3FSXA

Structure of tetrahydrodipicolinate n-succinyltransferase (rv1201c; dapd) from mycobacterium tuberculosis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
307
structure length
300
Chain Sequence
b'VTGAAGIGLATLAADGSVLDTWFPAPELTESGTSATSRLAVSDVPVELAALIGRDDDRRTETIAVRTVIGSLDDVAADPYDAYLRLHLLSHRLVAPHGLNAGGLFGVLTNVVWTNHGPCAIDGFEAVRARLRRRGPVTVYGVDKFPRMVDYVVPTGVRIADADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEGRISAGVVVGDGSDVGGGASIMGTVISIGKRCLLGANSGLGISLGDDCVVEAGLYVTAGTRVTMPDSNSVKARELSGSSNLLFRRNSVSGAVEVLARDGQGIAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tetrahydrodipicolinate N-succinyltransferase
publication title The three-dimensional Structure of a mycobacterial DapD provides insights into DapD diversity and reveals unexpected particulars about the enzymatic mechanism.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 93
structure length 300
sequence length 307
chains with identical sequence B, C, D, E
ec nomenclature ec 2.3.1.117: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase.
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
A PF14789 THDPS_M Tetrahydrodipicolinate N-succinyltransferase middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3fsxA03
3.30.60.70 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Trimeric LpxA-like enzymes 3fsxA02
3.30.70.2010 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3fsxA01
4DCLA 4KPXA 4EAAA 2QIVX 3FSCA 3FWWA 1QRFA 4K6RA 3EEVA 3R3IA 5DEMA 3Q1XA 3MQHA 1SSMA 4R7PA 2W0VA 1KRVA 3EH0A 4M98A 2W0WA 1T3DA 4HZCA 2IU9A 4J18A 4IHHA 4E79A 4IHFA 3V4EA 1YP2A 3NZ2A 4MZUA 1FXJA 2OEGA 3SRTA 4KNXA 3IXCA 3TV0A 3OTMA 4MFGA 3OU9A 3KWEA 2IU8A 2RIJA 2OEFA 2WLCA 1G97A 4G3PA 3T57A 3TK8A 3IGJA 1SSTA 2V0IA 3VNPA 1V67A 3R3RA 3FSBA 1V3WA 4EABA 2GGQA 3GOSA 4ISXA 4N69A 3VBMA 3FTTA 1Z90A 3FOQA 3JQYA 1FWYA 1OCXA 3DHOA 1KQAA 2VD4A 4HURA 3MQGA 1TDTA 3R2WA 3PMOA 2AQ9A 3D98A 3FS8A 3VBNA 2V0LA 4M28A 5ADXU 2P2OA 3P1BA 1QQ0A 2V0HA 3FSYA 3R1WA 4E6UA 5DG3A 3ST8A 4R36A 1HM8A 4MYOA 3OTZA 4AAWA 2OI7A 3TISA 2GGOA 4EGGA 3TWDA 4N27A 1G95A 2ICYA 2JF2A 2WLDA 1SSQA 5U2KA 4H7OA 3CJ8A 3BXYA 3D8VA 1XHDA 5E3QA 1HV9A 3I3AA 3R5CA 1MR9A 3R0SA 5AFUV 5E3RA 4M99A 2WLEA 3SPTA 5F42A 1KHRA 2TDTA 4E6TA 3P47A 2WLFA 3BSSA 2XATA 4G87A 1YP3A 1MR7A 4KQLA 4FCEA 4AC3A 1THJA 5L6VA 2OI5A 1KK6A 2I5KA 3HJJA 4HZDA 1QRMA 2FKOA 3KWDA 4HUSA 4IHGA 4KNRA 3EG4A 4EQYA 4EA9A 1KGTA 1QRLA 2V0KA 3R5DA 3BRKX 3F1XA 3R5AA 2WLGA 4KPZA 3GUEA 3TDTA 3VBPA 3VBLA 1LXAA 4G3SA 2QKXA 3BSYA 5L6SA 1YP4A 2Q4JA 1QRGA 4EA7A 3DJ4A 4M2AA 2V0JA 3VBJA 3MC4A 3R8YA 2OI6A 4M2BA 1KRRA 4J09A 4G3QA 1XATA 4M9CA 2QIAA 1HM0A 3OUPA 1KK4A 1J2ZA 3BSWA 4HCQA 1KRUA 2JF3A 4R37A 4EA8A 3ECTA 5AFUU 4E75A 3BFPA 3VBIA 1QREA 4N6AA 4AA7A 3GVDA 2IUAA 5DEPA 2ICXA 4N6BA 1KK5A 1HM9A 1S80A 5E3PA 2IC7A 5ADXV 3HSQA 3VBKA 1KGQA 3C8VA 3FSXA 3OW5A 1MRLA 3I3XA 3R5BA 3TIOA 3KWCA 3DK5A 2VHEA 2NPOA 4E1KA
chains in the Genus database with same CATH superfamily
2MY8A 2D1CA 1NNDA 5A6WA 5D0EA 3FNNA 1KC8T 1RK8A 2RS8A 2A2DA 1ZM3A 4N76A 4FF2A 2C2OB 3TEGA 2DXEA 1NPPA 4OJGA 4P7TA 2B4UA 5ETQA 2ZUGA 4ZVRB 2QMXA 1TP7A 4DDFA 4N69A 1K1QA 4WYLA 2VA3A 1BGXT 1GAOA 2A6MA 4DX8H 5H9EK 3RW6A 5L1IA 1FKOB 3BSCA 1NKCA 1DBDA 1XQIA 1YRXA 2WLDA 2MQNA 2V68A 2DNYA 1LNQA 2QA1A 2E73A 4NXNJ 2RAQA 1HWJA 3UOEA 3K8VA 1RT3B 2KO1A 4EQYA 1MMDA 2WAQD 4OJHA 5JXSA 3NS5A 1SPBP 3BSOA 1M8BA 2RNEA 2UUBF 4ELTA 1DAXA 2HHHJ 3GIIA 3MR5A 4J9PA 1S1WA 1KK4A 1R8AA 4KAIA 3VZIA 4DV4J 2VH7A 2BV3A 1YJNS 3DLKA 4WFBQ 3KDNA 4JI3J 1Y11A 3JQMA 2J0WA 1WOSA 3BYRA 2GW8A 4M5DA 3HHNB 1HPTA 5LM7E 3GJRB 2OEKA 2JZ5A 1N32J 2B6AA 2M3DA 1H0HB 4NLXA 1W3SA 2E29A 1UUCA 3FC9A 1RAJA 3W62A 3TUPA 2HBZB 2B43A 1AUSL 3CMES 3BH7B 4HURA 2G1HA 5KOWA 2I6WA 5GAGI 3R7BB 1TURA 1IR1A 4CLFA 1ZM9A 3QRQA 3M8WA 1LK5A 5DM7Q 1VQ9S 2V8HA 3UEYA 4CDIA 3W1YC 4G87A 2XO7A 4G1IA 3OV7A 1Q95G 5DAEA 5J2NB 2CQBA 3N0VA 2DO4A 3BO4A 3R5AA 5L8RC 6AT1B 2NS1B 4LF4J 4ZITA 2GJIA 4CO1A 2EKYA 3Q8UA 2WZ1A 2YNIB 3G86A 4HH1A 2QFJA 5K5MA 3I4HX 5HSPA 2UUAJ 2QX0A 2H4YB 1MMNA 1U7LA 2Z2YB 4MMOA 1HIYA 4F26A 3GFZA 1OYVI 3Q24A 2EXUA 2R7VA 1YZ7A 1S0NA 2EWHA 3M1VA 4JBCA 1QE1A 5ETTA 1R6YA 3CDBA 1TQLA 3DRRB 1WOPA 4A8SA 1TKXA 3T57A 4IH7A 3BGFA 1FY7A 3LP0A 4PCQA 5KFUA 4NXMF 4DLGA 4J9SA 4ZVGA 1N34F 4YP3A 3R2WA 1FKAF 1U5KA 4ID8A 2AP6A 1S9GA 2F8EX 1TL1B 1IKYA 2DNNA 5KFZA 3JQJA 4NA2A 4AQYJ 3NGSA 1Q53A 2EC0A 5AFUV 2VG5B 3OLBA 4TYBA 5FUYA 3ENWA 4AC3A 3I5CA 1OYDA 2ZH7A 3CJ0A 1YSJA 3D00A 2YKNB 4HDGA 4DCOB 1FD2A 3VBLA 4G3SA 4Y34A 2OVOA 4NCGB 3HZEA 3KLGB 4DR6F 4NCAA 4OX8A 3DYAB 2GHWA 3V4MA 1IQTA 1U0SA 2N3LA 1TUSA 4DQRA 3R5BA 3E2IA 3HT3A 2E44A 4ZHRB 3M30A 4KV8B 3CW2C 3RBXA 4KO0A 2XGPA 2YWWA 3OTMA 4ZPDA 1TUWA 2J9DA 2L9DA 1SSTA 5L1JA 4BCAA 3DLHA 2ATLA 3HHLC 3R3TA 1X9SA 2K9HA 3T1YJ 3FS8A 1Q5VA 3PCOB 4NXNF 3R1WA 1RA6A 4R36A 3TZXA 3NNCA 1RHJB 4WF9Q 4UOCA 3ZXWA 1Y5LB 4ZPBA 2CPZA 3VDUA 3DLEA 3G82A 1VQ4S 2NYHA 3IWLA 2BQUA 4DV4F 3GQ9A 5CHCB 5IS2A 4IDKA 3DU6A 2XB2D 4OZ3A 2KHCA 1U1NA 2W7PA 1RHRB 1NK5A 1LW0B 3FEYB 1BWEA 4CRJA 1WHXA 1F9EB 4L6V3 1IBCB 4DS4A 1YX2A 5E3PA 1YK9A 3J81j 2Y1IA 2MKHA 3ILLA 3NNHA 2Z56B 3UGLA 4LR9A 2PGCA 4WFXA 1TL5A 5KG7A 4B02A 4XPEA 3SZ2A 3PO4A 4HHUA 1AROP 1SKSA 4O23A 3WIUA 3M7VA 1HQEA 4DR7J 3I31A 2BMBA 1JLGB 3HT0A 3F44A 1Q82T 1Q79A 2L3MA 2PMWA 2GIVA 4ATNA 2R7TA 3VBMA 1FKPB 4I67A 2P5VA 4YY3J 1CSJA 3ZZUA 2DHSA 1X9WA 4IH5A 2GMJA 1CVJA 9WGAA 3B4DA 3ST8A 1RHQB 3AQOA 1G95A 4TU8A 3CCZA 2M9KA 3GPAA 2VB6A 1TELA 2HZAA 3POTB 2VKRA 2CPDA 1QVFR 4DJBA 4NPOA 3R7NB 2RHQB 3RRHA 4LF4F 4TXSA 2OI5A 1UJ6A 4RW7B 1DLOB 2LCWA 2K8GA 2UUAF 3VGUA 4KH1B 4QYRA 1MN7A 1JLQB 4A4JA 1WUUA 4F2SA 1YBUA 2FGOA 1S1TA 2AU0A 4PEOA 2XQCA 4Y2KA 4J09A 1HBNB 2YWHA 3MAAB 5JMNA 2NZCA 2OPPA 3FRYA 4EA8A 5DG8A 1J5OA 2CWFA 4O3PA 1AZSA 5DEPA 2OAUA 3D4JA 1TV6B 1MRLA 3DDIA 4EBCA 4JI4J 2UUCJ 2VONA 3K0JA 1HL6A 2CZVC 2VA2A 4AD6A 1TL3B 4J7CA 5LT5A 4CQ1A 3NRBA 2HLUA 2G2YA 4JB8B 3ZZ0A 3MEKA 4ECZA 1U4BA 2GVDA 2F3CI 4LFBF 1WI6A 3F56A 3CDEA 4QCLA 2IA0A 2DIVA 2ROEA 3TA1A 1X5TA 3JSMB 1MW7A 2ABYA 2HHUA 2GO9A 3RB0A 4GC7A 2U2FA 2NZ4A 2A0FB 3AOAA 4NMLA 2FC8A 3UVJA 2XMKA 5I3PA 2GNKA 1F9HA 2OLWA 2AGOA 1WKLA 4OZJA 1N8RT 2HAIA 2B51A 3JTOA 4ZPAA 4RW9B 2J6SA 1RWPB 3L7OA 2GQCA 3PYFA 3DLGA 1F1BB 1WJ9A 1RT5A 5IQ6A 4PXBA 4RR5A 4N6BA 4N5SA 2AJFE 3JTPA 2BEFA 1YI2S 2V4QA 4RL1A 1U1RA 1VIXA 3KK2B 1VBKA 4KHMA 1RT7A 2ZE2A 5J2QA 2EG2A 2M5XA 3GYXB 3OSNA 1KHWA 3EICA 3M8QA 2HS0A 1JKHA 3SV3A 1T3NA 5J8CA 4MIAA 3S8SA 4J9LA 3AD7C 2DHHA 2V2VA 5HATA 3PZPA 4C3KA 4EUVA 2ZD1B 3OH1A 4KY3A 3RRGA 1M5PC 4QU7A 1RTIA 3NWGA 1S49A 2W9CB 3DOKB 3SCLE 2HQFA 4YMEA 1S6OA 2F4FA 4KR0B 2GHVC 4MIBA 4RNHA 3FQLA 4HZDA 2EW9A 3KXDA 4UXJA 4TNOA 4J9MA 4DNCA 2LUYA 4P71A 2WOMA 3P5TL 3EGNA 3G4SS 1V9OA 3IRXB 3K89A 1FJEB 1TBOA 1KTVA 3G71S 2RDJA 5CYMB 5K14A 1HI1A 3HVTB 4N56A 2IUAA 1S6PA 1FYBA 2ZZNA 1ZZNA 2YPYA 3FBBA 1UA0A 1TFYA 5CXTA 3PFEA 1QRFA 5KFPA 4WWSA 3MM8A 2VPZB 4N47A 1M5VC 1N13A 3ISNC 3KJFB 4P9SA 4YY3F 1OS5A 2DHXA 1KEKA 5C24B 3T1AA 4KSEB 2MSSA 2VPYB 1NJYA 2HBQB 3MTJA 4K4UA 2X52A 3OTCA 3FMBA 1UW9A 4O4RA 1RBAA 1FRKA 1XR5A 2ZKUA 2OSQA 4CZCA 1BQNA 3AAWB 4ZN1A 2CJQA 2JF2A 3SUCA 2W4DA 1S7IA 3D6MB 3PIPQ 1NO8A 4RKUC 3KJVA 3NAIA 4AFFA 2V8PA 4RWWA 3OHAA 1RT3A 5CYQB 3KLHA 1E6YB 1RKJA 1I3OB 5FDLB 4WXWA 1RYSA 5FLXY 1SL2A 2CUYA 2K1RA 4P2MA 5A8WB 1S6QA 4LSZB 4BDPA 1TK0A 5EHHA 4CTAB 3N9UC 2V67A 2DGQA 4R0EA 2GGPA 4ED6A 3PHTA 2HEKA 4RW8B 3UGDA 1REGX 4IOBA 2GV1A 2QQCA 5KG0A 3OR2A 4NLTA 4L3NA 1WI8A 2FJXA 2HGMA 3C66A 2OUGA 2BR0A 1VRQC 1X4AA 2LQJA 1OY8A 4OYZA 3LP1B 4RNMA 2OMOA 4KTQA 3HHLA 1UVNA 1S76D 3A3PB 1AT1B 3EXCX 1PG5B 3E8OA 5A2QU 1AB8A 4XAKA 1G7CB 1YGYA 3DU5A 1SSQA 2DR9A 1OQ3A 3HSZA 4FPIA 2RQMA 2EC2A 4IRDA 3MR6A 2MLXA 2DNPA 1SJFA 2L48A 2NUHA 4CLUA 4OYAA 3HHKA 4L75A 3D7SB 3NL0A 2VFSA 1IY6A 1F5AA 4CI0B 3IMQJ 1NZAA 1CJUB 3WX4A 2MKIA 4WU2A 1WELA 2OGUA 2E5JA 3RJMB 2VC1A 4JI8J 1VI7A 2DXFA 4AA7A 5IM0B 2N82B 2CQGA 1Q8IA 4UUXA 4PWUA 5ETLA 2HHXA 2O67A 4DL5A 1VMBA 4FNIA 3QIPB 3HVWA 2LLZA 1Q1KA 1SB6A 2L08A 2RRAA 4ZOSA 3SGBI 4IG0B 1BD6A 2ZJRQ 1KQAA 2F63A 2PIIA 1TL1A 3AXMA 3I4PA 1RTHB 3GOXA 2E5HA 4JV2A 4G3IA 2WLEA 3NWRA 1RBOB 1N54B 1YG0A 1GNKA 2Y0MA 1JNZB 1NEEA 3AOCA 3OVOA 2XS5A 2CZ9A 4Y3CA 3DHXA 5IZHA 3PW5A 3W8GA 4LREA 1H7WA 1IKWB 4KGVB 4NLVA 1VCTA 2HAFA 1DJ0A 1KRRA 3JQKA 2IJNA 1FJGJ 1EHWA 1J2ZA 2BW2A 3DYAA 1WD6A 1C4CA 4OFZA 3I9V9 5EWEA 1OJ4A 4RU2A 1TL4A 4OHZA 3MXHP 2Q6BA 4KB7A 4DEZA 4C8KA 1XMOJ 5IFMA 1EZZB 1SGNI 1T9UA 5E7OB 3TI0A 2G0CA 2N7YA 2XMVA 5LMNJ 2ERWA 7AT1B 1JJ4A 3K5LA 4J9KA 1SQFA 2IHR1 3FBCA 4C8YA 3LGHA 3OFGA 3PRVA 5F8GA 1NSQA 4ZLJA 3VALA 3TOAA 2HHPA 2FHJD 3BO2A 3DRSB 3BSNA 1NH8A 3TQ1A 2AZ3A 5T41A 1T0TV 2CJXB 4E6TA 1GQEA 2KVIA 3FEZA 4QWCA 3ZTPA 2GZOA 1L3UA 4PG6A 1U49A 4OZLA 4M5LA 4OYWA 2AF6A 2OO4A 1WG5A 4WK1A 4FBUA 2VICA 3MR3A 3D68A 1SL1A 2XSJB 2DT9A 2Q4JA 1A0OB 2VU5A 1VQ5S 4WFYA 3ZZTA 3O1LA 1RXOB 1TK8A 1RDRA 2DH7A 2L41A 4FZVA 1X74A 2A6OA 3CO0P 2ZZTA 1RLDA 2HK3A 4Y28C 3R7SB 4DR2F 5EX3A 3D2WA 5HK4A 5CCMA 1WGTA 1TKZB 4PRFA 4LFAJ 3UO0A 2GC8A 3RAMA 4C0HA 4TYAA 2KTQA 3BH6B 5GAHU 1X4GA 3ONQA 3Q8VA 3WZ0A 3BDPA 3WDOA 4H4MA 3GB0A 3CJTA 4G3PA 3DLJA 1F60B 4LIWA 1FKPA 3UD3P 1R0AB 3SSRA 1WC6A 1RWUA 1WSRA 4RW6B 2MZSA 5IV3A 5ADXU 4EZ6A 2KT5A 4U8YA 4ANDA 3LP2A 4LF1A 2K3KA 2KDOA 1N4IA 3OFHA 3H7HB 2DR6A 1N5VA 4A47A 2MZTA 4OI2A 4WJBA 4IH6A 2AJ4A 3W61A 3RAXA 2SXLA 1RU2A 5C2CA 1DLOA 3BBBA 5DZ6A 2VF3A 4NZ6A 3JAMU 2B7CB 4LJMA 2IDLA 1FAQA 3WBZA 3MAAA 3I55S 5AJ3J 2RDIA 2QIAA 3BQ2A 4DU8A 3TWZA 3OPKA 2C2RA 3MM7B 5L1LA 2FB0A 1YJTA 5GMEA 1KN6A 1OPIA 5HQMA 2YVSA 1S10A 2R2SA 2DNZA 2IIHA 3HSJA 1OY6A 1JLAB 3LQVA 4OZ5A 4USTA 3H5SA 1PYSB 1X9MA 3N6LA 1LW2B 4E1PA 2IAJA 3UDLA 2UVUA 2Z2ZA 3D0IE 3SFUA 2V0IA 2RC4A 3UGIA 1X4SA 2YQ0A 2EBEA 1YBAA 2MKSA 1RT4B 2WBMA 2ZH9A 2QYGA 3T19A 1S4EA 2ELIA 4JI1J 1U47A 1UW4A 4URSA 4K4VA 1S1VA 4F0MA 1VS3A 3V2UC 5EUHA 2ARPF 1IM6A 3C14B 1OSCA 4HUSA 4B9MA 4PWDB 1VC0A 1K9MT 3C3LA 2JLFA 1B3TA 3KHHA 2CQDA 1KLNA 3BN7A 1KFSA 2WB4A 1XMOF 3GJSB 2CNKB 1VC5A 3PRBA 5K8MA 2C2NA 2VFVA 4RNNA 4NLYA 4B9LA 5LMNF 3IO1A 5DLFA 1A9NB 4ZDNA 2R2RA 2V8VA 2VRWB 4LBHA 1N48A 3KFWX 1KONA 1TK5A 4C11B 3KK2A 4DZDA 4IO9Q 1UWBA 2LEPA 4DV7J 3IXQA 3FBFA 2ZH2A 4MJKA 2KJVA 4JV5J 5B0DA 4I2PA 1RTZA 4OVOA 1U1KA 1VOMA 2B4VA 1IN0A 4NL5A 4I0WA 5LL6d 3SDEB 3KY9A 3CJ2A 1NJXA 4P52A 2DNQA 2JZMA 4X66F 2X1BA 4K7QA 2N17A 1CT4I 3M8RA 3CCQS 5HBMA 1WC0A 4YN3B 3LA0A 4MTPA 3VGSA 2BE2A 4F0KA 3EPGA 2NSCA 4LSLB 5ETOA 4KPZA 3AY0A 1YWXA 5ITHA 1XIQA 4OV1A 2BA9A 3KG1A 4M5MA 3BQ0A 3HVTA 3MFIA 5E5NA 1A7GE 1H98A 1JLEB 5DDQC 1G2EA 4LSNB 2XGQA 2HGLA 2H4WB 5D3GB 1YRUA 1WSVA 4NLOA 5C24A 3OL0A 1GXUA 4ZPCA 3HJFA 3KWEA 1U1QA 1G3OA 2SGFI 3W5ZA 3KLEA 1NK9A 3NBPA 3VF0B 2GGQA 3ET6B 3TAQA 2VD4A 3ITHA 3UR3C 3NNAA 5CQGA 3B6BA 4FXWA 4AAWA 4N8NA 4HACA 4JI2J 3TX8A 3PTWA 4CH7A 1WG4A 1J27A 2YH1A 1TBQR 3HD2A 1MU2A 5CYQA 4LMZA 5AJ3F 1HPZB 4ED7A 5B0EA 1ULMA 4F8RA 1E6YA 3BRKX 1SH2A 4IFYB 3SIPB 1W7WA 3M9MB 2H9ZA 5A8WA 5KFLA 4DV0J 2N3OA 2OI6A 3EGWB 4UT4A 3Q8QB 2CPJA 2DKVA 4IG3A 1T9WA 3MPYA 5ETNA 4RW8A 3UCGA 3Q8YA 4E0DA 1RT2A 3CCWA 1FFWB 5CABA 2BM1A 1AFIA 2JLGA 1IBMF 1KP6A 2YX1A 2GJ2A 3Q8SB 3V4EA 5D0HA 4BWMA 5KG5A 2JEFA 1NB2A 4X4VA 2VFTA 4Z37A 3HULA 3O2IA 3PXGa 3P4UB 3QBCA 1UFWA 4LRBA 1HM8A 4DSEA 2HG4A 2AT1B 1JLFB 2H5JB 1GH8A 5U2KA 1J5EF 4JI6J 1KR4A 1XMQF 3R5CA 1WC5A 1HNZF 4J9UE 3I5AA 1RKIA 2LP4A 2FNFX 1EQ0A 4I6YA 2WSCC 2KN4A 4RW4B 5LSRA 4R5PB 1QAYA 4HTJA 2PI5A 2OPSB 4OI1A 2FJVA 4DZ6A 1SUQB 1K73T 2Y1RI 3CDWA 4EU0A 3GMGA 1D8ZA 5A8RA 1SJ4P 2HFOA 4IQXA 4ECUA 2P6TA 1FXLA 1RTDA 1C0UB 1WORA 4X2BA 4DI6A 4NZ7A 3HK2A 2B8QA 1RP5A 2APOA 2MEWA 1M1KT 2FVQA 3CCRS 5C25B 2Q6CA 3QGPA 3FZBA 1XBTA 3DGPA 3KJNB 4IG0A 3ZTQA 4LRCA 3V6DB 4NLWA 1SGPI 1VBZA 1QUPA 2KRRA 2AJQA 1SH3A 5M2RA 4FVMA 1LOUA 4OLPA 3FSYA 3K17A 3UCUP 2HNZB 1NJIT 3N79A 2ZKTA 3CMAS 1VBYA 3W5YA 2ADCA 3CIZA 4KFBB 4QYZJ 4O0IA 2QLXA 4ZCLA 4PR6A 4KRWA 3T9NA 1IKWA 2Z2LA 3H20A 3MM6A 1X4FA 4KGMA 1CGII 4P72A 1HI8A 3BGRB 1HHQA 3HXMA 2YKPA 3W5XA 4P2SA 4DL6A 4F02A 4U8VA 4B6DA 1QJHA 5DM6Q 1P9ZA 1NDKA 2YWFA 2NPOA 2KT2A 5AXNA 3EX7B 1AN1I 3C8YA 3VHQA 3PV8A 1XNQJ 4IHHA 5ETSA 1V6HA 1KQFB 2FJDB 3BZQA 2IRXA 1RT1A 2HPUA 3OR1B 1EP4B 4NMXA 4OYMA 4JI2F 4K2XA 3M8YA 4QIEA 4UY8T 3UFFA 3O6QA 3J7ZT 1U8SA 1WEYA 5KFBA 3K58A 5HI7A 1EETB 5J1PA 2ZBRA 5LMUJ 1OYEA 3N4WA 2X1FA 4EFAC 2IVMA 2OPQB 1SC3B 4X4QA 4J9NA 3MWBA 3IBFB 3OGZA 2FZGB 3OL7A 3MI7X 2LKZA 3D9BA 3SSSA 2G1DA 2ZBPA 5KFKA 4W98A 5HP1B 1X0FA 2QLBB 4NASA 2MQOA 2JEIA 1S57A 2CWKA 2YQPA 4F04B 2PMZD 2MKYA 3MMCB 1RT6B 4DN0A 4HDHA 2UV8G 1UVGA 3KHRA 4K0KJ 2YQ1A 1D9FA 1TKZA 3Q89A 4DPOA 1MSWD 3B54A 2A1BA 5I42A 3Q0AA 4HZCA 1DQAA 3M6UA 5DS7A 1X5SA 2MJUA 1RFHA 3G8QA 3GTYX 3L7UA 1R0AA 3MCOA 3FSBA 4OV6A 4JI6F 4RW6A 2VC0A 4MPIA 2X3DA 2EK1A 1GXTA 4USWA 1WC3A 4H4KC 5KG4A 4MYOA 2CPFA 4NLGA 3MUTP 1Q5YA 5KFEA 3AB4B 3PYDA 5RUBA 1ICEB 2KMOA 2XATA 1YTPA 1VDHA 3RU0A 1KK6A 4ZKAA 4TY8B 1HMVB 1NK7A 4F36A 3ILOA 2CRLA 2W2MP 2C2DA 1OQ6A 2Y9HA 2D69A 2K7KA 1I94F 2RF2B 4HT5A 1Y10A 1HW9A 3NS6A 4P6QA 3JTNA 3H2UB 3S6EA 3HFZB 2JF3A 1B7YB 2CWXA 1S48A 2P6SA 2R8JA 4C3LA 1KK5A 1S80A 2AJ0A 1KFDA 1EAYC 1SC1B 5IT4A 1D3WA 1N33J 4WP9A 4DCLA 3FWWA 4DF8A 1JLAA 2IY5B 3D1QA 2BW7A 3NZ2A 1XNRJ 4JP8A 1IKXB 1GX6A 2DNKA 4B9TA 3R5GA 1TUGB 2IC3A 2WONB 1JIHA 3CMQA 2PA3A 3IGJA 1Q0NA 2GMHA 2V69A 4MYUA 4DSKA 4I2QB 1N52B 1XX6A 4DQPA 3VTIA 2V8DA 4HVZA 3HZGA 2HK2A 2J0QD 1IW4A 3HSDA 2MHNA 3AA8A 2ICYA 3PJWA 2D7SA 4CM0A 3PKYA 5CD4H 2JX2A 1PKUA 3ZZZA 4ZP8A 3C14A 2AHOB 4K4SA 2K2PA 1HLWA 1HYSA 3PG9A 3NOGA 1Y3JA 2FVCA 1CBKA 4E8UA 5FLXU 1EQMA 1DTTA 1XTZA 1VQNS 1CJVA 2JVRA 4M5GA 1VK3A 2FC9A 3CCES 4ES1A 4MK9A 4OJ1A 2AYBA 4Q45A 5CD4A 1RQ0A 4C11A 3EEVA 5H9EJ 3PYGA 2YNHB 2BKOA 3M6XA 3UDVA 2QE5A 2PE8A 3RR8A 3UPFA 1NKEA 1C2PA 4MFGA 2UXDJ 1F2HA 4I4BA 3OUYB 2XMUA 2DITA 5LMUF 2J7WA 3AD8C 4OX9J 5ADZA 1T7PA 4FYXB 2EFVA 3QO9A 3TARA 1NXIA 2W9BA 3F41A 1QTNB 4X64F 5KT5A 1MWQA 2RDDA 2VQFF 1EJ7L 2EPIA 4AT1B 3GJTB 1QAJA 1V3SA 1JXEA 4XDDA 4DHVA 4FS2A 5DLGA 1C1BA 2BXJA 2D41A 4M5DB 4M5IA 3EZUA 3NKYA 2GJFA 2VUGA 4IR9A 1XN9A 2W2NP 2LEAA 1X4CA 2XHCA 2ICXA 2IFXA 2B6AB 4ECQA 4LSNA 3BR8A 6FDRA 2N4DA 1YJVA 4RBVA 2O5DA 2V1CC 4DX5A 1IR0A 1RAFB 1VRTB 1Q8KA 4LF9F 3M9OB 5JJBA 5E0OA 3EYZA 1DURA 5GAHI 5DGBA 3M8ZA 4QZVB 3OTDA 3ET6A 2NXNA 5HMXA 1B4SA 1N36F 5KT6A 3FTTA 2P6AC 2XY7A 2DVIA 2FY8A 3GZ7A 1X31C 3EWGA 2MKJA 4ZVEA 1K0TA 2C3OA 1Z2FA 3EVMA 1Z4UA 3NGTA 1FWPA 1O5JA 1S6UA 1OPZA 1QSYA 3D5MA 4C8NA 3DXBA 3GUEA 2I2YA 5KFFA 2ZITA 3BBFA 2B8PA 3RAQA 3TO8A 4WZMA 2RU9A 3M1VB 3BFPA 3OFEA 1XNRF 2UUWA 5F8LA 2XTJP 1TKXB 1XEZA 3FC3A 3TO6A 5A0YA 5SUHA 3N5FA 3FSCA 3AFGA 4ILLA 2MHEA 1ULRA 3GQAA 2DXDA 2QQEA 4IO1A 1S9GB 2ZHAA 1Q7LB 1T8EA 3VE5A 1QAXA 1IKYB 4WPAA 3L95X 4HT7A 4ES2A 1X4HA 3QJLA 5C42B 1RHUB 5K8OA 1WDDA 2CZ4A 2HIQA 1LR9A 1K7TA 3CIMA 3ZNUA 1R79A 3IAS9 3IFEA 3PMOA 1FWLA 3X3UA 1FDNA 3TYTA 5IC4B 4B3OB 1V5VA 2V6AA 3GSIA 5T14A 2ZBQA 2DISA 4S0MA 2OH2A 1M5HA 1FFSB 1S72S 2XWXA 2MKKA 4UQTA 2GIQA 1WDTA 4Q2MA 2HFUA 5HL7Q 2FQQB 2N1AB 1Y3KA 3KG0A 1N5QA 3P49B 2AGQA 4R5PA 1FO1A 2V9WA 1UJ4A 4LIRA 4GVBA 4UOFA 1NXUA 4ED5A 5ETVA 2VBZA 3K59A 4CH1A 5KFYA 5D15A 1TIHA 2R3VA 4LF6J 2NU0I 4CH0S 3BN4A 4C3MA 4G3QA 1HKAA 3LGNA 5DQIA 1BQXA 3HKZD 4KO0B 2C1EB 3QLHA 3UR0A 1C0UA 4NX9A 2XBPA 2IYGA 3SI8A 4USUA 1Z2ZA 3KWCA 1L3SA 3H0PA 5A76A 3CXCR 3FQKA 2CJAA 3PO5A 1S0OA 2YKMB 4KH0B 3H5YA 4OX9F 4GMKA 2F5GA 3QAEA 4X4PA 2PEBA 4DR5F 4CLLA 1RWVB 1HHSA 4LF2A 3Q22A 1VBXA 4P10A 2J9RA 1TBNA 3D0GE 3JSYA 1TDTA 3DLEB 4EI2A 3G82B 3MM5A 4RUHA 4I6AA 3NCPA 3ZTSA 3KHGA 2IMWP 3A4TA 4IDKB 1FA0A 1AW0A 1ULKA 3OFFA 5IWAJ 1REVA 1WEZA 3OT9A 4MH8A 4ETXA 2B5JB 4C0BA 1LWFA 2PO4A 4KQLA 1UFKA 2DYAA 4OZ0A 3MZIA 2CPEA 5EWGA 2X3TA 4EGLA 3R5DA 4DF4A 1TAQA 4NRUA 3D67A 3SQOP 1ZOTA 3BGRA 4OHVA 3K5NA 3GVDA 3R2CJ 2RQCA 4C98A 1SBRA 4FP9A 1LXJA 2KG1A 3CWJA 2ZC4A 4IUFA 1DS2I 4A8XA 4DUZJ 3KLFB 2RQ4A 4K4ZA 3M2RA 1SC4B 1SV5B 4DL4A 1RAEB 4EZ9A 2E1RA 3C19A 2ORVA 4DN9A 4ED3A 2NXEA 3ENQA 2AEJA 3M8SA 3TVZA 1AUDA 2D3OR 2D3O1 1CT0I 1APSA 5H9FK 2CVEA 3TWDA 2HHWA 3CD6S 4H7OA 3N5BA 2YKQA 4Q2LA 1B64A 4KPCA 3U27A 3SPTA 2V8GA 3E51A 5SZTA 1HQUB 1O0PA 2OZUA 1KTQA 2HS3A 3CXLA 2XS2A 2LQ9A 1J2VA 1UVIA 1J5OB 2OU2A 1IBLJ 1AZSB 2QRRA 1YITS 4ZLPA 2W2OP 3L9ZA 3M05A 4GI3C 3BYPA 3J7A1 3OXGA 2XY6A 3CC2S 5LXRA 1RT6A 4KGZB 1JNRB 1U02A 2ZVSA 3TA0A 3SCJE 2N52A 3TO9A 4A8WA 2MLYA 3M8PA 5BR8J 4ER8A 3ZNJ1 2AGPA 1HW8A 2WVCA 2IU9A 1CLFA 4ZVUB 3L3CA 4Z2XA 3T6BA 4G1QA 2H5IB 1JXVA 3K8WA 2G2OA 2DRBA 2FPHX 1OMUA 3UVJB 1RHKB 4V19X 2XM3A 2ADBA 1ZTTA 1PAEX 1T95A 3SCKE 4DQQA 2PT0A 2DH8A 1IWAA 1Y5IB 3BSSA 4A8OA 1FI4A 4R8UA 3GQ7A 4LRDA 4RBUA 3AB2B 4Y2CA 4ZMMA 3CJSA 3KWDA 1HMVA 3DLGB 2IYIA 1T11A 1RT5B 4ZIWA 1VJQA 2UVRA 2RF2A 1U6BA 2V2KA 2GQ2A 2HQDA 3U1MA 1F2GA 1UPMB 2BQRA 1ULNA 3G8SA 2BUSA 1U26A 1RT7B 2L8EA 1NU4A 2ZE2B 5J2QB 1ITPA 1ZTWA 6FD1A 2EG1A 3IR7B 4PXEA 5ADXV 4M8LA 3TJAA 3V4IB 4LF7J 3BS9A 3G6XA 4K4YA 2KFZA 1W2BR 2V1CA 3GSDA 4F25A 4WIQA 1OIAA 2M2BA 1UZDA 1IKXA 1NZ8A 1VQOS 2XRCA 3CCSS 2WONA 1HD1A 2QMWA 2DD8S 1RTIB 3DOMA 3OSPA 3VNPA 5CZXA 2KKHA 1URNA 4K5SA 4ID5B 2BVZA 1TVRA 5IWAF 2AYMA 4IRCA 3EMTA 2ZBIA 2BJ3A 1MJBA 2XI3A 3OL9A 3IR5B 3OJSA 2POKA 3BXYA 2RILA 2NXJA 2FD2A 2D74B 3AH6A 1WOOA 3FEXB 3W9HA 4K59A 4ECYA 2XC9A 5I3QA 4G65A 3DLLQ 5K14B 3C16A 4A24A 4EBEA 1LXAA 1S6PB 2VODA 1MROA 4F4AA 2V0NA 1Y00A 5D4NA 3MM8B 2YNFA 3PACA 4OIXA 1S20A 2EK6A 1QUVA 2FHKA 3HPOA 1HNIA 5HMWA 3SV4A 4K4XA 1XK8A 2QFIA 2YNHA 2Y0SD 4U7UD 4JYAF 2ENNA 1AA1B 1TZ0A 3CDUA 1K44A 3LUYA 2J5AA 4CCHA 4HHJA 1Y4ZB 3SFGA 1BQNB 3OUYA 2QV6A 5E2QA 4RX6A 2Z0GA 3IS9A 1YJRA 3A8KA 1WTBA 1YTYA 3KJVB 1R8HA 4I64A 2NR0A 2B0GA 3DHOA 4C2MA 2HVHA 3BBCA 3HHLD 5DDPC 1XJWB 4B17A 3QRRA 2V2QA 3GR0A 1MNEA 4CLKA 3KLHB 4P2FA 3OHBA 1BUSA 2BX6A 2R2TA 2K1RB 1TR0A 4LBPA 1S79A 1YDLA 1S6QB 1HNVA 3MCSA 5HVHA 1V3ZA 2A20A 4ECRA 2DPJA 5F8NA 1Q86T 4N8OA 1FX2A 2LA4A 1GX5A 5DG9A 2GGPB 3CUNA 4WP8A 2QPOA 3VBJA 5I3UB 2ZEJA 5EWFA 1ZAWA 2C2MB 3FCWA 4CLPA 1P9GA 3OR2B 3D6TB 3BSWA 4DCJB 2KG0A 4J9OA 5HAOA 3TVYA 2HWHA 1RJJA 3QYYA 2QA2A 2QLJB 3HSQA 4BS2A 2A3JA 4OYPA 2JC1A 4KT0C 1VRTA 2XYHB 2C2EA 1HR0J 9ATCB 4I68A 2XMTA 4DOZA 3HHLB 2FIUA 2W0WA 4DX7A 2OTLS 3CTRA 1SGYI 1UFLA 3AD9C 4M1KA 4W92B 2ILYA 3VGVA 2RIJA 1P27B 1H6KX 5D4PA 3EE3A 1BQMB 2XMAA 1YJUA 1HWKA 1SI9A 3TJ9A 2V0LA 4E2FB 5ETRA 4GKKJ 3FBEA 2H54B 3ZZYA 1DRZA 5LSLA 3GIRA 1FTRA 2AX0A 5GMKa 2DY9A 2PC6A 4PKDB 2OP5A 2MZJA 1LWEA 4MFBA 1T03A 4B3MF 1YJWS 1XBWA 2W01A 4MKVA 2I5KA 2AKWB 4PG4A 3Q2SC 2GA7A 1HBUB 3MURP 3BKUA 4ED4A 2K06A 4LF7F 1IUJA 1E6VB 3US5A 1X0PA 5L9NA 2PD1A 5KFCA 1CJTA 5KFJA 1KLMB 1T3OA 1D0EA 2WCXA 3U1NA 5HN0A 4WK3A 3I3XA 3OTBA 3K5PA 3CO9A 2UZ3A 4NZ0A 1TOTA 1P6TA 4B3SJ 3I32A 2OEGA 4YQWA 1N5YB 3W8PA 5C42A 1JB0C 2BYCA 1M1GA 1UWAA 2O66A 2PSZA 3ZC4A 4A8QA 3ENVA 3GE9A 4C8MA 1U48A 2W8LA 4B3OA 2V0HA 5KG6A 1FDDA 3VAMA 2B56A 2DGTA 5JHWC 1PBUA 4TQSA 2M8DB 4L9MA 4LF8J 3R0SA 3HFVA 4FYDA 3EM1A 3ZZPA 1Y7PA 2F8MA 4QR0A 3HVRA 2QT7A 2RJZA 2EVZA 4C4WA 4B08A 1WWHA 4WU3A 2YXLA 3DRPA 5IQQA 4XDCA 1HI0P 3JSRA 4TVAB 3CULA 1V3RA 2LXFA 3E3XA 3UDCA 4IKAA 1ZA1B 4HLBA 3CCTA 2AX1A 1H74A 2EFQA 3BPDA 3PHEA 2BUNA 2VPWB 2I38A 2OHDA 3M32B 5DO2A 5IT0A 1GT8A 2V63A 2YKMA 2GAHC 2J9CA 2W0VA 3THVA 2VBWA 2C3PA 1ZETA 4RO0A 2DCLA 2CKWA 3UNGC 2WLCA 4ZLNA 3AXKA 4B9VA 4UXIA 2RQKA 2LU2A 2HHHF 4HYKA 1OO0B 1U1LA 4XO0A 5GVQA 1Y0HA 4NA3A 3U7JA 3QZ7A 2JL9A 1UA1A 4JI3F 3SSQA 3MEDB 3EGZA 2OKQA 3MDFA 3P6YC 4ILMA 2B5JA 3VAGA 5EGYA 2KFYA 3VAKA 2ZH5A 1MWYA 1YP3A 3IBWA 1NHVA 2WVFA 1WHVA 1PSDA 2Z4PA 3T5LA 3RZAA 4ANEA 1N32F 1QVGR 2H51B 4USVA 5JVHQ 1HR0F 1UVFA 1U2CA 4YB7A 2FHOB 3CD0A 1M0SA 1RE1B 3KUHA 3MOZA 4UY85 3IGNA 4H4MB 3OLAA 4YB5A 4RLEA 1PTQA 1IKVB 4OZNA 5KFOA 2FJBB 4KPXA 3R3IA 3KLFA 1KRVA 4O4GA 3DOLB 2E9ZA 2V4JA 2ENZA 1SV5A 2NCKL 4X4SA 2V9KA 1UVJA 3ISND 3QJJA 2IM3A 3FK4A 3LP2B 4O44A 2HW3A 3SGQI 2HQ3A 1KNZA 2NU3I 2U1AA 4UTGA 1IR2A 3MEEA 1EKSA 2J0XA 4ETZA 3QTLD 5EX0A 2AYGA 2DJWA 1AXQA 4GVLA 2G13A 1M8NA 4ZN3A 1FRJA 2HRTA 1HQUA 1C0TB 3W7BA 1SJQA 2M5YA 3OTOJ 3PW7A 2UVVA 1R0RI 1SJ3P 1IBKJ 2WSEC 1RWNB 2HBRB 3ZZOA 1K0VA 2ORWA 2JDJA 4O3OA 3EVOA 1WF2A 3DFEA 1B70B 4R37A 3L09A 1P1TA 1VGYA 5T7LB 1VISA 4AQYF 2IAJB 2DGUA 2GIRA 5K8NA 4E1KA 1FK9A 4QU6A 1R8PA 3UNYA 2E1AA 3GFYA 2P2CB 1XC9A 1VHIA 5KFGA 3R9LA 3LAMA 4MKYA 2IU8A 1SH0A 2CAJA 5AXLA 4LF8F 1PYTA 3MM9A 4C8LA 3HD1A 3CJ4A 4WTYA 4J90A 2B7BB 1T9YA 3W9IA 1DTQA 1S1VB 3W2WA 1QLNA 2J76E 4QBUA 5B09A 4CLWA 1UCNA 2FHMA 3GFHA 4UOHA 1SXLA 2CDQA 4ECTA 4DPUA 4RJVA 1JLBA 3P47A 2SGEI 2JFDA 1VHFA 4W4MA 5EDWA 3MPWA 3GLJA 3LWMA 3P96A 3DJ4A 3A8IA 3HHEA 1QSLA 2ZHOA 1CHOI 2PDAA 2J7KA 4DFJA 3T1YF 2XNQA 4C9DA 1UWBB 2IVFB 1OMSA 1DS3I 5KFHA 2W4PA 2ZM6J 3V4IA 1Z2IA 3DXSX 1QY7A 3C15A 3R1HA 2JW6A 1YU6C 5CAAA 2ZVIA 2NLWA 1VYAA 3KUGA 3KMQA 2AIRB 3IG1B 5DETA 4RUAA 1CS4A 1M90T 3RTVA 4MK8A 4I2PB 2MY7A 3H4BA 3RR7A 4O3NA 5E3CA 2RH3A 4B3TJ 5BYRA 1NSKL 1FF2A 4ID5A 3GONA 5ETMA 5HBMB 4X4TA 3I56S 3ADAC 3TUZC 1QQ0A 2Q79A 1M5KC 4E6UA 2BE2B 4WBFA 1HFEL 2RRNA 2VZ9A 2AV5A 2CG8A 4M5KA 1A6LA 2PA8D 2B4OA 2AZ1A 4CT8A 4DR7F 1LQ9A 3O8WA 2MLZA 2XNRA 3UDEA 2KU7A 4ECSA 1NM2A 1FE4A 1BHNA 3T1HJ 4M5NA 3VAHA 4USKA 2X7IA 4F3OA 3R27A 3TO7A 1HWLA 3QGIA 3KLEB 1S1UA 3NBPB 2KM8B 2R8GA 1PIEA 2OFHX 3D0HE 3PRDA 4I69A 2V4RA 1ZA2B 3ITHB 2W7OA 2E5LJ 3WC0A 4DFMA 2DRDA 3PNIA 1WF0A 4HACB 4DSLA 3MMAA 5HVGA 2UU9J 3MECB 3CPWR 4V1Ak 2W1BA 1MU2B 4QOTA 5MLCV 4Q44A 1VR6A 4LQ9A 3OTOF 1WC4A 3OTZA 1LFWA 3MD3A 4M5HA 4KGXB 1WACA 4WFAQ 5KFDA 5E3RA 2V34A 4JI4F 3J81Y 2BQ3A 2UUCF 1RISA 3BV8A 3UD5A 3CCJS 1VRUB 4IG3B 3OQ2A 1R0BG 2SGQI 4FF3A 3MD1A 3PW0A 1R6VA 5I3UA 3K5OA 1RT2B 2CQ4A 4NEZA 3GILA 4FPRA 2J8AA 4WIIA 5THWA 2DNHA 2BANA 2EKNA 4KHPJ 3HX9A 1WTJA 1IJFB 2F65A 3UCZP 2K3IA 4DPTA 4F7VA 1N88A 2F9JA 2E1CA 3VAFA 3VCDA 1F6TA 1G4CA 1RWWB 5D4LA 1UVLA 2V53A 1GMWA 3CD7A 2GAGC 1UPPA 4LRFA 4PG5A 5F8MA 1FXJA 2ZWPA 1KSPA 4ICLA 5H1SV 4XK8C 3LALA 3QFHA 1BQMA 2UUBJ 4U7UK 1AYEA 1Z90A 2KT3A 4U95A 1OCXA 2FVRA 3T3FA 1F3VA 2K7JA 3NCQA 4DPWA 3QPIA 4K50A 3TZYA 4XPCA 4ZJLA 1BE4A 4RPFA 3I3AA 1MR9A 4D3GA 1X8DA 3I6PA 1U8WA 2HNYA 3V6KA 3NEKA 3EGVA 2F7VA 2ROPA 1HBUA 1R0CB 5A8RB 5L38A 3T5KA 2OTJS 8RUCA 5HMYA 4NLSA 2QKXA 4PXDA 3TAMA 1RTDB 4K4TA 1E6VA 4P74A 2L9NA 3T9ZA 3T5JA 1ZAVA 2RS2A 4L72B 4O3QA 1KLMA 1GTHA 1OY9A 3DC2A 4C8OA 1Z2LA 2CQ0A 2VG6B 4F4XA 2BKPA 3DGPB 2KM8C 4C6AA 3P5BP 2YX4A 1NJWA 1KBEA 3BKTA 5DEMA 1V5IB 1N5YA 4RZRA 1VQ6S 1WKKA 1VQPS 1JK9B 3DLBA 1LXNA 3TR5A 4IFVB 2CQCA 2MQQA 1KQSR 1L0SA 3DRXA 4URQU 2E9TA 2XSFA 1G1XA 3PKMA 3MM6B 3T1HF 4PQUA 2E5RA 3G6VA 1SIWB 2GVZB 1RWOB 2GX8A 5DRKA 2LEBA 1B0PA 2KVQE 2XCPA 4ELUA 3BF4A 1WHWA 2KXNB 1T05A 1PBAA 4DQIA 1UVKA 2EBGA 4DCPB 4Y00A 1NPKA 3BQ1A 4ZVQB 4O0NA 2R8IA 4ZP6A 4PPDA 3HKWA 4M5JA 1RT1B 3M32A 1MN9A 1Q8LA 2YWGA 3PYEA 2KI2A 1R27B 1DQ8A 2B9EA 3IM9A 1D9DA 2QQDA 1S1XA 4I6WA 3TZWA 2BJ7A 2VBXA 2HFZA 3R1LA 3C6TA 3S1TA 5L39A 4DR6J 4KIAA 1SJ1A 1NSPA 4LVNP 3G96A 2DKOB 1S7HA 2JRSA 1UAWA 4ITSA 4PQAA 4ZPWR 3MEDA 2RSQA 3QSIA 3TANA 3HF5A 3EUNA 3MCNA 2OMLA 1QM9A 2HHQA 2A18A 5J2MA 2KZZA 2IM1A 2ODDA 1F3FA 4NLQA 2BRKA 1RUSA 4Z7CA 9RUBA 2B9XA 4KHPF 4MT1A 1S12A 1YBTA 3A12A 3I82A 3PW2A 2Y8YA 3TOQA 3DMJB 5IXUA 1FCAA 4WKRA 4K4WA 4JV1A 2JWNA 1ACMB 3W9JA 5I42B 4HCQA 5BYSA 3OL8A 2FLOA 2M70A 2Y8WA 4R25A 3GJQB 5FUVA 1IKVA 1HDLA 2NU1I 3DOLA 2RVJA 2DGOA 1AFJA 4IR1A 5DQGA 2DNLA 2HRYA 4W90B 3IXCA 4JCVE 4ZVSB 2CWGA 4AL5A 2I9SA 3R3RA 2J9EA 3FOQA 3M2VA 2ZJQQ 3GIJA 1Q16B 4XIUA 2W2PP 2KMQA 2KMPA 4JI8F 5C7PA 4AXJA 3QAUA 2CPXA 3N28A 1YRTA 4R0JA 4TLQA 5KFRA 1C0TA 3ENAA 5F42A 3MUVP 1WKXA 3H98A 2XY5A 3D3BJ 1Q81T 3ISZA 4YR0A 2V0KA 1NK4A 2XLIA 2HQCA 3D1OA 3IWXA 3LOUA 5LSOA 2MZQA 2P9EA 1QRGA 4XTTA 3BJYA 2CQ1A 1PPFI 3WC2A 2MYFA 2MDAA 2W4CA 4HHHA 2ZHBA 3VBIA 5T7LA 2HURA 3QT5A 4F4ZA 3WX8A 2IC3B 2HBYB 2JSXA 4AMLA 4R7PA 3LO3A 1FHTA 4GKJJ 4USJC 5J1EA 3HH2C 2MZRA 3TEHB 3GQ8A 4ED0A 2UVOA 3EJMA 2BOAA 3LGMA 4CO5A 4Z7YA 1FJGF 1HNXJ 1MWZA 2E66A 3J80U 4DL7A 1PCEA 4LT6A 3NP5A 2R7WA 1HYSB 3CJ3A 4I7FA 1HV9A 3GG1A 2OPRA 2QZ8A 1N6QA 4DWIA 2TDTA 2WLFA 2G2ZA 2VD3A 2J8SA 3NXZA 1DTTB 3I9ZA 1U0HB 3VVUA 1CJVB 2VKZG 1URRA 3J7YU 3FMWA 4ES3A 3FCVA 4ED8A 1H38A 4LFBJ 3OJUA 3R6GB 1B99A 1B0VA 4JI7J 1NLKL 3A8EA 4QIGA 3RB4A 1BMOA 1Q7YT 3X1LB 1SC6A 3IG1A 3KLVA 4CLSA 4M98A 1MJ9A 3G87A 5JUMA 1X5PA 1D1UA 3JYTB 1CC8A 3QO9B 1H73A 4MK7A 3Q23A 3H90A 4DV6J 2CPYA 1V67A 2XZWA 2W9BB 2H48B 1VQ8S 3ILIA 2QGFB 4Y2AA 2ASYA 3DNCA 2KH9A 2NQPA 1EARA 1C4AA 1SCJB 5GADU 3EDRB 5C5JA 2WTFA 1WC1A 1CC7A 1SL0A 2F4VJ 1T94A 4DLEA 2YKAA 4F3QA 2E7XA 1C1BB 3DDNA 1JLCA 5F3TA 1FNMA 4DUYJ 4FCEA 4LFAF 1RLCL 5J2PA 3LPYA 4Y2IA 2B3TB 1RSCA 2MB0B 1NSAA 5MAOA 3MR7A 1BLUA 5HMZA 4IYQA 3GV7B 4EA7A 5D0GA 2C2KB 1S97A 4WP3A 3H2VE 4QPXA 1Z1ZA 3EXYA 4YDXA 3BM7A 2Q3PA 3ULHA 4NA1A 4URGA 2HLTA 4ZVFA 1QREA 5HQLA 3UN3A 5DJBA 3VQTA 2M52A 2LXUA 2BJ1A 2QLFB 5HJYA 4A46A 3IBCB 3I96A 2CPIA 1S77D 1UL3A 2C42A 2ZZMA 3VR1A 2WHOA 5KFMA 1SKWA 2HVDA 5B08A 3OU9A 4WKYA 4AL7A 1H2TZ 4YUDA 2YY3A 4YFUA 1PJ5A 4FF1A 2RUSA 3RRKA 1NHUA 3MECA 1PTRA 4HGUA 2NPFA 3OH0A 1Q9BA 1HBOA 2I8EA 1O8BA 2DIPA 3CDAA 1GFWB 4WCEQ 4EGGA 4KQZA 4CT9A 4BHQA 2JA1A 2LB7A 2CNOB 4U67Q 1WNEA 4NYPA 3QSYB 5DDRC 2B8TA 2XWYA 1VRUA 1ZM2A 1VC6A 1V1IA 1C1CB 4UUWA 1R8CA 3GP9A 4SGBI 2ZNYA 5A0YB 1NB7A 5F0WA 2DBBA 5G0RB 5F0UA 2HIYA 4GKJF 5IOLA 3CJ5A 2F1FA 3B8HA 2FLPA 1EIYB 2IC7A 3OW5A 3KK1A 3OXLA 4TU9A 3D1HA 4JI1F 4CNZA 4H4OA 4V19J 2GCFA 3M6WA 3R2DJ 4QR1A 5E3AA 3MMBA 1YP2A 5D0RA 4PG8A 3TQEA 1HNXF 3FRZA 2QG9B 3QRPA 3AJ2A 3KNGA 2BABA 3NGKA 4CIOA 2Q43A 1WGCA 3JQYA 2R7QA 5AXKA 1I6JA 2X1AA 4ZLLA 1TUVA 4GVBB 2N4CA 5KFQA 4J37A 2HRUA 4TN2A 2ALYB 5HVFA 5IC6B 4LF5J 2XHWA 5GAEU 3R5JB 1S0VA 4DV7F 4JI7F 2R8KA 2ZFHA 4E1RA 4P7VA 3QLHB 2NXCA 4EBDA 1VQMS 3I0SB 4JV5F 2FJAB 3K57A 3ETMA 4RBTA 3BDEA 4AE5A 3Q8PB 1CE3A 4YR3A 2DRAA 2WVEA 2E1PA 3LWLA 2ZOMA 2VG6A 2VIHA 1ZM4A 1DY3A 3VBKA 4CYUA 4DV6F 3A13A 4FDFA 3PEHA 1N5TA 3QT8A 2ACYA 2OD6A 3MM5B 4KPYA 3Q2TC 3LPEA 1K1SA 5KG1A 4X4UA 4ZVHA 3C6UB 2MGZA 2F4VF 3GYNA 2B9YA 1F5CA 1REVB 2FTRA 4ENOA 1LWFB 2BKNA 4DUYF 4IFVA 3HO1A 3RW7A 2W2QP 4LUBA 2J9DE 2W9AA 3SMZA 3FVYA 3FJ2A 2ASJA 5L46A 3G9CA 1PILA 1SKUB 2KZMA 2GVZA 5D6GA 1LR7A 3HJJA 1KD1T 1NMEB 3E2EA 2RRBA 3CGIA 3KK3A 1RAOA 2HNDA 3ZO7A 2IVYA 3QQCD 3NMAA 1LWCA 5U47A 3TNVA 5CCLA 1YQHA 3D6FB 3M2RB 4HH0A 2WVDA 1GEHA 1RTJA 3RUBL 2A2CA 2YX7A 3EZ5A 3DGVA 1HBMB 2DEIA 3CEDA 1U1OA 2ZOFA 3BEGB 3KWMA 2AEFA 5H9FJ 3I5BA 3VVTA 4NRTA 1TMMA 3R97A 1VQLS 1FE0A 4B9UA 4FKDA 1S59A 3OTEA 3PX6A 4F0HA 4DV0F 5F9LA 3NLCA 1JJHA 1HARA 1JQGA 4YEAA 3D98A 4P75A 2D9OA 4PZVA 3H40A 1WHYA 4FYYB 3KMSA 1GMUA 3HJVA 1X4DA 4ERDA 2HFSA 3RBZA 5HLFB 4OI4A 1ELOA 2B9WA 2DB6A 2DK2A 1FKOA 5KTQA 3BGLA 3BGUA 3DMJA 4M63A 3CJKB 2C28A 4DG1B 3VDPA 4J9RA 5CH7B 2R7XA 3M8PB 4HL9A 1H2UX 3VZHA 2EFNA 3MEGB 4N6AA 2PMHA 3UQSA 4Q5VA 2QQ0A 3EPIA 1HM9A 4G1QB 3H4DA 2HQIA 4NI2B 3NG8A 3SXLA 2W7AA 2E7VA 4Q0BB 1HHTP 5F9NA 2QIVX 5B0FA 2QO3A 3FFIB 4Q43A 1FWKA 1SGDI 1ZH5A 4OHYA 4EYHB 3MGJA 2RD5C 3P8BB 4EEYA 5KFWA 1LV5A 2FDNA 4FXDA 4A8FA 1YIJS 4LF5F 2YWKA 4R8UB 2DNOA 4LRAA 2GGOA 4LBIA 2BACA 2C2ZB 4ZJQA 4X65J 4DR2J 1KOHA 1T02A 4Y0FA 2Y1JA 1KBRA 1KVJA 4OX7A 1NJZA 2CIMA 4B9NA 2PN6A 1W2IA 2QTWA 4OI6A 5KT4A 1D9AA 2ACMA 3OBIA 1TMJA 2MQ8A 2BBEA 4ZPVR 3ZZRA 1YP4A 1DQ9A 4QWAA 2MTLA 3FZ2A 2OIHA 5KFAA 2HWIA 3H5UA 5B0BA 2X1GA 1JMTA 3GG0A 3FDSA 3DDKA 4BLGA 5J2NA 1IM4A 4DFKA 5FUXA 3GFXA 3DOMB 4WE1B 3C8VA 4QR2A 1FESA 1R31A 2YNIA 1TVRB 1K47A 5KFNA 2J87A 1T3DA 3PW4A 3DI6B 2CQIA 1PC4A 1S9FA 2GFFA 3QGHA 4P2XA 3TK8A 2DGVA 3W65A 5KAKA 5AE3A 2I5JB 3M6VA 4CO4A 1BY9A 2CQ2A 1ZBTA 3H5XA 3DRRA 3PR4A 3MCMA 2Z58B 4PG7A 3C16B 4QIVA 2BJ8A 3W60A 1MROB 3B4MA 3CC7S 4OHXA 1PJ7A 2G4BA 1FRHA 2XMWA 4J5OA 3QJPA 4NLUA 3SQGB 1U0HA 1VQSA 2YNFB 1RZMA 1KMAA 2DO0A 1XNQF 3J81U 2DB1A 1FERA 2D9PA 2YQ3A 1QAIA 2RUGA 1HNIB 2WSFC 3UE2A 3M4XA 2VG5A 1D8YA 2SGPI 4ECWA 4ZPTR 5KFIA 4CLYA 1YZ6A 3CCVS 2LU1A 1EX8A 3A1YG 2YKNA 2H65B 2GKTI 5E41A 4UQGA 3DM2B 3CCMS 3ELHA 2VHGA 4QIWD 3IS9B 1QSSA 4NCGA 2MMYA 4L76A 3KLGA 2G0IA 3MQHA 1U1MA 2OJ3A 5KFSA 1JJCB 3JYTA 4J18A 3PJXA 1OSDA 1TAUA 1SQGA 3IWNC 3P45B 2XEXA 2HMIB 3LANA 1UZHA 3NOCA 4ZHRA 4MKAA 3GCWP 2CFXA 4FXVA 3BB5A 2WGCA 4KV8A 1FWYA 1HNVB 4ZVTB 2KL8A 3D28A 3SEOA 1U09A 2ASDA 4OYXA 5J8FA 3HVAA 3BKFA 4K0KF 1X4EA 4YDDB 5JVGQ 3V81B 4ZVOB 3CNQP 4AXIA 1RHMB 2FKOA 2KYXA 2BJDA 2WRMA 3PEJA 1VFJA 1MT1A 5CA5A 3H42A 4U7CA 5FIIA 4DL3A 3THTA 2CPHA 3LTOA 5AE2A 4DR1J 3NGUA 4ZA1A 2LDYA 4KKOB 1ZS6A 2AJ2A 3CT9A 3S01A 2LYVA 3D6HB 1V1HA 4X66J 3FSXA 3TIOA 3WIVA 5ETKA 1GK8A 1RAGB 2LMIA 3PIOQ 3GIKA 1LW0A 2GHPA 4JI0J 3Q1XA 5A6PA 3TX0A 5B0GA 2KRBA 5FD1A 4PUOB 1PJ6A 4DQSA 1BXNA 4I1TA 4K2JA 4X65F 4M95A 1V3WA 3U02A 3T41A 4QQBA 4A8KA 2UV8A 1LWEB 1W26A 4MFBB 1T03B 1I51B 2WW8A 4FNHA 1JLGA 5DG3A 2QIFA 1RWKB 4C0OC 2DH9A 2CA9A 4KE5A 2HFVA 3VAIA 3MAHA 2CVIA 1N33F 4UZBA 1CJTB 1C1CA 4WFZA 1MJAA 3HMJG 4OZ2A 1MMLA 1VIOA 3POTA 2XS7A 5L6SA 4ED1A 1FRLA 5G0RA 2Y0BB 1KWMA 1MLAA 5DG7A 3A3NB 1XMBA 3PFOA 2QSWA 3FSIA 4EYIB 5BJRA 4RW7A 4USHA 1NPRA 3SYZA 3CSKA 3QZ8A 1X4BA 3GQCA 2Z2MA 3HM9A 3QAHA 3PDNA 1JLQA 1VLYA 2HGNA 5LJ5Y 2HVZA 5KOXA 2FLNA 1F0XA 2J0SD 2AQ4A 2JXDA 1HBNA 1HNWJ 4LVOP 4RUCA 3MAQA 2I0XA 3A8JA 4JV0A 4DUTA 2PFFB 1TV6A 1CEZA 3MPVA 1UJ5A 2YKOA 3GIMA 3D54A 4IOAQ 2LQ8A 2QA4G 1TL3A 4IQMA 1KBFA 4DBQA 4DSJA 3TUIC 1KQGB 4N27A 3BSAA 4Y2MA 1M1HA 4X4NA 2BE7D 3DRPB 3UN5A 1LK7A 1IBMJ 4IHGA 1L5UA 5LOQA 3ZFVA 2CQ3A 1IY5A 2IRUA 1W25A 3AJ1A 1CG2A 3I0SA 4WXOA 3JSMA 2UXDF 3GV5B 3J7YI 2FUG9 2VOPA 4OI3A 2VDHA 4Y65A 2UUTA 1PAUB 2OELA 1WF1A 1XERA 3PX4A 4KHRA 3VQSA 2ZH4A 4A8YA 4ZCKA 1J5EJ 4KJIA 1XMQJ 1H7XA 4RNOA 4FS1A 2Z57B 1HNZJ 5F3ZA 4K8RA 2ALZA 3IC1A 2LA6A 1SSMA 2ZBCA 4RW9A 4Q7AA 4HR2A 3CE8A 4PYDA 1R3NA 5J1NA 3T6JA 2FVPA 3C6UA 3RBEA 4OYBA 3MFHA 1TL7B 4X4OA 4QW9A 3WQPA 2P2OA 3P1BA 5F41A 5GADI 1K8AT 2DPIA 1Y9OA 2RKIB 1NAQA 4NYOA 4DR1F 3R6LB 3IRWP 4X84A 5L6VA 2ZD1A 1HQ2A 2CJKA 2O1PA 4OX6A 4Y6IA 2FVSA 2B4PA 1QRLA 3OH3A 2LQBA 1CSOI 1RB0A 2W9CA 3VAJA 3DOKA 4LFCJ 3BSYA 4H54A 3QATA 1JJ2R 2AYEA 4MYTA 1T9XA 1OMTA 5K20B 1JWWA 3OUPA 4JI0F 2NYIA 4DPXA 4O4GB 1KRUA 2R2UA 4J9VA 3KOAA 2Q66A 2V4JB 1KOOA 4BWJA 1U1PA 4NLRA 4O44B 1HBMA 1S99A 3UI3A 1CQNA 4OI0A 1EB0A 5E33A 1YJ9S 1NDLA 5KG2A 2R8HA 3ETOA 3IRXA 1JXLA 4DS5A 4UOGA 2UP1A 1U25A 3MEEB 3H2LA 3TW0A 1NK8A 3TVKA 1U2FA 1IWGA 5CYMA 2IDEA 4MIWA 1U24A 2R7OA 3SRTA 2G9OA 3Q83A 5IT9Y 4CM2A 4FF4A 5HANA 2CDRB 2ZUAA 3GOSA 3ZTRA 4I56A 3UFCX 1BC6A 4M28A 3HLUA 2EFOA 3OVBA 2W24A 2OI7A 5K8PA 2X3GA 1S0MA 3KTQA 4ZK7M 3QT6A 1K7UA 4C48A 2O3DA 1KHRA 2OSRA 5HLFA 2VFUA 2BE9B 1PYOB 2R7SA 3EG4A 3GWCA 3OVAA 1LFPA 1NDCA 2FGCA 3EDQB 1FRIA 1SIZA 3CJKA 4DG1A 2IBKA 4M2AA 2ATCB 3GU0A 1FK9B 1RU1A 2VJVA 1SJRA 2QMUB 1HNWF 3MEGA 2V94A 1UVMA 5AFUU 3G8TA 4Q8FA 5F8JA 1GTEA 4PAAA 5FDLA 2MKCA 4NI2A 4Q0BA 3NS7B 3RBDA 1RCXB 2KMRA 3FFIA 2ZH3A 3MM9B 5D77A 1IQZA 1FT8A 4O3SA 1N0VC 4JI5J 4CTAA 4DR4J 4N41A 1DTQB 1TFWA 3W2WB 5D4OA 2OD4A 3AOBA 3W63A 3G6ES 1X7VA 3AHPA 5F8IA 4CNYA 4LF6F 2IRYA 4KBIA 4ZVPB 1JLBB 3UW1A 3JSBA 1TKTB 2DGSA 1S5ZA 2ZWOA 3HHDA 2FY1A 2VG7B 5HQ8A 1RWXB 3LP1A 3E01B 4FYWB 2HYIB 2J6UA 2QL9B 1P8GA 3LH2S 5GAEI 2GO8A 2HSEB 4FKYA 1RAIB 1CT2I 4CLZA 4LQ3A 4HI1A 3VBPA 1FARA 4USMA 5A8KB 4GRSA 5L9XA 1RADB 3NMRA 1I5OB 3C15B 3QIDA 4GO5X 3I0RB 2IJFA 2RMLA 3M2UB 1CS4B 1KKHA 4ED2A 1ZYQA 3IGVA 5CZVA 4TQRA 4WE1A 3IA0A 2H1YA 1CJUA 1YHQS 4K5RA 1IJEB 5HROB 4J91A 2ROWA 1R43A 2DY1A 5KFVA 3DI6A 2N7CA 1U2RA 4NWBA 2W25A 3N6MA 2QLWA 5IM0A 2DNMA 1XWLA 3G6YA 1RAHB 1YKWA 3AJDA 2AJ1A 2ZH8A 2JFKA 4QWDA 1I94J 4WFNQ 2I5JA 1WKJA 1RABB 1CPZA 2DNGA 3QIPA 3B82A 2JJ4D 1RA7A 5ETPA 2HZCA 4ECVA 1UHAA 2H3EB 2MZ1A 4LFCF 3BREA 3TOBA 3SQGA 3RB3A 3OH2A 4N7TA 1O51A 4DUZF 2Y3YA 4F4KA 2M0GB 1M8CA 1RTHA 4EA9A 2RT3A 3PM9A 2BJ9A 4DL2A 4PWWA 4CLTA 3N6NA 3DCAA 2ROGA 4U6PA 3TJ8A 4GC6A 1S1UB 1P1LA 5LJ3Y 3CD5A 2PI4A 3KDOA 3NAHA 2MQPA 3DM2A 1UEVA 4TY9A 1BUXA 4D3HA 2LEOA 3MMAB 3RGIA 2QN6B 3BR9A 1O6XA 3OXFA 4K6RA 3O3LA 2YNGB 3J80Y 2IM0A 5DZ7A 3K2YA 2M8HA 4UW2A 1GMWD 2YBVA 1RGVA 1HA1A 2FJEB 4KNXA 2XO6A 3TV0A 1IBLF 2HMIA 3TAPA 3NGRA 2OEJA 4IRKA 2N71A 2MJNA 2ZDOA 4F4YA 2QL7B 3KUEA 2V2ZA 4GO7X 1RBLA 2AD9A 2BZ2A 2L9WA 3O44A 1NDPA 1KDNA 3RYLA 2FJWA 4EK2A 5E3QA 1N4LA 4UF4A 2E1MC 1TKDA 4M99A 1LWXA 1Y5NB 3M9NB 3EVWA 3V81A 2QEXS 1CGJI 5BR8F 1RI7A 1THJA 4OMFG 1KHVA 2QL5B 2VL1A 1QRMA 2BANB 4CO2A 3DRSA 1N56A 1UMJA 4ANCA 2FYXA 4L74A 2CNLB 1U6ZA 4E98A 2KHDA 1RCOB 4B3RJ 4KKOA 2CJ9A 4L73A 3PY8A 4JI5F 4NLDA 4BC9A 4DR4F 4F67A 2QSFA 4EMDA 2XSJA 2LDIA 1MG7A 3MPDA 2MQMA 2KCXA 4ICLB 4F3MA 3HI9A 2YWEA 1S9EB 4X64J 4NEYA 2XLJA 2DGWA 4LR8A 1X60A 2VQFJ 3W3SA 2DIUA 1Y1BA 1NKBA 1CULB 4PUOA 1B0TA 3THPA 3V6JA 4QJVA 2X51A 5G4DA 2HNYB 5FUWA 5GAGU 2BRLA 2FHJA 2E7WA 3N01A 5HO4A 1ZPWX 3HCXA 4PXCA 2IA6A 1KRPA 2Q1LA 3TA2A 3TAMB 2L7XA 3SCIE 1YLXA 4ZJOA 3NCRA 4HKQA 4ALZA 4LF9J 2XMMA 4DFPA 4DXLA 1UP1A 5BXIA 2UXCJ 3OD2A 5GMDA 4PPZA 2UZAA 3ZTOA 1K7VA 2NXUA 2V5HG 3A3OB 3LW5C 4CWBA 3QFWA 2HHSA 1FDBA 1SVDA 1N36J 1CJKB 2ZH1A 3HFKA 1LKZA 3F0NA 2HVIA 4NLPA 2VV5A 2G0JA 2CJSC 4UXHA 3KLIB 4USIA 2LVWA 1U6FA 1OVOA 2ERRA 5EN1A 2C3UA 2HZVA 2F3JA 2SGDI 3MM7A 2BM0A 4EO8A 2HFNA 1Y1CA 3C2PA 2MSTA 5DGAA 1QD1A 3EZOA 2UXBJ 5B0AA 1DFDA 3TJQA 2NSBA 2RB7A 1SGEI 2DCUB 3MQGA 4PQUB 1Z7KB 2GS8A 4ZP7A 1H0ZA 3KKFA 2ZNZA 1OWXA 3LAKA 1LW2A 4OZ1A 3D8VA 4RNFA 3W2VB 1DHMA 1T05B 3FGVA 1GXLA 1SQEA 1LR8A 1RT4A 2W0TA 2JVOA 4BBYA 3GR1A 2HS4A 2GVIA 3IR6B 2NPIA 3GV8B 2XG8A 1P9QC 2VDIA 5BYQA 2BOPA 2XZDB 1KQKA 3PX0A 4RUBA 3ECTA 2KYZA 4J9QA 2AEMA 3MHYA 4YB1P 4PWDA 2GKVA 3FUYA 2PQ8A 1S1XB 1KGQA 4QW8A 1KVIA 4DPYA 2JEJA 1EKRA 3C6TB 3AQPA 4X62J 4CP5A 1ROFA 4E79A 1DZ5A 4MZUA 4YR2A 2ZOGA 5KG3A 1FVQA 1FFGB 5KT7A 1M5SA 1VK8A 4YHHJ 1PGZA 3O5TB 2F9DA 1TL7A 4FN5A 4DV2J 1ZZFA 5L1KA 1P9YA 3GCXP 5J2MB 3D3CJ 4QWEA 1S4FA 5HJXA 2HHTA 1VJWA 2YUUA 2P9CA 1PJUA 2VPXB 2IBOA 2CWHA 2RKIA 1WG1A 4HI2A 2CJYB 1RAAB 4HEA9 1XR6A 2FLLA 3ICLA 1MR7A 4B3RF 1D09B 3CVKA 5K9FA 3PJ9A 5KFXA 3H8YA 3J7Z5 1LEOA 4DR5J 3SDEA 4F50A 2ZC3A 4M94A 2VFRA 2V0JA 4U96A 4P73A 3OW2R 3MUMP 3S7RA 2ZJPQ 3V5RA 2R7UA 2XYPB 1S1WB 5FJ4A 4LSLA 2OFGX 4GKKF 3JB9k 3DLKB 4WTOB 1H2VZ 2AWZA 4C7QA 3MF5A 4EAAA 3K7RA 2HQGA 4G1PA 3FKBA 2KJWA 2PFDA 3M2VB 5I4MA 1PCAA 2VOOA 3OVSA 1FRMA 3B78A 2J7UA 1I1GA 1CQMA 3K5MA 3BO3A 1JLEA 1FEHA 4KC5A 3BPSP 2NU4I 4UZCA 1TU0B 5D3GA 2FZCB 4KYZA 4WP4A 2UXCF 3UN2A 3OH4A 3TP2A 3PR5B 3W64A 2KB2A 1KS2A 2W8KA 2M88A 1NCLA 3CF5Q 7WGAA 1L3KA 2JOQA 4B3SF 2QYCA 2CG4A 1BMQB 2JNJA 2Z8QA 3UEJA 3R8YA 2HKEA 3SEKC 4HTIA 1HPZA 4ELVA 1UEKA 2HVEA 2VASA 2IMOA 1TBRR 5J1EB 4IFYA 4YB6A 4OL8A 2HWTA 2GKRI 2UXBF 4QIFA 4IOCQ 5IV4A 2A10A 2DNRA 4DL0C 3QWUA 2JHEA 5KT3A 4KGKA 5DQHA 1FXDA 2Z30B 3JXOA 2OI2A 4AL6A 3OL6A 2DHAA 4OHWA 1QE1B 2DHGA 4FKXA 3D66A 2GMLA 2OEFA 4N77A 4OLOA 4I7FB 1HEVA 2IJRA 4PABA 2OPRB 3ILJA 3LP0B 4AUKA 1N6QB 1TKTA 2XMJA 2V50A 4OQJA 3E59A 3G2XA 1N0UA 2VG7A 5M2UA 3KJQB 4ZS6A 2AW0A 3V6HA 4YS2A 2ZDPA 3E01A 4ZIVA 2ZH6A 1U45A 2LQ5A 4TLRA 4DU7A 2BDPA 5AE1A 4AYBD 3T5HA 1F5BA 1FNOA 3KHLA 3NGDA 8ATCB 1L3VA 1JLFA 3F1XA 5A8KA 3QMQA 2QA4S 4NCBA 2OD1A 3I0RA 1NUEA 4DV5J 5KFTA 2F8HA 3M2UA 1HWUA 2M7SA 3MOJB 3UD4P 4RW4A 4X62F 1HJAI 4QPTA 2R42A 2OPSA 4NOHA 3Q8RB 2DR5A 1T9TA 1BWVA 2MXYA 5HROA 1SUQA 4YHHF 2EI5A 2XI2A 3L4BC 4FVCA 4DV2F 1VQ7S 3M30B 3EH0A 4DV3J 1QDUB 3DRYA 3IM8A 3Q86A 2EEYA 4A8MP 5D8HB 3VWSA 3WHIA 2DEJA 1H72C 4DR3J 4G6VB 4DSFA 3QT7A 4QWBA 3C46A 2E5GA 5A2QY 2WCYA 1JLCB 2WK4A 5C25A 2R4FA 2M4MA 3J7AN 1XR7A 1X5OA 1FEEA 5J2PB 1SKRA 3KG4A 4FBTA 1FTCA 2VBYA 3CJ8A 1QTMA 3CC4S 3V6DA 2D3ZA 4OYOA 2J6TA 2O01C 4U9RA 1IXKA 2CJBA 3TUJC 2JC0A 1FJCA 4RU9A 4H4KA 2VQEJ 1VLOA 2HNZA 4PYAA 5F8HA 1IVZA 2WVJA 2RU3A 5DDOC 3AA9A 7FD1A 4ZCIA 5B7WA 4M2BA 1XATA 1HD0A 4B9SA 3F73A 4F2RA 2P8IA 4KFBA 4JOUA 4WYWA 1NK0A 4ZCMA 3KNAA 4E75A 4QYZK 5AXMA 5CYJA 2NUUG 2CNNB 2YTCA 5C2GA 1T9VA 3DK5A 2P9GA 2YNGA 5D78A 1FNXH 4A48A 3MTKA 3PVXA 1HBOB 4FYVB 2WBRA 1HQEB 3CJQA 5LXYA 4TKTA 4DV1J 2R7RA 3QGGA 4X4RA 1G97A 1IBKF 1UKUA 1ZAXA 4EABA 2ILZA 3W66A 1SGQI 4JUZA 3P3DA 1VQKS 2EFGA 2UVWA 8AT1B 1FVSA 3CCUS 3DN9A 2AMCB 3VV2B 3TISA 3DHWC 3OR1A 1EP4A 2JLEA 3AT1B 1YVFA 4ILRA 1NK6A 1L3TA 1R89A 3HP6A 1B7FA 3I87A 3VGTA 1VDDA 4JYAJ 4OJ3A 2KXFA 3CJRA 4WZQA 2JYYA 4MAKA 1Y8FA 2QJ3A 4KNRA 1EETA 3QWPA 1KGTA 2I1RA 4Q8EA 3B4VC 1H3DA 3AODA 2DR8A 1XA6A 3KK1B 2OPQA 2KXHA 1TGSI 4CO0A 2DTJA 3DKDA 1PO6A 4M9CA 1S1TB 1Q4RA 2PEHA 4CO3A 4H4OB 2XCAA 4F4WA 2OPPB 3MMBB 2B0UC 1M5OC 4MKBA 5HP1A 1TTHB 1S9EA 4DX6A 4DMZA 2JH3A 1UTAA 2IPOB 2E9RX 1CULA 4IHFA 1FRXA 3MMCA 3RB6A 5M2PA 3LF0A 1FDAA 3HSGA 2MPUA 4ISXA 2H5EA 2XLKA 3TRGA 2GVDB 1PC5A 2F40A 2AQ9A 1JX4A 2OEMA 2C3MA 2CQHA 4ZP9A 2QC3A 3BJIA 2ZM6F 1XHDA 7FDRA 2RHSB 2WVBA 2CXEA 2HHVA 3H59A 4NYZA 4DV5F 4RWXA 2IM2A 5KT2A 1RACB 1SGRI 4EO6A 2XULA 5B0CA 1NUBA 3UWTA 1NBEB 4EWTA 4O3RA 1R7IA 3TDTA 2YPZA 3SBMA 1CJKA 2E5IA 4B3TF 4CYUB 2CYYA 4NE9C 3RG6A 1HM0A 1RWMB 4DV3F 2D3UA 4TY8A 3KLIA 4ECXA 1FXRA 4DR3F 4C97A 2CADA 1VQYA 4L3KA 2LECA 2MGZB 4B3MJ 1DARA 2NU2I 3MMJA 2EFPA 1Q8BA 3GYGA 1HWIA 1WEXA 1ZPVA 1NHKL 5AT1B 3NY0A 1R8BA 2LFVA 1NH7A 3IAM9 4OYIA 1GMVA 3QNWB 3M8QB 1JKHB 3CCLS 1EWWA 5IT9U 1KVKA 3IP0A 1Q78A 3VBNA 4TU7A 3L7PA 1UETA 3FCHA 2VQEF 3KK3B 2GIFA 3JS9A 2HNDB 1FD8A 2YH0A 2Y1LB 4NXMJ 4I2QA 3W2VA 2NREA 2WW4A 1N34J 1UEUA 2JEGA 1LWCB 4C8ZA 2C22A 3MPUB 3JAMY 2WB1D 3TZZA 2E5LF 2COLA 2RE1A 1W4RA 4YOEA 3MR2A 3IN5A 1RTJB 2WLGA 4LR7A 2GQQA 1F9FA 3U1LA 2WOMB 1RYRA 2DR7A 2C3YA 2BJEA 1YJ7A 3MC4A 2UU9F 2KFNA 2XYGB 1FJ7A 1NRKA 4DSIA 2XZTB 2ASLA 1G6BA 2CQPA 2LXIA 2FZKB 2MQLA 1N5SA 3BGOP 1WTFA 1FX4A 2R9LA 2VJUA 4DV1F 3KYLA 3H25A 3CB4A 4BC7A 2DGXA 2VHEA 3HDSA
chains in the Genus database with same CATH topology
1FK9A 2MY8A 4NZ7A 2D1CA 2LMIA 1NNDA 5A6WA 3PIOQ 3GIKA 3FNNA 1LW0A 2GHPA 3HK2A 3Q1XA 1RP5A 1KC8T 4QU6A 1R8PA 1RK8A 2RS8A 2APOA 2E1AA 3GFYA 1M1KT 2FVQA 5A6PA 3CCRS 5C25B 2A2DA 1ZM3A 5B0GA 2KRBA 4N76A 4FF2A 5FD1A 2Q6CA 1XC9A 4PUOB 3QGPA 5KFGA 3LAMA 3FZBA 3DGPA 4MKYA 2IU8A 1SH0A 4OJGA 4P7TA 4DQSA 2B4UA 4IG0A 4I1TA 4M95A 5AXLA 4X65F 1V3WA 2ZUGA 3U02A 4LF8F 3V6DB 2QMXA 1TP7A 3MM9A 4DDFA 4N69A 4NLWA 4QQBA 1K1QA 4WYLA 4A8KA 2UV8A 2VA3A 4C8LA 1BGXT 1LWEB 3CJ4A 4MFBB 1VBZA 1T03B 1QUPA 2KRRA 2AJQA 2WW8A 4WTYA 1GAOA 1SH3A 2B7BB 5M2RA 4FVMA 1DTQA 1LOUA 1S1VB 4FNHA 4DX8H 4OLPA 3W2WA 1QLNA 3FSYA 3RW6A 1JLGA 5DG3A 5L1IA 2J76E 4QBUA 2QIFA 5B09A 1FKOB 3BSCA 1NKCA 1DBDA 2FHMA 1YRXA 3GFHA 2WLDA 1SXLA 3UCUP 2HNZB 1NJIT 4C0OC 2CDQA 4ECTA 2MQNA 2DH9A 4KE5A 3VAIA 3MAHA 2CVIA 2DNYA 1JLBA 3N79A 3P47A 2ZKTA 3CMAS 1VBYA 1N33F 2QA1A 2ADCA 2JFDA 1HWJA 3CIZA 3K8VA 4KFBB 4QYZJ 1RT3B 4O0IA 1VHFA 2QLXA 2KO1A 4ZCLA 4EQYA 1C1CA 4PR6A 1MMDA 2WAQD 4OJHA 4WFZA 5JXSA 5EDWA 3HMJG 3MPWA 4KRWA 3NS5A 1MMLA 3T9NA 1VIOA 3POTA 1IKWA 2XS7A 5L6SA 3BSOA 3LWMA 4ED1A 2Z2LA 3P96A 3H20A 2RNEA 3DJ4A 2UUBF 3MM6A 1FRLA 1X4FA 4ELTA 3HHEA 5G0RA 1QSLA 2ZHOA 1DAXA 4KGMA 5DG7A 3GIIA 2PDAA 3MR5A 1XMBA 3PFOA 4J9PA 2QSWA 1S1WA 1HI8A 2J7KA 3FSIA 1KK4A 4EYIB 5BJRA 1R8AA 4DFJA 4KAIA 3T1YF 4RW7A 2XNQA 3BGRB 4C9DA 4USHA 3HXMA 1UWBB 3VZIA 3SYZA 2VH7A 2YKPA 2IVFB 2BV3A 1YJNS 3CSKA 4P2SA 3DLKA 1X4BA 4WFBQ 2Z2MA 5KFHA 3QZ8A 3GQCA 3HM9A 4DL6A 2W4PA 4F02A 3PDNA 3V4IA 1JLQA 1VLYA 2HGNA 5LJ5Y 2HVZA 3DXSX 1QY7A 1QJHA 5KOXA 5DM6Q 3R1HA 2FLNA 1F0XA 2J0WA 2J0SD 2YWFA 2NPOA 2KT2A 2AQ4A 2GW8A 4M5DA 5AXNA 3HHNB 2NLWA 1HBNA 3KMQA 3IG1B 4LVOP 5DETA 4RUAA 3EX7B 3C8YA 4RUCA 1M90T 3MAQA 3PV8A 3RTVA 4MK8A 4I2PB 4IHHA 2I0XA 1V6HA 2MY7A 1KQFB 2FJDB 3H4BA 3BZQA 4JV0A 2JZ5A 3RR7A 2IRXA 2PFFB 4O3NA 2B6AA 1RT1A 2HPUA 5E3CA 3OR1B 1EP4B 1TV6A 2M3DA 2RH3A 1CEZA 1H0HB 3MPVA 1UJ5A 2YKOA 4NLXA 4JI2F 3GIMA 5BYRA 1FF2A 3D54A 4ID5A 4K2XA 2E29A 1RAJA 4QIEA 4IOAQ 2B43A 4UY8T 2QA4G 3CMES 4HURA 3O6QA 3J7ZT 5HBMB 1TL3A 4IQMA 4X4TA 1U8SA 5KOWA 1WEYA 4DBQA 5GAGI 3I56S 3TUZC 5KFBA 1QQ0A 1ZM9A 2Q79A 4DSJA 4E6UA 3TUIC 3K58A 1M5KC 5HI7A 1EETB 2BE2B 5J1PA 1LK5A 1KQGB 4N27A 3BSAA 4Y2MA 5DM7Q 4X4NA 1VQ9S 1HFEL 3DRPB 3N4WA 2RRNA 2X1FA 2V8HA 2VZ9A 4EFAC 2IVMA 2OPQB 1LK7A 2AV5A 4G87A 4X4QA 2XO7A 4J9NA 1U1OA 4G1IA 3OV7A 3MWBA 1A6LA 2PA8D 5J2NB 2B4OA 2CQBA 4CT8A 4IHGA 1L5UA 3N0VA 4DR7F 1LQ9A 3ZFVA 2DO4A 3BO4A 2CQ3A 3OL7A 2IRUA 3MI7X 3O8WA 1W25A 2LKZA 3SSSA 3AJ1A 1CG2A 3R5AA 3I0SA 4WXOA 3JSMA 2G1DA 2XNRA 2UXDF 5KFKA 3GV5B 3J7YI 2KU7A 5HP1B 2FUG9 4ECSA 5L8RC 2NS1B 1FE4A 2VOPA 2GJIA 1X0FA 4CO1A 2EKYA 2MQOA 4OI3A 3VAHA 4Y65A 2UUTA 2JEIA 2YNIB 1WF1A 2PMZD 3G86A 1XERA 3PX4A 4HH1A 2QFJA 3PY8A 5K5MA 3I4HX 4KHRA 4F3OA 3R27A 3MMCB 3VQSA 1RT6B 4DN0A 2ZH4A 4A8YA 4ZCKA 4KJIA 4HDHA 2UV8G 1H7XA 1HWLA 4RNOA 4FS1A 3QGIA 3F73A 3KLEB 5F3ZA 3KHRA 1S1UA 3NBPB 2KM8B 1D9FA 1TKZA 1MMNA 2R8GA 2OFHX 1U7LA 3D0HE 4DPOA 4MMOA 1MSWD 2ALZA 2A1BA 3IC1A 2LA6A 1SSMA 2ZBCA 3GFZA 3PRDA 4I69A 4Q7AA 4RW9A 4F26A 2V4RA 3ITHB 3Q24A 3CE8A 2W7OA 3Q0AA 2R7VA 1S0NA 3WC0A 2EWHA 3M1VA 4JBCA 4HZCA 1DQAA 1R3NA 1QE1A 3M6UA 1R6YA 5J1NA 3CDBA 1TQLA 5DS7A 3T6JA 4DFMA 3DRRB 1X5SA 2MJUA 3PNIA 4A8SA 2FVPA 1WF0A 3G8QA 3C6UA 1TKXA 3T57A 4IH7A 3BGFA 4DSLA 3MMAA 3RBEA 1R0AA 3LP0A 3FSBA 4JI6F 4PCQA 4RW6A 5KFUA 3MFHA 2VC0A 2EK1A 4NXMF 1GXTA 4J9SA 4DLGA 4ZVGA 3MECB 4X4OA 4QW9A 3CPWR 4YP3A 1N34F 3R2WA 1MU2B 4QOTA 5MLCV 4Q44A 1FKAF 4ID8A 2P2OA 2AP6A 3P1BA 1S9GA 4H4KC 5F41A 4LQ9A 2F8EX 1TL1B 3OTOF 5KG4A 5GADI 4MYOA 1K8AT 3OTZA 1IKYA 1LFWA 2DNNA 5KFZA 3MD3A 2DPIA 2CPFA 4NA2A 1WACA 4NLGA 1Q53A 4WFAQ 3MUTP 5KFEA 2EC0A 1Y9OA 3AB4B 5KFDA 5AFUV 5E3RA 2RKIB 1NAQA 4JI4F 2VG5B 4NYOA 3J81Y 2BQ3A 2UUCF 3OLBA 1RISA 2XATA 4DR1F 4TYBA 3ENWA 4AC3A 3I5CA 3RU0A 3IRWP 4X84A 2ZH7A 5L6VA 3CJ0A 2ZD1A 1KK6A 2CJKA 2O1PA 4OX6A 1YSJA 3CCJS 4ZKAA 2YKNB 4Y6IA 2FVSA 1VRUB 1QRLA 2B4PA 4IG3B 4TY8B 2LQBA 1HMVB 1NK7A 3