PP7A 4UNTA 2MPAH 2H26A 4L37A 4UWQB 5DJXB 2EDKA 3QIWD 1BEYH 3FN9A 1ET5A 3ZZ1A 4FXTA 3GEFA 4MNQE 5IK3B 1AGBB 5JXEA 3MLWH 3C5ZB 3S34L 4JJ5A 1A6WL 1M3IA 1R5VB 1LO3H 3V6FA 4NM4H 3TYGL 4Q9CA 2DWTA 4NT6B 3LD8B 5ICZB 3FFCA 5AOKA 1B88A 5ALBL 2QZ5A 5DD0H 3MNVA 1GYUA 2IPTL 1MZZA 1UOLA 3FNKA 1BMWA 4LHUD 3CXFA 4RGNE 3W9EA 5E5MB 1NMAH 2NUTB 1CG9A 3QIBA 4YDIL 5FR3A 4U1HA 5DMYA 4PGEB 3F5WA 2AV7B 2W0FB 1BIHA 2H3NB 2Q20A 5J8OA 3T0XA 1WZKA 3VFUB 5EA0H 4AJVA 2X6UA 2NY6D 1NDGB 1A6VH 3DMMD 4X0NA 3ZO9A 3WFEL 1GZQB 1OQXA 4YWGH 3N50A 2NZ9C 1JGEA 3POHA 4TXVB 2ESVB 3M1BB 4GMTH 1JHKH 4P3DA 3WGVB 4H1LG 1YN6A 1QNZL 3FTGB 4G5AA 1JV5A 2AK4A 1LEGB 1OAUL 4F33A 1NEPA 3SDAB 3L48A 2AANA 4KZ0A 4R90H 1B4LA 1VA9A 1X4XA 2BNQA 5KJ4A 2V7HB 4BFNA 2KLSA 2GTZA 4Z7UF 2JH2A 2OYLA 3GK8H 2YA2A 5TQ2H 4TNGA 3RBSA 4PRHE 3UBGA 1XX9C 4Z7WA 1J10A 1K4DB 1FORL 1ZTXL 4I18A 3VFTB 5JA8B 5K93A 5IESH 2BDNH 1G7PB 1AC0A 2IDQA 1NBQA 5KJRL 1R24A 4EZLA 3GI8H 3NK3A 1P5VB 1G7QA 4CMHB 1I53A 4IW4C 4YSTA 3PYCA 1NAMB 4RISL 4RDBA 4WK0B 4PLOB 1PD1A 4GKNB 4W68A 3BZFB 3CN4A 2Z4QA 3GBNL 1SXSA 3HNTH 3X3FH 3U7YH 1S7UB 2P7TA 5ADPH 5H8DA 43C9A 1SQ2N 1U3YA 2D7NA 3B2VH 5I76A 3J7HA 2VXSH 5MEOA 4PHZA 5D7IE 3K71B 5E2VL 3MNWA 5D96C 2KMWA 2RQ8A 3EH5B 4KXZH 1BP3B 5AG9A 1G1KA 2F9BT 3F7PC 4ZFGH 5BRZD 4IMKC 4QKTA 3L3KB 5I8CB 3IPFA 3V0GA 5I73B 5E51A 1FYTE 3WELA 1LD9B 1A4JA 5EEZA 1U8MB 2HT3D 3PAZA 4XC1H 5CIPH 1P7HL 3WDJA 3MBXH 5GGUA 2G3ZA 5SWZE 1JNNL 2CHZA 4OSUL 3W57A 2ZONA 4EMZA 4YAQB 5FFLA 1S7VB 3UTTD 1YNKH 2BNRB 3KLLA 3NSFA 3VWKC 4NQCA 3AT0A 5IUSA 3RY6A 4YHPB 5SWSA 3ZT5A 1IEAA 3ZKQD 1NAML 5DRXA 2DLFL 1TQSA 4J3XA 2LABA 2XYBA 2BOLA 1QEXA 2NY1B 4I88A 3TBCA 3ZDZF 1NICA 1O5DT 4N3TA 1F6LL 5FDWA 3C2AH 4MLSA 3GBDA 5H94B 5T8IA 5DVPA 3H8NA 3QQXA 3UAEA 1CGSL 3DX6B 2G9HB 2ROXA 4M61A 4XXCA 4G83A 2CJTA 4XBGA 3OAZK 5ISZA 3W5NA 4Y7OC 2QHRL 4WRLA 5J1SC 3NBNA 4TSCL 2J20A 4F5CE 3QUYC 3OJMB 1ZSDA 2X9ZA 5EOQL 3X2QB 3W11C 1F3DJ 1MFMA 3MX0B 4ESKA 2DQMA 3QDMB 1JBJA 1NFIA 2X7LA 2YD9A 2VNCA 2AK1H 3SCMD 4K7PX 3U2JA 1KB5H 4EZJA 5CZXC 1CL7H 2A4EA 3IF1A 4HIJB 2OSLB 4JO4H 1YYMH 3SYOA 5ESAA 1J88A 4K3JH 5CLYA 1J5HA 4NWTH 2O5YH 2DI8A 4GNKB 5E1AA 2JI1A 3M7OA 4G11A 5DEJA 3EF7A 2NDGA 2AAVA 5ITBL 1CYWA 4P05A 1UACL 4DGVH 4E9LA 5LBGA 1CN4A 4WTZA 4ANUA 5I1HH 1R3KB 5E8NB 4X9GA 2NXZC 5KYWB 1ACYH 1MNNA 3N1FC 5D1ZD 3EYUL 1XTLA 2JELL 4JY4A 4MMZA 1F4WL 3OJDA 5GGVH 3QEHA 5FUCE 5B1CA 3M45A 2DI9A 4XP4L 5HHOA 3D3VA 1ANUA 3QRGH 3TN0D 4K5OA 2NR6A 2W65B 2EDRA 3KPSD 4X5QA 4GRWB 2RJMA 1A7RH 4BRVA 3H7BA 1AIFB 4UNIA 3P9MA 5CO1A 2TSAA 2XWJA 1BZQK 2LTQC 5GS0L 2EO9A 2XDHA 3RWGB 5DO2D 4CSTA 3WL9B 4FTVE 3N2JA 2VKWA 5F7DB 4AM0B 3LV3A 1MW2A 2YQ3A 5EU4A 4GAFB 3KPLB 1YRKA 3B9AA 1NFDF 3LCYA 4W81A 1CZ8L 4HJGB 3N0AA 1FLRH 2YJQA 1BXAA 4JZOA 1GGIL 2YO3A 4I89A 3FYIB 5C0AA 5HI4C 2YPKB 2PXYB 4G3YH 2ZXQA 3RB7A 5KAQG 2YK1H 3B9KB 1G7HA 3LKOA 4N9GB 3O6ML 1PZSA 5KANG 5CWSA 3KJ6H 2G2RB 1NPUA 4OJFH 1OHZA 2Q5BA 1BQRA 1MJUL 3HB3C 3NGBC 1AY1L 5D7LD 1NC4B 3VWJB 2E9BA 3MROB 4IBZA 4WY7L 2V3DA 2O5ZH 5BNXD 5BV7L 2ZWKA 3KBHE 3EH2A 3C8HA 2GB2A 4PCKA 3LOWA 1UM4L 3GB7A 5CBAB 3LQAC 1G9EA 3QFGA 5I15H 2XU9A 2X4UB 5D4HA 1LNUA 3IFPA 2AERT 3O0LA 5B7EA 2W9LA 4MS8C 3P3RA 3F64A 2OSWA 4LK4A 1MFBH 1L0YA 2CBPA 4LPYA 4ORGA 4FCHA 3TCLA 5E8OB 3VH8G 3LPWA 4M6NL 3RL1B 1NCIA 1ULVA 3TPUA 3RHWF 3PP3K 4A7SA 3ARFC 5H37H 1ZT4A 4DAGL 4WFHD 1C8PA 1HQRA 1WIOA 4G8GA 5CIPA 3DIFB 4YSPA 3U82B 1WISA 4AZ8A 1SHWA 4QF1A 5FKPA 1DQML 2BS71 3OPZL 4UIMB 4KI5E 4LIQE 3QPQC 1SDDA 2JTDA 2PPCA 4JHAL 4DQOH 1I7RA 2YRLA 3BKYH 5CNHA 1JWSA 5DHYA 1CPUA 5GJSL 2VE6B 4UILH 3QGVA 4DWHA 5EN3A 4F7CA 4N0UA 3K4ZA 1L3NA 4MA1B 2VXTH 4PYHA 2O6PA 4HUNB 1UKSA 1VADB 4FX5A 5DJAB 1E4WH 2CLVB 2XWZA 5GGRA 5IM7B 3VFWA 5LGHH 4P2RE 2A0LC 2EDDA 5SWQA 3H85A 1DLHB 4DO4A 3BKCH 4LBAA 3WBDA 4L1BA 3MRJB 5DJ8A 5DJDB 2GJJA 3TA4D 4IGBA 3TJPA 4AH2A 3CDZA 2FIKA 3AGVA 5EZOL 4CDGC 1SJVA 3HMWL 4O2CB 4NIYE 3TO2A 3ZE1E 3DTUB 4OFVA 4PGZA 5JOPE 2P9RA 2R29H 3HNSL 3HI5H 5DT1L 5HJGA 3H0TB 3QULB 4N0CD 4N2BA 1RV6X 4X7SH 2OR9H 1CXKA 2V5SA 3EYQD 3PWPA 3FU7A 2UZIH 3QJQB 1EAOA 5I24A 2NY0C 1T5KA 3O6FC 2Y7QA 2QMKA 5HD8C 3OHXB 1YYLH 3A4AA 3KEHA 3MXWL 4HOXA 3MU3A 1IKNC 4R2GC 4XN9A 5FA3A 4Y4FC 4N2AA 1H6EA 5TDPB 2DJMA 3QDJB 2ZCHL 1DBKH 5DUMH 2P80A 1ZLWK 3DSFH 2BOCA 4ZUUA 3A4DA 2JWYA 4Y5VB 3KLDA 4AQEB 3HG4A 1SM3H 5IVXE 4F93B 3DHMA 3KYMA 1RY7B 2PYFB 1R5WB 3DGGB 4YSCA 2AJUL 4OGAC 4R0LC 4XZUA 3DLQR 3TVMA 3KYKH 4JFEB 3UBFA 1GC1L 2FLBT 4OLVH 2Y69B 3EOBA 4ZAKD 1YECL 2H0EA 2H32B 2ZP8A 3VXMB 2EDQA 3VQ1C 1Z6JT 3LS4L 4HDIB 2J73A 3DX3A 2A73A 5CSZA 5C0CB 4YE0A 3WUWG 1V5JA 2WM0A 2GAZA 4L8SB 5FO2A 4FXGA 1WS7A 4FYTA 4WK4B 3GIZL 3NSCA 4HHWA 3T3PE 3ZMEA 4WV1A 3ULUL 25C8L 1J1XL 3HRZC 1A6TA 1OKEA 4NZRL 4RMUA 3SGDH 5F3BA 5DZNA 1U3NA 1R3LB 3PQYE 1CT8B 4Z7QB 3IFNH 3S9DB 4KRPC 1O6TA 4LSUH 3E1ZA 3S35H 1ET8A 4KQ0A 4YDVA 5IW6B 2ZOUA 5D7JD 1OP5H 3QO1B 3ZTNH 3K91A 4LPCA 4UI2A 2VLLA 4TQIA 5HYSB 1JAEA 1PZ2A 1OCRB 4BUGA 4CVXB 3EOAA 4PP2A 2WZPD 4O4YH 3P4MA 4GYBA 5KSAD 4CKQA 3S88L 3P11H 5GZOD 3SDXF 2GSGA 2NT1A 1KN2L 4KO9A 1LK2B 4QRRD 3GO1H 3VXUB 4D0BA 2B59B 1DCEA 5EFIB 5AAWC 3TM6A 4P3CH 1K4CA 2BIHA 4YS4A 2JV6A 1XB6A 1ILUA 4B60A 2X1OA 5DI8A 4ZTEA 5EO0B 4QXGL 3D69A 4N8CH 4HEPG 4FKHA 1IAKB 2OZ4L 1K9TA 4AK1A 4AYBA 1INQB 1PZDA 2VZOA 1UJ3A 4QJ3B 4G8EA 3SGJA 1WCBB 1BGXH 2IH1B 3QUZC 2QGCA 4HH9B 4L8DB 4UV4H 3LRLA 4BK5A 2XYCA 3C5SB 1S7XA 4HPOH 3WNPA 2VN4A 2ITDB 5DQDH 1U8QA 1R3JA 1JRHH 3K0WA 2DIBA 3HVDA 1C16B 1HILB 1KJMB 1D7CA 2OTUB 2QDVA 2VKXA 3APDA 4HKJB 4PI0A 4U6VL 5D7SL 1MIEH 2B14A 2D73A 2YKLH 4ERSL 4M9PA 1ED3A 1GIGH 1NC2D 2JB5L 1NDMA 4URTB 5CP3H 5DSCA 2VZSA 1AOHA 4N26A 1PG7H 3QQ4A 4QTIH 4HWEH 5IHWA 2DQHL 3DK0A 4OD3H 4OLXL 1WD8A 3TBBA 3D39D 5E2TL 3K46A 1VFOA 4LLUA 1G6RL 1IC7L 3ZHLA 2R29A 3O4LA 1FH2A 1TU2A 4KXDA 1KXTB 4X6CA 1Y18A 2EE3A 3SE6A 3G6JB 5FYJU 1T21B 2J7LA 3DHPA 5DQ9A 4MSWA 3KDMA 2KT6A 5MERA 3WKPA 5IB5A 5FGSA 1HE7A 3Q2VA 3BT0A 3QR1A 3BAXA 3BHBB 4U1GB 3PREA 4I3SH 4DH2A 1OB1B 3KPRA 1VENA 1WO2A 4YGVB 4MMYB 2XWTB 3PNWA 5IF0B 3WSQL 4BFGA 1LP9B 2YRBA 2JQAA 3BW9B 4UINL 1CVSC 1MHCB 4L1DA 3U4KA 5KG9B 2EDJA 4UMSA 4AYID 5DRWA 1I9JL 4AQZA 1TITA 4WU7A 1AE6L 1BSIA 1VF5C 3QEQA 2WXKA 3C08H 2WSKA 5JPMA 4M43L 4OQ1A 2MPVA 3DPDA 2QJDA 2CK0L 1PCSA 5KVMC 5IBUB 3V8CA 2YLHA 5A6LA 12E8L 4ZXBB 1RZJL 4XAWH 3G5XB 2XN9D 3D8MA 5I75C 4HEME 4H8PA 1IFHL 5E00A 5JIMA 3QH3A 1EJFA 3RUGE 5SX5H 3S96B 2QVFB 5L9DH 1TJHH 1I1AD 1A6UL 4GRMB 1T66D 4U1SB 1DVFA 2WXNA 4B6ZA 4Z7OB 4HF5L 2DY2A 4JW3A 5FECB 1V7ML 4DO5A 2VUYA 3HZMA 4S10A 1CICB 3EUDA 4YIQA 3STLA 1QI4A 4P46D 4NUGL 5IJVB 1A6PA 5EU5A 3OQRA 3MLRH 1I9EA 4PRIE 3GGWB 1A1NB 5CXPA 1JTPA 3QAZB 5I28A 5KVEE 5IOPB 1T1ZA 1X5IA 3K6DA 1A9EB 1AZVA 4FZ8L 4MVBD 5FS5A 3T0EB 1CQYA 1GR7A 4QYOB 4PRBA 4R9HA 5IK3A 1U9KA 4XCEA 2P47B 2BWQA 3C5ZA 1Z5HA 1LO2H 2IQAA 1QSVA 2I26N 3EYFB 1ZV9A 1BDYA 4P4RB 3SGEI 3D4CA 4Y5YC 5CSGA 4JM2F 3V4PB 2X4TA 3CZGA 3L4XA 3M8OH 5DC4B 4ODSH 1IBDA 1MFVA 4NT6A 2C5DC 3IJSB 3E8VA 3MUUA 4N87A 2OMUB 4HC1L 4HBCH 5C0IB 2J6EL 2LU4A 3HC3L 5J3HD 1XF1A 3TLRA 1VERA 4CU6A 3LZFH 1SZNA 1IGIL 4KITB 2W81C 3H9SE 4X9IA 1YEKL 5JOEA 1GGTA 1MPAH 3OJ2C 4K8RC 4LSQH 3CFCL 4KTEH 1YZZA 5MHSE 2PWGA 3WS6A 3IDYC 4BELD 2VIRB 5EC1B 1U8KB 2QADC 2C3GA 4ZS7L 1Z5YD 4NZUH 3P0VL 1XGZA 1AGCA 1WZ1L 1EERB 2W0FA 3KPMA 1I31A 1MG3C 1UC6A 2BIMA 4A38A 4RGNB 1E4XI 1R75A 3ETBF 2BVOA 3X1EA 3QVAA 1FNLA 4HKZA 2E6JA 2OJZL 4TN9A 1FGVH 2N7SA 2ZSVB 3IMWA 4NC2B 2P8MA 3MLYH 3LEVL 5AZUA 5HYQB 3EAKA 2NY5L 1UWGL 1A3LH 3QJRB 1KYFA 5HVHB 1E65A 2DEYX 3BLPX 5BPPA 1EAPA 1EA9C 4HJIA 2RA1A 1LEGA 2WLKA 4HUWA 3IYLW 5E6SB 1U91B 4JUSA 1QNIA 4DZBB 2R8SH 1RZFL 2CGYA 2CRZA 2BVYA 2D9QB 2WLYA 3V4PL 1BREA 3TO4C 4P0DA 1QLEL 2VDOL 1SOKA 5AUMA 2GHZA 5HGAB 1B4JH 2Z65C 2YGOA 1BVOA 3IDXH 2TRHA 4N0YH 5MENA 4FNPA 1QR1A 3FF7A 3SE3A 4F2ME 5DEGB 1G7PA 2ZG3A 3GSQB 4PEEA 4OUUB 3PWLA 2E5EA 3Q2NA 1J18A 2A83A 2E6QA 4PRHB 1M2VB 1BD2A 2B08A 1MRFH 1PY9A 2H7WA 1VDGA 1SXAA 2VSCA 3Q13A 4NC1C 4QO1B 3E0GA 4Z5RB 1NCTA 4PLKD 3SDDA 4GAJL 3BZFA 4K9EL 4O5LH 5DMIH 4BSWB 4HPHA 5HY9A 5JIHA 3HHSB 3C6LC 5JW5B 1PLBA 4KHXL 1N3NA 4MZ3A 2ZOKA 1NPJA 4AMXA 4HP5A 3IETA 1AI1L 2R2EB 5FOBB 3WNKA 5TE4L 1HCFX 1F90L 5JHDD 3HRPA 3QG7H 4JPQA 2ATPB 2EE6A 4KRNA 3RDTD 5EUOE 3CLEL 4O2FB 3RFZB 1UWXK 1NPNA 2CWRA 1GSKA 3G5YA 3V6OC 5HGBA 2CDFA 5AL8A 4WNQB 1BQ5A 4UBDC 4AMKL 4QRPE 3O9WA 1M42A 5D2NC 5D7IB 5DRNB 3R4DA 2EDTA 1UWYA 4LCIH 1P4IH 1G5AA 5FDYA 4DETA 1N64H 3PGFH 1TLKA 3CLWA 4H8UA 4N2NA 3VFSA 5JZ7C 5HYJE 5IQOA 1D5BB 4Y2NA 1JZEA 1TMQA 1N2RA 1FYTB 2JQMA 1A7QH 2YD3A 1SJEA 1ZJBA 2G75B 3Q2LA 4OCRH 1P5UB 4YHPA 3LRMA 4HMDA 1K3ZA 4OCLC 5SWZB 4I1PA 4L29B 3SO3C 2FD6L 5E9DE 2A9CA 1G5GA 2AJYL 4JGJA 4MHHI 5TJWK 1FFTB 1PSKH 1ZHBA 3IMVA 1X5YA 2Q7YB 5L88H 3ZGIA 1CGXA 4CW1A 4TL4A 1MAMH 1RIUL 2VR8A 4ZD3H 3ZKND 2O6DA 2G9HA 4R97C 2R1XA 3GM8A 3QUXC 3JWDH 4UQ2A 3BN9D 3GMQB 2K70A 3HOGA 3V0JA 4AYSA 4BBWA 2DH2A 2AZAA 4JHWL 3I9PA 4LO9A 2DQJH 5JW4N 2EEXA 1X5GA 2D4FA 3PDOB 3NRFA 2NY7L 2X70B 3GMRB 2CLZB 3Q3GB 4UOW1 1JGVH 3UBXA 1U8IB 3ARUA 2YPVL 3CQFA 5FWRA 1D9KB 4XRCA 3VGAC 4XCYB 1D6EB 2AKRA 1S6NA 4OAWB 3OF6A 5F96H 1VCBC 1S9YB 3KGUA 4MXVE 3RWCB 4CGUB 1DVXA 1AZZC 1OAZL 1UZGA 3WFDL 2K78A 4CA4A 1F4HA 4E42B 3K1KC 2NY3C 5E2UL 2OXHB 4XPAH 4OZHE 2VDMH 3HIZA 4YLBA 1CIUA 1QFWM 2WD0A 2XC8A 1INEH 4XPFH 1F3DH 3ARBB 1EAJA 4QIRA 3KBEA 1Q38A 1JCVA 2AI0H 3INOA 4MZ2A 5E8NA 3X14B 5KYWA 4KX9A 5A16B 3TF7C 2X2UA 4UV7L 2VOTA 4QOKE 5DEFB 2CR6A 2LFGA 1IAIH 3X1BA 3TEYA 1JF5A 3BRDA 1BPVA 4XVUD 1SMAA 3INUH 3L5JA 3FQRA 3BSZH 4G1MA 1WA2X 3UYOD 4G8FA 3OPUA 2J12B 1TT6A 3RKDC 5FHBL 3G6AA 5BZWB 3UYRL 1E3ZA 4APXB 1MHEB 3QE5A 5C70A 1A64A 3AWFA 3QIUD 2VQ1B 5A2JH 1SYVB 4ZPVA 5I1JH 2VXVH 2WO4A 3NZ8A 4ELKA 5KSBE 5CZVL 1RK7A 3TZVD 3WN5C 1X5KA 1KN4L 3X1NA 2AEPL 1ZRUA 1GGCL 2N7BA 3OBAA 3QUHA 4OLYH 3L1EA 1T6VN 3QIWA 3WD5L 4FTVB 1BAFL 5J5EA 3ZE2B 1YY9C 5EWIH 5DA0B 3VE0A 1X5ZA 2AQRA 5GRWA 4LGPB 4PR5B 4R3SB 4Y5XC 2YA1A 3LIZH 4TNVF 1NC4A 4M4RA 1PBYA 3HUJF 4DVRH 1R17A 1MEXL 1HU8A 1JZGA 4LSSH 3NABL 5F7UA 1JXFA 1JPEA 2DQEH 4LHUA 4FL4C 2PP9A 2BY2A 3IFLL 1COBA 3IDUA 4WEEA 4MRBA 1VGKA 3DX1A 3FUNA 3O3DA 3OAYK 3VM7A 5KBPA 4AV5A 1SDYA 3MN8A 3PP3H 5LAXA 5IIEA 3SKMB 2R4SL 4LARH 3NPSB 2FECL 4JFTA 2KLTA 5GZND 4K3DL 1A14L 5CN1A 3II1A 1QA9A 2APBA 1OCZB 2J4WH 4ONOA 4WU5A 4YHLH 1B0WA 1YNTB 4HX1A 4XOCA 3H9YA 5DUBB 3H2PA 1RZQA 4L4VE 1AHKA 1C12B 1CE1L 2HJFA 2X89D 2ZOLA 4OB5H 3ZKXB 4AXWB 4WDIA 1V27A 2V3EA 1NBZA 3DMMA 3HCVB 1AQMA 3R06A 2FECI 4PJHA 1DDHA 4H13C 2VN3A 4YSAA 1E50A 2E6PA 3LNEA 2NY2B 2CIIB 4YK4C 2E9JA 1EFQA 3DO7B 1SJXA 5IB1B 3SE8H 4PUBH 4HMCA 2OL3B 3PDDA 2P42B 4IIZA 1U93A 1XIWC 3IWUA 5HHPA 2VAAB 3PV6A 2HVJA 4I77H 1XSOA 4QHLB 4WWNA 1Z3GL 3S7GA 3T09A 4OLUL 4XMPH 1GGYA 3E8UH 4KXAA 4YXLH 3WO4C 3MZGB 5AVTB 2Y4SA 4NPYB 5KEZA 5DEZA 4WJ5A 4NO2A 2QKIB 4JN1H 1E42A 1HKLH 1UD6A 2F1BA 1B4TA 2I25N 5D1XE 2WC7A 5B1AB 4ZS6C 2UX6A 4FABH 2XKNA 3CFDB 3RURA 4LHQB 3IDIA 4URKA 4A55A 4UT7L 3SGKA 3ZHDA 4BGDA 1RK0B 5HHME 3MBEB 3V10A 3AG3B 5F0MB 5TE6L 3TNNB 3KGTA 1NCCL 4GAAA 2EICA 5DJZB 3X13A 2PYEE 3UERA 3KE0A 3ZTEA 4F91B 1TTCA 2HX7A 3ZE1B 5I71B 3FW6A 3B56A 4BM7A 1ZE3H 1SOQA 3QEUB 2CUMA 2DKUA 5DJ0A 4CJ0A 2E7BA 5EZJA 4WI2A 3MYJB 4F7MA 3NAAL 2DPKA 2OL3L 2OQJB 1C7TA 5E95B 4LIQL 1OGSA 4Z8FL 2EDBA 4M93C 5I0DA 4B50A 2YMXH 2AQSA 3QHZL 1AGFA 2FJSA 4L3ED 3BWAB 2DDQL 3EFOA 2N4IA 3AROA 3CMGA 2PYFA 3HG3A 3NCJH 1BAGA 3OB0K 4NN6B 4ZTPH 4JL1A 3TA3B 4UCFA 3ZVVA 4XB8A 4XMUA 3QZWB 4JFEA 3QNFA 5ACZB 2BM3A 3ZKSD 3QUMB 3CLFH 5EF1A 3BYTA 4AKQA 1SVBA 1VEPA 1WGVA 5IVXB 1D5ZB 2H32A 4MYWB 1EJ6A 3B83A 3G08B 3ELAT 5LXGH 1IC5H 5E94B 2OMXB 3RTQD 1FNSH 4M48L 3QS3A 2HA1A 1WBYA 2OMWB 4NC0B 4S1DD 3O2WL 4JFZL 3TOPA 1BZ8A 1H5BA 4AW7A 1M05A 3L3DA 5PAZA 4UDTB 3LIZA 3S98A 3A22A 1SHXA 3T3PB 5K9QI 4JQIA 2R2BB 2H2PC 3M1CA 4U3SB 2Y07L 3WKNA 1KJVB 2ZKYA 2NY4C 2Z8WC 4I0PD 5I9QC 2E76C 2DV6A 3PQYB 4L48A 4RAUA 5E8EA 5HYSA 1YEGH 1MHHB 4PAZA 3APCA 2WNXA 4UYPA 4F7TA 1OQOA 1PY4A 3SCMA 3THML 3ML8A 2WXLA 3PAVA 4HK3J 4UM9B 2QSCL 1PX3A 4HS8L 4OCSH 2NUPA 4ISVA 4C58B 1V3LA 5BS0D 3QUML 2FL5B 3QJTB 5MI0B 1DQTA 1F11B 3HE7C 2AHIA 4GH7B 4JCLA 3ILQD 1EEQA 3D4YA 1UD8A 4H1LH 1LLAA 2HG5B 5EPMB 1IAKA 4NC1E 2HLFD 5D1ZA 2VDQB 1WFNA 5INDA 2BSDA 3EGSA 4L8DA 4Y4KC 4MBOA 3MRFB 4JANA 1XT5A 4YXHH 2YWYA 3TN0A 1VFBA 3OMNB 1QFWL 2FDBP 4NKIH 3TV3L 3KPSA 5G4OA 1XSKA 1FZJA 1KGWA 2ZG1A 3V0WH 3QFDA 4X6BA 4PP1D 2JTYA 4HCGA 1JZ6A 3WKML 3V6OE 2XQYG 1JPGA 1ZA6B 3DBXA 2E3VA 3SOBH 1MCKA 1E8WA 1WT5C 5CGTA 5J4MA 1DQLL 5KZCD 3H3BC 5F8RC 1CXHA 5D2NE 3AXLB 1RUAL 4AGPA 2NYZA 4DGYL 1HCVA 4IDLA 4RAHA 4LBEB 5F7LB 1YA5A 4I48B 4UNUA 5I66B 4IRZH 4Z7WF 3SQBB 1QFPA 5EIQA 3ECBB 5IW3A 3RE0A 1IGYA 4MS6A 3UC0H 3IVKB 4X4ME 5D7LA 4LQFH 5J1AB 1QP1A 1KTJA 3MACH 3MFFA 1YAIA 9CGTA 4EAEA 3MV7D 4F27A 4PJAA 5C2BL 3BHBA 1FV1A 1DTUA 3HPJB 1NGPH 4YHZH 3VWKB 4AE0A 2CLRB 4XBPA 4FJZA 3VW3L 2DTMH 2G5RA 4DKEH 3IS0X 2E7LC 4W9EC 2W95A 3FCUB 3F6IA 3LIUA 3BO8A 2V4LA 3F65A 4ABVA 1Y7VA 3H3PH 3KWVA 2F58H 4X9BA 1HXMB 3V0VA 3RKPA 1OPOA 2EH8L 4BWWA 2IAMB 2D3LA 3FCTA 4FLHA 2OCCB 1R9FA 2V2XB 3ULVD 1W0WA 4AX3A 3P3YA 1J5CA 4IK6A 2ZUYA 3R1GL 5CJOL 2M26A 5HGHA 2EYTA 1KELH 4G9FD 1BXXA 2QSVA 3LVEA 4NX0A 3LNIA 2A1WL 3QUYB 3SYAA 1HSBB 1UQSB 1ZXKA 2OX5A 1LMIA 5BXFB 1PJ9A 3UTOA 5JR1L 1GCYA 4CADB 5JW4Q 5IHHA 2X6BA 5GGTH 2JKTM 5FW7A 2Q76A 1CFVH 4Y89A 4JHBA 4PGCA 1UXWA 2DLIA 4IEFB 1BWWA 5EU6E 1DL7H 4WEUD 3O8XC 1XF2B 1F18A 1A4BA 1NKGA 3KCPA 4ZYKB 2MKLC 3HLAB 3OWEA 4JFFD 3RUGB 5C86A 5JORB 1UVQA 3X1GA 3MUZ1 4ONFH 1CICA 3VGEA 5FM5O 3EYVA 3ISYA 2CG9X 2G4EA 2IG2H 2W91A 2Z93B 1EHLH 3ARGC 2I69A 4TUKL 5LJYH 1KIPB 3BH8A 4ICXA 4GP8B 4Z7UE 4P23C 4B9KC 4Q6IC 2LQRA 2MNJB 1YQVL 4PRIB 2Y7OA 3FU3A 5ALCH 5AZ2L 1CB4A 2VLME 1R1CA 4P4RA 3WV0A 3HNVL 3BAEL 5BZZA 2ZYSA 4I87A 1YEDB 5E8DL 4IU3B 2FO4A 1G4RA 1I8IA 1L3WA 4BSVB 4JO2L 1FL5A 1W72L 4YOKA 4KDVA 5C0IA 3W0WD 2LTQB 3MZTA 4WWKC 3BKMH 2FQGA 3N41F 4H25B 2RALA 1RIHH 4G70B 1X5AA 3K4DA 2EUXA 4H1LA 1NANI 4N6RB 1NIDA 3LRHA 2CUIA 4DO6A 4HULB 3NP3A 1ZT1A 1WSST 1W0YT 1ZANL 4G42A 4PS4L 1SBSH 3I6LD 1VZGA 1CFSB 2NY1D 1KLFA 1OTTC 3H9SB 5BMFH 4E41E 4NZ8A 4LSPL 1BQHG 4G82A 4Z77A 3FCGA 1NOLA 4TTGA 2XTLA 1IJ9A 2DN7A 3JVGA 3R18A 1RUPL 3HB3B 5GS0D 1NBVH 3NGBB 1JXDA 2OYMA 2X2IA 2XA8H 5AYUH 2V2TB 5AW2B 3U79A 2QKSA 4K5MA 2HT4C 2QQKL 1BVNP 1P6AB 2AFNA 3BVNA 2GJZB 3UTQB 1CURA 1CF8L 2V17H 4JFYA 1MFNA 1DBJL 2QPEB 5F70A 5KVEL 3IS1X 3VYNA 2E56A 2NQCA 3IE9A 4IRZA 1E28B 1MN4A 1TVBB 3E6FA 3F58L 2N56A 3TT3L 1XBRA 4CGTA 3RNQB 3ARFB 4GOSA 2R0LL 4UTAA 4D3CL 5IMKA 4F58L 4N5UA 2F2HA 4Z3JA 2OK0L 5FF6B 4H8VA 1W8NA 5DFVD 4NNPH 4X6FB 2QPSA 4PJ5E 3I9GH 1O7SA 5D7JA 2MSPA 5IG7B 3SSGA 2UWEA 3ZDZE 4AKOA 5F7NC 4ZZKA 4W9LC 3D2UB 3OMZA 4F2MB 4C56D 4Z5RA 4BH7B 2WZPA 4NENB 1INDH 2GK2A 5GZOA 4GI9A 4QRRA 5D4JA 1P53A 4YNYB 3C6SB 2IH3A 3FTSA 1O0VA 2D7TH 3FTYA 1UWXH 3QJHB 1FA4A 2X28A 3F6LA 2HLEB 3KDPB 3ZTJG 1EHXA 1FI8C 2J1WA 4J27A 4TVPE 1A6AA 2ATPA 5KSUA 2PR4L 4O51A 1RH8A 2Q9OA 3TXAA 3VTAA 2F5AL 5CP7B 5D6DC 3NJHA 4LVOC 4P07A 2GYSA 1TQWA 4M6OL 2IALB 2XV2A 4JPIB 3GUFA 5DJCA 1MCRA 1N9PA 3D33A 4ENZA 1UZ6F 1GS8A 3DTXB 3BSHA 4O9HH 2PW1A 3RZCD 4MXQD 3QWRA 5F1IA 3WIHH 4LLVA 2KZ1B 2WLLB 4FFWC 2CHDA 1PZ3A 2HZHA 4KAQL 4QRPB 1F3RB 3RYMA 1D5BA 4J3VA 3K6FA 2ZG2A 1FL6B 1NC2A 2NY0B 4WI5A 3I6GB 4NBZB 2D9CA 3EHBC 1AGDB 1P5UA 1IBBA 2WXJA 1UB5B 5AB0A 2H3XC 2HTLD 1HNFA 2WK2A 5HYJB 4PJXF 3D39A 4Y4FB 1GMEA 2C34A 1KIUA 4TUUA 3UC2A 3M17A 5TPWH 2K4WA 4IS6A 3C9NA 4Q4EA 1C5DA 1EFXB 4XE5B 4JM2C 1S7SB 2Q8AL 4OZIE 4TQ8A 1U8HB 3LKRB 4N1CA 4FA7B 5E9DB 5EO1A 2O30A 1CUOA 4M8UA 2ZJSH 2NZ1A 1UEMA 3F01A 2J5LC 1NGXB 1EDQA 4ZX6A 4F7EB 3VFNA 4G43B 4NQTA 4NRYB 4HIEB 5BRQA 2BCMA 4GAGL 3TTYA 4BFRA 1CI3M 4L5FH 4OM1L 1RPKA 2AXGB 4ZOAA 3G6DL 4D9LH 5E6ID 3G3LA 4XCYA 1QFUL 2GUOB 3B3IB 3UO8B 4YHYB 1A9BB 3D25B 3HE6C 4CSPA 3WJMB 4EJ1C 1C5CH 3HRZB 3BSGA 3UPCA 2OXHA 1YDPB 4NKOB 3NRPA 1U8LA 3AREB 4LOUC 4LCUA 5DGRA 4I5BB 4M7JH 2WGXA 4ZUTB 3X14A 1C5BH 2O61B 5A16A 3QORC 2XN9A 3O3AB 1Y0LB 1NA8A 1ZV2A 3DRQB 2EABA 4OZHB 3IJ7A 4NJ9H 3BFQG 3KWUA 4DZ8B 5CM1A 2PCPA 4XCFL 4CC4C 1F4XH 4M1CC 1SN0A 3KLKA 1A4KB 2YAPA 2I7SA 3FDWA 1CXFA 2CO7B 4ADIA 3BE1H 4KDTC 1AR1D 4QOKB 1RURH 3HI6H 3WYRA 3AS1A 4P9HH 2XPYA 3ZZSA 4EN3C 3OG6B 5JUEL 1QSZA 4P46A 2F7OA 3QUGA 2X4RA 5IBTH 1JPTL 1ZHKB 4OIIH 5I18H 4PJIA 4MHHG 1M3JA 4JQVC 2UY7A 4X80H 1FYHB 4P2OB 1QLFB 4KV5F 5T1LD 4BZ2H 4A7QA 3VH8A 5DJYB 3GMNA 1NGZB 1GW6A 4Q6YA 5KSBB 3F7LA 1T4KA 4XNXH 2VXQL 4P57A 1DQDH 1DLFH 1B3JA 3GSNH 3UP1A 1JZDC 4MJID 4MZIA 4X42A 5BVPL 5E08H 4OM0H 4OV6F 4R8WH 2AVGA 3BC9A 1N19A 2VLJE 1IZJA 2WVUA 3LMJL 5CCKL 2PCFB 4X2UA 2EDEA 4I2XA 1CTNA 3GXMA 2AP2A 2E8YA 3EXJA 1RZKH 4QGYA 1DE4B 3OSKA 5HVFB 3QHFH 4OD2A 4CAGA 4HHGA 3DURB 2LR4A 2ZD0A 4YPGA 3UJTH 2BW5A 2PUQT 3VD2A 5FKAA 2OULB 5H35B 1QYGH 2DLEA 4J6RH 5IKCB 1DQJB 2RFXA 1F4YH 1T0MA 2Q86A 2XY1A 2O6FA 4NXSA 4ODVH 4EXPX 3QRFM 4S2SB 5BZXA 1HHIA 4YDJB 3BAIA 2DQTH 1W8EA 2P24A 3KHOA 4G6JH 3VXNB 3VD9A 3N44B 2GT9B 4FAAB 4F9PC 1S7TA 4MCYB 1AACA 1BQSA 1ZEAL 2CIIA 1YEWA 1SJHA 3DUUA 2CDEB 3TIDB 2VN7A 3WIIL 5AW7B 4IHBA 3LY6A 4JFOB 4NUJA 1KEMH 1WAAA 5JQ6L 5DURD 2DS4A 1XH0A 4M5ZH 4U1IB 4WWID 1OP3H 5DK0B 1DUYB 3CCHA 3T6ZA 1OSPL 5LGKA 3CC5A 4V11A 2WXIA 2BMKB 4JFDD 1NIEA 3U36A 1E90A 3HG0A 2RR3A 2XFXA 4GW1B 3U2SA 4M6MH 4ES8A 2J44A 4JFHD 1UXLA 1CO1A 1OGTA 1GGUA 4G8IB 5I75B 4NO0D 5GGSY 1UM5L 2NYYC 3VSTA 3ZXAC 1ETJA 3P9LB 5B7FA 2VMJA 3KLHD 1T3FB 3B6SB 4J7RA 3KLSA 1TVDA 1HH9B 3MBEA 3M86A 4CVWA 1L9RA 5D1XB 2J1XA 1QRNB 1BXVA 5F88A 4JPWL 5DJZA 2BCKB 1NCDL 1A2YA 1T0OA 1U8PB 3NFNA 3Q01A 4LEOB 2O26U 1LE9B 4LU5H 5HDWA 5HHMB 1NKOA 4ZMOA 2WANA 5JHDA 3BPCA 4WSKA 1YMHB 2PYEB 1LO0H 2F8VA 3IJHA 4KK8D 3FTXA 4J3SA 1XF5A 3WUWA 4DPAX 3SDXE 4BQ9A 3VB9A 3ZL4H 3FONB 4NOBA 2VABA 4QRSB 3I3BA 3B2MA 3KNBA 3BOVA 3ULAB 4EQ2A 1G87A 2AMGA 3ELQA 2Y5EA 4RESB 1GHFL 1HAUA 4H2AA 4RMVA 5DS2A 1OLZA 3PABA 1JNHA 1ZY9A 4Y5YB 2OJEB 1A7OH 4GG8B 2ZXDA 5J7CC 3F7KA 1TTBA 1XR8A 1SF5A 3ZRFC 1NWPA 3IMUA 4XNUH 4LDEB 2BIPA 2W07A 3OLEA 2GITB 4BZ2A 1EGJL 2UUDK 4HXBH 4C59B 3BQUB 1KCRL 4W4OC 2GY7B 4CILA 1BIIB 3VFMA 3SO5A 1C1EH 3P9WB 5KW9L 3SZ6A 1F3JA 3DROB 3GSNA 1F8TH 3LRSA 3AT8A 3QXDB 4ZO8A 3OZLA 2OW6A 1ND0B 1NCUA 3K8MA 3FU0A 4NQDD 2CHNA 4L1LA 4JFPB 3HFFA 3HG1E 2BSED 4HEPA 1RUKL 4HFWA 4P5TC 4NBYB 3L3IB 3PIQA 3WNIA 3ZDXE 1BJMA 5KYUA 3QCVL 5TH2A 4DN4L 3PQYA 4HWBH 4IJTA 1LXMA 3P4OA 3MA7A 1XD1A 3OKOA 4LESA 5D7HA 3U1SL 2W9EH 1B2WH 3AG4B 3AS2A 3HBGA 3IAQA 3T4YA 5J6GA 5GS1C 4JPVL 4ODXA 4YDZA 4Z18A 2XCMC 1D7BA 1SY6L 5HDBE 3SPCA 3VI4A 2LLNA 3V55A 4GEIA 3TO4B 5KVFE 4HIXL 3LYRA 3GINA 4LASL 4PLJD 2JJSC 4B9CA 2AABL 1OGAE 5H2BA 3HMXL 5I16B 1V55B 1LE5A 4WUKH 2Z31B 5AD0B 4K8RL 4A67A 4DPBX 1JHTB 1AP2B 4JO3L 2HUEA 4MMXC 5DF0A 3IAGC 3QQDB 4GIPD 3UBHA 5F7EL 4EI5C 1E9OA 3OKDA 5EZPA 4MAYD 3T6QC 2QPDB 4OCYL 4G80A 1NGQH 3LNDA 3UJIL 1S3KH 2KKQA 3C6LB 4MNQD 5JYMA 1J5IA 3QIUA 4AL8C 4V1DE 2Q10A 2E8ZA 3ME0B 3RVUD 3QARA 3GIVA 5TDNB 1JXKA 1RMFL 3JTTA 3HJ0A 2G5BB 1JGLL 1TZIB 2ALWA 1VPOL 1GYAA 4FQCL 2WHVA 3G04A 1JSYA 3DA0A 4XR8C 5I66A 5L0QC 5K9QG 5C0EA 5C08E 5D2NB 2OXGB 1BW8A 1GOGA 3ECBA 3OXRA 1JN6B 3NIFF 1FFNB 1A6WH 3IVKA 2D0GA 4QRTA 4JMNA 3GMOB 5IB2A 4U1KA 2XWRA 2XXFA 5ALBH 3WTXA 2WQRA 4LLYA 3GTNA 2FQDA 1Z9SA 4N28A 1NLBL 1O6SA 3GXDA 1Z9LA 3HPJA 4FYSA 4QY8A 1EZVX 2FYVA 4TSBL 3ZKMD 4DP4X 1XZ0B 3OG4B 2DEXX 3VGBA 2GCYA 3L4WA 3BVTA 3BZEA 1HYSC 1DJYA 1SQMA 3SO3B 2P4AB 4YDIH 2R0WL 3N9GH 4HKXB 4F2EA 1C08B 4PJ6A 5AFAA 3BXNB 2ODHA 4NP4L 1J05B 2IAMA 4FNUA 1VGEL 3AS0A 5GGRY 2X89A 4IJ3C 4NFDA 4P2QE 1KG0B 5FPIA 4R97B 1NGYB 4NZTL 5DVOA 2GJ6E 3GF8A 2ADFL 3AACA 2L04A 3WFEH 5C8JB 2X4NB 5A2FA 1F00I 3MXVL 3VFRA 3ZL2A 2VDKB 2EDMA 4W9IC 5IMMA 1QNZH 3RPIB 4BZYA 4JR9H 1IKFH 4R6UA 1HSAA 1OAUH 3KL5A 1YC7A 2NX5E 3VGAB 4DVBA 2WO3B 4ZUSB 5B7MA 2CD0A 4TTDD 3D85D 5EHFA 1KTDA 2YAEA 1F1DA 3DXAD 2H3KA 1G7JA 4FXKC 5LWYL 3GXPA 1L7TL 3F7YA 4PJCA 5ILTL 2KH2B 3VTMA 1FORH 1RFDL 1ZTXH 4NSKA 1EXUB 4EBQL 5JXEC 2FO1A 1HZLA 3NK4A 4A6YB 3LZLA 3CPLB 4OIBA 5D72H 4HWBA 4FI6A 1RZGB 4L8CA 4U6XB 2AJVH 2Y2WA 2YMTA 4GW4A 5F1NA 2BRRL 4ZMZA 4HZ1A 4NP9A 2VC2H 4N85A 4RISH 1T1WB 1KYAA 2YN5A 4BXSV 1YEDA 3C6EA 2A6KB 1EBAA 1VAHA 1VHPA 1QASA 3ARRA 4L9LA 1BM3L 2Y3NA 3WI9A 1KSRA 4FC3E 5DHVH 3QIBC 4PB0H 2XG5B 3FO1A 4HPYL 4N90E 1CD9B 2A6IA 3D4ZA 5I1DB 1A1OA 1H0DA 2WAHA 3I02B 2VDKL 5JHAA 4IMLB 4QTFA 2VMEA 3WN5B 3HN3A 4I85A 1MW3A 1XGQA 4B9GA 4BFIA 3MSPA 3AQZA 3D6GA 5ECJE 1JJUA 1W8OA 3ABKB 3QPXL 1P7KA 1AZCA 1I7ZA 3OKKA 4L3EA 1UT1A 3RX9A 4PJGA 1K5NA 3DI2B 3KPOB 5DRZB 1HINL 3VXSD 3ULVH 2GK0B 3QP3A 3I84A 4LCVA 1N59B 1JNNH 5IT2L 4WO4D 2H9GB 4E41B 1A1MA 1EK3A 1XXDC 5EO9A 1E8ZA 4GRWF 1PQZA 1QBAA 2CPCA 3F7QA 3ZZLA 4FL4B 5CSBA 2XX0A 4D0DB 4AEFA 6FABH 3TH3T 1NAMH 1RZPA 3CG8A 3WXWL 2RCSL 3RTQA 3GXFA 2OTPA 1MKFA 1PMYA 4I18C 2B3RA 2D7OA 4POUB 1KULA 4JFXA 1KB9J 1GOHA 3EH3B 4HK0A 2X40A 1JFHA 3P2BA 4XVSL 5IEKB 4LCCA 4YZWA 5EZLA 1QTPA 4G7YH 4P99A 4OFQA 4X6FA 2YARA 4TSCH 3S36X 4HXAL 5EIIB 2IWKA 1U58A 5EOQH 4I0PA 4KK9C 3X1FA 3MUHL 2H5UA 1YNLL 5K9OB 4HZLA 3OZ9L 4J3TA 1KPRA 2UZYA 4FQLH 4U1LA 5CU5A 1HEZB 5EBWB 1JI2A 4PJ5B 4ADJA 3IU3B 1WBXB 3VXQA 1XIWB 3BDXA 4MD5B 4M8QB 4WHCA 4GQPH 3ZDZB 5T3XE 2XICA 1L6PA 5ITBH 5BS0A 1QHPA 1UACH 3QDGD 2KZBA 3GMPB 4WCYH 3UACA 1G9NH 2MRYA 1IT9L 1H6UA 4PWKA 4YFLF 3QHTC 1XBDA 5CP7A 1LO5A 1KC5H 4BEIA 2FEEL 1F4WH 4Y1AE 1KZYA 5E03A 3X3GL 5IMLA 1I1FB 1AD9A 1MG2C 4BE5A 1Z9PA 5FOJA 4S11A 1HNGA 4FADA 4LLAA 1T1XB 3L4TA 4LL4A 4RX4D 1FAIH 2QQNL 3NJNA 2Y22A 2D3NA 1JPFA 3O6LL 4J23A 3KWTA 2W8CA 3RY6C 3WIAA 3SDYL 2W60A 2FEEI 3QXVA 3L7FB 4R26L 5E0FA 4DP8X 5GS0H 5K59F 2XV0A 1FL6A 4JLRA 5ENWA 3NYKA 1CDBA 2DQ6A 4ZMQA 1P4LA 1I3GL 1AGDA 1RZ7H 1TZ8A 3LPGA 1CBVL 1MCHA 2J2ZB 4UQAA 4RAVB 4F57L 4S1QH 4DUVA 3REWB 4R7DA 1GGIH 4KX8A 5C7XH 4XXCC 1XWVA 3BISA 1R19A 4M93B 3BGFC 1L9TA 4MJ2A 3BFOA 1S7SA 4PJ8D 1XCXA 3MREA 1C7SA 1NBYB 2FR4A 4FG0A 2HKFL 1MJUH 1UXMA 1AY1H 1IARB 4E9YA 1D5IL 1U6AL 1KLGB 1NGXA 1WEJL 5DHVA 5A2CA 5BV7H 2DYSB 3MV7A 4G43A 2VH5H 4OZIB 1UM4H 3FQ1A 4P49A 4HIEA 4NO3B 2O6CA 2VAJA 1I9IH 3Q1EA 4AEIL 4TVPL 2GFBB 3ULUF 4NO5A 1TCRA 5CD5D 5FM8A 3SE4C 2X9WA 1T0NB 3R4RA 2Y5TA 2VWEE 3HUJE 3O2VL 3QFJD 3B3IA 2C4XA 4M6NH 1A9BA 4PY8I 2W92A 4S0HA 3WJMA 3ES6B 4X99A 4FHKA 4MMZC 4Q7DA 5D1QC 2D2OA 2WYTA 4NCC1 4NDMA 3MRBA 4GQZA 2IBZY 4POZD 1OSYA 3AC0A 3OPZH 1LEIA 2NR6C 2O61A 4G9FA 5EEWA 3MRRB 3LN5B 4M7LH 4IRSB 2NY4B 2EIMB 3VFPA 1S9KC 3LS5L 4JZNB 1O9ZA 5I9QB 5T3ZL 4EPSA 2MHAB 4P2RD 4DZ8A 4PJBE 1EEZB 2H2SC 5GJSH 4YSEA 1MUJA 4Q9QL 1BA9A 5KUMA 5IFJB 5T5FH 2C7UB 3BP5A 2AQ2A 3QWQB 4WUUE 3GT6A 5DD1L 3L7EA 3AGWA 1DJZA 2J3SA 2J21A 3EGXB 4KMTL 3TTSA 3VFGL 1OIOA 4LSVL 2H1LM 4JFFA 4XB3A 4XN8A 5BJTB 1N0LA 4Y9FA 1ET7A 4GBXD 1FNHA 3S48A 3UGEA 4AT6A 4RFOH 5I1EL 3C5JB 4JB9L 3HE7B 3VSQA 3PFQA 4DHLA 4DN3H 3FOLB 4KROC 4N2IA 4P2OA 2VN5A 3QJFA 3WNMA 1FVEB 1PD6A 3F04A 1UM6L 3ROLB 5DJYA 3VXPA 1J0JA 1S8DB 5EZOH 4Y4KB 3A4EA 3GSRA 3HMWH 3UZQB 1OALA 1GTFA 3G7TA 3UO1L 3QZLA 4DQAA 2X4OB 3SJVE 1YEFH 4MRCA 4UU9B 1R33A 4QTHB 4G7QB 3G9AB 2F54E 2AS5M 4FLSA 3HBZA 4YC2C 3IGKA 4ZMLA 3AMLA 2ZUUA 1SGKA 3HC4H 5AOLA 3KPTA 4O02B 4X5XB 3D51A 1AJ7H 4XBEL 2VLJB 2ZCHH 1NCAL 4A7VA 3GSXA 3VDAA 1YY8A 3MVSA 4H8WH 1U95B 1AZRA 4JVWA 4K3HA 4PRDB 3GEWB 3NACL 1ZGLP 2WXQA 4PTTB 1Y07A 4AVJA 3L3HA 4FQQA 3IRCA 1FVCB 1ZDSA 5I8OL 3QQ9D 3UPAA 2FHFA 4TM9A 4MCYA 5FWQA 3QA3B 2NZ9D 3NMEA 4PSRA 4ONHA 2YXFA 2FRGP 2KL6A 3LS4H 4KO7A 3HAEG 4JFOA 5FFGA 3FQTB 2CE6A 1UWEH 3FBQA 3QS2A 1BF8A 2VDLH 4YUEH 4DGIL 3KLAA 2ZUWA 5JXAL 3STZB 1LK3L 3QK0A 3B2UD 4IGBC 5JNYB 1DEEB 3RX8A 3QG6B 3MA9H 2VW7A 1A3RH 2ZWZA 1X5JA 4IKJA 2RQEA 4N68A 3WJJA 3WJLA 4AUUA 3MFGB 4ANXA 5KOMC 4O02L 4DK3A 4G8IA 4WGKA 1E5CA 3MO1A 3V4VA 4FJYA 5EBMB 6PCYA 3MRQB 5LBSL 3S3PA 1JGDB 3MRMA 5IGXL 4C56A 3WGUB 1F4AA 1QRNA 3PGDA 3F7RA 2ZUTA 3MGAA 3S88H 1N7ML 1SN5A 4PJAF 4U2YA 4LEOA 5CF3A 1J0IA 2NSQA 4E5XA 1IBGL 2CMRL 3ILDA 3RPKA 1G7LA 4LXFA 5CEZE 4WI0A 4QXGH 2B0SH 3FFCE 4NXKA 1B2YA 1IC4L 3N43B 3ARGB 3TFKD 2IGFH 2OZ4H 3II3A 4ODHH 1FFOB 1A7NH 2DRUA 3FONA 4J3UA 1TEGA 4LQ1A 2EYRA 3IJYB 4FXLA 3CZUB 1HH6B 1NIFA 4Q6IB 4AEHL 4LPTA 5T5FA 3Q0HA 4BK8A 1T7WA 3UZEA 3T3MF 4JFUA 3RZCA 3FT9A 3SDXB 4F8PA 4AG4L 4ALAH 1BFVL 2WWNA 5JPNA 2LOEA 5K33A 3AU1B 3DHJA 4GG8A 4MASA 5FC9A 4NKMA 3ZRSA 1BHGA 2HFEA 1BZ9A 5DK2A 4U6VH 4ERSH 1FBIL 1KBGH 1QRKA 4FXGC 2COVD 4WJG3 4TLSA 2CBMA 1GRWA 4WV1C 3CVHH 2HJKA 3CZFB 1TQTA 4C4KO 4DW2H 4Z7OF 2GITA 1KXQA 3BQUA 2RBLA 4PD4J 3BN3B 3DYMA 5E2TH 5B38B 2ZUSA 3NIGF 4TNWK 3OKMA 4R7LA 2IPKB 1G6RH 5MEPB 2AK4E 4PVNA 1IC7H 4JFSA 3HI1B 4QRAA 3QXDA 4YBLC 3ZOAA 1JYVA 1MQKL 1XCQB 2BNQE 1JZ8A 3CFEA 4G2AA 5K5YA 3BVDB 4YXKL 4KNUA 3L3IA 3EGDB 4MXWL 4BZ1L 4F7PB 2W9DL 5FUOL 3EBIA 4Z7WE 1MLBB 3CE1A 3NFPA 3W11D 4OU3A 1SRDA 3LPFA 3HG1B 1TOXA 4UINH 5DZLA 4KY2A 5E6IA 3ZDXB 5MP6L 5FYKE 1Q9LA 3EF4A 5CZXD 1A6ZB 4QEGA 1I4FA 1I9JH 1RK1B 2RH0A 4J1UB 1IX2A 1AE6H 3RVXC 3P30L 2XQYA 4N8VA 4JKNA 3JWNC 1UJ3C 4M43H 4JBSA 3B2DC 3SGJC 2IPUG 5DVKA 2CK0H 2R1YA 3KVPA 3O0RL 2VDPB 4BK5C 4X7TB 5HDBB 3F6JA 3OC5A 12E8H 2VR6A 4RWHA 1MZYA 5AD0A 2NXZD 3BDBA 5FGRA 1XR9B 3VYPA 2H0PA 4R7XA 5DWUH 2BSTB 5FV1L 4AY0A 2Y7MA 1OGAB 3W39A 2EVGA 1A6UH 1JMZA 4MYPA 5T1KD 2F74B 1ZTMA 3NFSL 4YSUA 1JMXA 1WICA 3ASWA 3NJJA 1ZHLB 4O58L 1W2KT 5DHEA 5J1TC 2A9DA 4LLQA 4HF5H 5IOKA 1PG7W 4RDQG 1V7MH 1GYCA 2JKIS 2EYSB 2HFGH 2J1KA 4PWHA 3SGEH 1F6AA 2AGJL 2K3HA 3CSYB 4M4PA 5FCUL 2P8PB 3LN4B 2ICEC 3BPLC 4XO5A 3CX5J 2X53A 1TZIA 3MRNA 2DW5A 4FZ8H 5EZIL 5T33L 5T1LA 3NCYS 4M1DL 4QR7A 3F2LA 3ECWA 4V1DB 4WFEE 4NQCE 4F9LA 3QQ3A 3DJTA 1N4XH 43CAA 3FZUC 1LMKA 3KXFD 5SWSE 4PCYA 4QHNA 2XACC 5ITFB 4MJIA 2WWMC 2AW2A 4G6KH 1XGTB 2UWEF 3BAWA 3U4BH 3D0AA 4HC1H 4JKLA 3HBQA 3HC3H 5C08B 5KVFL 1ORSA 4NQVB 1IGIH 3ZLQC 1E4XH 4JKWA 5ISZE 1RLBA 4MDJA 1TTFA 2WCPA 1C9SA 2OZ4A 4XNDA 1JZ7A 2E47A 1XZ0A 5JPMC 4MS8D 2M8XA 1O5PA 2VR9A 2ADGB 5F9AC 4NRXA 2CKBB 1RJLA 1T20B 4UOJA 1E3FA 4FN0A 1WZ1H 3BRGC 1ITBB 5DS1A 4JM2B 5ESVB 3PJSB 5JIIA 1PY0A 5A2LH 1PZ5A 2OJZH 2QGDA 1NGYA 4KWUA 2IDCA 1HIML 3WMQA 4A2LA 4PJ7A 3TYFB 1HHGA 3IGFA 3BAJA 3QPQD 4WWOA 2WLNA 1Q8MA 5DS8A 3CVHA 3LEVH 1DVFC 1JF1A 2NY5H 1UWGH 4OZ4A 2X2HA 3P40A 4TS6A 3RPIA 4KVNH 4MB4A 4RETB 4CRPA 2VQ4A 2GJ6B 3VSVA 1HOCA 2BHUA 3CQPA 3BVWA 3L8QA 4GP4B 5IFHL 4JHUA 3BH9B 1G6RA 4ZUSA 5HHOE 4MA3B 3CFJB 4ZW5A 3D3VE 1B4RA 2WY3B 4QRFA 5ESQB 1QLEH 2VDOH 1FE8L 3HE6B 1SVZA 2BY1A 3VU2A 1JWUA 2DMCA 1E27A 5DJ2A 1DVYA 5KVGL 4JFDA 2NX5B 4GIOA 1E40A 3C5ZC 3DX7A 1J12A 3MOQA 3OKLB 4IOIA 3HC0B 1K2DB 4OF6A 3BP6A 4Y9GA 3T77B 4A6YA 4X0KB 1RZGA 4JRXD 4NO0A 4B9ZA 2WCGA 4N25A 1HQ4A 3LD8C 4AM0Q 4DERA 2CKBL 2VMCA 4PIBA 1BQHA 2QPUA 4D7BA 4EEEA 1NMCC 1T1WA 2BC4B 5C0AE 4K9EH 1J8HD 1IGCL 1ZXQA 3QJOA 5I8EA 4BH8A 3HPLB 4UQ3B 4KHXH 3FB8B 3V6ZA 1AI1H 2YD7A 3LKSB 1OAYH 4B5ZA 4EN3B 5TE4H 1JFQH 3NN8B 3O6FD 3HR5A 5HD8D 3CLEH 1MJ7L 2WMPB 3D2TA 4XPHL 2KBGA 1UT2A 5I19L 1K72A 1MVUA 1TLMA 1U2HA 4GXVH 4LP5A 4NKDB 4R2GD 4NGHH 4AMKH 5IVNA 2A5UA 1T7VA 1Q0YL 5JHLH 1BFOB 3A6OA 3DRTB 4PREB 3IXAB 1SXNA 4OV5B 5IR1A 1R3IH 2YQ2A 2CALA 4MQSB 1DJXA 2EVIA 1URLA 2Z7ZA 3MJ7B 5EU3A 5FCSH 1AQ8A 1J7VR 2O5NA 1ADQL 2CDGB 2I5YL 1UZ8B 4G8GE 1HT6A 3ZRCC 1QO3B 5IEHB 1UZ6E 4TNVK 4NBXB 4A7GF 3D07A 4GB9A 2X3CA 3GSOB 5AL0A 3KR3L 6TAAA 5CUSL 2FD6H 4A2DA 4FFVD 4HV8B 1R3HA 2AJYH 2BVPA 2EIZA 4JKKA 4OI9A 3IDJB 4FMKA 4N3UA 2Q2EB 3SE3C 4DOHE 4Z9KB 2C1PB 1T2JA 3BUDA 2AJ3A 4N0UE 3O4OB 4PJIF 4UT9L 1RZIB 1KCLA 5LNEA 2HN7B 3US1A 2HVKB 4CMHC 4NQDA 2C9QA 3PHAA 2WYIA 4HC1A 4KRPD 1Q90A 4HUMB 4WVRA 2BSEA 2VRKA 4BE6A 3JTSA 3ZE2F 3SDDC 2FJGB 1WTLA 4X4XB 2H8PB 3OZKA 2X4SA 1VKXB 4GLRI 2H0JA 4QPEA 3PG2A 2NY7H 4HJJL 2FLMA 5EBWA 4K2UH 1S9VB 5ETUB 5EDSA 4GUOA 3S2AA 5DFAA 4MD0A 3E80A 4TLTA 2EINB 2UVEA 3CH1A 1OAZH 2VJ0A 4U33A 5E2UH 2DWYA 3HTLX 1A7PL 1TVHB 4FQXD 1HDMA 2CUAA 1Y1UA 2SEBB 2WIIA 3O9WC 3PWPE 5BVJA 5J0BA 1DBML 3K4AA 3EJQA 4JQXA 1OCWL 5I73C 5B8CA 2WKGA 3QT2A 1QWUA 1YCSA 2EXWC 3EFDH 3MODL 1IGFL 1NMBH 4V2CB 5KN5A 1G6VK 1I1FA 3QUZD 3VNYA 4FFZL 4LOVA 1UA7A 1OCCB 4G8AC 1WFMA 3MJ9H 4IU2A 3KPNA 3MRIB 1ZKAA 2YFOA 3Q05A 3VI3E 2WWKO 3DOSB 4Y1AB 4HCFA 3E7JA 4D7PA 5FHBH 5LHDA 4K07A 3PXJA 3UYRH 3TCXA 4FE9A 1AMXA 1U8CA 4FNSA 4PU2A 4PRNB 1ZLVH 1IU1A 1D2PA 1NOFA 3M07A 2V3FA 4KI5F 2CR3A 1WAAF 3MUGB 1JHLL 4R4BB 1AO7D 2CCVA 2A38A 1QQDA 1KN4H 3NSXA 2AEPH 1P7BA 1GGCH 2NTFB 3FT0A 2FATL 2CBTA 5HGDB 5CMAA 1J1PL 1KFGA 3GRBA 1QBLL 1TCMA 1UB6A 3WE1A 1QD0A 4Z0BL 3KYNA 1OAJA 4OJEH 1G9MH 3MLZL 1XTMA 4MB5A 3CPUA 1Z9MA 4UYQA 2HWZH 3R0NA 4HOZA 4QWWC 4DP9X 4XPGL 4JN2B 5KVDE 5CR1A 4KV5E 1S5IH 4ZFFB 2FH6A 1MEXH 1PX8A 1IQDB 2EDFA 2DIAA 5T3XL 3WFBH 4PW4A 4Y19B 4OZIA 4L4VD 3K72A 1ZCRA 4XXWA 3DOHA 3IFLH 5BW7A 2GFBA 1E5UI 3FT2A 1HCZA 1NUNB 2A6JA 4LRIA 3UDWA 2UZXB 4MQTB 1UHVA 1QVOA 4K3DH 1XF4A 1A14H 2LV4A 2VLRD 5JHLA 3CVBA 3JV4B 2IFGA 4U1JB 3ILPB 4A39A 1U8OB 1CE1H 2CGZA 2JI2A 3WHE0 5ID1A 3HUJB 5F7AA 4KGLA 4XMZA 4PJDE 4FQ1L 1ZSHA 4ZFZA 4Q2ZA 3CDYA 3MRRA 3LN5A 4IRSA 4DKAA 1QZNA 2JCWA 4JX0A 3QCUL 3OV6A 1OTUC 1N6VA 3O6KL 1A8ZA 5I26A 3B34A 1PTZA 5GSVA 4LKCB 4MA8H 4RZKA 1IM3B 1EJOH 3K5RA 5AWNH 1N5YH 5JDJA 3WHXB 1SXCA 7PAZA 4N1HB 2LGNA 5CJ5A 2YFNA 1WZAA 1Z3GH 3GBML 3BD4A 4PJBB 5CINL 5BJTA 3DXAA 1PYWB 3QIWC 4WUUB 3CVDA 4N0FA 2PXYC 5E6YA 5CD3A 5HJ3A 1E7VA 1AXSA 3FOLA 3QUKA 3VRJB 2ICWB 1IIKA 2YC1B 3ROLA 1ZHNB 4ZSOA 4FRWA 4MMXB 3B9EA 1AC6A 2Z91B 1EEUA 4P59H 2IANB 4UTBL 1DFXA 5TE6H 4LKXA 1J1OL 2A9BA 5BQDA 2WLIA 3NEEA 5JQIB 1UGKA 3O4LE 5KS9B 1WVZA 1YEJH 2O5XL 2PWDA 3L3GB 3U9UB 4X6CE 1DVSA 1RPQA 4OLWL 3SJVB 3H2WA 3I2CL 3DJZA 4K8RD 1N6QL 4PCTA 1NM4A 5SX4H 2F54B 2NY6C 2OJ1A 3KPRE 2QADD 4N1EA 3DMMC 1YMMD 3MJ9A 3MRGA 3QHZH 1U95A 1CFNB 2WYHA 1IGJB 2EXSA 2WYZA 2DDQH 2C9UA 3LHPL 5TQ0L 4Q97A 1ML0A 4PRDA 1FH5L 4DP5X 5CEYA 3VXSA 4EKXA 4XT1C 1NEZB 2WAQA 3QEQE 5TFSL 5IJCC 3UZVB 5L6YL 3QO0B 3FU9A 3MGTB 4MA1C 2V0AA 1Q1JL 1KCSL 4PJEA 2PTVA 1KPVA 4XPBH 4OGXL 3OAUH 2B39A 1U30A 2V5YA 1USQA 4M5YL 5CLZA 3SD2A 4BHUA 1KGYE 2VSDA 2XWBB 3M46A 5CCJA 4NNYA 1V05A 3JWDC 5C07D 1PNDA 3FQWB 4J6IA 5CGBA 4PB9L 4XN1A 3FN0H 5EIVA 1SLXA 4JFZH 3ABGA 1IMHC 1A3QA 1G9HA 3U1QA 3QR2A 3VDCA 1X5HA 2NZIA 1WHOA 1BX2B 1U92A 4ONGL 1DUZB 4AL8L 3CZEA 4W9ZA 4LL9A 3WUZA 1OT2A 1R0AL 3SGKC 1JZHA 1EUTA 2BPBA 4MBRA 2F5BL 4L8BB 3SPHA 5ACLA 4JRLA 4Z7VA 3PWVA 3VCLA 1MOEA 1FL3A 1OO2A 1Q72L 3GXIA 3RWJB 2JIXB 4ZFQA 4A2EA 2J88L 3L9EA 1AS6A 1JGDA 2FVNA 3GM0A 4PI2A 4ZFOB 2XZCL 1KEGL 1QEWA 4R5XA 3THMH 3V7MA 2QSCH 2XWXA 3CDFA 3RNKB 1ZIAA 4KKQA 3PL6D 1BCIA 2GSIA 3SPJA 2DMBA 5ANMB 3I9AA 3QDGA 4L37B 2H26B 1MREL 4UF7C 1CFQA 3MRDB 3NCMA 4CDHA 1ILSA 2FGWL 1TTUA 5F0LB 3TP4A 4M5TA 1FO0B 5DYOA 3LNFA 4JJ5B 3V6FB 3IU4L 2C8NA 5I6XC 1B3IA 1HH6A 3FFCB 2GIYA 1KIQA 3ET9F 3NA9L 3MNVB 1KGXA 4RX4A 3OMIB 2DQUH 2GJRA 5F6HI 1IUZA 2P5WD 2BX5A 2HKHL 3WKMH 3MRKA 2OPCA 2VUOA 3W9EB 5KJ7E 4L8SC 5AVXB 3WTWA 1CG9B 3B7UX 3QIBB 3WTYA 4NERA 5JDSA 2CJUL 1XGYL 1H5BC 1MI5B 2H41A 1BZEA 1HHHA 3F5WB 2V5TA 3RUGF 1BF5A 4TRPL 1A9VA 4ZFOL 1MFAL 3MR9B 3SPVB 4JZJA 2IPKA 4PJCF 1MCOL 1AYOA 4PJ8A 1W9XA 2WXPA 3T4AB 5TDOA 1ICTA 4OVUA 2OMYB 1JGEB 1EXGA 5J89A 1J5DA 1R6VA 1T5XA 2ZKMX 2ZXGA 4X8XA 3QUXD 3HZYA 4A2GA 4P3DB 1YN6B 1F1AA 1UFGA 3SCMC 3RGBA 1JV5B 1H8OA 2AK4B 4F33B 1LGVA 1MELA 5C2BH 4KTYA 2BNQB 3FUIA 1MLBA 3UABA 1YEEH 1GXEA 5MENE 1P4UA 1DN0A 1G7IA 3NIFE 2C1OA 3S3CB 3RILA 1KGJA 4LF3A 3QFJA 3S8FB 4EOWL 4U3HA 3K74B 1A6ZA 1BD2E 4RWYH 4Z7WB 1D5RA 1J9SA 4I18B 2X0VA 2NCEA 1GA2A 5D1ZC 2EDYA 3MJGX 4DEPC 4PJ9B 1D5XB 2NY3D 3MV9D 2EO7A 1R24B 1WHPA 2IGTA 1PCXA 4PVBA 1UA6L 5EU6D 4AIXA 2D31B 4PWEA 1G7QB 2B16A 1AHWB 3QXTA 1CGVA 2A77H 3TN0C 3VVWA 1CE6B 2JVUA 3H42H 1OAKL 2KLRA 1SEQL 4O2EA 4R4FH 2A1WH 3C87A 4U3XA 2Z4QB 3GLDA 2EDLA 4LCWD 5BUAA 3CFQA 4H20L 5DO2C 5FYJD 2VITB 3R0MA 3PHQA 43C9B 5BO1L 1T03L 1WJ3A 4L4TD 5MEOB 4KOCA 4NNXA 2QDWA 3DK2A 4GBXA 4N9OB 1B6DA 2ORBL 4KO6A 3T2PA 4MTMA 2P8PA 3SKJL 5K9JL 3AMKA 4TUKH 3ZT7A 3DX8A 1P7QD 5E23A 4BKLB 1V3MA 4NCDA 3TJHD 3QQNA 1OWRM 5D93C 1AXTL 4WNJA 5DMKB 1YQVH 5AZ2H 5CFHA 5GGUB 1YY9D 1NANH 1G0XA 3HNVH 3BAEH 4U1GC 2A9MH 4JM4H 4MAUL 2XQBL 3CHSA 1XGTA 1W72H 2W1NA 4X50A 1SVCP 1ZV5A 5FYKL 1T89A 2FSEA 2Y7NA 1MRCH 3CBKB 5SWSB 1YSOA 4U6HA 5HSFA 3I75A 2EIBA 5DK3A 5DRXB 3FCSB 3HS8A 1M7DA 2VDNH 2Q8BL 1E8XA 4NQED 4CNIA 3CXHJ 2I7OA 3H9ZA 5BQ7A 5FO7A 4PJFA 2B4CC 1CTOA 5FDWB 3B5HA 4HU2A 3Q5TA 5BOZG 4MD4A 1ZANH 4M61B 1DJIA 2G2PA 1VACB 4XBGB 1OF2A 5ISZB 3SYPA 3BGFB 4LSPH 4UZGA 4KPHL 1ZSDB 1MXGA 4I7ZC 2DQDL 1SEBA 3L54A 5D7KE 4YDKL 5DUPL 1TDQA 1J48A 1NFIB 4YQXH 1KXVA 2V7NA 2EIEA 4Q74A 2EC9T 3TYFA 4W93A 3ZK0A 35C8H 1P4BL 1PFOA 1KCKA 4H26A 1AZUA 2QQKH 3NZHL 4RGOL 4BQBA 5JIQA 3PRZA 1NDTA 1RZ8B 3PY9A 1DBJH 1CICC 5C6TL 3CSGA 4DGWC 1NZRA 4PWFA 4OLZL 3FAXA 3FSVA 3BWZA 4GKZA 1VB9A 1XGPA 1II4E 4HUXA 4MA3A 3QAZC 5ECGA 3F58H 4LLWA 5ANHA 5IQ7L 3R7RA 4WI7A 4F8NA 4JY4B 4U7KA 2R0LH 4MMZB 5L8KB 3OJDB 3Q8BA 1BEYL 4D3CH 1DSFL 3QEHB 4KKAD 4D8PA 4F58H 2OK0H 4C4BA 1PKOA 3APFA 3E6HB 2DL2A 3D3VB 3OKLA 4PV8A 3HC0A 4HAGA 4P2AA 4I8DA 1E6JL 3TBYA 5E4EC 3TIEA 4ZS6D 1E30A 1ZK5A 1Z3RA 4N0CC 3H7BB 2CO4A 3P9MB 4HETA 3RQ3A 2XWJB 3RX7A 2D7MA 3A24A 3GHBH 4HS6A 4YHNA 4Y4HD 1R47A 3LV3B 3ZY7A 5EU4B 4UQ3A 4KQ4H 3I74A 2HT2D 4JZOB 1NMAL 5C0AB 1FPTL 5D2LA 5CJQH 2DQIH 4JCMA 5FO9A 2F53D 1RI8A 3S5ZA 5T1DH 1G7HB 2F5AH 4RGNC 3RX5A 4KROB 3K6OA 2KS0A 2AXHA 1AQKL 3BZDA 4F15C 1FZOA 5CWSB 3JVGC 5T3ZD 4IIQB 3ULVF 2BWDA 4LL1A 2AZUA 4D9QE 1O9WA 2ZAGA 4NLHA 4PREA 4OZFG 4OV5A 5EEXA 5LG1A 5HVHC 1ZT7A 3PS6A 2BP8A 3IJ9A 1T1YA 4KAQH 4E9RA 1LNUB 2BIOA 3IFPB 4Z3TA 1IE5A 1J0YA 4AGQA 5IEHA 4R90L 4YSSA 4YC2B 4EZKA 3NTCH 3TPUB 4PY8J 4PJHE 4R83A 3S4SG 1NKRA 3DOIA 1NOAA 1IV8A 1ZT4B 5EBLA 1JZ4A 3KH4A 4FULA 2OMVA 1HQRB 5CIPB 4AZUA 5K59E 1FNGA 3MCYA 5JYLA 2PN5A 4AYEC 4AZ8B 4QF1B 3CSTA 2X9YA 2C1PA 5IESL 3CN1A 4GQQA 1RZIA 2BDNL 2MOQA 2NPLX 1SDDB 3VM5A 1XAUA 2QQQA 3KJ4C 1I7RB 2BIIA 3GI8L 4ZUVA 3VRLF 1W72A 4XGZA 1JWSB 3CN3A 1Q0EA 3BUPA 5DHYB 5G4MA 5EF3A 3NOIA 4DOHB 3FFOA 1BMZA 4F7CB 4Y8DC 5GZOC 2IQ9L 3H3KA 4HIHB 2CRMA 1VKXA 1EAQA 3MTXA 4JCWA 1LQSR 3V4UH 5LQBH 3U7YL 3CZLA 1FP5A 4FD0A 2B1AH 1B6UA 2QL1A 5ADPL 3MRHA 4OM1H 5F9OL 1UD4A 3K8KA 3B2VL 3R8BB 2VXSL 3RVTD 5A40E 1PAMA 3T0DA 4JGNA 4OTXL 1TNNA 3VMPA 2FX7L 1W0VA 2BVTA 5DJ8B 1M6OA 1I8UA 4XP1H 1MCIA 3RI5K 5SV3A 1TVHA 2OW7A 4GI6A 4IGBB 3TNMA 4ZFGL 3CDZB 1KENH 2FIKB 4PV9A 1W6LA 2YBRB 3AM8A 3TO2B 2MIZA 1EZLA 4RRPA 1WAEA 1KB5B 3HAEH 3TBSA 4JPKH 4ZO9A 4XCFH 3PWPB 2LVCA 4KXZI 5D70H 3MBXL 3FU7B 2AEQH 4AIOA 4HIQA 4TULL 3VFOA 3T8MA 4HVBA 1KFAL 2Y7QB 3MV8D 1P5UC 4FMFA 4AQ8A 5FA3B 1AHMA 1WG3A 4FQ2L 1W15A 4Q9RL 1JPTH 2YRZA 3VI3B 2EIDA 3A5VA 3ATFA 4LDOB 2BOCB 5IFAL 3BAKA 2A4ZA 2HH0L 5HGDA 1JCKA 3KYMB 5FV2A 5LGYA 4XN5A 1KGCD 4XZUB 4HYTB 3KXFA