3FSAA

Pseudomonas aeruginosa azurin with mutated metal-binding loop sequence (caahaam); chemically reduced.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
122
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLEQYMFFCAAHAAMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Azurin
publication title Metal-binding loop length and not sequence dictates structure.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 29
structure length 122
sequence length 125
ec nomenclature
pdb deposition date 2009-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fsaA00
2OCCB 3UGEA 3PXLA 2DWSA 2B08A 1NPNA 2EIMB 2BW5A 2JKWA 2I85A 3OQRA 1OCZB 3UACA 3FS9A 3SBPA 3WIAA 5FC9A 2VW4A 4G7SB 5AZUA 3FU7A 1W6LA 1A65A 2YAQA 2PP7A 1VLXA 1ILUA 1KCBA 4YSOA 1BXAA 3KW8A 1X9RA 3N55A 3GXUB 2BZCA 2YAMA 1E5ZA 3BQVA 4X4KA 4YSAA 5B7MA 3C75A 2AVFA 2IH9A 4E9WA 3NJJA 4Q8BA 1WA0X 4DP8X 4GP4B 1AZRA 1SDDB 1NIAA 4KOCA 1ILSA 4E9XA 5E9NA 5TK4A 5B7FA 2FTAA 5PAZA 4CSPA 2GC7C 2DYRB 3S8FB 4F2FA 1QLEB 5B1JA 3PCYA 1ASOA 4DP7X 3NP3A 2PPFA 3ZBMA 1IKOP 4A2HA 2XX1A 2HRGA 1AG0A 3T6WA 3TU6A 2QDWA 1NPJA 4DPBX 4FAAB 2IDSA 3X1FA 1ID2A 3OD3A 1PZBA 5LDUA 4P5SA 1PY0A 4QLWA 4YSUA 3AG2B 1PZAA 2J55A 2BP0B 2VSKB 3AG4B 4DPCX 1AQ8A 2RACA 4JKNA 5F7AA 3PPSA 4UANA 4AKPA 4F7KA 3IE9A 1ZDSA 3QJSB 1GY1A 2HLEB 1BYPA 4GXFA 5D4JA 4NERA 1AZNA 1L9QA 5PCYA 1E5YA 2B3IA 3FSWA 3FSZA 1MZYA 2GI0A 1DZ0A 1JZHA 2IWFA 4DPAX 2VSMB 1J9TA 1QHQA 3ZX1A 1BXVA 1JZIA 3FQ1A 3NJMA 2FT7A 1JZEA 3RYMA 3JT2A 3D12B 1GS8A 1AOZA 1W6WA 3H4HA 1OE2A 1AG6A 4BK5C 1ET7A 3X1EA 4MFHA 4JHUA 4HZ1A 3EF4A 1MG2C 5I5JA 3X2QB 3QJUB 3WG7B 1T5KA 4HHGA 4M4RB 2PLTA 1JXFA 1HFUA 1AIZA 2YAEA 6PAZA 1RZPA 3FU7B 2XU9A 2J56A 3NJNA 1YLBB 1NZRA 2UX6A 2UXVA 1OE3A 1I53A 2GIMA 1ET5A 3FPYA 2EIJB 2PCYA 2IH8A 4AI7A 4EF3A 1WAEA 1JXDA 1ET8A 4G7RB 2GB2A 3PAUA 1NINA 2JXMA 5I6MA 1IBZA 1KV7A 1NIEA 1TEFA 1FFTB 4E9TA 2Y1AA 3FSVA 2XV3A 2Q5BA 2WO2B 1NDTA 3U25A 1W8EA 2CCWA 1BQRA 1L9RA 1KDIA 2UX7A 5I26A 2R7EB 3FU9A 1V55B 3QPKA 5I6NA 3NSDA 4NB7A 4A66A 3ERXA 4DP5X 1KCWA 3NJKA 3SQRA 4G70B 4A2GA 2TSBA 2UXGA 3CVDA 2YARA 4AKQA 1B3IA 1WA2X 3IEAA 4BWUA 1JVOA 3KW7A 2AANA 3NJFA 2PP9A 2YAOA 4A2DA 3CZUB 2CUAA 2HX7A 2DYSB 3EHBB 3T9WA 1J5DA 3FYIB 1PF3A 3FU8A 3V9CA 2W88A 1WA1X 5B1KA 2OV0A 1OE1A 4HALA 3GDCA 1CYWA 3T6XA 1KBVA 1OCOB 1X9UA 2X87A 4Q89A 1OCRB 5ANHA 1AACA 1PCSA 3NYKA 4YSEA 1AS8A 1FWXA 2FT8A 1OCCB 1IC0A 1ASPA 3DTUB 5B3SB 3DKHA 4UAHA 2YAPA 3IN2A 3IBOA 4CSZA 4DP4X 4GYBA 2X88A 3ASNB 2H47C 1E67A 1ETJA 2BW4A 1A4CA 2DWTA 2PPCA 5I5MA 2HZHA 1PLBA 3TBCA 1XB3A 3HB3B 4L0PB 3IN0A 1ADWA 2AZAA 1AANA 6PCYA 5I6PA 4KNUA 2YAHA 4RH4A 2FJSA 2OJ1A 1IBYA 4HHWA 4KOBA 4M3HA 1KGYE 1SHXA 3QJRB 1XMEB 2N0MA 4AKOA 2I7SA 1BEXA 2FT6A 3PAVA 1ZV2A 2IWEA 1JZGA 1MDAA 1A3ZA 4A67A 1A8ZA 1KYAA 5I6KA 2FWLB 4N4YB 1GS7A 2GC4C 3TA4D 4KNSA 2FQDA 3FSAA 5B7EA 2J57A 5IY5B 4HCGA 2ZONA 1RZQA 2IDTA 3BVDB 2HX9A 1PAZA 4BDVA 1QNIA 1ZDQA 4NAJA 1AR1B 3OM3B 1BYOA 1WS8A 2XUWA 4HCIA 3QQXA 2Q9OA 3CVBA 1PLCA 3TBBA 2VW6A 2BP8A 2FQGA 1SFDA 3ASOB 4P5RA 1TKWA 1XB8A 2BHFA 2J5WA 1DYZA 3PLYA 3QJVB 3FQ2A 2XYBA 2BWDA 4YSTA 2CAKA 1EZLA 2IDFA 3ZDWA 2PPDA 2P80D 1NIDA 1J9QA 2P80A 3T71A 2GBAA 1PZCA 3UAEA 1URIA 2HX8A 4WKXA 1GYCA 4ENZA 2LLNA 3MX0B 2NRDA 2PPAA 4E9QA 4ZK8A 7PCYA 2IAAC 4HCFA 1NWPA 3ABMB 3S3BB 4A68A 3AZUA 1A4BA 1CC3A 2H3XC 4PCYA 4E9VA 1TEGA 4YVNA 2QPEB 4G71B 3FYEB 1NIBA 3ABKB 1BXUA 4YVUA 2YXWA 3NSYA 3OMNB 1OF0A 4BWTA 3H56A 2YXVA 3PAZA 2FQEA 4GP8B 4HAKA 3CVCA 3NJHA 9PCYA 1NIFA 3NSCA 3FQYA 2UXFA 2PCFA 4W1TA 1AZCA 3EH4B 2XV0A 1WS7A 1GR7A 4DP0X 1RCYA 4E9RA 2ZXWB 1CURA 4QKTA 2UXTA 2CJ3A 4YSDA 4W9ZA 2ZWNA 4YSRA 5EHFA 1BQKA 2QT6A 4KO7A 2VN3A 2XXFA 1IUZA 1SF3A 3CDZA 1E30A 3OMAB 3SBQA 4BWWA 2MTAA 1AS6A 1L9SA 1XB6A 3FT0A 2TSAA 1OOWA 2W8CA 3ABLB 1PMYA 4A2EA 2VW7A 2I7OA 3WNIA 2HRHA 2EIKB 2VM3A 4BXVA 1L9OA 2VM4A 5I6LA 3NJIA 3NJLA 3NP4A 1F56A 4KO9A 4BDVB 2H5UA 1M56B 3WNJA 3CG8A 5D4IA 1ZPUA 3UADA 1PNCA 2Y69B 3WKQA 4HIPA 1L9TA 1ZIBA 1CUOA 1E65A 2XLLA 3DIVA 4GY4A 2IDQA 4DP2X 1ZIAA 5F7BA 1V10A 4GP5B 2BP8B 1J9RA 3OMIB 2WO3B 5D4HA 4YL4A 2ZOOA 1NICA 5AKRA 2CALA 1PLAA 2PPEA 2VMJA 1GS6X 3S8GB 4YSPA 1HAWA 1J5CA 3G5WA 3T6VA 2XV2A 3S3DB 3QJTB 2EINB 2MRYA 3S3CB 1PNDA 3ABGA 5B1JC 1GW0A 4KNTA 1J9SA 2A3TA 2XWZA 2R7EA 3WKPA 4G7QB 3X1NA 2PP8A 2QDVA 1JXGA 3X1BA 2FQFA 1GY2A 1RKRA 2GHZA 5A7EA 5I28A 3FPXA 3UAAA 5I6OA 2JFCA 4K9JA 3EH3B 4DP1X 1AS7A 4N8UA 1NWOA 2WSDA 3ZIYA 5I5IA 1N70A 1R1CA 2XXGA 3AW5A 3TASA 3MBWB 3AG1B 1JERA 3NJGA 1OV8A 3NT0A 2XVBA 3JTBA 4YSCA 3GYRA 1JVLA 1V54B 1HAUA 1AAJA 4KO5A 4FA7B 3X1GA 1NTDA 1TU2A 2DV6A 3CDZB 1SNRA 1CYXA 2CBPA 4YSSA 3WI9A 4F2EA 1SDDA 2EILB 1ASQA 2IDUA 2XX0A 1SFHA 4JHVA 1BQ5A 7PAZA 1UATA 1A4AA 2DY2A 2BO0A 5B1AB 5AFAA 1EHKB 1SJMA 1JOIA 3SBRA 2YAFA 1MZZA 1JZJA 1M9WA 2GSMB 2YQBA 3N2JA 5TK2A 1SF5A 3HEIB 4YSQA 3QJQB 3T6ZA 2FNWA 2BWIA 4TXVB 4E9SA 1FA4A 3H4FA 2BP0A 1GSKA 4KO6A 2BZ7A 1N68A 1JZFA 3NSFA 1MG3C 4UF7C 4AX3A 4DP6X 4E9YA 4PAZA 4G72B 4AZUA 3L45A 3AG3B 4A2FA 2E86A 1M57B 4WTQA 1KBWA 2AZUA 5B1BB 1SHWA 8PAZA 1L9PA 3AY2A 3EH5B 1AZBA 4BXSV 1BAWA 1KDJA 3UABA 2HXAA 2AFNA 2IWKA 3V9EA 4DP9X 1AZUA 2QPDB
chains in the Genus database with same CATH superfamily
1GOFA 4NJAH 4OLWL 2VXVH 2DWSA 4X9FA 1RD6A 3ZDYE 4MZRA 2BW5A 3FCSB 4NC2B 3WEOA 2VM9A 1EH9A 1IGJB 5DZVA 1IGYB 2P44B 4WUUD 2B16A 1J87A 2FL5B 5BOPA 3QQ3B 4WUUA 4KH9A 4M4RA 5EOQL 4EN3C 2CO7B 1MHHB 4HJGB 4LVOB 1UASA 3K1DA 1SOSA 4XOCA 4PRAA 4N2CA 3F7LA 4ZW5A 3C9NB 4IMLB 1TENA 2VR6A 1U95A 2NR6D 2YIHA 4XBPA 5ALBL 3KJ6H 4NNXA 1VCAA 2NR6A 3BAXA 2W65B 3LS5L 5F9WB 2QSCL 4EUPA 4HJJL 1D5XB 4HLZG 4PRPE 3SE9L 3KW8A 2MOVA 4WDIA 2QKIB 3IJSA 3P4MB 4LKCA 2VDNL 2Z0UA 4HKJB 5LDSA 3GXUB 5HJ3A 4TVPE 4GG6A 4YSAA 4HWBA 5B7MA 2P49B 3BZ4A 4XVUC 1CZ8H 2BIMA 5C0CB 1WA0X 4EQ3A 3C6LD 5BV7L 1KCSL 3TIDB 4XNQB 4ELKB 3C6LA 3BMVA 4EPSA 1LVEA 4FQLH 2WXJA 1CLCA 4PI2A 1YEFH 2P5EA 1GJIA 2GBUA 1GGTA 4M02A 4O00A 3BPCA 4OZGA 4P2QB 4PTUB 3WFBH 4H25A 4KJPD 2NX5E 4HEPA 1AD0B 2DJ4A 2YK1L 1U8LB 1B3JA 1ZA6B 1FIEA 2JQZA 2WNXA 3IJYB 4JZOB 4DPBX 3B9AA 4NFBA 3BI9X 3HN8A 4F7CB 1UD6A 1TTGA 4EEEA 1RPQA 5IBTH 3ESUF 1MCFA 4NQEB 5C7ZA 3VXNB 4IBSA 2DQJH 1UM4H 3VFSB 1P5VB 3EJTA 3CQQA 1FN4B 1AQ8A 2VC2L 1CGYA 4N1HB 1Y7VA 2G5BA 2WN3A 4IK7A 3RVVD 1MCRA 4LPXA 3B6SB 1N8ZB 3QHFL 1AZNA 2YJQA 5L4IA 3BWSA 2B3IA 4YBLC 3SODB 3VFTB 3VX0A 4DNLA 4Y1SA 4GINA 1JV5A 1BXVA 3NJMA 1JZEA 1IL1B 3D12B 3CVIL 4DUXA 1FFRA 2KS0A 1XR9B 1IB5A 4RNRB 4LHQB 4PJEF 4YIQB 1RHHA 4NENA 3ZE0B 4IYKA 5EBMA 2B0SL 2X1PA 3BLKA 1J88A 3SE4A 5FYLL 2C9VA 1Q1JH 4HHGA 3V0EA 5D1XC 4N2IA 3DUUB 3WIHH 1WEJL 3CN0A 4FG2A 4HC1A 4XO3A 1JPTL 4FQXA 3NJNA 4HCRA 5IB3A 4YLQT 2ZYIA 4IHOA 5BQ7A 1GPOL 4ODHH 2D31A 1RIUH 3HLAA 4OIAA 3H6AA 4NIKB 1TJMA 2OTUA 1XR8B 3GI8L 3T3PE 4BHUI 1T2JA 2JWYA 5AUMB 3V0AC 3K46A 1X5LA 4I77L 1JHKL 4APXA 1Y6NR 2P5PA 2VDRB 2XA3A 3Q01A 4JFEB 3HI1A 4AWJC 2YWYA 2AJZA 3P02A 3CXDH 4MA1C 4MQ7A 2M83A 4WWKA 1CBVL 3QDAA 1I7ZB 1IFGA 3PS6A 1QFUH 4RZKA 3ECWA 5JYLA 5IMKA 3C6SB 3EBHA 5B3JF 4C56B 1KGUA 3ILQD 3QPKA 3CDGA 1AMYA 2YLHA 3NEOA 5DK3A 3MNMA 1A7OH 1HYSC 5E8OB 1Q94B 3TBSB 4JREC 2A73B 4QGYA 4OM0L 2PP9A 3IF1B 4ODTL 2WLJA 3RG1C 2BHUA 3V4PH 32C2B 1KELL 2GSGB 2N56A 2FK9A 1GL4B 5TFSH 1P4LA 5MEOB 1XGTA 4XH2B 4B0MM 4NQCE 4EI6B 4K5PA 1OB1A 2DQCH 1X9UA 3OKOB 4QXUH 5DLML 3M17A 1ZLSH 1FC1A 4OZIA 2NYYC 3D0LA 1VFAA 3I50L 3NTCL 4JPIA 1AS8A 4OQTL 2IQ9L 3B2UC 3UO1H 4C4UA 2DD8H 4X5QA 2GSIA 4JFFB 5K9KB 1YEWA 1GCYA 3IU4L 3KVQA 4W9FC 2EH8L 2M2DA 1BAGA 1RUKL 2AXFB 1QBAA 3JVFC 5IEKA 3C5JB 4UT9H 2BIPA 1S9KC 1YMMB 4PWKA 3WNPA 3Q2CA 2JI3A 3LRSA 3SDYH 4L0PB 5C07A 4GNKB 5CINH 3VNZA 3SYPA 1FE8H 2HKFL 4JG0L 6PCYA 5AVVB 3GSVB 5F7YC 2AJVL 1OAZH 2VDLL 4GMTH 4YHIA 3OJVC 1QYGH 2A7BA 3CZEA 1NC2D 2V7NB 4PJ9B 2H2SC 4JDEB 1HQRB 1NC2A 1QNZL 3DSNA 4FNSA 2APTA 1IGTB 1JZGA 3KNBA 5BW7C 4JVPA 2F7QA 2O6DA 2MOGA 1DCEA 5GGUA 5T3ZD 1AKJD 1MOEA 2FATL 3TM6A 1AKJA 4MMYB 2R51A 1NGZB 4H20H 5F0MB 5A16B 5T8IA 2UY6B 2P42B 4PGJA 5E2VH 5I8EA 4O2EB 1HSBA 4XNUL 4ZFZB 5LJYH 5J6GA 4QTHA 4P2RB 4NLAA 1HCFX 1I9RH 2ED7A 3ETBF 1U8QA 1JTPA 1TZHA 5DD0H 5J89A 3FUKA 5DZLA 5CGMA 4GW5A 2OULB 1TVBB 1Z5LA 3R06A 1R19A 1MFEH 1WIUA 4KFMA 3WV0A 1E4XL 1FH5H 4FCAA 4HF5L 4XP9H 5D1QE 3ZU8A 1NIDA 2IH1A 4PRPD 3HRZA 4F15C 1JWUA 2LLGA 4PRPA 2VTFA 2NY4B 2Y1YA 4EZKA 2X3BA 4FZ8H 4UU9A 4TVPD 4Z7QE 4S1RL 4QJ4B 3ULUH 1GYCA 1G7PB 4ZFGL 1YAIA 5EOTB 1A6VH 4CBPA 3O6LL 3FN0L 1JAEA 3VWJB 3WAKA 4F91B 2C3VA 1JK9B 1M05B 5EBLA 1G4RA 2R56H 4MD0B 4OUUB 1YY8A 1PIFA 1OP3K 2GJJA 1I7UA 1EIBA 5FKPB 5C9JA 3ABKB 1CK0H 1OSZA 1D7CA 4EIZC 4YS4A 4FEIA 2AEWA 5SX4I 2GJPA 3H56A 3NA9L 2N59A 4H88L 5IESL 1KXQE 2NX5D 4OFQA 5T3XH 4YWGL 5KJRH 3B2VH 4NQDB 3O41A 1N6QH 3FQYA 4FGMA 5KUKA 2Y07L 3L1OL 1WS7A 2OMUA 3D25A 4M93C 3LZRA 5KYWA 3BCFA 1CDBA 2OMBA 4KVNH 3H42L 5B8CB 1RZGA 5IFAH 3A6CL 2LVCA 4ZTOL 1KC5L 2ID5A 1EEUA 4KO7A 2VN3A 1PBYA 1J1OL 3FUIA 2NY3D 2XQBH 3LQZA 4K15A 5JLZA 4GSXA 1KTBA 4U33A 1QWNA 2IJ0C 2ZAGA 3VXQA 4M62L 5ACZB 2QLYA 3TVMD 4AYMC 4EJ1C 1MI5E 3CFJA 3TVMA 3RB5A 5I19H 3IRCA 4UIMA 1P4IH 3QB7C 1J0HA 2IFGA 4PY7B 2XPGB 1LO2L 2F5BH 1U21A 1KIRA 4P23D 4PJBE 4QO1B 1M56B 2BPBA 1Q4NX 4P23A 1YJDL 2VDML 3N40F 2A9BA 4YXKL 4K7FA 5AZEL 1IM3A 4Z7IA 1FGVH 2BP8B 2ZXEB 3T4AA 25C8L 4RGNB 1NAKH 2HA1A 2EZ0C 2H7WA 1TTBA 5D1XE 5I82A 1IGFH 1V8HA 5F97E 4PJCE 1BJ1H 1WZ1L 4U0QB 2X9ZA 4OLYL 1NCIA 4UTAA 1S5IH 4IOFD 2VJ0A 5EO9B 3T2QA 1G7HA 3EJZD 3L3IA 2EDKA 3AAZB 5E8PA 4GRLB 1V05A 1GW0A 2IO5A 1Z9SB 2QV4A 5SWQA 4X80L 2Y7NA 1FV1B 2ADIA 5EFIA 5L9DH 2ZUXA 3G6JB 3A6BH 15C8H 1CB4A 3D6GA 4ZUSA 2D7PA 4WTZG 4X99B 4KDTA 3QPXL 5CD3B 3LNDA 4R90H 3QI9C 4XXWA 1WAAE 3ELQA 4JG1H 4PGBA 2H26B 2RR3A 4ZFFB 2P46B 5CIPH 1E4KA 2CRZA 3S9DB 1JGUL 5F8RC 4OZFG 3S88H 3AUVA 2P5WA 1R1CA 3TASA 2FX9H 5G4NA 1GKOA 2R69L 3RHWF 1UA6L 3WN5C 1CGTA 4LCIH 1TTRA 4YSCA 4NQCD 5DR5H 3CMOL 3HC0B 4W9GC 2OMTA 3NZSA 4NQCA 4XZUA 4C55A 4LL1A 2NNXA 4FA7B 1YPZE 3X3FL 2DV6A 2W07B 3CXFA 1E9QA 3IB4A 1KGWA 2BP5M 4PB0H 4HKBA 1OSYA 5JR1H 1DBMH 3P4NA 1JMZA 4MMXA 5DU7A 2WOYA 3DX0A 3X11A 1AHKA 4NKMA 3B43A 3LV3A 3TTYA 2XWJA 4AITA 1Q9WB 4YDIH 3DUSA 2O6EA 4HFUL 5FA4A 3PNWA 5BRQA 5DQ9A 2D9QB 2A83A 3I9AA 5EO1B 5F7UA 3NFSL 3S37L 5KW9H 2WK2A 3BDYH 4YHMH 5KVFE 3U1SH 1ZOXA 3KBEA 3QCTL 1IEBA 1U8MB 4QRPE 4UZSA 4MAUH 4A7TA 5TPWL 3DDFA 1LDPL 1PD6A 1W91A 1U2HA 4R6UA 5GGVL 5AOIA 2G4EA 3TN0B 4JHWL 3P54A 1FCCA 4QXTB 1RUAL 4PY8J 4TSCH 1BA9A 1IQWL 2K3HA 2BVYA 3D06A 5DEGA 3QG6B 1T5XA 3SE3C 3AG3B 4MJIB 2HH0L 4ZW8A 4LKXB 3ZE2E 1QUNB 4UQIM 5CJBA 5HD8D 2X05A 4BFIB 4P2OA 5F88B 4WO4B 1JXJA 3AABA 4E41E 1J8KA 5C09E 1YEDB 4L8BA 1EJ6A 2IGFH 2XFXB 1ZGLP 2CXKA 5HGDB 1H6TA 3QUKB 3TZVA 4IJ3C 3FQNB 5DFTA 2VDNB 4LFHG 1KLGB 1F1AA 3LPFA 2P28B 4N8CH 1VHPA 3L3KB 3P11H 2W9LA 3DPBA 4NCDA 1VFUA 3HVDA 4ODUA 1DJGA 3L5XH 4KQ3H 4M5YL 3KPSB 2X28A 5D1QD 2ADFL 3FFDA 3GKZA 2R23B 3CPLA 5BV7B 5D1QA 4WENB 5ACMA 2WAQA 5INDA 1FL5A 4AIXA 1ZMYA 2RIKA 5LVEA 4ZTPH 4NNPL 3BPOB 4YSOA 5AW2B 2HB0A 2BSBA 1VRSA 2YBGA 3K0YA 1MCPL 1RZJH 1LILA 3VTMA 2CGYA 2NW2A 2F58H 5T1LA 3SYAA 5EBWB 3U9PH 3N44F 2ETWA 2Z0BA 3LQAL 2VRQA 1ZT4A 4GP4B 4Q9CA 5GRJL 3OAUH 2DJUA 1KT2B 2AAAA 3QFJE 2HTLC 4ORGB 5D5ME 2VC2B 5DRNB 3ARPA 3BIBX 2VB5A 1T0MB 1SBSH 2ZWKA 1UXSB 5FUOH 5B1JA 2L7UA 5BOJA 4LOUC 5KYXA 2XWRA 2IALA 4DEUA 3GIZH 3IKCB 2MPVA 1T0NB 3FZUC 3M1CA 4OB5H 3OD3A 2A9MH 3PL6B 1M6UA 4QLWA 4GUPA 1I8MA 5CWSB 4M48L 4YNYA 2DH3A 2IBBA 1UUSA 3N04A 3NAAL 4BFBD 3AG4B 1VB9A 1J05B 2Q3XA 4QRUB 1BBJB 2Y72A 1HNGA 1QQDA 3WNMA 4G8FB 2QFPA 2FJHA 1R5VA 3VJ6A 1QI4A 5ID0B 5CBAA 4Q6IB 1VZGA 4I88A 1MI5D 1MI5A 1TCRA 3BH9A 3ZHNA 4DPAX 3GS0A 2OR9L 2FJUB 1WHOA 3T4YB 2E46A 2DQEH 1P4BH 1QEWB 4JZJB 4AGNA 2NQ3A 3L2LA 4PJBA 4G3YH 1KXVC 4DN4H 2VABB 3BKYL 4HT1H 4JGNA 3ULVL 5F96H 3L3GB 3D34A 1L6ZA 2XRAH 3OZLA 4KGJA 4GXVH 2ZX5A 3AFLA 4PVNA 2EUWA 1MHCA 3O2WL 5KSBF 3JUZA 5AYUH 2VKXA 3UTZB 3QJUB 5SWZE 1WYJA 2NY0B 1A7QH 5D1XD 3BW9A 4G80A 4JR9H 2VWEC 4RFOL 5D1XA 3WENA 1R3KA 4GKZB 4LIQH 2VXTL 5HPOA 1YEGL 4PV8B 3VFRB 2PMZA 3QWRD 4G8IA 1IE4A 4J3SA 2F54E 4TUKL 1PGRB 2ZF9A 5C6PB 2HAZA 3ATEA 2IH8A 1EPFA 3BT2L 2ITCA 3DVFA 1MCWM 1KJVB 1HL5A 3CVHH 2JQMA 3DIFA 3NIDB 1KCVH 3GK8H 4O58L 5K9OB 1R3LB 3LZFL 3D8MA 5CEZH 1SYVB 2JB6B 1OF2A 1TFHA 1FFTB 2HVKA 3MR9A 3FFOA 4FMVA 1TQVA 2RFXB 2W9EH 1I8IB 3OKDB 4X0NA 4G9DA 3WJJC 1DUZA 2WCPA 3P9LA 2BIQA 4M8VA 3N9GH 4PJEE 1YEIL 4XAWL 4JGUA 4LARH 4ZNCD 1WAAA 1DSWA 3GTTA 4C59B 2LTQB 3LD8C 4OH2A 1HYSD 1EHXA 2IBZX 2B39A 1ECZA 2MCMA 1GAFH 4C83A 3FTWA 4X7CC 4NN5C 3P4OA 4LP8A 1OP4A 1TVHB 2CGZA 5HDBF 43CAB 4G9FE 5I1DA 2W88A 3ULUF 1KGJA 2JV6A 1S7UB 2O4EA 4A2MA 3QWQB 4POZC 5HDQH 3AXLA 2B5IC 1RIHL 2F9BT 1YPZA 2KPWA 5LBVA 3WD5L 2CPCA 2XSKA 4WF7A 2IV9A 1AC0A 2RTTA 2V2XB 1BWMA 1CFQB 2MEJB 1ZVYA 4GSUA 1K8DA 5AW1B 3B2UD 2VUYA 3EO9L 4PG9B 1JN6B 2VDLB 2WKGA 1WFOA 4HIJA 3VFUB 4F8LA 3PPEA 5HXMA 5I1IH 4FFYL 5B3JE 1PIGA 2V2WB 3EBGA 2DQHH 3O81A 4QRPD 4KXAA 4PB9L 4BZ1L 1XEDA 4QRPA 3WY2A 4YLCA 1HI6B 3CSTA 2AZAA 1XSOA 4OFPA 1GGBH 3S36X 4H13C 3SGEH 1IKFH 1F1GA 4I9WE 3TJEH 3MLTA 3F62A 1KTJA 1U4EA 3MRDB 2X1OA 1GA2A 1A6WL 5ELIA 5HI4D 4Z5RB 4U6YA 2GHWB 1HL8A 3RDJA 1Z7JA 1RZIB 4E41D 3V4VA 1AGBB 3F5WA 3JVGC 5C09D 3LKSB 5C09A 5BW7A 1G7MA 3V0WH 3NRFA 1E40A 5DHVH 4OT1H 5ALCH 3L7EA 4MNQB 3GXPA 4UNUA 4F2ME 5IB5A 4W9CC 3MTRA 1B4TA 2IDTA 1NBQA 3VG0H 4HD9A 3WHXB 1PAZA 1T04A 4UV7L 3ESVF 2MMXA 2OMYB 4QT5B 3OM3B 2E9GA 1E3XA 4Y16C 4U3SB 4HCIA 7FABH 4AOFA 5DA4A 3QQXA 3MU3A 5EF0A 2WY3B 3TFKC 3ARBB 1LQBC 4JKLA 1ZLEA 1KIUB 5JHAA 1CD8A 3OKEB 2VW6A 4TOYL 5A2IH 4L4VB 3HIZA 2P24B 3D2UD 2CAKA 3O6FB 3SDAB 4Z3EA 2IDFA 4KK8C 2MFNA 1A4JB 1HDMA 2F5AL 3K5RA 1BBDL 4QHNA 3VXMA 2BOBB 4KRPC 3RIFK 3HR5A 3ML8A 5CP3H 3GIVA 1XH3A 1URIA 4PJFF 4GI9A 5G5DA 5AD0B 2W95A 1MFBH 2CDFB 2LLNA 3EGSA 4DVBA 5EC2A 3GTNA 3X13A 4FD0A 5F3HA 1CXIA 1JJUA 3QEQB 4MA8H 3GPEA 1EXHA 2ZNWA 5E2TL 1OXYA 3P2BA 2R0LH 2VLLB 3QFJD 4JQVC 2Z8VC 1LP9B 3OGOE 3QFJA 4ABVA 4U1IA 3FYEB 3IMSA 5DT1L 5D5MA 1QSZA 1GIGH 1OF0A 1N7MH 3WDIA 4U4IA 3WTUA 3PAZA 4PP1C 1HHGA 1YY9D 3ZHFA 3AM8C 1HHIB 3DVGB 2YPLB 2ZPKH 2GABA 2WIIA 4J6IA 4G8GB 1TZIA 3F6IA 3PP3K 4OZFA 4YC2C 2WBJB 3KPMB 4ZPVB 3UP1A 4RLDA 2FWOB 4TULL 4UTBA 1UA7A 1KJ3L 4UT7H 4FQQB 1EVTC 1E27A 3IFPB 4H2AA 2GCYA 4FNRA 4KVCL 1LD9B 1GOGA 5CLYA 3OF6D 2XZZA 3IDMB 3RWDA 5D6CA 2Q76A 1A5FL 3OF6A 2B77A 2WLYA 1YEKH 3L3DB 1E7UA 3ZSSA 1C5BL 3F05A 3IS1X 1F02I 1U2CA 2VDMB 3BKMH 3OMAB 3F7YB 3MRCB 2EP6A 4UYPA 3HC4H 4FXKA 3MV9B 3BZFA 3JZ7A 1K5NA 4DGVL 1FO0L 3UYRL 2MCPL 2HRHA 4L4TB 4XPHL 1VACA 4V33A 3STZB 5KS9B 4Y5XB 4BXVA 3TS8A 2YEZA 1UQSA 2ATPB 1QEXA 2W0PA 1TQSA 2ODHA 3UADA 4NZ8A 3MRHA 2Z4TA 1NBYA 2ROXA 3LEYL 1DBKL 4UNTA 1ZE3H 1CYGA 4KMTL 5SWZD 1CDYA 3MV7E 5SWZA 2CDEB 3ATDA 3I6KA 1DQMH 3VRJA 4S1DC 4WI2A 4XN2A 1M4KA 3U4BH 4R0LB 1TR7A 3RVWC 2ARJQ 1E8XA 3ES6B 3QNYA 3U4KA 2F54D 4JM2F 4UQ9A 1S9VA 1E28A 3FH8A 2XVKA 3NGBC 1V3LA 3R18A 2PCPB 5AKRA 3Q2LA 2XZQH 2ZUQB 5DJ2B 5CSBA 1R5IA 1TPXC 1JF5A 4G6AC 2PTTA 3IRPX 2J4WH 4Y1AB 3VAEA 4X4YB 2D3JA 5BPPA 5KEZA 4MJ6A 1MIML 3EW3B 4LFHD 5GGQH 2NNAA 4H26A 3N1GC 2GY5A 4GS7B 4PJEA 3PV7A 1NBZB 3BKJL 4BQ6A 1NCDL 5KVDH 3GGWB 5F1NB 4PLKC 3SJVB 4L48A 4WNQA 3Q06A 2Q10A 3QI9D 4PH8A 1Z0MA 4M8QA 2A9NL 3QI9A 2WSDA 4XVJL 5LBSH 3NQIA 5ADPL 5CCKH 1MUJB 2DL2A 4G9FD 1QTPA 3QIWC 3PGFH 1SJEA 1CU4L 4G9FA 4QHMB 2J88L 4KZCA 3SDCD 1XL6A 3H3KA 2WXLA 4J8QA 5C0BB 3BOVA 3GYRA 3SDCA 4AENA 1ZJAA 3C60C 2E7HA 4X8JB 3GMOA 5LXGH 4ZD3H 2IXQA 2ZOLB 3IPEA 3GBML 4J7RA 4Q58C 3HS9A 4NWTH 3WI9A 3QQDA 1ZLWK 2QELA 4D7BA 3TPKA 2X4UB 2Y1VA 3KR3L 2DW5A 2QGBA 1QLRB 1QTSA 2FCBA 2GJ6E 1D5RA 2WIMA 4MD5B 4ZSOB 3V6ZA 3DO4A 4PMFA 3CX2A 1XL4A 2PYEB 3K71B 4B95C 5AQ0A 2YAFA 2C3WA 3MLWH 1E4WH 1X7TA 3VTAA 3WUZA 5HHQA 4F24A 3RWCA 3T65A 3MRMB 4I9WD 2V17L 4DJMA 3ALPA 1JFQH 4E9SA 5JA8B 3EDDA 1D6EA 2BP0A 1QFWM 1U4FA 2IG2H 4CJ0A 1MG3C 1ZTMA 1DQQA 4DP6X 5DO2D 2G0KA 4U1SB 5A6IA 3EOAB 2G3MA 1B9KA 1GKEA 5KN5A 4U1KA 3GSWB 3SE3A 4HUXA 2EE3A 4J6RL 1EGJL 3MZTA 3OAZH 2WB1A 1NBVL 3K2UL 4GEJA 2WLZA 4XXDB 4N6QA 2Y7QA 2YA0A 3D4CA 4F2MA 3KLKA 5I75C 2UZPA 5JHLL 4M1GL 4CVXA 3K6OA 5AW5B 1LO4L 2BSEA 3II3A 2FWUA 1A9VA 4X6BA 4WEBH 2J25A 4P46B 2CHDA 1DLFL 3JZYA 3BAEH 5DK2B 2V7HB 4M56A 4A55A 1MQKH 3DX8B 4PWFA 1U3NA 4AVHA 5EB9A 4OF3A 1VENA 1HEZB 1A8JH 4QNPF 5EDXA 2O5NA 1CI5A 3PDDA 5JQ6H 1YEEL 1A65A 3ZDZB 1FGNL 4LLUB 4PVBA 3D50A 1OSPL 1QBLL 2BVOB 3LPWA 4YO0B 5D93C 2D73A 3IGFA 1HOCB 3L4UA 2DI9A 1D5ZB 4EXPX 4UUJB 4Z7NE 5IB4B 5E6IB 1BHGA 1PY9A 1Q1PA 3QFDA 3FT3A 2EACA 3QIUB 5DK0B 1VPOL 2DQTL 1JGEB 4Y4KB 4YHPB 3AWEA 1RJYB 5C0GB 4D8PB 1UM5L 3L81A 3EGXB 1I8KA 4X7TA 4Z0XA 4KROD 2XKUA 3BVNB 1OZUA 2BVQA 5C7XH 2GPZA 2BSCA 3UIZA 2K1MA 5B7FA 2FTAA 5IK3A 2ZYRA 2R2HA 4B60A 5B38B 3DECA 3EYFA 3HI5H 3U9UB 3C09B 1GHFL 4PBXA 3IPBA 2XCMC 4DEWA 3BP5A 4HUUB 2X89D 1IEHA 5CZKA 3MJ6A 4LOUD 3PWPE 4I3RH 4M7LH 1CLYL 4J12A 4N25A 2R4RL 3Q1EA 1IO4C 3MNDA 4PJAF 3FZUD 1T4KB 2WXKA 1A6AB 2VL5B 4WHTA 4O02L 2W5PA 1K8IB 2J6EL 3LIZL 3P73A 4HBCH 3MLZL 1EEYB 4OLVL 3MROB 1ZLVK 1H8SA 2NY6D 2NY5C 2L3BA 3NABH 4WLCA 1XH0A 1GY1A 2B1AH 4W4NA 4K3JH 1MFCH 5J11C 1BYPA 2E6PA 3TWYA 2A6KB 5D4JA 3RU8H 5DTFB 2LABA 5C0IB 2BXYA 4NS0A 3D3VB 3IK2A 5EEYA 2DQGH 2YGVA 1YN7A 3MGOA 1JGVL 1ADQL 2DIBA 4YHOL 5EU7E 4R97C 5HYSG 4JLRB 3CXHK 4KGLA 3VACA 1G0DA 1KXVA 4BK5C 1ET7A 4MFHA 3MV7D 4KDVA 2PTVA 3U4AA 1U8NA 1R24B 3MV7A 3BEVA 4G5AA 3DRQB 3FXIC 3CFMA 1J12A 1OAUL 2VE6B 5ITBH 2AS5M 1C5CL 2EICA 2CKBB 3EAKA 1CL7I 1G6RB 3E8UH 2VQUA 4BZ2A 1GC1H 3DSFH 1S8DB 1BMGA 1T1ZB 2KI6A 3CSPA 3MLUL 3TF4A 4R7DA 2UX6A 3L9EA 5K39B 2VLRE 3QJXA 2YUZA 3I2CL 5E5RB 1ET5A 2F2HA 5EV7A 1CT8B 1KTDA 1FFOB 3FPYA 3KLLA 1XIWC 4AYFA 4I0CC 3ILPB 1E5BA 4WGKA 4UM8B 5A2BA 5FO7A 5AW6B 4M9OA 3VFOA 1LDSA 1TVDA 1V7MH 2IVFC 4PJDF 1IC4L 1P6FA 1W2KT 2XWBB 4FQ1L 4G11A 4ODWB 4Q74A 1KUMA 4A39A 4JVUA 4LAJH 5LCVA 3V79C 2JLLA 3UTQA 3SQOH 2MSPA 5KBLA 4ADGA 2YXFA 5HY9B 3V5DA 1I3GH 1EERB 4U1LA 4AM0Q 3HE7B 1UWEL 3WJJA 1I3VA 2ICEC 3EOTL 1MCIA 4FTVE 2ZWZA 1BFVH 1S46A 3HR6A 1L6PA 3SPVA 1T7WA 4FMFA 5KSBE 2XIDA 4AKQA 5GQBA 5JIHA 4HWBL 2X38A 5F93C 2YRPA 1ID5I 1VGKB 4WWID 3WEAA 1L5GB 4MLIA 1T03H 5L88L 3PYCA 4KUCF 4BEIA 1MW1A 4OF0A 3LDBC 3UPAA 2AC0A 1CFNA 3O45A 5ABDE 1L0XA 1WA1X 5GS0C 5EC1B 2HYMA 3TWCL 3DWTA 4DO4A 3CD4A 5FFOA 4B9FA 4OV6F 4LO9A 3T0EC 3ARGD 4BD4A 3BPNB 3P4LA 1G7JB 4N2AA 4XT1C 3QFGA 4QTIH 4PREA 2E6QA 2Q6WA 5C70A 3UZVA 2FDBP 2AJ3B 1U3HB 4NGHL 3OSKA 1OCCB 4DGYL 4NJ9L 4ZT1A 2GJ6D 1KLFA 4WHYG 1FVEB 2GJ6A 3IBOA 2RD0A 5AYQA 2CLZA 3R0NA 4YPJA 5H37H 1K4DB 2VIRA 5CGYC 5F7HA 1A4CA 4CADA 1QA9B 3LHAA 3M46A 1OAQL 4E9LA 3KL5A 1OT4A 4LSVH 1ADWA 1MF2L 4MJ4A 5SX4H 1NKOA 1PEWA 5DGQA 3NN8A 4KITB 3IYLW 3W9EA 3V0VB 1MCSA 2KKQA 5G4OA 5D7IB 2A6JB 1RZJC 4YBQD 4M61A 5K93A 5HDBE 2RH0A 1X7SA 4G43B 4X4XB 3ULUE 5IREA 1GMEA 4YDKH 3HBQA 4P49A 2CZNA 1ZV2A 3EJJX 4LCYA 3QS2A 2OPCA 5KOVC 3O9WB 2EUXA 2I26N 4PGCB 2VNCA 3RX9A 2OMVA 2X4NA 4A67A 3JVGA 3FB6A 1RZ8B 2FQDA 5BZDA 5LO7A 4A38A 4KKPA 2ZXGA 1JDDA 2IF7A 3QEGL 2A6IB 1W80A 1KTRL 1MCOH 3OHXB 4GAJH 4LVOC 1AR1B 1HIMH 3QZWG 5T3XE 4HCRL 1MKFA 4Y16D 3ZL4L 2QJDA 5L8KB 3SKNA 5GRUL 4Y16A 4LLMB 3AC0A 1X7QB 3TFKD 1RUPL 2FEEI 2XXCB 2Y2TA 4JB9H 3JXAA 5IB2A 2JIXB 3N50A 5F9WC 4TUUA 2FQGA 1N2RB 1AGDA 2QKIC 3MUY1 4NZRH 4WW2F 2PPDA 5I1EL 4OCYL 1TQCB 4OCMC 5CZXC 3L3HA 4GSDL 4N20A 1T1WA 4KRPD 4N0UB 5HP5A 4PJXB 1FZJA 3GJEA 2K6WA 3JV4B 4N28A 4FNLH 5EU3A 4G1EA 5T33L 2O5XH 3DURB 2AABL 4ZK8A 1IC1A 3NFNB 4Z7WF 3F7VA 2P8MA 2WJ7A 1FBIL 4HCFA 5DMGC 3WY1A 1ZHBB 4HH9B 2AVGA 4UM9B 4XMWA 5AZ2L 4N3TA 3BGMA 2HWZL 1FNHA 2OSYA 4PCYA 5IGXH 1VFBA 3KPQA 5E9DE 8FABB 1NIBA 4JQVA 4XO8A 4OGYH 4F7EB 2PCXA 1PL3A 3PWPD 4PP1D 4HAKA 3CVCA 5ICYB 4DUVA 5IEHA 3PWPA 1ZLUK 1E9OA 1W72L 3AM8A 3MXWH 3WIHA 4JRYB 4U7MA 4H1LA 5BJTB 2NTSP 2OR7A 3DX9B 3EF7A 3SKOB 3EDJA 5IQ7H 5FCSH 4ZBJA 1FO0B 4N6RA 3VFWA 3HAEB 4GT7A 2IPTL 5I2IB 5HVHC 3BQUB 1F4XH 5KBDA 4PJIB 4P4RB 1CE1L 3S7GA 2VN6A 4MS8C 4N2MA 4Y19B 3VFMA 1BQKA 1YMHA 4PJFE 1SF3A 1EJOL 4PUBH 5ES4B 3SDXB 1ANUA 5GGTL 2F19L 5TJWK 1SN2A 5C0ND 5T1JA 2P43B 2OI9C 4XN1A 1FZOB 5KJ7E 4CW1A 4I1PA 3FTXA 2XWXA 4JO2L 3VRIA 2B1OA 3SN6N 5ESVA 5JIQA 1SXBA 3I02A 4MCYA 4N2LA 3UAJC 3I6LE 3CG8A 3KBPA 1OQXA 2BM3A 3AQDA 4ATWA 4XN7A 1CFTB 3VMNA 1CUOA 2ENSA 3D7PA 4KTDH 2CBTA 1ORSB 4NZDA 1GGCL 1P7QB 4S1DD 3AREB 5EORH 2CCVA 3HC3L 4X6EA 2PABA 5IR1B 3BH8B 4WI3A 3GB7B 2VLRD 5GRVL 3V4PA 3ZKMD 4Q9BA 1KV3A 4TPRL 4MJHA 2VLRA 3H55A 1ED3B 3ZKXC 5I1HL 1KENH 4XXCC 4D3CL 4HGWA 5CU9A 5F9DC 2C4XA 4GUQA 4EOWH 4LLVB 1AO7B 4YDJB 1MFAH 2Z4QB 4L05A 3WIFA 3S3DB 4CN6A 1UOLA 2HJFB 4ZO9A 3N43B 4NKIH 2VLJB 4JO1L 4CGUB 4JFOB 2FX7L 4YEEA 1LO5B 2WZ0A 3OKNA 5D2LB 3UGXA 4BFRA 4UT9A 1I9IL 5A2LH 1C16B 4FTVD 5B22A 3W39A 2EDBA 4FTVA 4D0BB 4G6KL 2P8LA 4PLKD 3MRLB 5FGCB 4TVPL 5KSBA 1AY1H 3HZKA 5E95B 3PV6A 1U8PA 2DMBA 3M8OL 3SGDI 4I3SH 1ZANL 2EDEA 4D0DB 3IJ9A 1FHNA 2X40A 2H9GA 5JUEH 1T5WA 1O6SA 1RXLA 1SZNA 5H4ZA 2I69A 4OCSH 3VU1A 1JNHB 2WMPA 4NN6B 4RGOL 5D1ZB 5SV3A 2NXZC 1KCLA 5CR1A 4GW1B 3HE6C 1OAXH 3HBGA 3TBTA 3PP4L 1OGAB 3C2AH 3PHOB 5TQ2H 1CDJA 2KDGA 4P3DB 4TVUA 4DT2A 4N2EA 2CK2A 4J4PC 3VM5A 1TIUA 2BNUB 1ZVHA 4QRBA 3L17A 3ESNA 4G6FB 1N4XL 3S96A 4J1UB 4YK4B 5EU6A 4YUEL 1L0PA 3HRPA 1G9HA 1IZKA 3N2JA 3CE1A 1AE6L 2XG5B 1FVDA 3LY6A 1XXDC 1EWHA 4FFTA 1ZLDA 3S6CA 5AVTB 1ZA3B 5CN1A 4K23L 4PQXA 2APFA 1GGIL 1N68A 2M8XA 1FPTH 4DKEL 3ULUD 4XN8A 2CSPA 2R1YA 2OXGB 3ZPDA 4ODSH 3MRFA 5J1SC 1UH3A 3HMXL 4D0CA 3ASWA 4ELMB 3CLFH 3GBLA 4KHXL 3ZLQC 2C4FU 4TNWF 3FB8A 5L4JA 4K55A 5HHVH 3DLQR 5CP7A 2AV7A 2EDTA 5HYSA 3FQUB 5T3XD 5IW3A 1CE6B 3TOPA 3CHXA 2WVUA 3FH7A 1ZT7A 5C3TA 4FDWA 1H15A 2I85A 5CLZA 5MEQA 2ZF8A 4JDVB 3ECQA 2Y7LA 4X6CA 3SBPA 3L4WA 1QMUA 4JKMA 5K9JL 4K7PH 4XWGH 5JW4N 4HMEA 4X5WB 5JXED 2E76C 3M1BA 4XOAA 5JXEA 4I0PC 4AEFA 1MIEL 4IBZA 3VO0A 2Z6FA 5DQDL 2YC1B 4X9HA 5AALA 3VFVB 3GT6A 1W15A 2NMSA 3BP7A 5F9JB 2FJFA 4PLJC 1NFDF 3N55A 1M6OB 5GSRA 3KD4A 1Y6KR 4XWOD 3ZN6A 1SOXA 4ZQKB 3DO7B 1QPXA 3OAWA 5E9DD 2G60H 1ETA1 5EWIL 3WU1A 2AJUL 5FGBC 5E9DA 1NMCC 4XN4A 3QIBD 4FI8A 4O02B 1XF3A 3QIBA 3MZGB 4O2CB 2APBA 3KCPA 4ERSH 3UEZA 3TPUB 3FB7B 5I8OL 1XZWA 2OP4H 1NGQH 2H6PA 3WUWA 3S3PA 2XX1A 5B8CC 4M7ZB 3BJLA 4YL9A 1XD0A 4PLNC 1F4AA 2GK2A 2WZPD 3TU6A 1T4WA 3TO2B 2QQKL 4QNPE 4WW2C 4AH2A 5C0RH 2WZPA 2LR4A 1HQ4A 4MQXD 5I16A 3F58H 1PY0A 1QLFB 5FW8A 4LIQE 1NOLA 3BESR 1LMKA 1AQMA 2ZYHA 3DOSA 2DQFB 5FGSA 3ELAT 4TS6A 4DPCX 5B39B 2K8MA 1P5UC 1IJNA 2P48B 3CQFA 5F7AA 1B4LA 1NCWL 3FMGH 2FSEA 2GFBA 1ZDSA 4PJFA 4R2GD 4BKTC 4B5ZA 5LGHL 1OPOA 2C3GA 4XCNB 2X2JA 3KWXA 3EJRA 4XODA 5CEZE 1NCAH 3LSOB 4LSUL 1P0SE 4HKZA 5EMYA 3RUGF 4XMUA 4CVZA 4DGIL 2IWFA 3CC1A 3GTVA 3U82B 1J9TA 1EX0A 1JUFA 2BRRL 2VDKH 3RYMA 3I6LD 3VSTA 4NO0D 2PXYB 4N0FA 2Y6TE 4FF9A 4RGNC 4TNGA 3VUAA 5LQBL 2BY0A 2XJKA 3ZE1F 1FG9C 3STBA 4WSKA 2HLAA 1PPIA 1EV2E 3PHSA 4WUUB 4M4RB 3ARSA 4PJAE 4FADA 4HISA 4PRAB 2YAEA 6PAZA 1NEUA 2VO8A 2VN7A 3O3UN 4MA7L 2XU9A 2Q86A 4TQIA 1YZZA 1U95B 2HCZX 4XBPB 3RY5A 1BZDA 4NNXB 1ZS8A 5CNHA 3IGKA 4F7TA 4X6DF 4U1GB 3GBNL 3BVXA 5EZJA 3U7YL 1UD5A 4EUPB 4L1LA 3HNTL 1A9EA 4K0OA 3IJSB 4WDIB 5F7EH 4LKCB 1ET8A 4WFHE 2PN5A 1XIWA 5HJ3B 1I1CA 4GQ9H 3X14A 2CR3A 1KV7A 4UOJA 4HXAL 4ZNEE 3BZ4B 4QDGA 2R39A 3N41B 2R2EA 1X5MA 1OTUC 1H8NA 1F90H 3UJTL 1W8EA 5TE7L 2L0DA 3C6LB 2DB8A 2JKLA 3L54A 3HG1E 2CIIA 4IIZA 5EU4A 4NWUL 5D2NC 1CTMA 3FU9A 1F6AA 3BPCB 3FO1A 3ZY7A 4GAGH 3U7AA 1CD9B 2ICEA 4H25B 1U8HA 2CMRL 1SYSA 4AGQA 4ETQA 4JO5A 2BINA 1DQIA 3LXUX 2AANA 1OGPA 2CKNA 4JM2D 4MGXA 3LAFA 4R4BA 1XF5A 4AE0A 3GRWH 1BQUA 2F61A 3APMA 2AK4A 1AGFA 1OW0C 3SSGA 2F8IA 3D9AH 1UWXK 3GD1C 4PIBA 4LCCC 4NBZB 1RFDH 3CZSA 4NUQA 3T0EA 3OJ2C 4HUMB 2VXUH 1BVZA 1MAKA 1E4XI 2ORBH 2FT8A 4PJDE 4RRPM 3VQMA 3NBNA 5IW6A 1AJ7H 4Q97A 3S35H 3HA0A 3VQ1C 2BC4B 4S0HA 5EZIH 3APFA 3HFMH 4DVRH 1RHHB 5EBMB 3UJJL 1XB3A 4A7GA 2WNWA 4DKDC 3QO1B 5CJQH 1YEJL 2FJSA 3L7FA 5GGRA 2UWEB 2ROYA 1YYLH 3FQ4A 3IU3A 1SLWA 2VDPL 3H2PA 3IXAA 3QS3A 1ZAGA 4IHOB 5BQ7B 4HXBL 1BEXA 1FZKA 5D7LE 3DX4A 2D31B 1R3IL 1VFMA 3HLAB 4KKCC 3DX7A 1ZSHA 2ZX9A 3ROOA 2OTUB 4XP6L 3ISRA 5E51A 4LCWE 3TA4D 4KXCA 3FSAA 3N1FC 2N01B 3W38A 2AJZB 5HGGS 4MQ7B 5T1MB 2IPUK 2F1EA 1IGIL 4BE6A 1TUPA 1IBDA 5HJBA 2HLFD 2X3CA 1XDTT 3C9NA 5IMKB 5IVNA 2VMFA 5CHNA 1DN2A 3BEWA 3BPOC 4Z78B 3BO8A 1VERA 3DJRA 1WD9A 3VTTA 2YOAA 2VOTA 1D5XA 2KZKA 3BDBA 3QWOB 1H3PH 3MMEB 3TXAA 4IBWA 2FB4H 1EZLA 1DVZA 2X70A 3MLXL 4YHZH 4HKJA 3LN5A 3CFEA 3US1A 1OEZW 2QBWA 3DMMD 5CZXD 5DFAA 1NDGA 3KM1A 4BUHA 2ZG3A 1U36A 4WKXA 2EC9T 5IQ9A 5C0CA 2J2ZB 1SEQH 3C08H 2V0AA 4MQSB 1P4LB 4DQOH 1XGTB 1C5DA 3NIGB 5F7MC 4F1SA 4XNQA 1OB1B 2AJSH 2X4OA 3M17B 1NLBL 3CBRA 4OZIB 2CCLA 1A4BA 1E5AA 1HVXA 3D0LB 1VFAB 4XMLH 3L1EA 2IFFL 4WI0B 3QXVA 5FLUA 2VZVA 4OD3H 4PTUA 4Y2OA 3T8MA 1A1MA 4ZJ9A 5HPMB 2GSIB 5I1GH 4HOZA 1ETZA 4MZIA 2YXVA 2ZOWA 3IJYA 1U8CB 2DLFL 3PL6C 4K2UH 4GP8B 2E5EA 4F7CA 2OX5A 3EFDL 5J6SA 4NPJA 1GC1C 1DVQA 5IEKB 3NSCA 1MRCL 4KZ0A 5L6YH 1K2DB 2VJ8A 2Z7ZA 1FN4A 3E9TA 1IC5H 4W6XB 1QHOA 4KZDL 3LRSB 5JW3H 1REIA 2E27L 1AZVA 1A47A 4HS8L 4GIAA 4P59L 3B6SA 2YD0A 3HLKA 1CIDA 4KRMB 4GT0A 2IANE 4KHTH 4W9IC 4W9ZA 2ZAHA 4YHIB 4BYHA 4YSRA 4MS8D 2BNRE 3CFCH 3CVHA 4NUGL 1UEYA 2EYSB 5C6TH 4CMMB 4PHXA 4F37K 5CEZD 2PO6D 4ADJA 5JNYA 1YECL 4JZJC 3CDZA 3RZCA 2ITEA 1IBHA 1NC2B 3DSNB 1WK0A 3SBQA 3KNBB 4BWWA 4DESA 2NNRA 5GGUB 4Z7WE 3VFNA 1TZAA 3F7RA 5I9QB 2VW7A 1GCFA 4AJYV 1AKJB 1N59A 3WFHA 3BP6A 4EKXA 3GLDA 2VM3A 2QGCA 3NJIA 2E8YA 2WOBA 2NY0C 4L5FL 1E6JH 4XO5A 5E1HB 2H5UA 4E42B 1HSBB 1NAMH 5KVDE 1OK8A 3NDZE 4QTHB 3WJMA 4LRIC 5J6GB 2WUCH 3ZDYB 1R0AH 2OR8A 1YO4A 3UAJA 3WKQA 2EDNA 1Q8MA 1U8QB 1ODUA 1TZHB 4GY4A 3V4VL 2BCKA 2WCGA 3NH7H 1ACYL 2A5UA 4GW5B 1LEGA 4PJAA 1KLUA 3SHSA 3R06B 2MHAB 4PS4L 1FRGL 1S2EA 3JSSA 3O6MH 3AWGA 2F7IA 3BAIA 3L5WB 3M7FB 4RAVA 4ZXBD 3T3MF 5AUMA 4E5XG 4UV4H 4EBQL 2IH1B 3HRZB 2K70A 2Y2YA 2X4QA 4P07A 1JWUB 4PRPB 4WFHD 3WTVA 5IT2H 1ML0A 4HWEH 4UU9B 3PRZA 3E0GA 3S4SG 4JEGB 4HPOL 1LK2A 4M8RA 2NYKA 3S5LG 2FO4A 3GSNB 4YSPA 3G5WA 1I7ZA 3K8MA 1CDUA 3UL4A 2EINB 3KYKH 4B96A 2MRYA 4ZNEA 1BPVA 3WMPA 1QRNE 3LPGA 2DLTA 2C3VB 5EBLB 1J9SA 3GXMA 3AGWA 1YY8B 3HG1D 4W9KC 5E2UL 1A9BA 2LTQC 2R0WL 1IIKA 3LZQA 1I7UB 1JXGA 2BCMA 1WAPA 5C9JB 1OSZB 3UO8B 1RKRA 5A7EA 2GTWB 1JYNA 3AS3A 2WBWB 5MEPA 2CLRA 1CQKA 1EDQA 2Z31D 2OS7A 3BKCL 1X5GA 4XOEA 5FUZH 1DQDL 2R29H 2NX5B 5JMRA 2JFCA 5D2NE 5E99H 3EH3B 3O41B 1NWOA 1JWSA 3LOWA 2GSGA 5CU5A 5TDOA 5AW7B 4IK6A 5D72H 2OMUB 3D25B 4JY5L 1QLEL 5KYWB 4EI6A 1JZ4A 2Q2LA 3VXSE 1YQ2A 1OV8A 4X8CA 2OBGA 4H0LC 1RZGB 1G9MC 3K4DA 2O6PA 5EUKA 1FF5A 4G5ZH 5DHVA 5CGTA 4MASA 5DSCA 4DH2A 1JWMA 2OQJA 4HYTB 3LQZB 5JLZB 2NXZD 2CBPA 2NY3B 3J27A 4LLYA 4PJDA 4LSRL 4BFGA 3HE6D 3VXQB 3WXVL 4L1TA 2O5YH 3HE6A 4RMUA 5DJCA 2IDUA 2XX0A 2DTMH 2X6VA 1A7RH 3CFJB 4B27A 3TVMB 4GG8A 4D9LL 4RWYH 4UIMB 5GHWH 1I8UA 5GRXG 5I1CH 1KIRB 5I8KH 4L18A 3RHWK 4J4PA 4P23B 4BKLA 2I5YH 4JM0A 4DO6A 4HLEA 3FO0L 1EDHA 3D33A 2D03L 3PHQB 1SJVA 2LLLA 5T5NF 3U2SA 2FD6L 1E3ZA 1WQVT 2P45B 3RGBA 3MCLH 4FQCH 2EXWC 4DHLA 2ICWA 2V7NA 4O4YL 5LGYA 4KUCD 4DGUA 2WYTA 4FZEL 4RMQA 5I1JL 3QAQA 5CP3A 3T4AB 4KO6A 2AQSA 3WE1A 5D7LD 3HS0B 3NSFA 3F7QA 2MKWA 5KSAD 5D7LA 4E9YA 3FT4A 4N8PA 4KX8A 4ODBD 5KSAA 4NI6A 2WUBH 3DDGA 4Q4IA 3DX6A 4LCWD 3T3PB 5I74C 4ZO7A 2WQWA 2VR4A 4LCWA 4CBZA 5I6XB 1G7HB 3L3IB 4PS3A 2BFGA 5AOJA 4ZFZA 4PWGA 1HCZA 3F7KA 4YFLF 4CN4A 1EEQA 4PRDB 4AC4A 5E8PB 2XA8L 2KERA 4MLSA 4HMDA 5SWQB 1JRHL 4Q2ZB 3LH9A 4M6NL 2ADIB 5EFIB 3RWHA 1D5IL 3WFDH 1TJHL 1KY7A 1DLHA 1MCWW 3O6FC 5H37G 3K8LA 4ZUSB 4MVBC 1UCBH 5CJOL 4JFZL 4U6XA 1G9EA 3ECVA 1K3ZA 4LCUA 1CI3M 5FM5O 2F7PA 4PGBB 3TLRA 3FU7A 2DOCA 2ZXBA 4JKWA 4I0PD 1GH7A 4KUZH 5EOTA 1G0XA 1HXMA 4I0PA 2BSDA 3K6DA 4TUJA 5J4MA 5DURD 5IMMA 4PGDA 1CFVH 4FG6D 4NM4L 3WNLA 1UM6L 1KFAL 3OJMB 2CJSA 2OMTB 4NQCB 4PLJD 1FORL 4XZUB 3G5XB 2G9HB 3I9GL 3ZR6A 4ZX4A 3FCTA 3OKKA 2ZZUT 4LSPL 4HKBB 3AMKA 1DN0A 2BS8A 4MMXB 4W93A 1X5IA 3DA0A 3FTYA 5FGBA 1MCKA 3I6GA 4AUYA 4NKMB 3LV3B 3S8FB 1IGCH 2H1PL 2XWJB 3QC5X 4F80A 3MRPA 3DUSB 1RZ7H 1N5AB 5FA4B 3PNWB 4LAQL 4Y4HC 2ZWYA 3V4UH 5DWUH 2A83B 2PPFA 2HRGA 5D7SL 1DJYA 4X50A 1QBBA 3OB0K 1JZ5A 3FCGA 1Q9OA 5B8CA 3RX8A 1DCLA 2IDSA 3X1FA 3X3GL 1IEBB 2GBTA 1T83C 3DOHA 2XPYA 2ZTBA 4WW2A 4YSUA 2IAND 2XWTA 5FHAH 4F27A 1RZKH 2IANA 4XCEA 2BNRD 2XQ0A 2EVIA 2BNRA 2O72A 2YFOA 4NZTL 4ESKA 4KK5C 4FA8A 2WD0A 4XPTL 1TTFA 1HILB 5DEGB 1P5UA 1T5XB 1A3RL 4Y5XC 1LEKA 5BUGA 2VQ1A 5C2BH 5LXVA 4NERA 5L8LB 2XWCA 4FP8H 2BSTA 2GI0A 3WKML 4L8BB 4R4FH 1RUMH 1Z3RA 1KTKE 3TJHC 5CBEA 1G1CA 3AU1B 1OE2A 5TH2A 3TZVB 4G8AC 3HB3D 2FSDA 3X2QB 1Z3GL 4OCWH 4KNQA 3WS3A 1Q72H 3DPBB 3CZNA 5KVGH 2AQTA 2G9KA 4ODUB 2IMMA 3A67L 3FFDB 3CPLB 2QTEA 3DXAE 5D1QB 1EO8L 2CJUL 5INDB 2V5SA 4MBOA 2FLMA 2R4SL 5F1KC 4U05A 2WV3A 2YD1A 3CNKA 2H0FA 5FM4A 5AL8A 4Z7QB 1Z9SA 2P1YA 4QWWC 3ZHKA 1RU9H 1G9NL 3MKKA 3PAUA 1QRND 3PUUA 2W9DH 2NW2B 1QRNA 4X5PA 5T1LB 1KXTA 3RUGE 4X99A 1HH6A 1M2VA 1RMFL 2WBXA 4GPVA 5CD3A 3MC0A 1JZ8A 1OTUD 4OGAD 1MJ7L 1ZT4B 4G8EA 1V5JA 3O0LA 1EHAA 3QXTA 5C0FA 4NQVA 3O3EA 5FEBA 2JI1A 3L13A 3QJFA 1T20B 4JFWA 4NB7A 3SDDC 5D2NA 4A66A 5E8DL 1Q38A 3ZE1E 4WU5A 5KYXB 4MYPA 5D70L 2IALB 3GRGA 3QUYC 2R9HC 4N86A 2GBVA 4E2OA 4KY2A 4JY6A 1W0VA 3HBPA 4LU5H 3VXSD 1I8MB 4G6ML 4WTWA 4GUPB 4Q6YA 5ABAA 4AQ8C 2IH3A 3BWUF 4LL9A 4YNYB 2Y0SA 4X6DE 4HOXA 2AGJH 2VKWA 2D2CC 4Z7UF 1PQZA 1QQDB 1A64A 3CZJA 5KVEH 2FJHB 4GFXA 1R5VB 2MNJB 3KG5A 1DJXA 2VXSH 4JPVH 4LCCA 4CNIA 5CBAB 4S1QH 4RDQG 3QDME 5J5EA 1MI5B 1QFWH 1TCRB 3BH9B 4JO4H 4J2QA 4YBLB 2YAPA 2VDPB 3U7YH 1CLOL 5KTEH 1BCIA 1NEZG 5IROD 4LXFA 4LZKA 4PJBB 5AVYB 3MLRL 5IROA 1E67A 1Q9LA 5BO1H 5L4FA 5LG6A 3MRJA 3VXTA 5HI5C 3LRKA 2BHYA 2A38A 5C08E 2YQGA 3FT1A 1AANA 2DJMA 3GSQA 4IBLT 3K6NA 2ZICA 4DN3H 1I9JH 4FQ2H 4MJIA 4LDCA 2WM0A 3BW9B 4G80B 1GZPA 5D1XB 2ZUVA 4FQHA 1H3GA 3PP3H 5GJTH 1R3KB 1ZGLM 4Z76B 3RWIB 2I7SA 3MO1B 1B90A 3FQTA 4G8IB 3I9IA 5L2KE 1DJWA 3BWAA 1XHHA 3OJDA 4BSWA 1C1EL 4FQJH 1KCRH 3VM7A 1DBAL 3N0PB 5DZNA 4X7DC 2ITCB 1F6FB 4P46C 3IFLH 5DYOB 3D4YA 4KXZH 1MCEA 3FQNA 3HKFA 1OF2B 2HVKB 3MR9B 2HX9A 4BZ2L 1K5WA 4H8HA 5FKAA 3T8XB 3VVWA 3KEDA 4LEXH 5CKGA 5BUPA 1N5YH 4XVSH 4G9DB 5EULV 4YXLH 1UZGA 43C9A 2DDQL 3UCRA 1DUZB 1KEML 2RQEA 1OOAA 3P9LB 1QR1A 1INEH 1FL6A 3QK0A 3LN9A 2XJLA 1K4CA 3N85L 2J1ZA 4RFNB 3O8XC 4KQ4L 1XB8A 1U9KA 2XIBA 1DYZA 4C54A 4E5XA 3QIUC 2COVD 3QUXC 2HFTA 4C83B 3WMQA 3P4OB 2WLIA 5LCVL 4JREB 3TGXA 1J9QA 1ROCA 2FLBT 2FGZA 3S4SA 1JNJA 4X7SH 2Z1PA 1MFMA 3S5LA 2EEFA 5I1DB 3S8WA 4NRYA 1G6VK 3AXLB 4QCIA 3CHRA 2C7UA 2NRDA 1YPZB 4TRPH 3C09C 4K3DL 2OK0H 1Q0EA 5D7JD 3DV4A 5D7JA 3S3BB 3E8VA 4ENEC 4YDVA 1W8OA 4AL8L 4YVNA 1K8DB 1CFMA 5MI0C 4X2UA 3OMNB 2DWYA 4AMKH 1MW2A 2LQRA 4Y2DC 3GBEA 4HIJB 4Z1PA 4UILH 2A9CA 4N0RA 4EVNA 3OR7A 2LVEA 2R0ZH 5DJ0A 1BWWA 4I1RA 2CGRL 2FH8A 2BJMH 3K81A 5L8JB 4JRWA 3ULVC 4QRPB 5IG7A 4XNAA 4TQ8A 3ZDXF 3GMMA 1RURH 3MBWA 1NCGA 1SXCA 4WSJA 5DEZA 4NJAL 5ID0A 1IFRA 3MLTB 1MRFH 4L9DA 4MA3A 1KYFA 2RA1A 2CHXA 3VX1A 4BE5A 4NCC2 1LE5A 1MRDL 3E1ZA 3ZE2B 3V4VB 3F5WB 2F53E 4E41B 3R7RA 2TSAA 3H0TB 3ULSA 5C09B 2W8CA 4A2EA 1G7MB 2C9PA 4B50A 1FAKT 4ZUVA 4LK4A 3L7EB 3BP4A 4XBGA 5IB5B 5IFJA 1KG0B 4H0GA 1N6VA 1PZDA 4HHAA 5CD5D 4ZUWB 1T04B 3NP4A 3ZT7A 3EFOB 5LNGA 4IKLA 5JORB 4RMVA 1A02N 2HVJB 3N42F 1OKEA 4HIPA 1ZIBA 4LRIA 4TL4A 1ZIAA 3LS5H 2QSCH 4PV8A 3SE9H 1O7DC 4LBEA 4EDXA 5HHME 3DXAD 4PRIE 4YHKL 4FQIH 1GYUA 3P3SA 3OMIB 3DXAA 2C26A 3IT8D 3B7UX 3NPZB 5GSVB 5AAWC 3PJLA 4LL4A 4ZW7A 3EDKA 3KWUA 3QPQC 1HDMB 4F8QA 2LAAA 4QHNB 1YN6A 1SYVA 4PV9A 5FV1L 2EO1A 2QZQA 4GKSA 2JB6A 3HR5B 4P4KC 5BV7H 3GIVB 4F15B 4U6HA 2ISDA 1RK7A 5D1ZI 5G5DB 1B0WA 3EGSB 4DVBB 2RFXA 3HPJA 3AJ7A 3G6AA 5EC2B 4IKJA 5I8CA 3HE7C 5IBTL 3RUGA 5F3HB 3X13B 2YKKA 2DQJL 1GZQB 2ZUUA 2XWZA 3Q0HA 4MNGE 4PCSA 3T0XA 3QFJB 2K4WA 4U1IB 2J1WA 4IU2A 3RDTD 3VD9A 1WV7T 5D5MB 1SVBA 2QZ5A 5E2WL 2YMOA 4MDRA 1NBCA 5E9AA 1HHGB 3FB5A 1BZ7A 3FPXA 2VAAA 4YGVA 2BIOA 3I84A 4MB3A 4OIFA 2WIIB 1MHEA 3HJEA 1TZIB 4OZFB 4GBXC 2JKRM 2YEVB 2PW2A 3SYQA 3FSOA 3BPNC 5I73C 1J86A 3KBFA 1VKXB 2YQ2A 1BVLA 3AG1B 3WFEH 1BVOA 3T3ME 2GUOA 3RWDB 5D6CB 1BSIA 4X6DA 2Q76B 4IRZH 1VFOA 3NIFF 4OGXL 4JL2A 1F42A 4WI8A 2QFRA 3BZEA 4RVBA 1Q1JL 3HHRB 3CLEH 1NANI 3U9WA 3QDMD 3WIHL 3MNVA 4FXKB 4M9PA 3BZFB 3DK2A 3QDMA 1JV2A 1HJCA 2CLVA 4IRJD 1K5NB 4OAWA 2B0SH 4AMXA 5E4OA 2V2WA 4ODHL 3UTTE 5FYLH 1BDYA 2BO0A 4Y7OC 1VACB 3H3PH 4IOIB 5LBGA 1X5ZA 2E9IA 4W6WB 3V95A 2YEZB 4AG4L 1WEJH 2XNAA 4NFCA 1M7XA 2GIXA 2RQ8A 1DQJA 5C08D 5G4MA 1M9WA 3MRHB 5C08A 1K72A 1NBYB 3VWKC 5SWZB 3I6KB 1FA4A 5KVMC 2EXWD 4LQFH 3VRJB 4Z5RA 4HPYL 1BM7A 3H4FA 5I15H 5BQDA 1AGBA 1QFUL 2OSXA 3BUBA 3QNYB 4YE0A 4I77H 5DZJA 5L2KD 1JHKH 4QF1B 4XPFH 1HH9A 1S9VB 1E28B 4G72B 5L2KA 2F54B 3V6BR 3OHXC 2J71A 3P3RA 4ZMZA 5KUMA 2V5YA 4Q52A 3KWTA 1AR1C 3QQ9C 4FN0A 3CN3A 4RMWA 3HJ0A 3RA7L 3RL1A 3AQYA 1P1VA 2CO3A 1BFSA 2PTTB 4MJJA 3EH5B 3PWNA 3JYCA 4MXWH 2E3VA 2DICA 2IBGA 3QDHA 4MJ6B 5AB1A 3UABA 4KI5F 3FU0A 1QHPA 2MQGA 1NKRA 5TQ0H 2NNAB 5TFSL 4NN7C 1JYXA 3G7TA 4QHUA 1O6VA 1AXIB 4QXUL 2DQCL 1ZLSL 1XVSA 2JKWA 4PJEB 1XSJA 1ZT1A 1TQCC 3G3LA 4FXGA 2W92A 3UTOA 4WNQB 3NPSB 4M8QB 3QI9B 4OLZL 5F0JB 3UO1L 2DD8L 4XMTA 3V7MA 5AD0A 3BHBA 3LNGA 3CZLA 5DLMH 4K7PX 3IGAA 4RAUB 2DMKA 4DZBA 5LAPA 4JFQA 4LSDA 2Y2WA 3TYGL 1SJEB 3UC0H 4G9FB 2QLVB 2VDOB 1KCBA 3Q5TA 4MHHG 4OQTH 2IQ9H 2WWKT 4IJTA 4IIQA 1DTUA 1X9RA 4UT9L 4AMWA 2VLLA 3SDCB 4AENB 1F8TH 4YLBA 3IU4H 3GMOB 2VMEA 1FE8L 2EH8H 3G6DL 2IXQB 1XFPA 1OAZL 1XGQA 3QQDB 3A23A 5I66A 4KOCA 1NC4D 5PAZA 1QYGL 1NC4A 1BQSA 3KPMA 4ZPVA 2FWOA 4JG0H 3KPTA 3TIEA 3V6ZB 4N8VG 2AJVH 4WVRA 2YMXL 2VDLH 3BQUC 5FYJU 2HT2D 4Y4HA 4B9PA 4BCZA 5C0DA 4K71C 5D6DA 5D7KE 4ZYKA 3IDMA 2H1XA 5HHQB 4FAAB 3T65B 1I1AD 4NO3A 2UUDH 1PZBA 5JIPA 3FRUA 3RRQA 3SYOA 2Q20A 1M3JA 2G5RA 3ZHLA 1D6EB 2BP0B 2FATH 2DBLH 3NCJL 2F0CA 3CH1B 4JFHE 4JKNA 1I9RL 1DQQB 5DD0L 2XN9E 3UYOD 1CLZH 3V6FB 4HJUA 4BKSC 3QISA 1TNNA 4KJWC 2F53A 2QGDA 2Y5QA 4U1KB 3RIFF 5KN5B 3STZA 4HUXB 4Y5XA 3JWOH 4EAEA 1LTXA 2BS9A 1DFBH 1MFEL 2ATPA 2Z1KA 1WDAA 4F2MB 1NEZA 2KL6A 2Y7QB 4XP9L 5HGAA 2HFGH 4ANKA 2Y3NA 1E9PA 4CVXB 5EEZA 2EQDA 2I9LA 3GXDA 1S7VA 3TJHD 4FZ8L 1W6WA 3ULUL 3B7TA 4ZW6A 1A6ZA 4KTYA 4KY1H 4X6BB 4JFPA 1JXKA 2GJRA 4HF5H 1EAQA 3APNA 1A6VL 4CC0A 4XI5C 3RIAK 3EF4A 3ES6A 4IJ3B 1UT1A 1R46A 3QZBA 4JUSA 4KFZC 4PRID 5HHMD 2BERA 4HIHA 4PRIA 2OMWA 4LEBA 4ZFGH 1XGUA 1CK0L 2JJVA 1BG9A 5FYKL 4TMPA 2LU5A 3O6LH 4QOKE 2DKMA 2H6OA 5T3XL 1I53A 1L3WA 3CH8A 2VH5H 3B2VL 4K5OA 2E47A 1MWOA 3FT3B 2EIJB 5DRWA 3ZO0A 3Q05A 2XKNA 1N6QL 1G94A 4U7SA 4QRQA 3U30C 3NA9H 5GPRA 3LKRA 1Y07A 1KMGA 1TEFA 1TJGH 4KVNL 4MNGA 4X7TB 4Z0XB 5DGRA 5F1NA 3SJVA 4L2LA 1NDTA 4AEHL 2BVQB 2Y07H 1HZHL 3L1OH 3PWVA 5IK3B 5KSUA 1KN2H 4CJ1A 2XOTA 2R2HB 4WWNA 3OKLA 3EYFB 3G6JF 2Q8AL 4MCZA 3TBYA 3EYUL 1FCGA 3BP5B 3H42H 3ZKSD 3SDDD 1WFUA 4QHMA 3A6CH 4YFEA 3SDDA 4N2GA 3QUYD 4OFDA 4M43L 1HE7A 4BUGA 3QUYA 5KBPA 5I19L 5FO9B 3EJPA 3NJFA 4PJ8C 1P4IL 4A2DA 1MWAH 3MCYA 4NN6C 4RSVA 4HKXA 2HX7A 2B2XH 4HIEA 4WHTB 5HI3D 1T7XA 4M62H 5FO8A 2OYLA 3W9DA 1UA3A 4AQ8A 1LJMA 3P73B 4U2ZA 3GEFA 1NCJA 1JPST 1L9NA 3B56A 3QJZA 2X4UA 3QG7H 2NY6B 1OCOB 5J1AA 5ANME 1TF4A 1LO2H 5ANHA 4Y4FD 1M42A 1IC7L 2X42A 2E75C 1FWXA 3UTTD 2PYEA 3B9KD 1SY6H 3UTTA 1IGFL 3IN2A 4HJSA 3LB6C 5A6LA 1ZXKA 3ATBA 3MGOB 3MRMA 5IVXF 3JTSA 25C8H 3S35X 4DTGH 4AV0A 4NBXB 3DK0A 1HL9A 1U8NB 3NJXA 1ZTXH 2VISA 3BEVB 3MV7B 3SKJH 3TBVA 5I0YA 2O5ZL 5LGKA 5CCGE 3OAYK 3WIIH 4XRCA 3ROLA 1ZLUH 5KAQF 4B5EA 1IBYA 5L9DL 1UG9A 1A1OA 1VEOA 3A6BL 2XN2A 4R7DB 3AACA 4RMRA 3EYOA 5HJDA 4XXDA 4R90L 2BWQA 4KU1A 1MVFA 1URZA 3IDUA 1EK3A 2ZSVA 1FNFA 4OM1H 3WHE0 1NCHA 1KTDB 4Z7UE 2X2HA 4YQXH 2ZCKH 4AYFB 1KYAA 3MLYL 3JQOB 5FO7B 2A77H 3S88L 3VFOB 4UZGA 5HYJE 4P46A 3TEZA 2ZONA 2R2CA 4F7PB 2OW6A 4Y5YB 3BSHA 2ZSWA 3CU7A 5DR5L 5IUSA 4F57H 4F9LC 4KKBD 3EH2A 3V5DB 5DD3H 4U1LB 3LNIA 4PB0L 4CVWA 5IWLC 1PLCA 4JJOA 5JR1L 2W91A 4YO0A 4WY7H 2IMNA 3AUWB 4ZDHA 1MLCA 1HOCA 3O8XD 3SPVB 3MOAL 5IB4A 4W4OA 4XNXL 3O8XA 4BA8A 2WWMC 3LD8B 4EKJA 3F7PC 3QUXD 3X3FH 1UKTA 4YDIL 5IHHA 3APCA 1DJIA 3TV3H 4PGEA 1SXSA 4YHPA 3QUXA 5EIQA 4I8DA 2LFGA 4NN5B 1KTLB 2HG5A 1CFNB 1PG7H 2APXA 3BDYL 1A3QA 4LHJB 4BH7A 3U1SL 7PCYA 4MAUL 3KPRE 3F84A 1NSNH 2AK1H 5B38A 2GUYA 3ARGB 4PREB 2Q6WB 4C4KT 3UZVB 3B5HA 3SGKC 5FWRA 5KYNA 1TLMA 1T7ZA 1X5FA 1KLFB 2WTPA 3H7LA 3NSYA 1E42A 2WXHA 2DWEA 4BRJA 2GJ6B 2V33A 5TPWH 1LDPH 4XPBH 2CLZB 4FI6A 5D7KD 4X7EC 4Y2DA 1ITCA 2X2UA 3OPZL 4JHWH 1CO1A 2VIRB 5GS0L 3A4DA 3IMUA 1K8IA 3RFRA 3ABZA 3J2PA 3F12A 3GNML 4HQQH 5L2JA 1EEYA 2HH0H 1F3DJ 3PXHA 3KJ4B 5HJGA 1G7IB 3D07A 3NN8B 3PU7A 3W9EB 2WPGA 2XN9D 5EEVA 3WTSA 5A2KH 1F4YH 2XN9A 4M61B 1DBJH 3CHPA 5C0IA 3WDHA 4N8CL 4WU7A 1SHSA 3D3VA 2WQUA 4LCYB 3RL2A 1ZHNA 2GW5A 4TSAL 3L5XL 3BWZA 3O4OB 2OMVB 2X4NB 3ABLB 4PN6A 3RGVC 2K6ZA 4JLRA 3FB6B 3DNKA 1DHKA 4HJTA 3U6XS 5BZDB 3WDJA 3WLWC 4ZTPL 1L9OA 3C8KA 3K0WA 2JELH 4M5YH 4IU3A 3QDGE 3WNJA 3A5VA 4KKZA 3VDCA 2CKBA 1RZJL 1W16A 3T09A 1G6RA 4N9GA 3VD3A 3SKNB 4Y16B 2H0JA 2WXRA 2H32H 5DVPA 4ILDA 4NNPH 3U9PL 5IB2B 2X0WA 5IP4A 4QUOA 2DMCA 2Y06H 3OAUL 3FUEA 4QOKD 1AGDB 3GRWA 3ZDXE 2VITA 4DWHA 1FFOA 3IKKA 3ILPA 4GQQA 3T0DA 3E2HC 4JE4B 5AAWA 4UM8A 5FUOL 1WFIA 2PETA 3QPQD 1A14H 4Z7NB 3L3HB 4YZFF 1T1WB 2BH0A 2PPEA 3LQAH 4P4KD 4ZW3A 4XNZC 5GRJH 4R7NA 3CZGA 4KRPB 4P4KA 5K5YA 2E7BA 4ZMAT 5EU3B 4OB5L 3E7JA 4XMVA 1J5CA 3EJSA 4I5BA 5HY9A 2GKIA 4KKAD 3F7VB 2P8MB 3I3DA 4UOW0 3CBKB 4L3FA 2XN1A 4A6YH 1GXEA 2I27N 2KHAA 1U58A 2YUXA 3BGMB 4Y88A 3B9DA 1SXZA 1VFBB 2PP8A 4G7QB 3GLZA 5CJXC 4XC3L 1IARB 2GHZA 3FFCE 3KEHA 1ZVNA 5EG6C 4Y9EA 1VGKA 1KGCE 1F58L 1L5GA 1OALA 3NAAH 4FHBD 5CZVH 2Y3AA 3PWPB 3QRGH 5IEHB 4WAFA 1E9OB 5FAAA 2OZ4A 3OAZK 4A04A 5FF6A 3VA6A 4YC2B 2DQEL 2MNWA 4GBXA 2ZCLL 4XE0A 2XXGA 4N6RB 1TYJA 3VFWB 5DUML 4G3YL 4XP4H 5F2FA 2V37A 4HT1L 1KB9J 5F96L 5L7XL 2XRAL 1JVLA 2D4DA 2OR9H 4GXVL 3M45A 1BX2A 4NIYE 4WW1A 4K9EH 3VFMB 2OYKA 1W8NA 5J06A 4WJKB 3OB8A 5AYUL 5ANMA 3UPCA 2H3NA 5AAPA 5IVZA 1MHPH 1KIPA 3L4ZA 4OVVA 1ONQA 1JGIA 3BKYH 1IQDA 3MOQA 4TSBL 2OFQA 4X8XA 5J9PA 4JR9L 2QVTA 3MV8E 4LIQL 3O2WH 2XWDA 1H3WM 4N8VA 4CW1B 5ILTH 2V4LA 4Z76A 1L6XA 1V3MA 5E8NA 4EIBA 3VRIB 3DTXB 1F0LA 5ESVB 5K9QI 2L04A 4MCYB 3CVHL 4RFOH 5IF0A 1KCVL 3GK8L 1AGCA 2B4CH 2VXTH 5TK2A 2Q3AA 5CEZL 5D7IA 2A6JA 4BSVA 4TUKH 3VWKD 4I2XE 4FQPA 3VWKA 1Z5HA 5E6ZA 2NTFA 5KJ4A 5E24E 5EZPA 3BT2H 1XF4B 5DC2A 4X6EB 2BZ7A 3VGAC 3V4PB 3LZFH 2N7BA 2RB8A 5HYQA 3PREA 1B2YA 4P5TC 4UF7C 2WB7A 2VLRB 3VGBA 3RTQC 3N9GL 2NY7H 4W81A 4KKLD 3NIFE 2E9BA 4Z7UA 4HGWB 3S97C 1RJCA 3H54A 5E5MA 4AUJA 5HYJD 4P57A 4MQTB 4YR6A 3WIFB 5HYJA 5AB0A 1G1YA 1TPXB 2O1AA 1SQMA 1KDJA 2IWGA 4NC0B 5E5LA 4LLMA 4M5SA 1CTNA 3ILQC 4Q4EA 2QPDB 3O2DA 4TYUA 4XTRC 1THCA 1DVUA 5HDQL 2OMNA 3OKNB 1UYWH 4B7IA 4B97A 3EXJA 3Q9PA 2EVJA 1TJIL 3VXRE 1ZK5A 2VDRL 4NDMA 4PRHE 3ZL1A 2IOIA 3EJCA 4FTVB 4EI5D 3F6LA 3FS9A 2P8LB 3WIAA 4EI5A 1VZIA 4NUMA 5KSBB 4PJXA 4TLKA 1RIHH 1X5KA 3PV6B 3ZQXA 3WD5H 4TNWK 2BFVL 1JYVA 1O6TA 3S98A 1YC7A 4JHAL 2JK5A 3KLAB 5F8QC 5DEFA 5IHBA 3BAJA 1AOHA 1OD7A 5LG1A 4JFDE 3PABA 3S5ZA 1XD1A 4KTEL 5I1IL 1ZHBA 1T5WB 2Y6SC 2DQHL 3AGVA 3KPRD 1SDAB 5E1AB 2ZXCA 1O6SB 4FJ6A 1E5ZA 3BQVA 1MJ8H 4X4KA 1ZHKB 3K5SA 1J1XH 1WPCA 2H8PA 2WMPB 4XP1H 4F3FA 3IAQA 4PBWD 1IKFL 3NJJA 1UH2A 1AZRA 2UVEA 2FLRT 3GXTA 3TBTB 3QEUA 3PIQA 4KI5E 4OJDH 1LP9F 1S3KH 2AJXH 3R19A 4JGJA 1FFPA 5BJTA 2AEQL 5D55A 1IGMH 3PCYA 1TG8A 4OJFL 3P0GB 5M7QA 3KLQA 3BUPA 1DJSA 3GFUA 4JPSA 4JK0D 1J8SA 3AB0C 4I18C 5EU6B 5ISZE 4OT1L 3VG9B 5KVGE 1B4JL 1X6NA 3Q48A 1A6WH 4UOQA 2VUKA 1L7IL 2DQ6A 5EN3A 3LXBA 3VG0L 5LDUA 1LWJA 2D0FA 2HT3D 3B1UA 4NUPA 2V3FA 1JHLH 3F00A 1D9KC 5HDBB 2Q8AH 5I9QC 4PP2A 2R1YB 4UANA 3MJ8A 3MRFB 4OFYA 4QRSB 1MFUA 4D0CB 3RQ3A 5DDHA 4DKFH 1GGUA 2VL4A 4KJWD 3FRPG 3TT3L 4JZNA 4GH7B 2FO1A 1NQBA 2Q2EB 3MV11 2EC9U 3FB8B 4CC1A 2ADYA 1EQWA 4K07A 1EBAA 5CP7B 4FXTA 4JAMB 1UWXH 2AV7B 3QDGD 5HYSB 4ALAH 4PRNA 3QDGA 1KSRA 2BHZA 2R29A 3C87A 1MFBL 3BYTA 4JHUA 1WBYA 1ZT7B 5JMOC 3II1A 1WT5C 2F5AH 3B2XA 4CMHB 1BBDH 4MA8L 1MCJA 1H15B 5MEQB 3FAXA 5GJSH 2R0LL 2O93L 1JNNH 4MMZC 1XF2A 1GIGL 3M1BB 1CD1B 2A74B 1N7ML 5IFHL 2GK0A 5LAXA 1BD2A 5KAQG 3RKDC 2GIMA 5D93B 2ZPKL 3SE8H 1E4JA 5KVEE 4DKAA 2JKXA 3BP7B 5DT1H 3EZ8A 5ERWB 3RAJL 2FJFB 5GSRB 2IBZY 1MEXH 3RTLA 3T5WA 4K73A 1DSFH 2Z8SA 4GIPD 2WHVA 4JM4L 1KCUL 2MQ3A 5IMLA 5E9DB 3QQ4A 1JPSL 1XF3B 3FFCD 3QIBB 4NP4L 4WJ5B 3FFCA 1KGCD 1HHKA 1KOAA 3BKML 4KVCH 3OQ3B 5I6NA 1J5OL 3HC4L 5M95B 2H6PB 2K78A 3P0YH 2Y9RT 1A5FH 2WO4A 4G70B 2C3HA 2DLIA 1B3IA 4KZEH 5F3FA 4AH2B 3TT1H 4PJ8D 2AJYH 1IAKA 5I16B 4PJ8A 2JKIS 1S3RA 2NY3C 1MW0A 4ICXA 1AQKL 3DOSB 2YD5A 4GW1A 3LNFA 4L1SA 4ZFOA 4QRFA 3MX0A 3OR6A 2V3DA 4PJFB 2FSEB 2GFBB 2EVHA 2X87A 1LYQA 4QRTA 1D6VL 1DQML 3MV8D 4ZFQA 1PCSA 5D7HA 5K1JA 3U4BL 3MJ7B 5HHXL 3UBFA 2LAGB 1SN5A 2BNUA 3OC8A 3IE4A 4HKZB 5AOKA 1VJSA 4M03A 4W9HC 4CVZB 1DBKH 4KMTH 3ARXA 3U7WL 4UBDD 4K3HA 1JUFB 2VZTA 3V0JA 2XZQL 1M7UA