3FSXA

Structure of tetrahydrodipicolinate n-succinyltransferase (rv1201c; dapd) from mycobacterium tuberculosis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
307
structure length
300
Chain Sequence
VTGAAGIGLATLAADGSVLDTWFPAPELTESGTSATSRLAVSDVPVELAALIGRDDDRRTETIAVRTVIGSLDDVAADPYDAYLRLHLLSHRLVAPHGLNAGGLFGVLTNVVWTNHGPCAIDGFEAVRARLRRRGPVTVYGVDKFPRMVDYVVPTGVRIADADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEGRISAGVVVGDGSDVGGGASIMGTVISIGKRCLLGANSGLGISLGDDCVVEAGLYVTAGTRVTMPDSNSVKARELSGSSNLLFRRNSVSGAVEVLARDGQGIAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tetrahydrodipicolinate N-succinyltransferase
publication title The three-dimensional Structure of a mycobacterial DapD provides insights into DapD diversity and reveals unexpected particulars about the enzymatic mechanism.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 93
structure length 300
sequence length 307
chains with identical sequence B, C, D, E
ec nomenclature ec 2.3.1.117: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase.
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
A PF14789 THDPS_M Tetrahydrodipicolinate N-succinyltransferase middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3fsxA03
3.30.60.70 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Trimeric LpxA-like enzymes 3fsxA02
3.30.70.2010 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3fsxA01
4K6RA 1KGTA 2GGOA 1TDTA 2RIJA 3BSWA 1KK6A 1KQAA 1QRMA 4M99A 5ADXV 3R5CA 3DHOA 2XATA 5AFUV 4J09A 3I3XA 3TIOA 1QREA 3VBJA 4KPXA 3R0SA 3R5BA 3TISA 1T3DA 4N27A 4KNXA 1HM0A 3R3RA 1MRLA 5DEMA 1HV9A 2VD4A 3DK5A 2V0HA 4ISXA 3JQYA 3OUPA 3D8VA 3HSQA 3V4EA 2OEFA 4M9CA 4R36A 3P47A 3FOQA 1SSMA 3GUEA 5E3PA 1SSQA 4KPZA 1G97A 1QRGA 3R5AA 3Q1XA 2ICYA 3R1WA 3TWDA 4EQYA 2V0IA 1Z90A 2ICXA 3IXCA 3F1XA 4G87A 2FKOA 3CJ8A 2NPOA 1YP4A 3KWEA 3MQGA 5U2KA 3T57A 1QQ0A 2QKXA 3OU9A 2W0VA 4KQLA 5E3RA 3BFPA 3ECTA 4E6UA 4EA7A 4HUSA 4KNRA 3SRTA 2Q4JA 3MC4A 2GGQA 3VBLA 4E79A 2IUAA 1HM9A 2JF3A 3FWWA 3PMOA 5DEPA 4E6TA 2WLCA 4DCLA 1FXJA 3HJJA 3BRKX 3FS8A 3VBPA 5L6SA 4EGGA 1XATA 2AQ9A 4MYOA 3TDTA 3R2WA 2OI5A 1G95A 2I5KA 3FTTA 4IHHA 3NZ2A 3VBIA 4E1KA 1YP2A 2IU9A 2WLEA 3FSYA 4HZDA 4HZCA 4IHGA 4IHFA 3VBMA 4AA7A 3OTMA 1MR9A 3GOSA 3P1BA 1KRVA 2IC7A 3EG4A 2V0KA 2OI6A 2V0LA 1V67A 2JF2A 3GVDA 3FSXA 4N6BA 1KRUA 2OI7A 4R37A 5DG3A 5L6VA 1KK5A 3BSSA 4EA9A 3KWDA 4N6AA 3FSCA 3R3IA 5AFUU 2OEGA 4EA8A 4FCEA 4EAAA 2TDTA 3EH0A 4M2BA 1V3WA 3TK8A 1THJA 3VBNA 3ST8A 1XHDA 4M98A 4AAWA 3DJ4A 1KHRA 2IU8A 4R7PA 3KWCA 3VBKA 3FSBA 4HURA 4J18A 3MQHA 2WLDA 3OW5A 4AC3A 4MZUA 3EEVA 3IGJA 2W0WA 3OTZA 4E75A 4M2AA 1J2ZA 2QIAA 3D98A 2QIVX 4H7OA 2P2OA 4MFGA 2WLFA 4EABA 1S80A 3BSYA 5F42A 3C8VA 1YP3A 3SPTA 1KK4A 4HCQA 1KGQA 1SSTA 3R5DA 3VNPA 1MR7A 5ADXU 2V0JA 3TV0A 3I3AA 4G3SA 3R8YA 1QRFA 4G3QA 1KRRA 5E3QA 1OCXA 3BXYA 4N69A 1FWYA 4G3PA 4M28A 1HM8A 1QRLA 2VHEA 1LXAA 2WLGA
chains in the Genus database with same CATH superfamily
3W2WB 1TDTA 2H3EB 1XR5A 1TR0A 1PC4A 3Q83A 4NEZA 1ZAXA 2KXNB 2RAQA 3EVWA 3JAMY 4DL7A 1XTZA 3ETOA 2V1CA 1W4RA 3G8TA 1H7XA 3IR7B 2XCAA 1OY8A 3L9ZA 3DLEB 3AJ1A 4JI2F 2MHNA 1VI7A 5H1SV 2CQ1A 2RRNA 5DQGA 3E59A 5F8MA 1NHKL 2VB6A 5AXKA 2UUAF 4DV0F 1KK5A 4KV8A 4O4RA 3NL0A 1OMTA 2MSTA 4KGKA 3JS9A 2HFOA 4X84A 1AA1B 3D6TB 1IN0A 4ZHRA 3P5BP 2DD8S 1FNOA 3SV3A 1TP7A 2EKNA 3M8QB 1MJAA 4C2MA 4LFCF 1SH3A 2IC3A 4AL7A 3K7RA 4G3PA 1VQ4S 1QRLA 3VHQA 4GO7X 3K5OA 4FDFA 1N34F 4ANEA 5LOQA 5HP1B 1N5YB 4KC5A 3GU0A 4LF8F 5KG3A 3EZ5A 1VHIA 4F50A 4WZMA 2W1BA 1O8BA 3VTIA 1YX2A 1MRLA 4YHHF 4U7UD 3T6BA 4XPCA 2DEJA 4P52A 4B3MJ 5LM7E 2FHJA 4TU8A 5JHWC 2KO1A 5HSPA 3IBCB 2MGZB 1VRUA 2QIFA 3CDWA 4MKVA 5L8RC 3RU0A 3S1TA 4CLZA 4DUZJ 3K17A 2J9RA 5BR8J 1VJQA 2GW8A 2HNYB 1WC5A 4K7QA 1HJAI 3SSRA 1ULKA 3QGHA 3F73A 5J1NA 1N56A 4CO1A 1N36F 5EX0A 3FDSA 3HT0A 4Z2XA 5C7PA 4UTGA 2GX8A 1KKHA 2GKVA 3C6UA 1SJ4P 5GVQA 5F8NA 2X1BA 4LJMA 1LW2A 5CQGA 3U1LA 5KG1A 4JI7F 1NK5A 1VLOA 3DDNA 2ZH1A 5KG4A 1E6VB 1SJ1A 3GJRB 2NUUG 1H98A 2Y0MA 3OLBA 1DQ8A 2XZTB 1TL3B 4G3IA 1F9FA 2WVFA 4KKOB 1QTMA 1X9MA 1S97A 1HV9A 2I0XA 1S1VA 5A8KB 1XNQF 3D67A 4DSJA 3M30B 1LEOA 3OR1B 2BE7D 1QD1A 3Q2SC 2IRXA 3E01B 3G8SA 1XNRJ 3RG6A 3MFHA 3JB9k 2PFDA 3LP1B 4MPIA 1DAXA 2D3OR 2U1AA 3D1QA 5DAEA 5KG2A 4I2QB 1WJ9A 3MM8A 3EMTA 3QIPA 1LR8A 3W2VA 1EQMA 2AGPA 2OPQB 4RNNA 2VBYA 3GIIA 1XIQA 3A8JA 3M6VA 2C22A 4O0NA 1K0TA 4HI2A 2W7AA 3D6FB 1GXUA 4BC7A 4UOGA 5D3GA 2BQ3A 1NK4A 4A8MP 1FRKA 1ZM3A 4M5HA 1HNWJ 3SFUA 4FP9A 3IP0A 3M32B 1JLGA 3CMQA 1HEVA 3CVKA 1B0TA 5D0RA 1EKSA 5DO2A 3R8YA 3OVBA 4NLXA 2YX1A 4GKKJ 3W66A 3KWMA 3ICLA 2DBBA 3PDNA 3RR8A 1RCXB 2JFDA 5SUHA 2GC8A 1GMWA 3OBIA 5D15A 1HM0A 2OVOA 4TY9A 1SI9A 4IR9A 2DHAA 3G71S 4EBDA 3VDPA 3WIUA 1NZ8A 2O66A 3OTBA 5LJ3Y 1HNXF 4ELTA 1U49A 1SJ3P 4ZLPA 2UP1A 1ROFA 4OMFG 1X4AA 2XGQA 3Q8QB 1UJ4A 4ZS6A 2JLEA 3O44A 4FN5A 4ZPWR 2V4RA 1RHMB 3LWMA 3FCWA 4K4YA 1AXQA 4ZJQA 3FBCA 1HFEL 3B78A 3OTMA 3GIMA 3GJQB 2J0SD 2V8HA 2GQ2A 4F4ZA 3DGPA 2MLXA 1RT7B 2R8JA 3JSMB 4DJBA 2NSBA 3I31A 1F1BB 3JQMA 4F0MA 2UUWA 1S1XA 3UD5A 4TLQA 3LAKA 4HI1A 1RK8A 1Q81T 1KQKA 4ES1A 1RU1A 2K2PA 4DG1A 3OT9A 2PO4A 5K8MA 2NXEA 2Z58B 4YDXA 2N71A 2GVZB 5FUYA 1RHJB 1MROB 2MKYA 4Y6IA 2OPPB 1HNVA 3I4PA 4U96A 2DNLA 3P47A 4DOZA 1M5KC 2AIRB 3C14A 4J37A 2DEIA 2X7IA 3D4JA 2HS4A 4B02A 3QPIA 3KLFB 2E29A 4R8UB 2DGWA 4DUZF 4MK7A 1FVQA 2HVIA 5I3QA 5KFDA 5BR8F 1RBOB 1RT3A 1EARA 4DV7J 3DRRB 1TTHB 4E6TA 1SGEI 2XLKA 2ZKUA 1LK5A 2C3OA 3HZGA 5EN1A 1GNKA 4XTTA 1JJ2R 4DV6J 5H9EJ 1J27A 4N8OA 4DX6A 2FLPA 2RF2A 2GO9A 2E7XA 4ZCKA 2OEGA 2XSJA 2Y8YA 4WFZA 2MZRA 4ZPDA 4B08A 1NH8A 2HWHA 2CA9A 1YTPA 1TZ0A 2VICA 4EK2A 1QVFR 1H7WA 2J87A 1U6ZA 3KHHA 2QMWA 4I68A 3MMAB 3BO2A 4UT4A 4ETZA 3UVJB 3DRPB 2MLZA 4RW8A 1TL1B 1DS2I 1RT2B 2C2RA 2BQRA 2J9EA 2VG6B 4WJBA 1ZA2B 4JB8B 2YH0A 1UW9A 3HVAA 4HR2A 4WP8A 4PWUA 3OQ2A 1UHAA 2XNRA 3FRYA 4KGMA 2FJAB 1M90T 4N27A 2FZCB 2J0WA 3K5NA 3OUPA 3D8VA 1HI1A 1SC1B 1C2PA 3T41A 1SSQA 3QLHA 1NJYA 2XWYA 3TWDA 4OI6A 3R7NB 4Y2MA 4JI6J 2BE2B 3ZC4A 1SQFA 1HQEA 4R5PB 3QRQA 3MC4A 2RHSB 3I0SB 3FS8A 4QWAA 4CT9A 1Q53A 4GVLA 3PKYA 1UW4A 4WKRA 5KFYA 1VJWA 3N01A 3W61A 3EGNA 1FD8A 1RHKB 4YB7A 3K5LA 2IU8A 2QRRA 2CWKA 4LRFA 2CJKA 2R2SA 2GMLA 2M5YA 4GKKF 3C8VA 1WKJA 1M5VC 1RTJB 2BA9A 1SSTA 1REVA 4RU9A 3GQ8A 1QSSA 4V19X 3V6JA 3BBCA 1WG4A 4PG4A 5K14A 2EFNA 1RT1B 4M5GA 3R5CA 2LDYA 3TIOA 1JLFB 3NOGA 1LWEA 2XGPA 4LSNA 2GFFA 3HM9A 1K9MT 2ZC3A 3RBZA 1U8SA 3VALA 3EXYA 4GI3C 2DNZA 3KLHB 4G65A 4CRJA 3FRZA 1K44A 4P2XA 2IAJA 2WSFC 3N28A 1ZZNA 3BR9A 1NPPA 4USUA 3RAQA 2P9EA 4ECTA 3V4MA 1TV6B 2MY8A 2OUGA 3NBPB 2HVDA 1M1GA 2XO6A 2I9SA 3KK1B 3NOCA 1DURA 3GLJA 5LMNJ 2PMWA 2AW0A 1R43A 4B17A 3TAQA 2YX7A 3AD8C 3N9UC 3HKZD 4PQAA 1ULRA 2GKRI 4PZVA 1WNEA 4EABA 1RHRB 3HSDA 3CT9A 3D0HE 1J5EJ 5M2PA 2DRBA 4V19J 3AY0A 4OZ5A 4I4BA 3TNVA 2DNNA 4YB6A 2EFOA 3H5SA 1PBUA 2CJBA 1FRJA 5DG7A 3AXKA 4WCEQ 4DV7F 2W9BA 1O6XA 4B9UA 2DNRA 3KJQB 2YPYA 2FD2A 1DQ9A 2MQLA 5D6GA 4E1PA 2LEOA 3W62A 4DV6F 4ZLJA 3BRKX 2J9CA 2VKZG 4DS5A 1AUSL 2C2NA 1XA6A 2JSXA 3KYLA 1FJCA 3GG1A 2BANA 1CT4I 4EAAA 2W7PA 4RZRA 5E7OB 5L39A 3KLIA 3VVTA 2JC1A 2OD6A 4MZUA 3EEVA 2BJ9A 3U7JA 2DKOB 4USKA 3UQSA 1JJCB 2BX6A 1FKOB 3FCHA 3ZZPA 2NCKL 1FWLA 4DSKA 2VHEA 2H9ZA 1LXAA 3IG1A 3JTPA 2DGXA 3TRGA 1S76D 2VFSA 1SGPI 1M8NA 5AFUV 1EWWA 3SCLE 5LXRA 3HT3A 2DTJA 3QJPA 5JXSA 1IJEB 4QPXA 4Z7YA 3UNGC 2XZDB 4LRCA 4JI6F 3N5FA 2B8TA 1U25A 5I4MA 3KUEA 2DKVA 4ZCLA 1VFJA 2N82B 3W8PA 1HM9A 4I56A 2FUG9 2SGPI 4EGGA 3PX4A 4LBIA 3TEGA 3T5KA 5DGBA 1BMQB 1SGRI 3HPOA 4GMKA 2XMAA 4F3OA 3R3IA 4KV8B 3BGUA 4OI2A 3P3DA 1SUQA 4LBPA 3V6KA 3SGQI 4J18A 2YKOA 1FDAA 4ZHRB 2QIVX 3MI7X 3CUNA 5KOXA 3PJWA 2NQPA 1YWXA 2IC3B 2UVOA 2EFVA 2ARPF 2RIJA 1ZAWA 2R2UA 1VQLS 3KMQA 3PRBA 3UOEA 3TZZA 2XMWA 3G8QA 1Y7PA 3QTLD 2WW8A 2DY1A 5KFQA 1RE1B 5DRKA 4M9CA 1F5CA 4OHWA 4IQMA 4I2PA 4RW6A 1U2RA 2EEYA 5ETSA 1I1GA 1VQ7S 3C6TA 4A8FA 5HLFA 1DBDA 3CJSA 3FZ2A 2JEGA 2A20A 3CJTA 3RYLA 2ERWA 2VD3A 2MXYA 1VRUB 2AQ9A 3VBIA 4XPEA 3DRXA 3P8BB 3X3UA 3UGLA 3IRWP 4C6AA 4DHVA 5HVHA 2XHWA 3UN3A 2D3ZA 2F65A 2MKJA 4NYOA 3KWCA 3FSBA 1TKDA 1AFJA 3C6UB 5KFKA 2DHGA 2CQPA 4WFNQ 1J5EF 3KG0A 3CW2C 4ED3A 1LW2B 5L1JA 1HI0P 4CT8A 4PG7A 3QT7A 1PKUA 1CLFA 3P96A 3M6XA 3DM2A 4LFBF 4AL6A 1UPMB 3NKYA 2PC6A 4PXDA 4ZDNA 5HN0A 3GQCA 2IPOB 1S1VB 2CPZA 3HHLD 3OVOA 2WOMA 4AYBD 2M9KA 3MGJA 2AD9A 5GAEU 1HR0F 1UEKA 5GMDA 4EI2A 4HUSA 4DPUA 4HH1A 1ZH5A 4M5KA 3DU5A 4P71A 4QIEA 1QAXA 3ISNC 2OEKA 5J2NA 2C3MA 1SJQA 3L7OA 1RSCA 3I56S 4O3OA 1VIOA 4C11A 4PWWA 3MM8B 3QIPB 3W2VB 2HYIB 2GHVC 4KE5A 2ZITA 3F41A 2RNEA 5KFEA 2CJ9A 1X0FA 5D3GB 4UQTA 3EDQB 1HW9A 4S0MA 4DS4A 1OQ6A 2CQHA 4OYIA 1WTFA 2MJNA 5C5JA 2WLFA 4O44A 1N0UA 1K7TA 3AFGA 1JLGB 2H65B 2HFZA 1CULA 1SH2A 2ZNZA 1BQNA 4NZ0A 4B3RJ 3LP2A 5LSRA 4NI2A 3LGMA 3MUTP 3KLGA 4QWCA 1KK6A 4MYUA 2ZM6J 3PYFA 3QFHA 1F2GA 4JV0A 2VOOA 4X65J 1UAWA 3V4EA 1YZ7A 4K4SA 2CIMA 4ECXA 4P75A 3MPYA 5HMYA 2L7XA 2L9WA 1X9SA 3TVKA 1YRTA 2GJ2A 1S49A 2CNOB 4ZVTB 1LWXA 2HSEB 2XYHB 4NA2A 3D7SB 4DFJA 4OHXA 2AYGA 1S12A 3EG4A 4EYHB 1V67A 2UXDJ 4EU0A 3AT1B 4WIQA 1LR7A 3DGPB 2D7SA 3A12A 1Q16B 4ECYA 1N54B 4J9MA 1N5TA 2VU5A 3GFZA 1S1XB 5CAAA 1T8EA 2IM3A 1T9YA 2ZFHA 2HWIA 4B9TA 4JI1F 3UFFA 1RBAA 1R6YA 3OR2A 3TV0A 4DG1B 3J7YU 3H5XA 1N32F 1IWGA 1X5OA 4ZN1A 3D28A 5B0CA 3T1YF 1OMSA 3HDSA 3IBFB 3HHNB 3TAMA 3ZZYA 2E7VA 2K1RA 3D6HB 3KHRA 1S1TA 1HNVB 5ITHA 3ITHA 1K73T 4ECQA 3QAEA 4DX5A 1HBNA 1N5VA 4FKXA 3A3NB 3C14B 2HRYA 3VAKA 1X4BA 3CDUA 1SGQI 1U8WA 1ZZFA 2FC8A 4WPAA 4ZVFA 4I7FA 1G4CA 2C3YA 1H72C 4KNRA 2MKCA 1OVOA 2W2OP 1UVKA 3KFWX 1RT3B 3CB4A 3Q8YA 3WHIA 4Y00A 2AQ4A 4IHGA 3HK2A 5F41A 2AWZA 3SYZA 3IO1A 2RF2B 2LP4A 3MCNA 2XSJB 3BO3A 1XHDA 2YWEA 4QJVA 4ER8A 2KFYA 2AJ0A 4PAAA 4DPXA 1GK8A 4QIFA 3PW5A 2KMRA 4M2AA 1TU0B 2SGDI 3SSQA 3BKFA 4DR7J 4DX7A 4FXWA 1SC6A 3ELHA 1FK9A 1XEZA 5B0BA 4F3QA 4F4KA 4RW8B 4I0WA 1IY6A 4MYTA 2I1RA 2VQFF 1UVNA 4NLTA 2N7CA 2YNIA 1QY7A 2MQ8A 4DN9A 1B70B 1LWFA 3HSQA 3PY8A 2HK2A 2OPRA 2IRUA 2ACMA 3CJRA 1RCOB 3QLHB 5GADU 4Q8FA 2UUBJ 2AJFE 1P9QC 1RWMB 2FHMA 4CLFA 1JIHA 2HFNA 1HQEB 2F9JA 1XR6A 3T6JA 2W2PP 3EX7B 4DF4A 1EETA 3I5BA 3OTDA 1UFWA 2H4YB 2B56A 2KM8C 2B9WA 3DKDA 4P2FA 3C8YA 4QCLA 1IM4A 3W60A 2VZ9A 1U0HA 4OJ1A 2RSQA 3ONQA 4OI0A 2E5JA 2VFTA 2KRRA 4NE9C 3NAIA 3THVA 2GA7A 2ZC4A 1REVB 2CWGA 2DK2A 3T1HF 3PYDA 2OU2A 1TUGB 2Q6BA 2XLIA 3M1VA 4X65F 2VH7A 1CC8A 5K14B 3OFFA 3BSCA 2XI3A 2JZMA 1I5OB 1LWEB 4DBQA 3R7SB 4LSNB 2BUNA 1S10A 2ZZTA 1MN9A 3CCQS 3B4VC 3MQGA 4ZCMA 2IAJB 3VVUA 3WIVA 3V6DA 4MK9A 2VPYB 4M8LA 2RU3A 3IRXA 2UXDF 4J9SA 4DXLA 2HURA 2FPHX 3VBMA 2W9CA 1BUXA 5E2QA 4JI3J 4TLRA 1IM6A 2DGUA 3M8SA 2WVCA 2WCXA 1HWLA 4M5LA 2IDLA 3T5LA 1KR4A 4CLWA 4CQ1A 5CH7B 2F3JA 5HMWA 5ETLA 4EWTA 3PNIA 4F25A 2W0WA 1KLMA 1FT8A 5IXUA 2FQQB 3PRVA 1VQPS 2M2BA 3OL7A 4W90B 1S6UA 2OIHA 2DIVA 2V94A 3KY9A 2B8PA 2M52A 1N13A 3CJQA 4C4WA 3OL0A 4OZ1A 4DSFA 3QNWB 5HANA 2QV6A 3LWLA 5KFAA 3NRBA 1JXEA 1KFSA 4L3KA 2WVBA 2Q1LA 1SGDI 3HVWA 1XC9A 4V1Ak 2VFVA 1WOSA 3BV8A 1U47A 1S9GA 1ITPA 4ZPCA 5KFSA 1AW0A 4ECSA 3CXLA 1VGYA 3SIPB 3BN7A 2DNPA 4DN0A 5DDPC 5D0GA 3T57A 3M05A 5B0DA 2W9BB 1N8RT 5E3RA 1UA1A 1R79A 7FD1A 2DYAA 1YBUA 1T11A 3CJ0A 4HT7A 4JI5J 1OPIA 3CD6S 3QGIA 3MPUB 3RAXA 2HFSA 1NDPA 3W9IA 4OZJA 3TA1A 2R4FA 3Q8VA 3NS5A 1YJ7A 2QL7B 3FSIA 2LA6A 2BANB 4UQGA 1OYDA 2Y9HA 2XI2A 3FVYA 2E44A 2Y1JA 3QAUA 4E1RA 1HI8A 3KLIB 3U1NA 3UGDA 1ZM2A 1G3OA 2RQMA 1TKTA 1D1UA 4M95A 1S6PA 2GHWA 4MIAA 8AT1B 1Q78A 5J8CA 3BS9A 4NLOA 3DLJA 4IOBA 5HATA 4BS2A 2SGEI 4RLEA 4DPWA 2E1PA 2H51B 4ZPTR 1H2TZ 4I1TA 3CCZA 3IG1B 4A24A 3HH2C 5THWA 1VDHA 3CWJA 2ADBA 1JLEA 3UFCX 1VQMS 2PD1A 3MAAA 4XDDA 1R8AA 5IT9U 2ASLA 1FD2A 1ZTTA 3RRGA 2UUBF 3AA9A 1T02A 3I4HX 3R6GB 1T9TA 1WC6A 4KH1B 2K9HA 3G82A 1N4LA 4OL8A 3SDEA 1L3KA 2IM2A 3W1YC 5C2GA 2HLUA 5AXMA 2OGUA 3E2EA 2JJ4D 4IQXA 4URGA 2OI5A 4FKDA 2HRTA 5KFMA 4AE5A 1VRQC 2W01A 3GOSA 1NLKL 2NSCA 1KRUA 5M2RA 5T7LA 3OFEA 1TKZA 4URSA 1Q79A 3N6NA 2F63A 4D3GA 1SUQB 2CG4A 4WXWA 2DNGA 4CLPA 5K8OA 4ANDA 3EXCX 1UUCA 1Y0HA 2QO3A 2X1AA 1MR7A 4PQUA 2R42A 4EBCA 4N69A 3RB4A 2NUHA 1SKWA 1VQSA 1YG0A 4K8RA 3MM5A 2ZH4A 4F4WA 4DL5A 1SBRA 4O3RA 1RAHB 3H7HB 2KL8A 1SL1A 4DQPA 2L9NA 2ZH3A 1XQIA 5K9FA 2OEFA 2UU9J 4Y2KA 1R0BG 3RRKA 5I3PA 4YFUA 5CZVA 3OL9A 2VONA 4OX9J 1R0AA 1VK8A 1RWNB 4I2PB 2X3TA 4RW6B 3RB3A 1F60B 5ETTA 3C6TB 5HLFB 4YR0A 1U0SA 1NKBA 3VZIA 1GX6A 2FC9A 3DRYA 3IS9A 3GIRA 2YTCA 2YWKA 1IBCB 1TMMA 2MB0B 5LL6d 4ECVA 4LIWA 2YWFA 2BW2A 4EMDA 4C8OA 2B0UC 3KLEA 2KH9A 4FXDA 3OTEA 2K8GA 4EUVA 2KXFA 2VC0A 1VC6A 3QYYA 2C3PA 2G0JA 4TXSA 1VBYA 3J7AN 3J7YI 4IDKA 3N6LA 4E0DA 1SXLA 2QZ8A 2XULA 2KCXA 2V0JA 2HVHA 3UGIA 3FKBA 2GZOA 2JW6A 4USWA 2KJWA 3W63A 3TDTA 1CJUA 5IV4A 5CYJA 3CSKA 3QMQA 1D9FA 3DM2B 2DHSA 1X31C 4KR0B 4LFAJ 2HBQB 3LH2S 5BYRA 5L1IA 2VRWB 1RWWB 1IR1A 4O3NA 3A3PB 3HULA 4JI5F 3K59A 2WOMB 2GMJA 4BDPA 1S1WA 4OLOA 2W0VA 2HAFA 4IKAA 2ZBCA 2G2YA 3NCPA 3X1LB 5J2NB 2MEWA 2UVRA 4ED8A 4ED7A 1V9OA 3E51A 2J6SA 1TIHA 4C11B 1RWXB 5HK4A 3PHEA 5CABA 2Y0SD 3ZTSA 4EA8A 4CLUA 2TDTA 3V2UC 4DV3F 4J9NA 3FGVA 1VRTA 3NMRA 1FFGB 3NGKA 4ZVRB 1GFWB 5L9XA 1PJ7A 5BYSA 2OTJS 5KT2A 3KTQA 2QIAA 1WORA 2QLXA 1YIJS 1X60A 4O44B 3FMWA 2H5EA 1CULB 1H0HB 2CQBA 4AA7A 2HHWA 3DHWC 1BQNB 1SB6A 3LP2B 4NI2B 2R9LA 3KLGB 1VQ5S 1KBEA 2M7SA 1YITS 3CCSS 4KBIA 4IFVA 1IJFB 3PR4A 4PYDA 2NYIA 5GADI 3SEKC 1S0MA 1KD1T 1FDDA 4U67Q 2G1DA 2FJEB 4NLQA 4KAIA 4HHHA 1QSLA 1NSPA 4ENOA 1B3TA 2FY1A 4FYYB 4KHMA 3G86A 2FHOB 4DCLA 3NXZA 1WDTA 1L5UA 2KJVA 3PR5B 1UETA 3DU6A 1U1RA 5B08A 1V3RA 4B3SJ 3I9ZA 1CJVA 5MLCV 4OZLA 3UR0A 3OH3A 3UWTA 3VGTA 2YNFA 4M2BA 2B4VA 1Q8IA 2E5HA 1HNZJ 2YH1A 2W8LA 3CDEA 1Z2LA 4NMXA 4A8QA 3HFKA 4WU2A 2CADA 1HWUA 2MZ1A 5F42A 2RUSA 3TOQA 4HCQA 4QW8A 3BEGB 2UVUA 4C98A 3OR2B 5EDWA 1FHTA 3D0IE 2Z0GA 1M5SA 3G87A 2GJIA 3EVOA 3Q0AA 3OHAA 1T9WA 3N6MA 4G6VB 5GAGU 2KZZA 5J2QA 2XMVA 3BDPA 4C8KA 2A1BA 2JL9A 3QO9A 1U2FA 2HVZA 3TAMB 1XMOJ 1NKEA 3DXBA 2PI4A 2XM3A 1PC5A 1QTNB 2K1RB 4WYLA 4RKUC 1S1TB 3R1LA 3ITHB 1HBNB 1TFYA 4ITSA 3Q1XA 2HGMA 2NYHA 4USVA 3KWEA 3CGIA 4I7FB 4X4SA 3SRTA 3NGTA 2B3TB 2KDOA 3MCOA 5A76A 1BHNA 2CYYA 4M5DA 1FJEB 4OYZA 2V50A 3LAMA 2CNNB 2GIVA 2ODDA 2Z30B 4ZKAA 4LQ9A 1L3VA 2R8IA 1YBAA 4FCEA 2ZVIA 1OO0B 2ACYA 3K5MA 2A6OA 2YQPA 3AXMA 1PYTA 1PYOB 4NA1A 4DR1J 3CD7A 1OSCA 4OHYA 1FK9B 2VFRA 1JMTA 2WSEC 4FXVA 5ETNA 4OJHA 4F36A 3EM1A 2WLGA 3BQ1A 4L9MA 3JQKA 3UN2A 1WWHA 2UXCJ 1NHUA 1JLQA 1RKIA 2AT1B 2MHEA 1T3DA 1T9VA 2V8GA 4TNOA 2ILZA 1LWFB 4UOHA 3C15A 1HWIA 1KTVA 1Y5NB 2OPRB 2BR0A 3BH7B 4TQRA 5U2KA 2CPDA 4GO5X 1FARA 4JV5J 2IUAA 4SGBI 2ZJQQ 1ZA1B 4MYOA 3P4UB 4LVOP 4ZA1A 3CULA 1F9EB 5AE1A 1EETB 2J0QD 2V0KA 1FTCA 3FEYB 2DITA 4DQSA 1NJIT 1N5QA 4OI4A 3TYTA 4J7CA 2WBMA 3DXSX 4X66J 1VQOS 3B4DA 2R8HA 2ADCA 3QATA 2AGQA 3CCMS 1U0HB 1NK7A 3NCQA 4MFGA 5HQMA 5KFWA 3TVZA 1GMWD 3O5TB 5KT7A 3MTJA 3VGVA 2V4QA 2B4OA 4DR3J 1DLOA 4NCGA 2QQCA 3ENQA 4NLDA 2HPUA 3M1VB 2NU1I 5IT4A 3RAMA 4FF3A 4PCQA 2PQ8A 4C8NA 2SGQI 1U7LA 1U1OA 3TISA 2VKRA 3AOAA 4Y2IA 3GUEA 1U1QA 3KG4A 2V2QA 2ZVSA 1NRKA 1GEHA 1DHMA 1BE4A 2ALYB 3JSMA 3BKUA 3HHLC 2CRLA 3QSIA 4B3SF 3V6DB 4PUOA 1IQTA 2EG2A 2VA2A 1NK8A 3JXOA 3IRXB 3KK2A 4TVAB 1X5TA 3ZZTA 2ZNYA 1V1HA 3ZZRA 4QPTA 2W9CB 1VOMA 2VG5A 3CO0P 1PG5B 4N76A 4QYZK 2CDRB 2CNLB 1S72S 2QLFB 4FYXB 3RRHA 1U6FA 2E1AA 4B3OB 2OPSA 1RT5A 2A0FB 3OW5A 2DHXA 4LR9A 4IFYA 3HX9A 3OW2R 4IG3A 2F9DA 2AZ3A 1KLMB 1S80A 3HF5A 1BLUA 1GH8A 4EO8A 4JI0F 1RAEB 1IKXA 3MUMP 3D00A 3DCAA 1KOOA 5CZXA 1XMOF 3LA0A 2RRBA 1NDKA 4IRDA 1D8ZA 4ZN3A 4IOAQ 4G1QA 1LXNA 1XK8A 2E5LF 2WCYA 4KB7A 3GONA 2BJ8A 5DLGA 2V0HA 1SH0A 5CXTA 2ASJA 1VISA 3P45B 1UVFA 1S9GB 3CCVS 1EKRA 2W2MP 1QRGA 3OSPA 4ID5A 5HQ8A 1QM9A 5SZTA 3GQ7A 2YUUA 1WEYA 3R1HA 3Q22A 1EX8A 5C2CA 4CZCA 5DG9A 3H5YA 2K3KA 3OGZA 5DQIA 1RWKB 1UCNA 1VMBA 1XWLA 2CNKB 2IHR1 2C42A 4WYWA 5AJ3J 1F3VA 1UVMA 2VDIA 2MY7A 4DDFA 2ENZA 4K4WA 4Y28C 4A8YA 2YKMA 4KHPF 3VV2B 5C25A 1S99A 1V1IA 3TA0A 1TKTB 1TUVA 1S6PB 3TAPA 2IDEA 4LT6A 5K20B 1FDNA 2K3IA 1APSA 3TJAA 1KQSR 1WG1A 3U27A 3GQ9A 4ZPBA 1RAGB 1W2IA 4X4RA 1JLEB 3MAAB 1VC5A 3QJJA 1LWCA 3SMZA 1RDRA 3GJSB 1PSDA 2LU1A 1DTQA 1FI4A 4HACA 4DCOB 2MMYA 1X0PA 2ZOGA 3D3CJ 1YRUA 3U1MA 3BJIA 3OU9A 3G82B 4ID8A 4EA7A 1X4GA 2H54B 3SDEB 2GIFA 2KVQE 1FVSA 1WACA 4DV0J 2ZBPA 2OP5A 3ZXWA 5KG7A 1RP5A 1KVIA 4N6BA 4X66F 2RVJA 5IWAF 2DXEA 5T7LB 4AQYF 1R8PA 1TKZB 2CZ9A 2VPXB 1BXNA 1MMNA 1FJGF 1FNMA 1KHRA 2YQ1A 3EPGA 9WGAA 2YWHA 3OV7A 3R2DJ 1Q0NA 3ISZA 2QLJB 2QPOA 4DR3F 5H9FK 4LFCJ 2ZDOA 4WTYA 1TL4A 1FFSB 3ENAA 4IO1A 1N34J 4PQUB 1S6QA 2JHEA 3EGZA 4F4YA 1F5BA 4F2RA 1QVGR 3BGOP 5CA5A 3MM5B 3RZAA 4ELVA 1ZETA 1TV6A 3M9MB 3DMJA 3OJSA 5JUMA 4OV1A 4JYAJ 2CKWA 4A8OA 1R0AB 3GSDA 1D0EA 3CEDA 4ILRA 2J8SA 2IA6A 4WFAQ 2FZGB 2UUTA 3FZBA 1FA0A 3CJ4A 3PMOA 3PO4A 1P8GA 2E66A 1BY9A 3IS9B 4K2JA 4USMA 2R8KA 2I8EA 3SCJE 2VBWA 1KTQA 1CSJA 2EK1A 3KLEB 3CCLS 2LEBA 2ASYA 3HFVA 1SIWB 4TU9A 2RS8A 6FD1A 2Y0BB 4KPYA 1N5SA 3CNQP 4JI7J 4IDKB 2JWNA 5IQ6A 3HXMA 3BXYA 3CJKA 1PJ6A 2EC0A 1FWYA 2HZAA 2OJ3A 1FWPA 3E2IA 3GCXP 2AEJA 4ZLNA 4J9QA 2HQIA 1CJUB 2GGOA 3ADAC 2HRUA 4IH6A 1WHYA 1XNQJ 1KOHA 1EB0A 4KPXA 4P7VA 5D4NA 1PCEA 2CQ0A 4ZPAA 3CCWA 2UZAA 2I38A 2ZJPQ 1FXRA 2LVWA 3OFGA 4C0BA 4LR8A 4CNZA 4DMZA 4AFFA 1VS3A 1K7UA 2JH3A 4LF9J 1UFLA 3LP0A 1C1CA 1ZM9A 1RISA 3LW5C 4K4UA 3GP9A 2R7RA 3MTKA 4QIWD 2QKXA 3AQOA 1S1WB 3GWCA 5ETOA 4DR5J 3GYXB 2BOPA 2WB1D 3PW0A 3HJJA 3EICA 3EZUA 4E1KA 2AHOB 4ECZA 4HL9A 2ABYA 2KHDA 1RT4A 3A1YG 3MM6A 3GVDA 4QR0A 1S77D 3UDLA 4ZVUB 4ED6A 3UO0A 3T19A 3K8VA 1KVJA 3R5JB 1UVJA 1VRTB 4PG5A 1P9GA 2MPUA 2W2QP 4X4PA 4I6YA 3TOBA 5HJXA 2KG0A 2LA4A 4HHUA 2O67A 1Y4ZB 5L1LA 3UPFA 2MZTA 1VHFA 1PCAA 2F8HA 4K6RA 1RAIB 1V3ZA 3EPIA 4MH8A 2F1FA 1FY7A 2CAJA 4Y3CA 3SQOP 4IFVB 4OYXA 5LT5A 4FF4A 3BBBA 1HNXJ 3GJTB 4WK3A 3MF5A 3R97A 3UR3C 2BYCA 1W2BR 1HD1A 4WE1A 3M7VA 4KQLA 4I67A 3RJMB 1X4HA 2L08A 4P74A 4ED0A 3BGRA 3C19A 2Z2ZA 1KQFB 4CH0S 4PKDB 1X74A 2EPIA 4DI6A 2JEIA 1YK9A 9RUBA 3S01A 3OL8A 2V0LA 3G4SS 1CJVB 3Q8RB 3R7BB 3H2LA 3DHXA 3RB6A 2YNFB 1ULMA 1HHTP 3CD5A 3HHEA 1D8YA 2IM1A 3BZQA 3MD3A 2BACA 3I87A 4H7OA 3RB0A 3WQPA 3PW7A 3NNAA 1WHWA 2QA1A 1GTEA 4U7UK 4KO0A 1SCJB 2NU4I 3H40A 1RTDA 2FLOA 5FDLA 2MKHA 2VASA 2YKPA 4QU6A 2CDQA 1FNXH 2AKWB 4G1IA 3HP6A 4P2SA 3LO3A 3MFIA 5J2QB 1UEUA 4JYAF 3QO9B 3GV8B 2KYZA 4CLSA 1N33J 4HTJA 2KI2A 4M5JA 1Q8KA 4ED5A 3SCKE 2CPHA 3DRSA 1XBTA 2LFVA 3JSRA 2R7QA 1IKVA 1NK6A 2AEFA 2CFXA 4EEYA 4Y2CA 2IMOA 4OHVA 3D1HA 1YJ9S 5D78A 4TY8A 1HQUA 1M5HA 4BCAA 1HARA 3GOXA 4EYIB 4M5DB 3LQVA 3CC7S 2JF2A 5EHHA 2EFPA 1ELOA 5A8RA 2N7YA 3OPKA 1RYSA 4QYZJ 3OD2A 1C1BA 4TQSA 1G2EA 2B9XA 4DL6A 1WHVA 1HPTA 1Q95G 4RL1A 4K50A 1HBUA 5MAOA 1YTYA 1KVKA 4B3TJ 2DGSA 2WVJA 3PACA 2P6SA 4NLGA 3OH4A 2X52A 2IRYA 1XX6A 4LF9F 1JLQB 1EAYC 3TWZA 4A47A 3I82A 3M6WA 4ISXA 3BYRA 3W64A 2OMLA 4YB5A 4DZ6A 1HLWA 4DR5F 3C15B 1RTHA 1HNIA 3FFIA 2X1FA 1RQ0A 1JLCA 4OX6A 2OKQA 1A0OB 2V63A 1R89A 3MHYA 2IIHA 4Q43A 3DLBA 1XMQJ 4KRWA 4IRKA 3PX6A 4Y2AA 3JYTA 4J9PA 3GG0A 2BXJA 4DFKA 2ZZMA 4DL4A 4U6PA 5DZ7A 4WP3A 1YZ6A 3CIZA 4NRTA 1NAQA 1X4EA 2IJFA 5K8PA 2GO8A 2ELIA 4RUAA 1HHQA 3RBDA 4ZP7A 5CD4H 1WI8A 2ZOMA 1RB0A 1WSRA 1ZS6A 4W98A 2O01C 1DLOB 4NCGB 1UL3A 2ZWPA 4DQRA 5M2UA 1DJ0A 4ZVSB 2R7OA 2XBPA 2F40A 3AHPA 3IGVA 4C7QA 5IT0A 4YQWA 4GC6A 1M1HA 2R8GA 4ECUA 1UZHA 3UCUP 3SCIE 2XYPB 5L38A 5IT9Y 1OJ4A 1QQ0A 3CMES 3A4TA 2CQCA 4ED1A 3T9NA 2YX4A 1N48A 4PUOB 2CQDA 2QN6B 4RNMA 2XO7A 3F44A 3KK2B 5DM6Q 1UKUA 3O2IA 1KC8T 2V9WA 5L6VA 2BJEA 3VAGA 3FSCA 2VG5B 4DL3A 2EBGA 3DGVA 4U8YA 4NCBA 4XAKA 4WP9A 4F02A 1Q5VA 1WC0A 3QFWA 1ZYQA 2OPSB 3MZIA 2B8QA 1RT5B 3D2WA 4IFYB 2ZH6A 4IG3B 5H9FJ 1SKUB 2B0GA 3VNPA 3CJ5A 1WGTA 4DNCA 3DDKA 2YNGA 3A8EA 2XYGB 3BH6B 1OCXA 4USJC 1NO8A 4OYAA 3TA2A 1U02A 1IKXB 1KHWA 3OLAA 2AZ1A 2BM1A 1IKYA 1N33F 4LQ3A 1QRMA 4I69A 1LK7A 1NU4A 2PEBA 3C66A 2HQCA 1KWMA 3R9LA 4CO2A 2EI5A 2V1CC 4G1QB 3MECA 3EGVA 2QYGA 5B0GA 1KN6A 2G9OA 3V6HA 1IWAA 1L0SA 1CG2A 1OS5A 3UDEA 3R2CJ 4FPIA 4YY3F 1GX5A 1WC3A 2MQPA 2Q43A 4ID5B 1PPFI 4KPCA 2FYXA 2JYYA 4CWBA 2QA4G 4L6V3 1LV5A 3PFOA 3TQ1A 5JJBA 1WOOA 5KFVA 3FSYA 1YJUA 2B7BB 1GQEA 1MJBA 2IY5B 2AX0A 2L8EA 1NB2A 4AT1B 4WTOB 4ZVPB 5A2QU 4CH7A 3MAQA 2LXUA 2BMBA 3TK8A 3HD1A 1GT8A 4B3TF 2YKMB 5C25B 2ZWOA 5J1EA 1ZTWA 3D1OA 4MT1A 4DU8A 3M4XA 2VF3A 3W9HA 3K57A 1KHVA 1K47A 4YDDB 3I9V9 4MIWA 2B9YA 3N5BA 4JI8J 1S0NA 2RHQB 3R0SA 4NLYA 2UXBF 3THPA 3ENWA 1LWCB 2LYVA 1Y3JA 2WGCA 1KDNA 3J80U 4HACB 1DTQB 5FUXA 4ECWA 3HSGA 2HQFA 3RBXA 3OHBA 1XMQF 3GQAA 3M2RA 3SI8A 1KMAA 1H38A 3LTOA 3OFHA 2CJYB 5JVHQ 1IR0A 1B99A 3CC2S 1VQ9S 5KFFA 3UI3A 5KFOA 1X4FA 2IYIA 1GTHA 2FHKA 1HL6A 3TJ8A 3AA8A 4ZJOA 4I64A 1SIZA 4YOEA 2C3UA 3G6ES 3VQSA 4FBUA 3UN5A 3LUYA 2H5JB 2HQ3A 3VAMA 1MMLA 4U7CA 1HDLA 1WF2A 2DH8A 2B7CB 2FJDB 3EDRB 1FF2A 1S6QB 4NRUA 1SJRA 5FJ4A 3M2UA 3ZNJ1 1FJ7A 3ILOA 2K06A 2E7WA 3BGLA 2BABA 2C2EA 2HHXA 4WFBQ 4OI3A 4A4JA 2RB7A 4EGLA 2YKAA 3BDEA 4A8XA 1XMBA 5B0EA 2Y8WA 3DMJB 1FAQA 5E3PA 3AOCA 2H5IB 3HD2A 4LSZB 2DO4A 1BC6A 5FLXU 3PYEA 1H2UX 4E79A 3I5CA 2AYMA 2GIRA 1DQAA 3B82A 4J9LA 1T3NA 2YNHA 1FX4A 2H4WB 3LANA 4U95A 3M8ZA 1RKJA 1MR9A 1M5OC 3KG1A 1R0RI 4N56A 3U02A 2LDIA 4WK1A 4WF9Q 1C0UA 1VCTA 2J6TA 2RT3A 3CIMA 3IR5B 1RU2A 3K89A 1HKAA 4R7PA 2WLDA 1PO6A 2G1HA 3MOJB 3T5HA 4HVZA 3GPAA 2W0TA 2ROEA 2WK4A 5A0YA 1L3SA 2DB6A 2O3DA 3MEGA 2E1CA 4NMLA 4DX8H 1HYSA 1TBRR 2GAGC 4RBTA 1IW4A 4OJ3A 4LFBJ 2V5HG 1VDDA 3CJKB 2JEJA 4OLPA 5D4LA 2CQ4A 5GAHI 4F3MA 4IR1A 2HK3A 1MWZA 2QL9B 1NMEB 3H5UA 3M8PA 1CPZA 1P6TA 3AJ2A 1HR0J 3H59A 2JX2A 3RGIA 1V6HA 3LP0B 1C1CB 5HMXA 4F0KA 4PABA 1X5PA 5KG5A 1FRMA 2FIUA 1LOUA 1T9XA 4J90A 1RZMA 1QE1A 2RDIA 4ILLA 2PMHA 2EG1A 2DGOA 1NJZA 2Z4PA 1NXUA 1L3UA 2MQNA 4K5RA 2E9TA 3P1BA 1RT4B 3PX0A 3MM6B 5DG3A 2HAIA 4K2XA 4KSEB 3IWNC 1S5ZA 2KG1A 2IBKA 4LF4J 2D9PA 1F2HA 4HURA 4X4UA 5A8WA 3SBMA 1CS4A 4PXBA 3A3OB 1UVGA 2LXIA 6FDRA 4PYAA 3BSYA 4DFMA 1Q9BA 1RTZA 2KB2A 4JI8F 2Y3YA 2EWHA 5C24A 4M28A 1HM8A 2HHHF 4LF5J 4EO6A 3L7UA 1PJUA 4QWEA 5JVGQ 2AGOA 2FJBB 4MJKA 4BBYA 5DS7A 4DV1F 3OVAA 4NEYA 4LF6F 1MN7A 1B7YB 3IXQA 2FKOA 2XRCA 4CP5A 3NS6A 3Q8SB 4PR6A 2M8HA 2V8VA 4WE1B 3LGNA 5E5NA 3MPDA 1WELA 2QLWA 2OI2A 5GMEA 3BGRB 3TEHB 1Y1BA 1S6OA 3R2WA 2XS2A 1D3WA 3NZ2A 3PO5A 2E73A 3ISND 1BWEA 4BWJA 1KP6A 3FBBA 1TK0A 1O5JA 4QR2A 4JI1J 1M8BA 1A6LA 3TI0A 2FVPA 3ETMA 1PTRA 4R25A 4KGZB 1IKWA 2BZ2A 4PG6A 1N32J 2DNYA 3T1YJ 4RW7A 5KFIA 4DV5J 2YPZA 2KHCA 2ENNA 5KFJA 4KO0B 2JVOA 1RTDB 2RQ4A 1UWAA 2NLWA 5FDLB 4QOTA 4EBEA 2A3JA 1CE3A 2RDDA 3IA0A 3CTRA 4X4TA 4Q2LA 1MW7A 3CXCR 2B51A 5C42A 3PZPA 2E5RA 2DPIA 4CM2A 2PGCA 3NGRA 2OH2A 3T3FA 3IFEA 3ZNUA 2NS1B 3DRSB 4CDIA 7AT1B 5D0HA 3QIDA 1KS2A 1IKVB 2LKZA 1RA6A 1C4AA 4LRDA 4RNOA 2CVIA 3MPVA 4TY8B 2QGFB 1HQUB 2GGPB 1RACB 3FJ2A 2I5KA 1Q4RA 4ZVOB 2HNDB 2WRMA 3KDNA 2AJ2A 2CPYA 3MR2A 4R0EA 4KJIA 4LRAA 5A8RB 4I6WA 2ATLA 1WI6A 3L3CA 4RPFA 4AC3A 3D5MA 2HLTA 1C1BB 3FK4A 3ZTQA 1A7GE 1BD6A 3OXGA 1Y10A 1UPPA 1G1XA 1SL0A 2VQFJ 2N4CA 1AFIA 2C2KB 4IYQA 1HBUB 2OD4A 2HZCA 4RUCA 2G0CA 1U1PA 3CD0A 2MKKA 3GE9A 1CQMA 4GVBA 3V81B 1S4FA 2IFXA 2VD4A 3KHLA 1U6BA 4K0KJ 1CT0I 3O1LA 3MMCA 3I0RA 1J5OA 4FYDA 1OY6A 1RTHB 1FXLA 1PAUB 5AXLA 2OSQA 1H2VZ 4OHZA 1HNIB 3FFIB 3D3BJ 4H4MA 4IH5A 1JLCB 4HDHA 3D0GE 2P9CA 3J81U 3IM8A 4P9SA 2AJ1A 2MKIA 2SXLA 4CLYA 5IQQA 4JV2A 3HCXA 4LF4F 3ILJA 3FQLA 3JYTB 2ZHAA 3BPSP 4DFPA 5D4OA 4E2FB 4NZ7A 5I42A 4OZNA 4OYMA 4HH0A 3GFHA 3VBKA 5IC6B 2XLJA 2KT2A 2GVDA 3W5XA 1I51B 4A46A 3T1HJ 1TKXA 2GCFA 4X64J 1X7VA 3FEXB 4LF5F 3TARA 3THTA 2O5DA 4LVNP 4FF2A 4HYKA 2M88A 3LPEA 3N79A 2GHPA 1VQ8S 5HVFA 4PG8A 5ADXV 3BQ0A 2YWWA 2GKTI 3WC2A 4M5NA 3EGWB 3AB2B 2WVDA 1X8DA 1NSAA 1G6BA 4HHJA 4KPZA 1FCAA 2IVMA 3VWSA 2XB2D 3N0VA 4Q44A 4RUHA 2G4BA 1JLBA 1OIAA 2QJ3A 1U26A 1E6YA 1DY3A 1S20A 1G7CB 5DDQC 1VYAA 2D41A 4TKTA 3IC1A 2D69A 1V5IB 2IYGA 4X4VA 4USIA 4EA9A 2KKHA 3CE8A 2XMTA 2DB1A 4NASA 3NS7B 4DV5F 1QAIA 5ETVA 3VQTA 1RYRA 4LSLA 2GIQA 3UD3P 1U1LA 3P6YC 3TANA 3WC0A 1FWKA 2V4JA 4M63A 1R31A 1CBKA 2YNGB 2IVFB 3B6BA 1IQZA 1IKYB 3DHOA 4P7TA 1RFHA 3JTNA 2F5GA 3GV5B 4J9VA 3R3RA 3TZWA 2P9GA 3MECB 4JBCA 3F56A 5KFZA 2LEPA 4IUFA 3FCVA 3IBWA 2DRAA 1BQMB 1K1QA 4L75A 1B0VA 4RX6A 1LW0A 1X4SA 2WB4A 1RADB 4LREA 4WIIA 2QMXA 4UF4A 4WKYA 5KFNA 1NXIA 3MMJA 1X5SA 1JLAA 1B7FA 3H4BA 2CZ4A 5KFGA 1X4DA 1FRXA 4KY3A 2V2KA 2K7JA 1D9AA 4X4OA 1G95A 1AN1I 4RNHA 2KXHA 2VUGA 4KYZA 5KFCA 4W92B 3AB4B 1A9NB 3RW7A 1WKKA 4FBTA 2QC3A 5IFMA 3E8OA 2HBRB 1RGVA 1CSOI 2U2FA 1NSKL 4L74A 4YMEA 2BEFA 2YXLA 5KG0A 1OSDA 1UWBA 1NB7A 5KG6A 1NNDA 2OEJA 2HEKA 3D98A 4C3MA 2RILA 1NPKA 3R5GA 1P1LA 1IVZA 2BKNA 1R6VA 3PW2A 2ZD1A 5J1EB 3QQCD 1FTRA 4RW4A 2BRKA 3N4WA 4NA3A 3GYGA 4XDCA 2FJVA 3EYZA 2LQ5A 2XMUA 4K0KF 5E33A 4ZVGA 4ZVHA 1CGII 2JEFA 2DISA 1NEEA 3NNCA 1RAFB 4KGVB 1EIYB 2J9DE 1SSMA 2GAHC 4C8ZA 1SKRA 5IOLA 1MSWD 3CJ8A 1F6TA 2Q66A 1ICEB 3M2RB 1NCLA 2NU0I 3VGUA 2B4PA 5BXIA 2EBEA 4RBUA 4DEZA 1YKWA 1XATA 3VBNA 2ZDPA 3WX8A 2L9DA 1FFWB 2QMUB 1V5VA 4X2BA 3TJQA 5HVGA 1DTTA 2WONA 2QT7A 4F67A 1HWKA 3M8YA 5B09A 2VG7A 4X64F 5L9NA 2DIUA 2M5XA 3I5AA 1UTAA 2DJWA 2VC1A 4UXIA 2OHDA 1NUEA 4EFAC 3VAIA 3QWPA 2CQGA 2R7SA 2KMOA 3C2PA 3CCTA 3CC4S 4CNYA 4GC7A 2N17A 3C16A 2BJDA 4ELUA 4H4OA 3M2UB 3BSWA 4ZP8A 1NK0A 1U09A 1TVRA 2E1RA 3KDOA 1K0VA 2UVWA 4K4TA 3FC3A 2HW3A 4MKBA 2VA3A 1MMDA 2DH9A 4O3PA 4AD6A 2V2VA 1HD0A 1QAJA 2V2ZA 2IA0A 4LMZA 3G6YA 2OAUA 3EE3A 4FF1A 2XNQA 2QQ0A 2Q4JA 4B3MF 4B3OA 3BO4A 2MLYA 3G9CA 1FXJA 5FUVA 4C3KA 1Y5IB 2YNHB 1QJHA 1UJ6A 2PN6A 4O3SA 1ZOTA 1KRPA 3OJUA 1NBEB 2HHUA 1C0UB 1QDUB 2DCLA 4OI1A 5EWGA 3TO7A 1RWVB 1H3DA 2VV5A 3TOAA 4LRBA 3IGJA 4RWXA 3UE2A 2EVZA 4YUDA 3DC2A 5J2PA 1FE0A 1T05A 3SPTA 2DRDA 4A8WA 4FPRA 2AX1A 5A0YB 3MEGB 2IJRA 4QQBA 2RQCA 1HYSB 2NU3I 3SGBI 1IBKJ 2FY8A 3G6XA 1AUDA 2HHQA 1TUWA 4OYBA 2B43A 1UFKA 2DNMA 2M70A 1Q7YT 3CCRS 1OQ3A 4OFZA 3L09A 3VZHA 3QRPA 3TVYA 3CJ3A 1R8CA 3M8PB 2Y1RI 3W65A 1LKZA 2XMMA 4DL2A 1NK9A 2QFJA 5J2MA 1M1KT 3DFEA 3CDAA 2XEXA 1GXLA 2PEHA 2JLFA 1XNRF 5F8GA 2FLNA 2KU7A 3VBLA 3NAHA 2GV1A 5HMZA 2M3DA 3V5RA 1QE1B 1Y5LB 4URQU 2JA1A 2F4FA 3DLGA 1RT6A 3LGHA 5IM0A 2B5JA 4EZ9A 4DV3J 2OZUA 1LNQA 2QA2A 3OTCA 3FSXA 4R0JA 4AXIA 2BJ3A 3ZTPA 1CEZA 1Y1CA 2RS2A 2PDAA 4NYZA 3D54A 1VC0A 2J6UA 5K8NA 2UV8G 3GFYA 5A8WB 2JNJA 1CS4B 3UDVA 4NXMJ 2VQEJ 2HHVA 4ZPVR 1FX2A 1KK4A 3SXLA 4IOCQ 1F5AA 4TU7A 2FGCA 2NPIA 1REGX 1Q82T 1H74A 1HNWF 4DLEA 4PXEA 5D77A 5C24B 1W3SA 4P2MA 1F9HA 4DL0C 2JOQA 3KNAA 1RTIA 1F3FA 3VGSA 1H73A 2CQIA 3JTOA 4N7TA 3AD7C 2HGLA 3DLLQ 1S48A 3DNCA 2GMHA 2ZBQA 2NXJA 4QIGA 4CO0A 2ROGA 3UD4P 3RUBL 2F7VA 5EWFA 2A6MA 3S6EA 2DR8A 3NY0A 2DHHA 2C1EB 4NLVA 1VQKS 2DNOA 2BV3A 1KBFA 1MU2A 3KNGA 4OZ0A 3QSYB 4OX8A 4YB1P 2G13A 3KJVA 3KK3A 2PA3A 3BSSA 2COLA 5LMUJ 2CVEA 2WAQD 4J9UE 1YJTA 3DJ4A 4F26A 4M94A 2CJXB 4UUXA 2ZBRA 5F8HA 5HI7A 1IKWB 1Y8FA 2KN4A 4P6QA 1FDBA 4MMOA 4FYWB 3H20A 1AROP 2Z8QA 5T41A 3DLKA 4RW7B 2RH3A 2AV5A 2HNZA 1RA7A 3VE5A 4LF1A 2F3CI 1KSPA 4EZ6A 4UOCA 4JV1A 2NU2I 1UJ5A 3H2UB 1JKHA 3BF4A 2EW9A 3HVRA 2APOA 2RKIA 5C42B 4DSEA 5A6WA 4DWIA 5CCLA 4W4MA 2YKNA 2DR6A 2QQEA 5AE2A 2CJSC 1S1UA 2Y1LB 5E3CA 3MURP 2B6AA 1Q8BA 3O3LA 4C0HA 3DOMA 3BB5A 1JX4A 4YR2A 4LF7J 3BQ2A 1FYBA 1RUSA 5F8JA 3K8WA 3I6PA 2OI6A 5B0FA 1JNRB 5IV3A 2BQUA 2MZJA 3SV4A 2V69A 2NZCA 4CIOA 1YJNS 1O51A 3MD1A 4M1KA 2DR5A 1H6KX 3POTA 2LQ8A 4O23A 3P5TL 3IR6B 2UV8A 1IBKF 2KRBA 3PFEA 3R5DA 2BM0A 4ILMA 5CYMA 4DPTA 3GIJA 1SPBP 2PMZD 4J5OA 3O6QA 3SQGA 3PV8A 4KT0C 4ERDA 1WHXA 3LALA 1WF1A 3VBJA 2M4MA 4F8RA 4GVBB 1HPZA 5D4PA 4P72A 2UZ3A 3J7A1 1JWWA 1FKPA 2ROWA 3S8SA 4MAKA 5CYQA 3H8YA 1Q1KA 3WX4A 5F8IA 4E8UA 2ICYA 2DGQA 3DN9A 3MMCB 4ANCA 3I0RB 1TFWA 2Q3PA 3IWXA 3G2XA 3QZ8A 3M9NB 1J5OB 2NPOA 3ZZ0A 1WKLA 2K7KA 2BKPA 2HBYB 4H4MB 1WUUA 5F3ZA 1TL5A 1CGJI 2IU9A 2X3DA 4HZDA 3L7PA 2R7UA 2W4PA 1Z7KB 3PTWA 5KAKA 1R8HA 1V3WA 4IG0A 4NXMF 2VQEF 1FEHA 5I42B 4ZVQB 2XS7A 4RUBA 5AXNA 5A2QY 3A13A 4ES2A 4DSIA 2GVDB 1Q8LA 4B9VA 1TKXB 5KFHA 2ZJRQ 3R6LB 1YP3A 1O0PA 3GB0A 2V8DA 1QRFA 3HKWA 1W26A 4KFBA 4QWDA 3TJ9A 2R3VA 2X3GA 1HBMA 4NZ6A 1LFPA 3B54A 1RWPB 3KUGA 3RTVA 4PPDA 2ZUGA 1AT1B 5DDRC 3PHTA 3PYGA 1TBOA 3OTOJ 2IJNA 3NCRA 5KFBA 5J8FA 1KLNA 1VQNS 3TUIC 2C28A 4G87A 3MMBA 1OYEA 2OSRA 2ATCB 1JLBB 4Q7AA 4N8NA 1T0TV 4RW9A 1TQLA 5KFUA 3J80Y 1D09B 3Q2TC 2BBEA 1E6YB 4J9RA 5LMUF 4ZP9A 4CLTA 4A48A 2QA4S 4OX7A 4RR5A 5LXYA 2NR0A 2RMLA 1M8CA 4DZDA 4ZMMA 4C0OC 3MR5A 5LMNF 3QJLA 1MWYA 4JI0J 4Q0BA 3D68A 1YBTA 1EZZB 5T14A 4DR6J 3H42A 3PEJA 3W3SA 4LSLB 1N6QA 2DNQA 1S7HA 4JI4J 2V4JB 4QR1A 2E5LJ 2GNKA 2XTJP 1WEXA 2XATA 5LSLA 3I3XA 2OMOA 1FO1A 2ZEJA 1NH7A 4ZJLA 2HBZB 2DY9A 1UVIA 3NMAA 2W4CA 4LR7A 2CPXA 2I2YA 1LW0B 2MQMA 4LF7F 2E9ZA 5LJ5Y 3DOKA 1SV5A 1PTQA 3L4BC 2C2DA 2QLBB 1JLAB 5IS2A 3AH6A 4DR4J 5FLXY 2GQCA 2LU2A 2B9EA 2J7KA 1KQGB 1GXTA 4OYPA 3MEEA 5KTQA 2VL1A 1XERA 2FJWA 1M0SA 3O8WA 4KHPJ 3TQEA 3LOUA 3M6UA 2VIHA 3ENVA 4WZQA 3UDCA 2FVRA 4N47A 1UWBB 2XY7A 3HZEA 1UMJA 2VJVA 2XSFA 3MAHA 2I6WA 3AD9C 2JVRA 3TO9A 3TUZC 2W25A 2RD5C 2ZD1B 3PIOQ 1Z2FA 4RW4B 5U47A 3EJMA 3PKMA 4QYRA 3MR6A 2GS8A 3M9OB 1XJWB 4R36A 3T1AA 3PG9A 4ALZA 5ETPA 2FTRA 4PWDA 3H4DA 4ATNA 3ECTA 1U24A 2V67A 3LPYA 1FERA 3Q8PB 2WLCA 4DF8A 1JB0C 2FLLA 4UUWA 2L41A 2ZUAA 5IWAJ 1OWXA 1DS3I 9ATCB 4AQYJ 4A8KA 3UCGA 2ZHBA 1FJGJ 1UP1A 1VR6A 2DNKA 4PXCA 1DTTB 4RBVA 2WONB 5DM7Q 2SGFI 1THJA 2D9OA 2VG7B 4N5SA 1Q86T 2XS5A 1B0PA 3TZXA 4HLBA 1P1TA 1J2ZA 3CF5Q 3KHGA 3VAJA 3L95X 3PM9A 1SQGA 5HO4A 3G6VA 5AE3A 3GR1A 3C16B 2V6AA 1RLDA 3MOZA 3OTOF 5F0UA 4YP3A 2W4DA 4H4OB 1R8BA 4CO3A 1U1MA 4YN3B 2DXDA 3M8RA 5KFPA 2KZMA 1TVRB 2D74B 1RXOB 1NZAA 1TBQR 2VHGA 2G2ZA 4C97A 3UEYA 3WZ0A 3VAFA 2PT0A 2VBZA 1VBKA 1WOPA 3BSAA 3KOAA 4B9LA 4DU7A 2E9RX 4E98A 4NL5A 5KOWA 5FUWA 2DNHA 1SL2A 2HWTA 2QE5A 2OTLS 1Q5YA 3MEDA 3NWRA 3QT6A 3T9ZA 4OQJA 4C8LA 1T95A 4J9OA 4DR6F 4G1PA 3OSNA 3GIKA 1S9EA 1TK5A 1WC4A 4JI4F 5D8HB 3TO6A 1HBOA 2J7UA 4Z37A 5J2PB 2ZBIA 3Q23A 2ROPA 4OVOA 1T05B 5KFLA 4G3SA 1TURA 4RNFA 1IBLJ 3QGPA 2IMWP 3PRDA 1DZ5A 2P5VA 3JAMU 4FNIA 2EFGA 1N88A 5G4DA 3DDIA 2MKSA 3ET6A 2ZH5A 4F4AA 2QTWA 1MG7A 3D6MB 2Z56B 2RUGA 4DUYJ 3E3XA 4B9MA 1U1KA 2ZZNA 1FKAF 5J2MB 3IGNA 3IXCA 4IO9Q 1WG5A 5EGYA 4DR4F 3BFPA 4E6UA 2PIIA 2XZWA 5FIIA 1OYVI 5E3AA 4DLGA 4X62J 3BKTA 2HGNA 2FJXA 1GMVA 3DLGB 1RT6B 2RRAA 4CO4A 5IM0B 4H4KA 1JK9B 2B5JB 1T03A 1FRLA 2C2OB 3NEKA 4OZ3A 2A2DA 1GMUA 1QUVA 3S7RA 2GQQA 2CJAA 2PFFB 2CG8A 4L3NA 1K1SA 3EUNA 3SFGA 2R7TA 4LBHA 2X51A 4HEA9 3OTZA 2LLZA 4ICLA 4QW9A 2XY6A 2YWGA 1WTBA 3R27A 4ZP6A 2UUCJ 4AUKA 4KGXB 3GYNA 1RJJA 4NLSA 1TL7A 3MM7A 1EP4A 2PE8A 2DR9A 4NWBA 4B3RF 2WSCC 1TBNA 1RTIB 2F4VJ 2OEMA 4KH0B 3SSSA 2HIYA 5JMNA 1TGSI 2ZM6F 1IXKA 4FNHA 1NHVA 3M2VA 4RJVA 5F9NA 2BRLA 3Q86A 1CT2I 2G2OA 2HHSA 1SKSA 4EQYA 1YP4A 1C0TA 3WDOA 1IBMJ 2HS0A 4QU7A 4C8MA 3NGSA 2LMIA 3TW0A 3GFXA 1YP2A 2LQ9A 1MU2B 2P8IA 2YQ3A 4A8SA 3J81Y 3KJVB 3MM9A 1UEVA 2OI7A 3TUJC 1U2CA 2CPIA 5HQLA 2DH7A 3KK3B 1WC1A 3MEKA 1BQXA 3CMAS 1MNEA 2CUYA 2I5JA 5ADZA 4JP8A 4ZIVA 2P2OA 1URNA 2MYFA 3OH2A 1N4IA 2QX0A 2YKQA 3DLKB 3DYAA 5IZHA 2HNZB 3BM7A 3ZO7A 2EFQA 2XCPA 4C8YA 3MR7A 4HDGA 3A8IA 2AJQA 3H98A 3MR3A 3TUPA 1JKHB 2KYXA 2Q79A 2RKIB 3V4IA 5ETRA 3WBZA 4DR2J 4K5SA 2MSSA 1LFWA 2YKNB 1T3OA 4J91A 1S0OA 1U1NA 1S1UB 3ULHA 2DPJA 3K2YA 2QSWA 2ZKTA 2B6AB 1PAEX 5F8LA 3DOMB 2VJUA 2HMIA 2DGVA 1JXVA 3HVTA 4NYPA 3PCOB 4K59A 2HQGA 2Q6CA 2NXCA 1S7IA 3NGUA 3TX0A 1WDDA 2W2NP 5HBMA 2DT9A 2VPWB 2J0XA 4MIBA 4DQQA 3POTB 2E5GA 3AQPA 5ETKA 3FUYA 1IBLF 4D3HA 2PI5A 5RUBA 3CO9A 3ILLA 5CYMB 4FVCA 2HHPA 4DR7F 1U48A 1CVJA 1F0XA 1FXDA 4TYAA 3HFZB 3SQGB 5HROA 2OO4A 4DUYF 2XMJA 4HTIA 3NGDA 2ILYA 1I94J 1HPZB 3CCJS 2KMPA 4OZ2A 4XIUA 1S9FA 1AYEA 4CLKA 1VBZA 2V68A 5BJRA 1FKPB 3NNHA 3KUHA 2N1AB 5CYQB 1RI7A 4RWWA 1PGZA 1W25A 4X62F 2N4DA 2HHTA 3RW6A 2WTFA 2WW4A 4QZVB 4BC9A 2JXDA 4L76A 2MZQA 5GAEI 2QSFA 3JQJA 3CCES 2GVIA 1WD6A 4U8VA 1VQ6S 4UOFA 2DCUB 5EX3A 3W7BA 3DLHA 3GMGA 2POKA 4FS2A 2RQKA 1OMUA 1PYSB 2RJZA 1BWVA 3MCSA 8ATCB 2HFUA 4USTA 1RHUB 1YGYA 2JLGA 4IG0B 4M98A 2UUCF 3MQHA 3ZTOA 1K8AT 2V9KA 1Y00A 2Z2LA 4ED4A 4L73A 4ZOSA 2KFZA 4OJGA 2HVEA 2Z57B 4AXJA 4NLRA 3K0JA 4KFBB 4ETXA 2F4VF 2DXFA 4Y0FA 4B9NA 4JUZA 1HBMB 1IUJA 2DGTA 1VIXA 3PVXA 4DV2J 5KFRA 4C3LA 5KT4A 2BVZA 1VBXA 1NKCA 2XWXA 2F8EX 1Z2IA 1TAUA 2HG4A 1IBMF 3ZZUA 2W24A 1CJTA 2EXUA 2FZKB 1RAOA 1CHOI 1B64A 2AYEA 3MMBB 3OH1A 2PSZA 3H90A 4PPZA 4MFBA 4FVMA 2VPZB 1URRA 4RW9B 3QT8A 5L46A 3NLCA 4Q2MA 3BREA 3HMJG 5KT5A 2CWHA 3UCZP 3D66A 3NG8A 1SGYI 4MTPA 2CPFA 3HI9A 3I55S 4JI3F 4DV4J 4CLLA 2YQ0A 3DOLA 4H4KC 4AAWA 1HMVA 1MLAA 2KM8B 4UXJA 2YBVA 2E1MC 3NWGA 3DI6A 1SQEA 4Q0BB 1SVDA 1V3SA 2KVIA 2XQCA 3B8HA 1N6QB 1EQ0A 4MK8A 3QGGA 2NPFA 5GAHU 3CCUS 2CZVC 4LUBA 2O1PA 1NSQA 1N0VC 3AAWB 3VAHA 1NM2A 2X1GA 4DR2F 3J7Z5 4O4GA 4CTAA 3R5BA 1Z1ZA 2VDHA 4ES3A 1ULNA 2VODA 5DEMA 3VR1A 3OUYA 2GGPA 2FDNA 3JQYA 2HS3A 4YY3J 2D3O1 5DGAA 5G0RA 2NXUA 2HZVA 1PJ5A 4QIVA 2HNDA 3EZOA 1AZSA 1KEKA 2V34A 2WVEA 2ASDA 5A6PA 3HJVA 2R2RA 1R27B 2ZH2A 1Z90A 5I3UA 2CJQA 4WXOA 1U4BA 4DCPB 3AOBA 3DOKB 3FBEA 4K4XA 1SV5B 4Q5VA 5L6SA 2G0IA 3HHLA 1R3NA 2WZ1A 2XG8A 5D0EA 4CYUA 4ZK7M 1U5KA 1CJKA 3GCWP 3JSYA 1FRIA 4RO0A 1YI2S 4OYOA 3MEEB 2LUYA 3GZ7A 3KWDA 1Z2ZA 3KJFB 1N52B 3EH0A 3BYPA 4P10A 5AT1B 2J76E 4TYBA 3Q24A 3K5PA 4HT5A 1ZPWX 2ZE2A 3FEZA 4ZVEA 3IMQJ 1NPRA 3V81A 4KHRA 2H48B 1JNZB 4ZITA 1TUSA 2M0GB 5EWEA 5J1PA 1JJHA 3FMBA 3W2WA 4JOUA 4Q45A 1S0VA 2R7XA 1I94F 2ORVA 4USHA 2UXBJ 2XY5A 1WSVA 1T7PA 4CH1A 5E0OA 3VCDA 1UVLA 2JZ5A 4PEOA 3R5AA 4XK8C 3MPWA 4PWDB 5E41A 2AJ4A 3DLEA 3FWWA 1XN9A 4NCAA 3QRRA 3QBCA 3W9JA 1LR9A 1HA1A 3TZYA 4NXNJ 2P6AC 2IC7A 1CQNA 1YJVA 4UY85 4NLPA 2L48A 2HIQA 1RAAB 3H2VE 2DIPA 2KMQA 1HQ2A 3US5A 4OYWA 1WF0A 1HHSA 3UNYA 1AB8A 3BGFA 2QEXS 1S57A 3M8QA 4HGUA 2LQJA 2LEAA 3BSOA 3JSBA 2UVVA 5DLFA 1WEZA 3HLUA 5KT3A 2DO0A 3W5YA 4DV2F 5HP1A 1N5YA 2AYBA 1M5PC 1KONA 3MUVP 2ZOFA 5ETMA 1SC4B 2KTQA 4Q8EA 4M5MA 4BWMA 1BUSA 1HW8A 1BMOA 3IAS9 1T94A 1MWQA 5F3TA 3HSZA 3PJXA 4GRSA 2UU9F 1H0ZA 4C9DA 1XBWA 2FHJD 2J5AA 1OPZA 2MGZA 4OX9F 1S79A 3ZFVA 1YU6C 4AL5A 2KT3A 3J81j 3P49B 5K5MA 5B0AA 3VBPA 1XR7A 1FE4A 2NREA 2CQ2A 4DV4F 2HNYA 5ETQA 2EKYA 5F9LA 1R0CB 3MEDB 4NPOA 3BN4A 2P2CB 1PBAA 1QAYA 3TP2A 2L3MA 2AMCB 4DUTA 2CPEA 3OXFA 1FESA 1PILA 3UEJA 3HHDA 3IWLA 4FKYA 4X4NA 1S9EB 4FZVA 3W5ZA 2AP6A 1HBOB 4UW2A 4FS1A 1YJRA 4F7VA 5L1KA 1E6VA 3D9BA 1BQMA 3PJ9A 2WHOA 4F4XA 2MJUA 1KGTA 5CD4A 1TL3A 2OELA 5DETA 4KKOA 4DPYA 3IAM9 5A8KA 2Y1IA 2CPJA 4L72B 3ET6B 3KKFA 4LIRA 3M30A 2MDAA 1JQGA 3J7ZT 3OR1A 1IR2A 4LFAF 3E01A 1NDLA 1P9ZA 1G97A 1TMJA 4DPOA 2V0IA 4IRCA 2ICXA 4CI0B 5FD1A 1YJWS 3LP1A 2CWXA 1ZPVA 1RWOB 2YNIB 2BJ7A 2GGQA 3GV7B 4I2QA 1SC3B 2JF3A 1NUBA 1IY5A 2QYCA 4WFYA 2OPQA 8RUCA 2VFUA 2WLEA 3ZZZA 1T03B 4F2SA 2R2TA 4K4VA 5AFUU 4Z7CA 4QWBA 4UZCA 4H54A 4ZLLA 1WTJA 3Q89A 3QAHA 5KFTA 4AMLA 1WGCA 2VBXA 1YVFA 3M32A 4PRFA 5EUHA 4ICLB 2HHHJ 1QSYA 1YSJA 1KGQA 3C46A 4ECRA 2JC0A 4KIAA 2W7OA 1JXLA 1S4EA 2J9DA 2ZH7A 1TL7B 3MM7B 2GJFA 2QFIA 3QT5A 5B7WA 1EP4B 4M99A 1TOTA 3KXDA 3EWGA 3GR0A 2Z2YB 4DV1J 4KNXA 4J9KA 1UA0A 3DK5A 4LF6J 4KQZA 1MT1A 1VLYA 4WFXA 4M5IA 1Y11A 3KLVA 1B4SA 1VK3A 3M2VB 1RAJA 2FNFX 2BUSA 2Z2MA 4WBFA 2P6TA 1C0TB 3TO8A 4NXNF 2DR7A 4BHQA 4MKAA 1ACMB 2JDJA 5F0WA 1QLNA 2JRSA 1Q7LB 3OH0A 1RT7A 1YDLA 3MM9B 4N41A 2OFGX 1TAQA 3CJ2A 4UY8T 2ORWA 4YEAA 2I5JB 1YRXA 3HJFA 1Y9OA 2C2MB 4QBUA 1HNZF 4HKQA 2LQBA 1OY9A 4F04B 4DCJB 2WBRA 4NX9A 2B4UA 3B4MA 3SEOA 1KRRA 2V8PA 4YR3A 2GVZA 3DYAB 1MROA 4GKJJ 5DJBA 2HKEA 1ZAVA 2KFNA 3GTYX 2OPPA 3BR8A 1X4CA 4IH7A 6AT1B 5DDOC 2M8DB 2IBOA 3QWUA 3HHKA 3V4IB 3LF0A 3BBFA 2J8AA 2QQDA 3KLFA 4R8UA 4OIXA 4F0HA 3IN5A 3T5JA 1TK8A 7WGAA 3TX8A 4ZCIA 2KT5A 4C48A 3DRRA 2YVSA 4B6DA 5KFXA 3MWBA 3HO1A 2IM0A 4BLGA 1SJFA 4IHFA 2HMIB 2W8KA 5KT6A 1KRVA 3HVTB 1RWUA 2ERRA 2W9AA 2OLWA 2NXNA 2ZHOA 4N6AA 2CWFA 5CHCB 1HWJA 3OVSA 2BKOA 3FC9A 3OXLA 2ZH8A 5HBMB 1RHQB 3I96A 4CCHA 3SZ2A 1Y3KA 3MMAA 4DQIA 2EK6A 3UVJA 3DRPA 3BSNA 1TL1A 1W7WA 2CXEA 1RT2A 2R7VA 2VG6A 1RBLA 5E3QA 3KMSA 2NZ4A 4CO5A 4ZIWA 2H1YA 2XMKA 4DR1F 3AODA 1K7VA 4U9RA 3K58A 3PIPQ 4NLWA 4JCVE 2MQOA 1J2VA 4X4QA 3MXHP 5HROB 2QG9B 1QREA 2LECA 1DRZA 4TN2A 1LQ9A 2UXCF 1DARA 4CM0A 2LXFA 3FOQA 2FB0A 1YLXA 3QZ7A 1NDCA 1NJXA 4I6AA 3C3LA 2BE2A 3F1XA 2IVYA 4R5PA 3I0SA 1I6JA 1HIYA 3I32A 2BOAA 4JV5F 2BW7A 4IHHA 1EJ7L 2BDPA 2ALZA 3A8KA 4K4ZA 4Y65A 4UZBA 2FVCA 1Z4UA 1BGXT 4NOHA 4JI2J 3ZTRA 1RABB 1T9UA 2AEMA 1X9WA 2AF6A 1ZM4A 1SGNI 3OL6A 4YS2A 1KNZA 2FVSA 4LF2A 3R3TA 5HAOA 3MCMA 4WU3A 7FDRA 2BE9B 1MJ9A 2UUAJ 2MZSA 2FVQA 3GSIA 4E75A 1TELA 3FNNA 3BJYA 1L3TA 3AJDA 2D3UA 1RTJA 3PEHA 3HSJA 1YQHA 3Q8UA 2LCWA 5ADXU 4MKYA 1ZBTA 1FRHA 1KFDA 2PA8D 5HJYA 1RT1A 3UW1A 4OV6A 2BJ1A 1KQAA 3SUCA 1S59A 1LXJA 1JLFA 3W8GA 2JFKA 5DQHA 2N3LA 1YHQS 2C2ZB 3KLHA 1NJWA 2XC9A 2QL5B 4LF8J 3GILA 4P73A 1WKXA 2A10A 3R1WA 4ED2A 2RC4A 4YHHJ 4RU2A 1CJTB 4FYVB 2VOPA 4MFBB 1CC7A 1PIEA 2OFHX 1D9DA 4N77A 3NBPA 5H9EK 4NLUA 3PXGa 3KK1A 3BPDA 1DFDA 2HFVA 1C4CA 1VQYA 3NP5A 2RDJA 1UZDA 3DOLB 1I3OB 3ZZOA 1HMVB 3RR7A 3CDBA 3FBFA 1FEEA 2N3OA 3M8WA 3IM9A 3DI6B 3CPWR 1N36J 4GKJF 5DG8A 4XO0A 2RE1A 3G96A 2XHCA 4KTQA 3PW4A 1RLCL 2LB7A 3TR5A 5GMKa 4J09A 3F0NA 2OD1A 3VDUA 1P27B 4O4GB 1P9YA 1QUPA 4CTAB 4DSLA 5GAGI 3H25A 2RU9A 2V53A 2HQDA 3VF0B 3OUYB 1EHWA 2YY3A 4WWSA 5G0RB 5BYQA 1AZSB 1KBRA 4UXHA 5CCMA 5I3UB 1R7IA 2R7WA 2DVIA 2A2CA 5DEPA 3EVMA 4B9SA 3FTTA 4WP4A 3HHLB 4HZCA 2ZH9A 4CYUB 2E5IA 2AU0A 5DZ6A 2MQQA 3KJNB 1CJKB 2FGOA 4R37A 5IC4B 2A18A 2MTLA 3ILIA 3ST8A 1U45A 2F8MA 2N52A 3H0PA 5AJ3F 5LSOA 1JJ4A 2D1CA 4O0IA 2CQ3A 4O3QA 2EC2A 3FQKA 2V0NA 2ZE2B 5HL7Q 2J7WA 1FKOA 3I3AA 4G3QA 1GAOA 3RBEA 4Y34A 3MDFA
chains in the Genus database with same CATH topology
3W2WB 1KHVA 3CCZA 3IG1B 4YDDB 3I9V9 1TDTA 4MIWA 2B9YA 3N5BA 4QYRA 1S0NA 5THWA 3CWJA 3MR6A 2ADBA 1XR5A 3R0SA 1JLEA 1TR0A 3UFCX 2PD1A 1VQMS 1PC4A 4XDDA 1R8AA 4NLYA 2UXBF 2ASLA 1FD2A 1ZAXA 1ZTTA 3THPA 3M9OB 3AA9A 2UUBF 2KXNB 3RRGA 3ENWA 1T02A 4R36A 3JAMY 1LWCB 4DL7A 3T1AA 2LYVA 1XTZA 1Y3JA 3I4HX 4ALZA 3ETOA 2FTRA 3G8TA 1DTQB 4ECWA 4PWDA 3OHBA 1XMQF 1N4LA 3SI8A 3M2RA 4OL8A 3H4DA 3SDEA 1L3KA 4ATNA 2IM2A 1H38A 1H7XA 3IR7B 2HLUA 3ECTA 3OFHA 1U24A 5AXMA 3E2EA 2XCAA 3DLEB 3LPYA 3AJ1A 1FERA 3Q8PB 2JJ4D 2WLCA 4IQXA 4JI2F 1JB0C 4DF8A 2FLLA 4UUWA 2L41A 5JVHQ 1IR0A 2MHNA 4URGA 3CC2S 1VI7A 5H1SV 2OI5A 1VQ9S 1OWXA 5KFMA 2CQ1A 5KFFA 2RRNA 4AE5A 5DQGA 3UI3A 3GOSA 5F8MA 5KFOA 1X4FA 2IYIA 2NSCA 2VB6A 1GTHA 3UCGA 2ZHBA 2FHKA 4A8KA 5AXKA 1HL6A 1KRUA 1UP1A 4DV0F 2UUAF 1KK5A 4KV8A 5M2RA 2DNKA 4PXCA 1DTTB 5T7LA 4RBVA 3AA8A 2WONB 3OFEA 4O4RA 3NL0A 4KGKA 2MSTA 1TKZA 2HFOA 4X84A 5DM7Q 4URSA 1IN0A 1Q79A 1THJA 3N6NA 4I64A 2D9OA 2VG7B 4D3GA 1SUQB 2CG4A 4N5SA 4WXWA 2DNGA 1SIZA 1Q86T 2XS5A 1B0PA 2C3UA 4YOEA 5K8OA 4HLBA 3G6ES 3VQSA 3EXCX 4ZHRA 1P1TA 4FBUA 1Y0HA 2DD8S 1J2ZA 3LUYA 1FNOA 3CF5Q 2HQ3A 3KHGA 3VAMA 1MMLA 3SV3A 1TP7A 3VAJA 4U7CA 3M8QB 2QO3A 3L95X 1WF2A 2DH8A 3PM9A 1MR7A 2X1AA 4PQUA 2B7CB 4C2MA 5HO4A 4LFCF 2FJDB 1SH3A 2IC3A 4AL7A 3G6VA 1FF2A 4N69A 4EBCA 3K7RA 5AE3A 3RB4A 4G3PA 1S6QB 2NUHA 3GR1A 4NRUA 1SKWA 1QRLA 1VQ4S 1SJRA 4GO7X 3K57A 3K5OA 3M2UA 5FJ4A 1N34F 1FJ7A 3MOZA 3OTOF 5F0UA 1VQSA 1YG0A 4YP3A 5HP1B 2E7WA 1N5YB 2W4DA 4H4OB 3BGLA 1R8BA 3MM5A 4CO3A 2ZH4A 1U1MA 2BABA 4KC5A 3M8RA 4F4WA 5KFPA 4DL5A 4LF8F 2KZMA 1SBRA 5KG3A 3EZ5A 4O3RA 4F50A 4WZMA 1TVRB 1O8BA 3VTIA 2C2EA 1SL1A 2HHXA 4DQPA 4WFBQ 4OI3A 1MRLA 2D74B 2RB7A 4A4JA 1NZAA 4EGLA 2YKAA 2L9NA 3BDEA 4YHHF 2ZH3A 4A8XA 1XMBA 5K9FA 2OEFA 5B0EA 4C97A 3T6BA 4Y2KA 3DMJB 3RRKA 5I3PA 5E3PA 4YFUA 3WZ0A 5CZVA 3VAFA 3OL9A 2PT0A 2VBZA 2VONA 1R0AA 4XPCA 1VK8A 4I2PB 4RW6B 3RB3A 1F60B 2FHJA 4TU8A 2DO4A 1BC6A 1H2UX 3BSAA 3KOAA 2KO1A 3C6TB 4B9LA 5HLFB 4YR0A 1NKBA 3VZIA 1GX6A 4E79A 2FC9A 2MGZB 3I5CA 2AYMA 2GIRA 3DRYA 3IS9A 2E9RX 1VRUA 1DQAA 2QIFA 3CDWA 3B82A 5L8RC 4E98A 4NL5A 2YTCA 3RU0A 3S1TA 2YWKA 4J9LA 1T3NA 2YNHA 5KOWA 2DNHA 3LANA 2MB0B 1RKJA 5LL6d 1MR9A 4ECVA 2HWTA 1SL2A 2QE5A 4LIWA 2GW8A 2HNYB 1M5OC 2OTLS 2YWFA 2BW2A 3MEDA 3KG1A 4C8OA 4N56A 3U02A 2LDIA 3KLEA 4WK1A 3SSRA 3T9ZA 2KH9A 4OQJA 4FXDA 3OTEA 3QGHA 4WF9Q 2K8GA 1C0UA 3F73A 5J1NA 1N56A 4EUVA 2J6TA 2KXFA 2RT3A 3CIMA 1T95A 2VC0A 3IR5B 4CO1A 4J9OA 3QYYA 1VC6A 4C8LA 4DR6F 2C3PA 1N36F 3FDSA 5EX0A 4R7PA 4Z2XA 4G1PA 3OSNA 3GIKA 1S9EA 1TK5A 2GX8A 4TXSA 1VBYA 2WLDA 1PO6A 3J7YI 3MOJB 3T5HA 3C6UA 4IDKA 4JI4F 1SJ4P 3N6LA 5GVQA 4HVZA 5F8NA 2X1BA 4E0DA 2ROEA 1SXLA 2WK4A 5D8HB 4LJMA 2QZ8A 2XULA 1LW2A 1HBOA 2J7UA 5A0YA 1L3SA 2O3DA 3MEGA 4Z37A 5J2PB 2E1CA 2ZBIA 4NMLA 3Q23A 4DX8H 2ROPA 5CQGA 1T05B 3U1LA 1HYSA 5KFLA 2V0JA 5KG1A 2HVHA 4JI7F 4G3SA 4RBTA 1NK5A 4OJ3A 2ZH1A 3DDNA 2V5HG 4RNFA 5KG4A 3CJKB 2KJWA 3TDTA 1E6VB 2JEJA 4OLPA 1SJ1A 3QGPA 2IMWP 3PRDA 5D4LA 1DZ5A 2CQ4A 2NUUG 1H98A 5CYJA 3CSKA 5GAHI 2P5VA 4F3MA 3OLBA 3QMQA 1D9FA 4FNIA 1DQ8A 2EFGA 4IR1A 1N88A 1TL3B 2DHSA 3DM2B 2MKSA 1F9FA 5G4DA 4G3IA 4KR0B 1MWZA 4KKOB 1QTMA 2ZH5A 1X9MA 3LH2S 3H5UA 1HV9A 1S97A 2I0XA 1S1VA 3M8PA 5A8KB 1CPZA 5BYRA 1P6TA 3AJ2A 1XNQF 2RUGA 4DSJA 5L1IA 3M30B 3E3XA 4B9MA 3H59A 1U1KA 2JX2A 3OR1B 3Q2SC 2IRXA 2ZZNA 3E01B 4O3NA 3G8SA 1FKAF 1V6HA 4JI5F 3K59A 5J2MB 2WOMB 3IGNA 3LP0B 1C1CB 2GMJA 4BDPA 3IXCA 5HMXA 4IO9Q 3MFHA 1S1WA 1WG5A 5EGYA 3JB9k 4OLOA 2W0VA 4DR4F 1X5PA 5KG5A 3BFPA 1FRMA 4E6UA 2FIUA 2PIIA 3LP1B 4IKAA 2XZWA 2ZBCA 5FIIA 1LOUA 1DAXA 2D3OR 2U1AA 3D1QA 1B7FA 5E3AA 5KG2A 1QE1A 4I2QB 4DLGA 3NCPA 3X1LB 2RDIA 4ILLA 2PMHA 3MM8A 2EG1A 2HGNA 5J2NB 3QIPA 2DGOA 3W2VA 1NJZA 2Z4PA 1L3UA 2AGPA 2UVRA 4ED8A 2MQNA 1V9OA 3E51A 4K5RA 4ED7A 2FJXA 2OPQB 2J6SA 4C11B 4RNNA 3DLGB 1RT6B 2E9TA 3P1BA 2RRAA 4CO4A 5IM0B 4H4KA 1JK9B 2B5JB 1T03A 2VBYA 3GIIA 1RT4B 3PX0A 1FRLA 3M6VA 3MM6B 5DG3A 3PHEA