3FSXA

Structure of tetrahydrodipicolinate n-succinyltransferase (rv1201c; dapd) from mycobacterium tuberculosis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
307
structure length
300
Chain Sequence
VTGAAGIGLATLAADGSVLDTWFPAPELTESGTSATSRLAVSDVPVELAALIGRDDDRRTETIAVRTVIGSLDDVAADPYDAYLRLHLLSHRLVAPHGLNAGGLFGVLTNVVWTNHGPCAIDGFEAVRARLRRRGPVTVYGVDKFPRMVDYVVPTGVRIADADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEGRISAGVVVGDGSDVGGGASIMGTVISIGKRCLLGANSGLGISLGDDCVVEAGLYVTAGTRVTMPDSNSVKARELSGSSNLLFRRNSVSGAVEVLARDGQGIAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tetrahydrodipicolinate N-succinyltransferase
publication title The three-dimensional Structure of a mycobacterial DapD provides insights into DapD diversity and reveals unexpected particulars about the enzymatic mechanism.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 93
structure length 300
sequence length 307
chains with identical sequence B, C, D, E
ec nomenclature ec 2.3.1.117: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase.
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
A PF14789 THDPS_M Tetrahydrodipicolinate N-succinyltransferase middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3fsxA03
3.30.60.70 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Trimeric LpxA-like enzymes 3fsxA02
3.30.70.2010 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3fsxA01
2OEFA 2QKXA 1HM8A 4N6BA 4M2BA 4N27A 3FS8A 3ST8A 2WLGA 1KRUA 3I3XA 1QRGA 3SPTA 3FSXA 3EH0A 4MYOA 1KGQA 3TWDA 4KPXA 3R8YA 3PMOA 3HJJA 1MR7A 3BFPA 3KWEA 3D8VA 1J2ZA 4K6RA 3OU9A 4E6TA 3VBIA 2WLCA 2OEGA 4HCQA 4DCLA 1SSTA 3FSCA 5ADXU 5E3PA 4E6UA 4KQLA 1XATA 3D98A 4AA7A 1HV9A 3GUEA 5U2KA 4MZUA 2IU8A 3R5BA 2IU9A 5L6VA 2QIAA 3R5CA 3R5DA 3VBLA 4HUSA 4M9CA 1QREA 2V0JA 4IHHA 1KK5A 3Q1XA 3SRTA 3VBPA 3FTTA 2JF2A 2VD4A 3TDTA 1SSQA 2QIVX 1HM9A 5DEMA 4ISXA 3TIOA 4E79A 3OUPA 4E1KA 1QRMA 4IHFA 3FOQA 3P47A 2P2OA 3R5AA 3DJ4A 2FKOA 2I5KA 4R7PA 2Q4JA 3EG4A 4M98A 3TK8A 3C8VA 4EQYA 1S80A 3MQGA 3VNPA 1LXAA 5DEPA 1G97A 5AFUV 3GOSA 2NPOA 3VBMA 3BSWA 2W0WA 3MC4A 3FSBA 3IGJA 1MRLA 4KNXA 4M2AA 1MR9A 4HZDA 4AAWA 2XATA 3F1XA 3FWWA 4EA7A 3GVDA 1KK6A 3NZ2A 1KGTA 1TDTA 4G3PA 1THJA 5L6SA 1SSMA 3BSSA 3IXCA 1KRRA 3P1BA 1G95A 4G87A 3KWCA 4HURA 1KRVA 4E75A 2ICXA 1YP4A 3OTMA 3VBJA 5E3QA 2AQ9A 4IHGA 3I3AA 1KHRA 4J09A 4KPZA 5F42A 1YP3A 3BRKX 1FXJA 3BXYA 3R3RA 2W0VA 5ADXV 4AC3A 5AFUU 1HM0A 4G3SA 2V0KA 1V67A 2VHEA 1YP2A 2OI7A 3R2WA 1V3WA 1OCXA 2TDTA 3DK5A 1T3DA 2RIJA 4KNRA 5DG3A 3R3IA 4G3QA 1XHDA 4J18A 2OI6A 2JF3A 4N6AA 4EA9A 2WLFA 3VBKA 4M99A 3BSYA 2WLEA 4FCEA 1QRLA 5E3RA 3MQHA 4M28A 3ECTA 3CJ8A 3V4EA 2OI5A 3VBNA 3TISA 3JQYA 1Z90A 3OTZA 1FWYA 2GGQA 4N69A 4EGGA 1QRFA 3TV0A 2GGOA 3FSYA 1KQAA 3R0SA 4EABA 4MFGA 2IC7A 2V0IA 3KWDA 4R37A 1QQ0A 4HZCA 4R36A 4EA8A 2IUAA 3T57A 4EAAA 3OW5A 3R1WA 2V0HA 3DHOA 2V0LA 3EEVA 3HSQA 2WLDA 1KK4A 4H7OA 2ICYA
chains in the Genus database with same CATH superfamily
5D4LA 4N7TA 4ZJOA 4B3RJ 1RWUA 4C3LA 1HNWJ 4OV1A 3R1LA 2VC0A 4KFBA 4U95A 2QN6B 3EGNA 4JV5J 4RW7B 1JLGB 2UUAJ 2E7VA 4O44B 3X1LB 2ALYB 3VZHA 3HHLA 1XN9A 2ZFHA 4DLEA 5HLFA 2HMIB 2DGXA 3RAMA 5BYQA 5J2MB 4WPAA 2UXCJ 4I7FB 1JLAA 2FKOA 1YGYA 1JXLA 3KOAA 4CIOA 4DR2F 1X0FA 3FSBA 2FIUA 2VG7A 4L72B 1SB6A 2V2QA 4Y65A 2J6SA 1WEYA 3HJFA 1TL3B 1KN6A 2E29A 3DGVA 1QAIA 2XULA 1JNRB 4QBUA 5F8JA 3TJQA 5HSPA 4ZVQB 3ZZPA 4WCEQ 3V5RA 5F9LA 3PR4A 2EFPA 3D4JA 4OX7A 4J9OA 4DFPA 2CNKB 3MD1A 2IC7A 5F3TA 2XBPA 1D8ZA 3BO2A 4YFUA 1QRGA 3Q8YA 4I0WA 4HL9A 5HK4A 5KFRA 1JLEB 4XPCA 5HQLA 3HVAA 1AA1B 3KK2A 3SUCA 1HHTP 1CEZA 3CT9A 3OVAA 2IU8A 3NXZA 4DL4A 4FS1A 3DOLB 3SSRA 2X1BA 4MKYA 4O4RA 1QD1A 1WHYA 2FJEB 2Z2YB 3R5AA 2ZBQA 3H2LA 5D4PA 4K4WA 2MZRA 2MQQA 2FLNA 3HH2C 2DHHA 1NSAA 1THJA 3FCWA 2C2NA 1NMEB 3F0NA 3HZEA 2J76E 4A8XA 4YDDB 3HZGA 1MMLA 5LMUF 1S76D 1P9GA 3A1YG 1VR6A 2CPEA 2ATLA 3N4WA 1U09A 3SGBI 4DFJA 2GGOA 2QPOA 1S6UA 3UDCA 2HHHJ 1HBOB 1FKOA 2X51A 2CJAA 2VBZA 1WORA 4RLEA 2VASA 1QSSA 2F3CI 4M5DA 3LWMA 4Q8EA 4PYAA 4DU7A 1S4EA 1UVKA 5HP1B 1S0NA 1IM6A 5AE2A 3LP0B 2BOAA 1XNRF 2YX4A 2XMVA 3MR6A 3M2VB 3GJSB 1GMWD 1Q4RA 5F8NA 1ZAWA 2VH7A 4QPTA 2CQPA 2ZJRQ 1N0VC 1GEHA 4DV2J 1PJUA 5FDLA 4A48A 4CLKA 3PKYA 1JB0C 2R42A 2V67A 1RWPB 2MKCA 2D1CA 4E1RA 2U2FA 2K1RB 2NXCA 1FJGF 1AZSB 1UZHA 4LFBF 3DOMB 4E75A 2M3DA 2MLXA 3MPWA 3PV8A 4ED8A 2VB6A 2DD8S 1ULNA 4DCJB 1HEVA 4O4GA 5GMDA 2AYMA 2ZOGA 2Q66A 2EFNA 1QRLA 3TO9A 2XGPA 2F65A 2HNZA 2N4DA 2HSEB 3KUEA 1HQ2A 2RF2A 2JZMA 5A0YB 3J7YU 2M88A 1WDDA 1JLFA 4YY3F 3OW5A 3SEOA 4M5KA 1RCXB 2DT9A 2NU3I 1VRUA 3M30B 2VFVA 4F36A 3UVJA 2BE2B 2WLGA 4G1IA 4RW6A 2CNNB 2KVQE 5L9NA 2P9EA 3FMWA 1M5HA 2EFQA 4Y2AA 2IJFA 3ZZ0A 2PA8D 1N33J 2IU9A 4UY8T 2FLLA 1SV5B 4TQRA 1HR0J 2LDIA 3AODA 4LRDA 1URNA 1YHQS 3PW0A 1YVFA 2FJAB 2FC9A 1WG5A 1CT4I 1X74A 3OLBA 1D0EA 2XYHB 4KFBB 1UVGA 2H54B 1YJ9S 2LU1A 1H98A 3D2WA 1G6BA 4DR4J 3N6NA 1OYEA 2B51A 3HHLB 3UCUP 2L41A 4HR2A 5HLFB 5B0AA 3MAAB 3M8RA 1JLAB 2BQRA 3MEDA 4XDCA 1SJ4P 2GGQA 1Q8BA 2B0GA 2OP5A 3D9BA 2YNIB 4C4WA 2E66A 3M6XA 1ULRA 2VG7B 4DPUA 3CJQA 3HXMA 3W64A 4ZMMA 3DDKA 3J7A1 4K2XA 3MOZA 4UTGA 3LW5C 4F4KA 2Y3YA 3GUEA 4KKOA 2F5GA 4DV7F 3TUJC 4EBDA 2GJFA 5DEMA 2WVDA 2BV3A 2H3EB 3IBFB 1NHVA 3PHTA 2BE9B 4P2SA 2B4OA 2ZBCA 1VRTA 2KT5A 3QLHB 2Y8WA 4ZCKA 2MKSA 3KK2B 1F60B 5KFXA 5JUMA 2M0GB 3H8YA 1EETB 1HNXF 1KQGB 2BJ1A 4KPZA 2KMQA 2R8KA 3NY0A 2CRLA 4FKYA 1SIWB 2AX0A 3DCAA 2DNYA 2WVCA 3DYAA 1GXLA 1WKLA 1X7VA 5KOWA 1RAOA 3FNNA 4XDDA 1QRFA 1HWIA 4QPXA 3WDOA 2YKNA 2XO7A 4J90A 2JVOA 3M05A 1VQKS 4MIWA 1ZZFA 2M9KA 2OMOA 3JQJA 3PIPQ 1SJ1A 1TUVA 5IM0A 1RI7A 4KBIA 4LF4F 3C16A 4CO1A 2X1FA 4D3HA 1RFHA 3FJ2A 2BRKA 5I3PA 4UQTA 1SSQA 2QIVX 1SC6A 4C48A 2J87A 2C22A 4Q8FA 3F41A 1FKOB 2DYAA 1VC0A 4C98A 3SSQA 2D3OR 4WP9A 4M5DB 1FDBA 3Q8RB 1VBKA 1SKUB 4YHHF 1BC6A 2R8IA 2HZCA 2YKQA 3BH7B 4TXSA 5JJBA 1EAYC 5H9FK 1P8GA 2QLFB 2KL8A 4ZVEA 2HVDA 3GIJA 2BOPA 4IG3A 2QL5B 2MZSA 5IT9Y 5F41A 4U9RA 4J9UE 3C14A 3UD5A 4LMZA 2D9OA 3H40A 3EXYA 3QQCD 1KS2A 4CO2A 2QKXA 1W7WA 2RSQA 2DB1A 1DURA 1O8BA 1YX2A 3BDPA 5L1JA 4O4GB 3DFEA 1XATA 3LPEA 5DJBA 2WHOA 2P6AC 2HNZB 5DGAA 2RF2B 3NS7B 3OL0A 4ZA1A 4W4MA 2QFIA 2A18A 1JLFB 2XY5A 2PO4A 4LF2A 1LFWA 2IC3A 2MQMA 1VRUB 1K9MT 3KDOA 1NKBA 1VQ4S 3GQ7A 1Z7KB 1BQNA 4RW6B 3GFZA 4NOHA 1J5EF 3BQ1A 1SGYI 3D68A 3KJQB 4FYXB 1URRA 2MSTA 1RT2B 3OVOA 4DV6F 2H65B 1F2HA 2V8VA 1I1GA 1V3WA 1C0UA 2RQ4A 4ANDA 3OQ2A 2KXNB 4XPEA 3UCZP 2X3TA 2BJ3A 4M99A 4OJGA 1NCLA 1KONA 1UJ6A 1LXJA 1QSLA 2XZWA 2HHPA 3DLKA 1MWQA 2CQBA 4DCPB 2OO4A 5E41A 5GMKa 2G0JA 4ZN3A 2N7YA 2H48B 2DNQA 4ZP8A 1WOSA 3DI6A 1WHXA 1G1XA 1LW2A 3WHIA 4K4YA 4DS5A 1WOOA 5ETSA 2YVSA 3IO1A 5DQHA 3W9JA 1CLFA 1FE4A 1TBQR 1Q5VA 3CO0P 5DETA 2Z2MA 2O67A 3D6MB 1U1PA 2YKMA 4I69A 2WVJA 4KH1B 3VGVA 4J9RA 1P1LA 3HT3A 4HYKA 1V1HA 4Q2LA 1Y3KA 3RBZA 3T19A 4GKJF 2ZH5A 4KKOB 5D3GA 1FJEB 3F73A 2HZVA 1BUXA 4F3OA 1HM0A 1JX4A 2XI3A 2D74B 1ITPA 1YKWA 3R3TA 5AT1B 3IN5A 3G6VA 2W4PA 1HBUA 3NOCA 3KUGA 1NAQA 3MUMP 2NU1I 3BH6B 3KWDA 3IG1A 5M2UA 3A8EA 1H74A 2J7UA 1FFSB 5HATA 4X84A 2R7XA 3ST8A 2WGCA 3PDNA 1FRXA 2H5JB 5CYMB 4HACA 2FNFX 2M52A 3QIDA 3BFPA 1TAQA 3VAMA 4NLWA 2OGUA 2XZDB 2EC0A 2QIAA 2YNHA 1QTNB 2AGOA 2V50A 1TFYA 4OI3A 3GR1A 4UZBA 2KZZA 2YKNB 3R27A 2GCFA 4AUKA 2OTJS 2CQGA 3Q0AA 3MPVA 3CF5Q 1M1GA 1SKRA 3W7BA 4PXBA 5IM0B 2C3YA 4AL6A 2AMCB 3C16B 2R2TA 3EGZA 2JEGA 2GMJA 4AYBD 3CSKA 1IBLF 2CAJA 4DUZJ 4NE9C 1REGX 2PN6A 4N77A 1YDLA 3C8YA 4J9NA 1WI8A 1U6BA 2ZC4A 4OI4A 1T03A 3FFIB 3T57A 3L7UA 2DRBA 3I0RA 5I42B 2HHSA 3DC2A 2EXUA 3KMQA 1F6TA 3HHLD 3D54A 3DRRA 1OYDA 1HMVA 2AT1B 4A8YA 4NLGA 4IG3B 2BABA 2DHXA 2V63A 4CLFA 2XLJA 2DR9A 1FKPA 2JOQA 2NCKL 2KHDA 4DQPA 1T94A 3I9V9 2DNMA 3C14B 3OLAA 2R8JA 2F8EX 2KU7A 2XATA 4B9NA 2Y0BB 1KK6A 1MU2A 5JVGQ 4OHXA 4IKAA 5LMUJ 4F0MA 2ABYA 2EKYA 4B3OA 4ZVRB 1IWGA 4WFXA 5J1NA 3CMES 4X4TA 3EGWB 5CD4A 3IR7B 5KAKA 2OI6A 2JF3A 3GYGA 3TUIC 1F2GA 1T3NA 2BUSA 4M28A 2IC3B 5C25A 2GAHC 3QWPA 1RYRA 4EABA 4BC9A 1BQNB 4DL7A 2A20A 2DISA 1OMTA 2ICYA 1RWOB 2I9SA 1TMMA 4NASA 4OX9J 4DX6A 3MMBA 4CTAA 2DNOA 4ECUA 3KLIA 1D9AA 2BVZA 4HCQA 5C5JA 1HWLA 5KFLA 1S9FA 3DU6A 1NDKA 2KXFA 1XNRJ 1WKKA 2VG6A 1U2CA 1NPRA 3QO9A 1NKCA 1CJVB 1M0SA 3OFGA 2V8DA 1YG0A 2BKPA 4ES1A 3SCLE 4NLTA 4AMLA 3DXSX 1A9NB 4O3PA 3W63A 3OL9A 3MQGA 4WFNQ 4JI7F 5KT6A 2E1CA 3JYTA 2WB1D 1AROP 1RLCL 3DI6B 4O3RA 1LW2B 1J5OA 2D69A 2RU3A 2AZ3A 3H25A 3M1VA 3M7VA 3I3AA 1KEKA 2CFXA 4P2FA 1PYOB 2LFVA 2LXIA 1JWWA 1X4SA 1FX2A 3PYFA 2YKMB 4ER8A 1CG2A 3IRXA 5GAHU 3PW4A 1HWUA 3T1HF 2Z0GA 2DGTA 1X5TA 2OFGX 5GAGU 2KM8B 2YH1A 4R25A 3EH0A 5D3GB 4Z7YA 4RNMA 3TYTA 3G4SS 4S0MA 1SSTA 5CHCB 5CZVA 2H1YA 3MMCA 4ZPDA 1QVGR 3NBPA 5J8CA 1HBUB 2CPZA 4IFYA 4Z7CA 2AEFA 1WG4A 1WNEA 2PIIA 3IG1B 3I31A 3K8VA 4E79A 1FDDA 1VQ5S 2ENZA 3DDIA 2M70A 3DRXA 1Q8IA 2UZAA 1Y00A 1AFJA 4HACB 3QJLA 1QJHA 2KT3A 4HI2A 3Q2TC 1Q82T 4KAIA 4DV4J 4DBQA 2OPSA 4EK2A 2XYPB 1H73A 4WXWA 3PIOQ 8RUCA 2YNHB 5CA5A 3G8TA 1SKSA 2UUCF 3GE9A 4RW4A 4QIWD 4O3SA 1RAJA 2VFRA 3W5YA 4UUWA 2OI5A 1YWXA 2V8GA 1S49A 4G1QA 2F1FA 5KFDA 2WVEA 1BHNA 1D09B 3BSNA 1FK9B 2V4QA 1HNVA 3OSNA 1IY5A 4A47A 5CCMA 1S20A 2VPYB 1M5VC 4PQUA 3D67A 4CLLA 4J9QA 3CCQS 2VJVA 4DPXA 3R8YA 3EDQB 2F3JA 2Z2ZA 3OU9A 2OUGA 2HKEA 4DV7J 4DR6J 1RAGB 3G82B 3W62A 1CGJI 2MKKA 3JSMA 1TK0A 1I51B 5CYQB 4UOGA 3LANA 3VDPA 2ZZTA 2B43A 1T03B 2J7WA 3PG9A 3MPUB 3ILOA 1L3KA 4RW9B 2XNRA 3I0RB 1S97A 3I56S 4A8SA 1YJRA 5IOLA 4ZJQA 1WEZA 5K14A 5DLGA 4DSLA 2VKRA 3QNWB 1IJEB 1T9YA 4KHMA 2W7PA 3DRRB 3GVDA 3SQGA 2Z4PA 5L6SA 1HNXJ 1CSJA 1RHMB 2YQ3A 5KFEA 1KRRA 1G95A 4YQWA 4DSEA 4ZIVA 3KWCA 1HMVB 4FPIA 1IR0A 1PYTA 1YP3A 3MECA 2M5YA 1FXJA 4A8KA 2W0VA 3V6DA 4C8ZA 2KCXA 1YITS 3G6ES 2B9WA 1FKPB 2PI5A 2CQIA 2HQIA 3RAQA 3GG1A 4M5NA 1H2UX 1WC3A 3FQKA 5AE3A 3AOCA 2XRCA 1KBFA 4P75A 2XCAA 1VRQC 4OHWA 1FNMA 3HSQA 1KOOA 1RTDA 1MU2B 4ZLNA 4PRFA 2EKNA 2CWFA 4LF6F 3SPTA 3G86A 4B3OB 3K5MA 1Q78A 4Q5VA 2XWYA 5KG2A 3ZZTA 3D98A 2AJ2A 3VE5A 3BQ2A 1VK3A 4HUSA 1SH3A 4I68A 4CH0S 3OTOF 6AT1B 1TKTA 3ZFVA 5C25B 1FD8A 3OXFA 4I64A 2W9CA 3SGQI 1WI6A 1MN9A 1Y5LB 2Q4JA 2ZHAA 1DQ9A 1OMUA 4EZ9A 2ZH2A 4DUTA 4HT7A 3MMBB 2DNHA 4CTAB 4YHHJ 4ECTA 4DPTA 3KLIB 3GJTB 3PFOA 3HD2A 1PJ7A 5E3QA 1PCAA 7WGAA 5D78A 1L3SA 3DLJA 3BREA 4Q44A 2W8LA 4F7VA 3QT7A 1WC0A 4LUBA 4Y28C 3T5JA 3POTA 1EX8A 1TMJA 4B6DA 3ECTA 2CJBA 3CC7S 2MXYA 4HZCA 1FT8A 5ETQA 4DNCA 1L0SA 3JYTB 1HQUA 3EEVA 2QLBB 5C24A 1J5OB 4JUZA 2OEFA 3H7HB 3CB4A 2KYXA 3WC2A 1MT1A 4OYBA 2JZ5A 2EFVA 4TY9A 3M1VB 3PXGa 1J2ZA 3GZ7A 3OTDA 2W2PP 1YTYA 1XMQF 5DG7A 2HS3A 3I87A 3RRHA 4B9SA 5GVQA 1UW9A 4KHRA 4LFAF 3UCGA 2AU0A 3AD9C 1OWXA 1EP4A 1L3UA 1SH2A 3U7JA 1KVJA 4OYMA 5HAOA 4E8UA 4J37A 1EKSA 2HGNA 3R97A 2DIUA 4FF1A 3OR1A 3UR3C 3BSWA 2UXDF 2BJEA 4DQIA 4QU7A 3PX0A 1RHQB 5AE1A 4A46A 4CT8A 4DV6J 3VAFA 1Q95G 1FHTA 2IMWP 3RR7A 1JLCB 1S0OA 3MMCB 3TW0A 2XC9A 2B6AA 1TL1A 3NBPB 1CGII 1XA6A 4QWAA 5AFUU 5FUYA 1VQ6S 4IFYB 1SIZA 1AW0A 2L9NA 5DS7A 3HK2A 4DSJA 2JC1A 2DIPA 1RDRA 2XY7A 1CJUA 4X4VA 1NSPA 1UVNA 2LMIA 2DNGA 2OPSB 5AXMA 1JMTA 4A24A 4HHHA 2JC0A 1NK9A 1TQLA 2NSCA 2XMKA 3HJJA 3MMAB 3VBIA 1MJ9A 1WC5A 4KO0A 3B54A 1UW4A 4RW4B 3AA8A 3BBBA 4YB6A 3UW1A 3EUNA 4HGUA 3LOUA 2G0CA 4ED6A 4ILMA 4G1QB 5KT4A 1YZ7A 2FHOB 3R5JB 3D28A 5BYRA 1HNVB 2ZH6A 4ZITA 1CSOI 1KKHA 5LJ5Y 4PQUB 1N5QA 1S6QA 1CQMA 3NS6A 2W4CA 3MMJA 5ADZA 1U02A 2B3TB 3JSMB 4OYWA 3TANA 4OZLA 3NNAA 1NZ8A 2XWXA 2VHEA 1W3SA 3M32B 2QE5A 5HROA 1MMDA 4ERDA 1AXQA 2WRMA 4LSLA 4PR6A 2OU2A 2V8HA 4E0DA 3GQCA 5K14B 1JKHA 3LWLA 3KTQA 1V3SA 5MAOA 4TKTA 3SQGB 3JSYA 2WW4A 1NZAA 2KH9A 4DI6A 1VHIA 1N5VA 4M5IA 3MECB 5KFSA 4X66F 1LWEA 3V6DB 3MEGA 3UDVA 3D6HB 4QWBA 2QMWA 1OMSA 1QY7A 2L9DA 2H5IB 2JLFA 4ICLA 3HD1A 3MD3A 5KFFA 1NXIA 3NGRA 2W9AA 3K0JA 4DL5A 4M9CA 2C28A 5H9EJ 3J80U 1LOUA 1FEHA 4ALZA 3U1LA 2VBYA 2GS8A 2J8SA 3OXGA 4Q43A 3HFVA 1RTDB 2IA6A 1H2VZ 3ENWA 2DH8A 2YWEA 1VGYA 3EGVA 3MM6A 9RUBA 3F1XA 1AUDA 3AOAA 2OEKA 1U7LA 1NDPA 3JTNA 2F63A 2LQBA 2LP4A 4LF5J 1U2FA 1IBLJ 5C7PA 3J7ZT 3EPIA 4ED1A 1V67A 3R2WA 1TKTB 4Y2MA 2QV6A 1C1CB 4JBCA 1RT7A 1NK6A 1S48A 3O3LA 1YQHA 2VA3A 4DL2A 2W9CB 3VALA 3ENQA 3TZXA 2YPYA 1IVZA 3KWMA 5KFIA 2VL1A 3AD7C 1HM8A 3TAPA 1KRUA 4RW8B 3B8HA 3D5MA 1N34J 4FF2A 2CWKA 1JNZB 3I96A 1HHSA 3UGIA 3FMBA 3BZQA 5D4NA 3VQTA 4Q0BA 4WE1A 1MSWD 2DR8A 4LSZB 2IM3A 3A3NB 3BPSP 3NNHA 3TIOA 1TIHA 4NCGA 1RKJA 5HANA 1HQUB 4RWXA 4EO8A 5C24B 3UDLA 4EQYA 1TUSA 3SDEA 4B3MJ 1UEUA 2GGPB 5DDQC 2X1AA 5KFZA 3FWWA 3P96A 4EI2A 4U96A 2QQDA 1Q86T 4TU9A 2POKA 1ZBTA 2E9ZA 4U7UD 1M8BA 1EP4B 4U8YA 3OW2R 5KG1A 2VQFF 3OH3A 2JVRA 1PYSB 1YJUA 2U1AA 1JIHA 4MAKA 1RK8A 2BJDA 4RNNA 5IS2A 4LF8F 1GT8A 3OR1B 2BJ8A 2R4FA 3ZZYA 3VVTA 3R2CJ 3CJ4A 3KK3A 5J2QA 1X9MA 5ETOA 5LOQA 2ASDA 4H7OA 1IKVA 1XIQA 2P6TA 4BCAA 5KFVA 3GSIA 4Q45A 5KFPA 2Y9HA 3DGPA 4EYHB 2B6AB 1TL1B 2B4UA 2CNLB 1F5BA 5D0HA 3K5LA 2GIRA 4LF7F 2W8KA 5BYSA 1Y1CA 1HKAA 1U6FA 2AYBA 3FBFA 5L38A 4FZVA 4MIBA 4H4OA 1Y7PA 1CJUB 3C66A 4NXMF 2ZH9A 2IPOB 1RBLA 1WSVA 2RU9A 3HDSA 4QJVA 4XO0A 3G2XA 3ENAA 3J81U 2D3UA 4KO0B 3N79A 3TAMA 5EWFA 4YDXA 2MQ8A 4ENOA 4DX8H 3TEHB 1G7CB 1PKUA 3CJRA 3JQKA 2C3MA 2AW0A 3HM9A 3AD8C 4TN2A 3ELHA 3ISNC 3O6QA 3GV7B 1S1VA 2R7QA 3BSYA 2VZ9A 2J9CA 2MKJA 2HHVA 4B3RF 2MHEA 1RGVA 2W25A 4G3IA 2ZOFA 1HNWF 3H5XA 1UFWA 4X65J 3JXOA 4JV5F 1G2EA 1WEXA 1LWFA 1OY9A 2UUAF 1G3OA 4A8WA 3NP5A 2KO1A 4NLRA 4YN3B 4DL3A 4ETXA 4JI8J 2UXCF 5HROB 1WF2A 1SGQI 1KFDA 3HSDA 1TGSI 3ZTQA 4X64F 5L1LA 5DM6Q 1LW0A 4RL1A 3HI9A 4LSLB 5AXLA 1JKHB 4ZJLA 3Q23A 3AXKA 1OY6A 4FNHA 4Y6IA 1IQZA 5I3UB 1ZS6A 2NQPA 1EQMA 3WZ0A 1RTIA 2JEFA 1LWEB 1FXLA 2HNYA 3MEGB 4FDFA 4ICLB 3TUZC 1FNOA 3OJUA 2DBBA 2CQ0A 3MM9A 4C3KA 5A6WA 2UUCJ 4JB8B 3JSBA 1U1RA 4AQYF 2TDTA 1HI1A 1DTQA 5C2CA 4G3QA 1UVFA 2WCYA 4DJBA 2AV5A 3BO3A 2ZD1A 3P4UB 2XMJA 3CMQA 2FJVA 2FHMA 2O3DA 3MM6B 5GMEA 3MFIA 1ZTWA 4DLGA 5DM7Q 4R0EA 3UR0A 2CDRB 2ZH4A 1WJ9A 1ZZNA 3UEJA 4M5GA 4DN9A 2FY8A 1N5TA 1P9YA 2JEIA 2DNNA 3KJVA 2V9WA 1V3RA 1DHMA 3D1OA 4URGA 1RT7B 2UVOA 1RABB 3OTBA 1GMWA 1CC7A 2GKTI 1Y4ZB 1FE0A 1YIJS 3K8WA 3N5BA 2NLWA 1S6OA 2KT2A 3FTTA 1FRLA 3T6JA 3PEHA 3G96A 1WSRA 1BQXA 4CO4A 2G2YA 1TKXB 1CPZA 2V1CC 3C8VA 1KNZA 1TL7A 1B3TA 3R7SB 5JHWC 2N3OA 1BE4A 1MR9A 4DZDA 1H72C 4EA7A 4C8MA 4CLUA 2AJ1A 2JW6A 4ECYA 3QSIA 1VJQA 2QYCA 4Y0FA 4Q0BB 4WE1B 3ET6A 3H42A 4DSIA 3UOEA 3E3XA 1KMAA 1JJ2R 3BSAA 1RTJA 2V2VA 1TR0A 4NCGB 2DY9A 3DHWC 2B8QA 3LH2S 4N69A 1NLKL 1IY6A 5IC4B 1YZ6A 2SXLA 3TQ1A 1FVSA 1S99A 3Q2SC 3SDEB 2HRYA 3M8WA 2V0HA 5LM7E 4LF6J 1DLOA 3W8GA 2HPUA 2Q3PA 2JHEA 4NLVA 2ZVIA 1RT4A 4WFZA 4ANCA 3FC3A 1C2PA 1T95A 4B3SJ 3KNGA 4DU8A 5LSLA 4EMDA 2RDDA 1NUEA 1Q8LA 4DV2F 3OTOJ 4FVMA 1R3NA 2DH9A 1ZETA 1X4DA 1GTEA 5KG3A 1KVIA 3EDRB 2EEYA 1WGTA 2J0QD 3KK3B 5J2QB 3WX4A 1IKVB 1FWKA 4UOCA 4RU2A 4PXDA 4USMA 3DGPB 4AAWA 5B7WA 2OVOA 3QRRA 4CP5A 4FP9A 2HHQA 5BJRA 3RAXA 1ZYQA 4JI6J 1YP4A 1YBTA 5FIIA 3HHKA 3RW7A 2JFKA 1YJVA 4I2QA 4GVBB 4H4OB 4FNIA 1TAUA 4X4SA 5IC6B 3VBNA 2KFZA 4CCHA 4SGBI 3G9CA 4AD6A 4ZVFA 3PY8A 1Z2IA 4KSEB 4UXJA 3TAMB 1XEZA 1N33F 2M5XA 2IM2A 2W1BA 4WIIA 5ETLA 4L9MA 2XYGB 3CJTA 5LMNF 3TQEA 4GKKJ 4NXNJ 4LFAJ 3TR5A 1R8BA 2MTLA 1S1VB 3BN7A 5GAEI 6FDRA 1RBAA 4DOZA 3AOBA 2BA9A 2QIFA 4NEZA 1NJWA 3F56A 4KQZA 4DPWA 2MYFA 2ORWA 3A3PB 4P10A 3GR0A 3NMRA 4DWIA 1LWFB 2RE1A 3ZZOA 4L74A 4E1PA 2CPXA 2KMRA 5A8KA 4OLOA 4P52A 3RR8A 2MJUA 4MMOA 4OL8A 4CI0B 4MK8A 4X62J 1IW4A 1QUPA 5DO2A 3GP9A 2XLKA 5DZ6A 1LW0B 4XIUA 3KLFA 5L1IA 1I3OB 1TTHB 2G2ZA 3MCSA 1T05A 4OQJA 3I5BA 4C8KA 2HURA 5BR8J 3PW7A 1IBCB 3M9OB 1R0AA 4DHVA 1RTIB 3KLVA 2LA4A 1PAUB 5EX0A 1HPZA 4C7QA 2GIVA 2E5IA 3MM9B 3D8VA 3ENVA 1DTQB 3ZC4A 1HDLA 5KT7A 1K7UA 3MFHA 2ZD1B 2IFXA 4E98A 3FVYA 2C3UA 5D6GA 1D8YA 1LK5A 2PEBA 3G87A 3DJ4A 5KFUA 3VF0B 2EK6A 4WZQA 4RW7A 4ZCIA 1JLGA 4F3QA 5D8HB 3S7RA 3KJVB 1S9EA 4IH5A 2QA4G 2GV1A 1S57A 3P1BA 3ETMA 4UOHA 4DQQA 1T8EA 2ZJPQ 4KPYA 4EBEA 5A2QU 4C8LA 1PJ6A 4NZ7A 3PZPA 3SCJE 2R3VA 1SGEI 2C2OB 1TL7B 4IQXA 4KIAA 3D3CJ 4J9SA 3IAM9 2RKIA 3M8ZA 3R1WA 1TL3A 2OEJA 1FNXH 3EPGA 3GJRB 4FXDA 2IAJA 3TZZA 3UGLA 3ET6B 3HT0A 1UETA 5HJYA 3UE2A 5E33A 3M2RB 4C0BA 2YH0A 1Y1BA 5KG0A 2F8HA 1FI4A 1VIXA 1R8CA 3IR5B 2B7CB 2DNPA 1MNEA 2K3KA 4UT4A 1RT4B 3DHXA 4WJBA 2QGFB 4ZPWR 1QE1A 2UVWA 3OV7A 2DPIA 4IQMA 5C42A 1WF0A 4WXOA 1Y3JA 3AJ2A 4K2JA 3W9HA 1RP5A 1SQEA 1XR7A 4ELVA 2W7AA 2OJ3A 4LBIA 1RAFB 4P2XA 4LRFA 1FAQA 4UXHA 3NGKA 3ILIA 3A4TA 2ZE2A 2QQCA 4OYZA 4K0KJ 1XBWA 5EDWA 1U0HA 4FBTA 1LV5A 3T3FA 3UNGC 3LUYA 5U47A 2JNJA 3OTEA 5CH7B 5B0EA 4NYOA 3JAMU 5H1SV 3HHNB 4MKBA 4RR5A 4KPXA 2PFFB 3IXQA 2EPIA 2E5HA 1FJCA 4LBPA 3K58A 4QR0A 1UWBA 4AXIA 4I2QB 3TARA 1HBOA 1BGXT 3VAGA 1ZAVA 4F4XA 4F02A 3OUPA 4B3TJ 1W4RA 1RXOB 2Y1LB 2JLEA 2ZDOA 2B8PA 1CBKA 1KQKA 4F04B 4FKXA 1SL0A 3LAKA 3F44A 4DX7A 2VQFJ 5HMXA 2ZKTA 2E9TA 4JV1A 4G65A 2MEWA 2XM3A 4J9LA 2WTFA 3DRPA 2ARPF 1M5SA 3MOJB 3V4IB 3G71S 2K1RA 1AZSA 1XMOF 3QPIA 1U0SA 2DPJA 4JI2J 3DOMA 2FGOA 4P7TA 2SGQI 5ETNA 2CQ3A 3PJXA 3ADAC 2AX1A 1R8HA 4I4BA 5A8KB 4YEAA 3UD4P 4J5OA 3GQAA 4QIVA 3T6BA 4C8OA 4PYDA 5HN0A 2EK1A 4BLGA 1WUUA 4ZCLA 3VR1A 8ATCB 1CT2I 2RRAA 4P74A 3EJMA 4CLWA 3HFKA 4UXIA 1T05B 3SFGA 3BB5A 1WELA 2QX0A 4NXMJ 2VBWA 3TDTA 3VGUA 1VC6A 3D0HE 5LL6d 1R0AB 3QT6A 1OSCA 2FPHX 3M6WA 4WZMA 3TK8A 4KB7A 3MR7A 1WWHA 3VWSA 2EI5A 5SZTA 1QVFR 2HEKA 3EZ5A 1M90T 1XWLA 1T9WA 1VIOA 4N41A 3VDUA 3O5TB 5DGBA 1H0ZA 2IRYA 2PC6A 3W9IA 2ACYA 1GH8A 1X8DA 4R8UA 2V0KA 3HX9A 3IM8A 4JI4J 4WF9Q 2DK2A 1O0PA 2HAFA 1VISA 2ZH7A 4XTTA 2WSFC 2CJSC 4DQSA 3MTJA 2JX2A 2X3DA 1ICEB 2C2DA 1X60A 3DHOA 3B4DA 1S9EB 2KJWA 4N6BA 3O1LA 3C2PA 3I3XA 3PX4A 1V9OA 4U6PA 3MAAA 2HFUA 4TU8A 1QDUB 4TLRA 1U1OA 4X64J 2LU2A 4C0OC 2LQ9A 2ZBRA 3R9LA 3QFWA 4EU0A 2YNIA 1HWKA 1X4HA 2O66A 3B4VC 5L6VA 2ASJA 3IGVA 3C6UA 5D0EA 5T7LA 1FWPA 3HJVA 5HJXA 1NH8A 4WFYA 2BM1A 2C2RA 1VQLS 2CG4A 3THVA 2RKIB 1QTMA 4B02A 2W0TA 3MR3A 3BR8A 4OJHA 2HK2A 3PYGA 2IAJB 4N47A 3AHPA 1FESA 4LR9A 3FDSA 4F25A 1S5ZA 4DUZF 3GYXB 2KXHA 4M8LA 4AQYJ 3PRDA 2SGFI 5HVGA 3UGDA 3QGPA 4KNRA 3ULHA 5DQGA 3QZ7A 4EA9A 2AGQA 3QLHA 4ILRA 4WFAQ 4LFCF 1EETA 4CO3A 1QE1B 2QMXA 2WLDA 2HVHA 3V4EA 3MPYA 1EHWA 4QWEA 5C42B 4ECWA 2EBEA 1KWMA 2MQNA 4QWDA 5KFWA 1SQGA 3CDEA 1FTRA 1GMVA 5D0GA 2JYYA 5EX3A 1QAJA 2Q1LA 1X4BA 5DG9A 2V6AA 5IFMA 4F4WA 2ZE2B 2V0JA 1NM2A 1UFLA 4IO9Q 2N71A 1U0HB 4JI1F 1RTZA 2GIFA 4ITSA 3QWUA 1KP6A 2A6MA 3TZYA 4ZS6A 1TVRA 2J9RA 1RB0A 4ZVGA 1PTRA 1U49A 3H5SA 4L75A 4HH1A 3DRYA 3W66A 3KHLA 3B6BA 3LGNA 1UWBB 2W2MP 1KHRA 3GSDA 5DQIA 4F4ZA 1LQ9A 1KQSR 5HQ8A 4CM0A 2VOPA 2BW2A 2V4JA 1KTVA 1S10A 1HNZJ 4PG5A 4K4SA 3P6YC 2E1AA 4OX9F 2CADA 4NYZA 3WBZA 3HSZA 1T02A 3CCWA 1KBRA 4YB7A 2ZH1A 3TWDA 3IWXA 3KWEA 2GVDA 1NDCA 2RUGA 4MKAA 1T3OA 4IDKB 3DRPB 3MPDA 3A8IA 4M5MA 3QATA 1N4IA 4USJC 2B7BB 4B08A 1TOTA 2BZ2A 1NJYA 2GKVA 2DIVA 2UP1A 2YWHA 3SRTA 2L3MA 3EX7B 1Q8KA 1CC8A 2H5EA 2F4FA 5GADU 1VQ9S 3DMJA 3HVRA 3H90A 3MC4A 4KNXA 2KTQA 4G3PA 1RT5B 5IT0A 5HL7Q 1ZH5A 4FYWB 2XB2D 1F5AA 4HURA 2C2EA 1KFSA 3IM9A 4DF4A 1U48A 5CCLA 3ITHA 1MROA 1T0TV 4HDGA 4ZIWA 3MQHA 3HSJA 1NJXA 3C46A 2RQCA 2NPFA 4JCVE 4EGGA 4NLQA 1HARA 2VA2A 3FSYA 1RT2A 2PT0A 1SXLA 2DXEA 1PIEA 4YS2A 2HQGA 1UMJA 3MUVP 2D3ZA 5LMNJ 3PO5A 3KHRA 2AYGA 4EO6A 4R8UB 2QLWA 1N13A 2HHUA 2HQDA 2K2PA 2C3PA 4CO0A 3C19A 2LYVA 4C3MA 1R89A 3DOKB 4C8NA 4CLSA 2OPPB 1UWAA 5KFNA 2QA4S 2UVRA 1RCOB 4JOUA 1KRPA 5IT4A 1MLAA 3W2VB 1RAHB 4DV4F 4M5LA 2GO8A 4QYZJ 3J81Y 2ERRA 3GOSA 3I55S 2ASLA 1U1NA 4UY85 2R8HA 1V3ZA 1U8SA 1BWEA 3O44A 2ZUGA 1K7VA 3CWJA 2N4CA 5G0RA 3I5AA 5KFCA 1K0TA 2AD9A 2Z56B 5CZXA 4TYAA 2GMLA 4WBFA 3C6UB 5T7LB 3BN4A 4C11A 5DAEA 4C97A 3CJ3A 2ZHOA 1JXVA 1NB2A 1R27B 4K7QA 3G8SA 1TZ0A 4P72A 1JK9B 2IVMA 4N5SA 1Z2ZA 5J1EB 3Q8PB 2FVPA 3A13A 5LSOA 4DR6F 4IYQA 2I38A 2MZQA 4USTA 3VZIA 4CLZA 2ZZNA 1NDLA 2OHDA 9WGAA 5B0BA 1MJBA 3TEGA 1WTFA 3T5LA 4Y00A 1FVQA 4K50A 4RJVA 3GLJA 2CPHA 3KFWX 3V2UC 1SGRI 2F9JA 5IT9U 3RZAA 3KUHA 1MJAA 1WOPA 5C2GA 4PQAA 3W2WA 1GQEA 5CYMA 4OVOA 4LRBA 1IUJA 1RHKB 3NRBA 4ZVTB 1GMUA 3W5ZA 3DU5A 4ZN1A 3PYEA 4WP4A 2R2SA 1RWKB 2ZJQQ 4GMKA 4DR5J 4P2MA 5L39A 3G6YA 1P9ZA 3PEJA 1Q7YT 1JLBA 3UWTA 1SJRA 4P6QA 2PMWA 2PMHA 2NXEA 4IUFA 2QL7B 3EWGA 2DNKA 3LAMA 2F9DA 1SVDA 1TVRB 4L73A 4ZLLA 2D41A 3P5BP 4ZLJA 1S1TA 3B4MA 4OJ1A 3GMGA 3KXDA 4K59A 2QSFA 3BSCA 3HCXA 4CLYA 4RU9A 4WTOB 1X9WA 5LSRA 3PO4A 1Y0HA 5J2NB 1N88A 4AL7A 4DCLA 2HBZB 4FYDA 4RUAA 5HVFA 2V4JB 3KG1A 4K5SA 3FFIA 2QSWA 3A3OB 5KFTA 1Y10A 1FA0A 4JYAJ 5I42A 2YQ1A 2AF6A 2UUWA 5DG8A 1HYSA 2LEBA 1SGDI 3E01A 3H20A 4MFBA 2GJIA 2ZNZA 3QBCA 1UPPA 4WU3A 2ZH3A 4ES3A 3PVXA 1TBOA 1YLXA 2VBXA 4IH6A 1X0PA 2GVDB 2B56A 2W9BA 4RBTA 4MK7A 2YQ0A 1DBDA 1WC4A 1M1HA 1KSPA 1NSQA 2AJFE 2NXUA 4CLPA 3R6GB 4W90B 2I5JA 5IWAF 4WWSA 3FBCA 3UNYA 1RWMB 3VAJA 3DM2A 4H4KA 1OPZA 3DMJB 3KMSA 1K7TA 1RTHA 3D0IE 3N01A 4L3NA 2I8EA 2JXDA 1HL6A 2XZTB 2LQJA 3A8KA 4NMLA 4TU7A 4AXJA 4I6YA 3CEDA 4EBCA 5KG5A 4EFAC 2KN4A 1F1BB 1VQSA 3ITHB 4UUXA 1MROB 2RMLA 3NCRA 1NXUA 5E3CA 5U2KA 3UN3A 2R7RA 1GX6A 2UU9J 1NK7A 1S0VA 2GFFA 3R5CA 5CD4H 1IBMJ 3OJSA 2DRDA 3T9NA 2DEJA 2DKVA 3FEXB 3H2VE 3TVKA 3H98A 2HNDA 3DLEA 1QRMA 2H4YB 3FOQA 1S80A 2I6WA 1B99A 4CM2A 4EGLA 1ZOTA 3Q24A 3TJ8A 4HZDA 1REVA 3V6JA 3SMZA 4LQ3A 4PPZA 4BWJA 3UFCX 1UP1A 3BSSA 1CJVA 3DLGA 4QYRA 5EHHA 1V1IA 3SIPB 4TVAB 2I2YA 2E7WA 3OL6A 2XS5A 1ZA2B 1U6ZA 2DCLA 4BHQA 2GNKA 1A7GE 1XMOJ 2N17A 4X4PA 4OX8A 1U47A 2VQEF 4I2PA 3CD5A 2NR0A 1N52B 1VQNS 4RBUA 3K7RA 4P73A 4OYIA 5L1KA 1KOHA 2MKHA 3LO3A 3RU0A 2B8TA 4U8VA 1C1BA 4O0IA 4DN0A 2FQQB 5G0RB 2YWFA 1DTTA 2PFDA 3MGJA 3DLLQ 1KLMB 2RVJA 1IKWB 2WLCA 3V6HA 1SGNI 4C11B 5A8RB 4K4UA 4GO5X 5K5MA 1XERA 2ROWA 1LKZA 2JEJA 3EMTA 3RRGA 2MKIA 5FJ4A 4E1KA 3PNIA 1VC5A 1UVMA 4CT9A 3IBCB 2OFHX 1EB0A 3CXLA 3MEEA 1TELA 3SXLA 5K8NA 2OELA 3RGIA 4G87A 5B0FA 2X1GA 2OAUA 1RWXB 3VBJA 2HLTA 4B9VA 2WONB 5KFMA 3EYZA 3PR5B 3W2WB 1DZ5A 3CIZA 3LALA 2FVQA 1WTJA 1IJFB 4BC7A 1S9GA 2XSFA 3D66A 5IV3A 1FYBA 2AGPA 2HBQB 5E5NA 3RB0A 3NL0A 1WDTA 4I67A 2N1AB 5EN1A 3W3SA 4J9VA 1Q79A 2FJBB 2HWTA 2VHGA 4QOTA 1K8AT 2JDJA 2DHSA 3SFUA 2EG2A 1JLBB 1GNKA 5F0WA 2LEPA 4ECSA 4CQ1A 4YUDA 1FK9A 1X4CA 4FXVA 1QREA 2MLZA 4KV8B 1N56A 5HQMA 2DNLA 3HF5A 3K5PA 1LEOA 1S1TB 2WW8A 1UHAA 1VMBA 4JI0F 4LF5F 3IR6B 4DSKA 3G82A 5T41A 5JVHQ 4EUVA 3ZNUA 2DR7A 5CYQA 1TDTA 3IBWA 3CC2S 4OHYA 2VU5A 3CPWR 5A2QY 3BPDA 1RZMA 1X4FA 4RW9A 3NMAA 4KC5A 1AT1B 1VQPS 2P5VA 1T3DA 2C1EB 2VPZB 3TOBA 1B7FA 1FWLA 1XHDA 3TJAA 3ZZZA 1HYSB 4P9SA 4LFCJ 3E01B 4MFBB 4OI6A 1N34F 2B5JA 1WKXA 1J27A 2R7OA 5HMZA 2XSJB 4PG8A 2E73A 3CE8A 2W9BB 4ZPTR 4CH1A 2MGZA 5M2PA 2WBRA 1VFJA 3IS9A 4F2SA 2OIHA 4A8OA 1K0VA 5HBMB 2E5LJ 3C6TB 4E6TA 4LF9F 4NA2A 2I5JB 3QTLD 5ADXU 2B4PA 3HVTB 3BR9A 1W25A 1H6KX 2FTRA 3DM2B 1HLWA 4JI1J 3CTRA 2HG4A 4B3MF 1LWCA 3E2IA 1RTHB 2NUUG 3NKYA 4EEYA 4J91A 5FLXY 4FKDA 2CWXA 3LF0A 2JH3A 1HNIB 2H9ZA 4RNFA 4F8RA 3GFYA 4DEZA 3GV5B 3VHQA 4P7VA 1RA6A 2OD4A 3FRZA 4PWWA 1XNQF 5F42A 4OZ3A 5ADXV 3RUBL 4B17A 3DDNA 3PX6A 3D6TB 4DF8A 4IOAQ 2RQKA 1RWNB 3D3BJ 1N36F 4G1PA 5L46A 4GI3C 2YNGA 1U25A 2HNDB 2A3JA 3DLEB 4PXCA 2AYEA 2OPRA 2NU2I 1N54B 4H4MB 2QYGA 3TNVA 3Q83A 3WIVA 2LQ5A 2YWKA 1REVB 1BD6A 1EWWA 3EICA 2X3GA 5FUXA 3DLGB 1ROFA 1Y5IB 1Q0NA 2ORVA 1L3VA 3KG0A 4USVA 4OFZA 2CVIA 1T9XA 3ZXWA 4EZ6A 1FARA 1TL4A 3R5DA 1OSDA 1AB8A 4K4VA 1OQ3A 1ZPWX 4I2PB 4LRAA 3PRBA 4M1KA 2AHOB 1U26A 1ZA1B 2XGQA 4ECRA 4IHFA 1U24A 2XMWA 1C1BB 2GHWA 3NOGA 3FKBA 3TO8A 2DO4A 1DTTB 4J7CA 4DQRA 2HFZA 5KFQA 2QO3A 5IQ6A 2J7KA 1PILA 3G8QA 1SBRA 3PRVA 4NLXA 3OXLA 2UUBF 3BQ0A 1MWYA 2G1DA 1R7IA 3IMQJ 4X65F 5J1PA 4PKDB 2V53A 3CJ8A 4USWA 1FRIA 1LK7A 2LCWA 2HGMA 2HAIA 1JLCA 4EAAA 3MEEB 1VOMA 5LXRA 2EWHA 4JI8F 2GKRI 5FD1A 2LVWA 2RS2A 3UN2A 3KLGB 2BKOA 2FZGB 4NLPA 5GAHI 4O0NA 3SYZA 1TKDA 1M8CA 1OIAA 1H7XA 1FO1A 2KG0A 3S6EA 3AT1B 5GAGI 2VIHA 4RKUC 3GTYX 2XMAA 2XMMA 2E5JA 2N82B 1S9GB 1TUWA 3O2IA 4OX6A 3MMAA 3VNPA 4ZPBA 3ZTSA 2XHCA 3R2DJ 2RC4A 3IP0A 1FJ7A 1VDHA 4ZK7M 9ATCB 2MQPA 1HQEA 2QEXS 3RB6A 2HZAA 1TKZB 4DL0C 2E5RA 1BWVA 3BXYA 2QLJB 2J9EA 1BUSA 2SGDI 3N6LA 1XTZA 4ED7A 1DAXA 1HI0P 5HMYA 3U02A 1PCEA 2MKYA 3WIUA 3N28A 2RRBA 1FRKA 4IG0A 4WYWA 1KC8T 2H4WB 4UZCA 1HD1A 3LP2A 1K1QA 4LF1A 5HMWA 3KKFA 2CIMA 3M32A 4OV6A 2FVSA 1V6HA 1H0HB 3TZWA 3QRPA 1OVOA 2LXUA 2VOOA 1AFIA 1NKEA 1HBNA 4OJ3A 2QQEA 4K4ZA 3OFFA 2CPFA 2ILYA 4N8OA 1FRHA 2NUHA 2B5JB 1NEEA 4WK1A 3QZ8A 1PG5B 2YQPA 1IKXA 1B7YB 2ZUAA 3K5OA 3ZO7A 4PWDA 2LEOA 4KGKA 2MGZB 4NCBA 3RBXA 4FXWA 4JI5J 4LBHA 1PPFI 3IS9B 3DRSB 2V8PA 2YTCA 4L76A 4YR2A 3WX8A 5KT5A 2ZM6F 2YPZA 2QG9B 2G0IA 2WOMA 3R6LB 3QJPA 2ZKUA 1LWCB 2P9GA 4ILLA 3UPFA 5F8LA 4KY3A 2F4VJ 5B09A 3QFHA 1XC9A 3SZ2A 1X31C 2OD1A 2RH3A 2DGQA 3OTZA 1S7IA 3BGRA 1RWWB 1JLQA 1NHKL 4ECXA 2B9YA 2C2ZB 2FJXA 4IR1A 4B3SF 5H9EK 4MT1A 3KLEA 2KFNA 2ZNYA 3PACA 2NXJA 1HFEL 1C1CA 3OHBA 3OUYA 1I6JA 2ZC3A 3BJIA 4ED0A 2QMUB 1ZTTA 2OSQA 2YNGB 4BBYA 2BDPA 3CDAA 2J5AA 2OPRB 1T9VA 3ISND 2RDIA 4QQBA 4N56A 4RW8A 1OJ4A 2R7UA 1VQMS 4XAKA 4NI2A 2J0WA 4WIQA 2LXFA 4JI6F 1Y8FA 2A10A 3MI7X 2QJ3A 1VLOA 3K89A 2DEIA 4ZVHA 4LVNP 1EIYB 3HVWA 3L95X 2DY1A 2KRBA 3N5FA 3I4HX 3H4DA 3UFFA 2MZ1A 1HD0A 5IWAJ 1LWXA 2VODA 4Q2MA 3CVKA 5E3AA 3MWBA 3BGFA 2XHWA 2GGPA 3BDEA 4OZ5A 4FYYB 2Y0MA 2PEHA 3SCKE 4C6AA 3R7NB 4NLUA 2Q6BA 4GKKF 1WHVA 2R2RA 1SC1B 4NXNF 5JXSA 3FQLA 3ZZRA 3TI0A 2HK3A 3GFHA 3JSRA 1Z2LA 1FKAF 2AP6A 1EARA 2BX6A 4WKYA 4DV5F 2HHXA 3OD2A 3GG0A 4KRWA 2FYXA 3AAWB 1RACB 2CNOB 3ETOA 3THTA 1HM9A 3V4MA 2YKOA 2WK4A 1TBNA 2E7XA 3KK1A 2HLUA 4X62F 3OL7A 2EW9A 2MY7A 1A6LA 3PTWA 2DNZA 1NU4A 3C3LA 2WCXA 3MDFA 4A8QA 2OEMA 2ATCB 4ZLPA 2C2MB 2LB7A 3ILJA 5BR8F 3JTPA 2SGPI 1NK0A 2VQEJ 1YJ7A 2YX1A 3MCNA 4FVCA 2UXBJ 2WLEA 3MHYA 4ZP7A 1RHUB 4EA8A 2F8MA 4DUYJ 3D1HA 2EC2A 5AJ3F 3UO0A 1HQEB 1E6YA 3CD6S 2M4MA 4RUBA 2VFUA 4YP3A 4GC7A 1SC3B 4PG4A 1ULKA 1VCTA 1RSCA 3TA1A 3AXMA 4IRDA 1SCJB 2VV5A 3C15A 4MZUA 2C3OA 2ZWPA 3K2YA 3FCVA 4IG0B 3RG6A 4ZPCA 3J81j 1YBUA 2CZ9A 4ISXA 3LP2B 1NK8A 2CG8A 3L09A 5A8WA 4PAAA 1XR5A 1LXAA 1R8PA 3I5CA 2NPOA 3JB9k 2WZ1A 2HVZA 3HO1A 2QQ0A 2G13A 3CJKA 3DNCA 3HPOA 3GIMA 3CDWA 4LVOP 3OR2A 4F50A 1T7PA 1WC6A 4HLBA 3OTMA 2CWGA 3TA0A 1HBNB 2OPQA 1NPPA 4A8MP 4DR3F 2DO0A 1N4LA 1WG1A 4JI3F 4ES2A 2AKWB 2IM1A 3CJSA 2RNEA 5DDPC 1NH7A 3R3IA 5I3UA 2J8AA 1IKXB 1PAEX 3HHDA 1WHWA 3P8BB 4PWDB 1IQTA 2YXLA 3PJWA 4RUHA 1ZM4A 1N48A 4OLPA 4WP3A 4O23A 5IXUA 4MK9A 3IAS9 3QRQA 5FDLB 2WOMB 2V2KA 3CCSS 2HFOA 3I32A 4MYTA 1JQGA 4PEOA 4ZDNA 2PMZD 3K17A 1SJFA 2HBRB 2FVRA 2Y1JA 2ERWA 5EWEA 5ETRA 3BGRB 1JLQB 2CQCA 3MURP 3LGHA 2E1RA 2OKQA 1H2TZ 1S1WA 1R43A 2KRRA 4G6VB 3KLEB 4JI0J 4PWUA 2W2NP 2OH2A 3W8PA 4F2RA 2RILA 5E7OB 5HO4A 3CXCR 5LT5A 3MUTP 3OUYB 2YNFA 2MMYA 2BKNA 2DR6A 3CCMS 3FBBA 3CDBA 1FRJA 3M2UA 3AA9A 2MZJA 4K0KF 3UVJB 1TKXA 4DFKA 1RU2A 3NGDA 4K4TA 2BJ7A 4DV1J 2PI4A 1PJ5A 1X5OA 3P5TL 1Z1ZA 2GJ2A 1K47A 1YBAA 4NI2B 2VFSA 3VQSA 3OHAA 3J7Z5 4OI1A 3FSIA 1TK8A 3MCOA 2LECA 4NRUA 1X4GA 4OZ2A 3MAQA 2CUYA 2GVZA 1N32F 1V5VA 1RWVB 3FSXA 3S1TA 2RQMA 4LF9J 4PCQA 4BDPA 3GV8B 3QMQA 4C8YA 1B0PA 4NA1A 4B3TF 2NXNA 3WC0A 3IA0A 3KG4A 2V94A 3E51A 4URQU 2E9RX 3L9ZA 4KGVB 2BW7A 1DJ0A 2FY1A 1QAXA 2ZDPA 4WK3A 4HH0A 5F3ZA 5KG7A 3JS9A 3PJ9A 1F9FA 2MLYA 3UQSA 2Y1IA 4W98A 3MEDB 4LJMA 1Q1KA 2R7TA 1RUSA 1XNQJ 2VONA 2FGCA 3OVSA 4QIEA 2RT3A 2G1HA 4Z2XA 4EWTA 4F26A 1UTAA 5D15A 1N36J 4JI2F 3IGNA 1RYSA 5DG3A 2CQHA 1SGPI 3HKZD 3M8PA 4IFVA 1DS3I 1ULMA 2KYZA 3UD3P 4FCEA 2IY5B 2ROEA 3IRWP 3KK1B 1F9EB 3N6MA 4OMFG 5CABA 3PW5A 2FB0A 1RT3A 2V0IA 4DR1F 1QQ0A 7FD1A 4C9DA 4XK8C 1YRTA 1D3WA 2DTJA 3Q8UA 1VQ7S 2LKZA 1KGQA 3CD0A 2HRUA 4GVBA 3NGSA 2Q6CA 4RWWA 3SV3A 4KHPJ 2VG5A 2R7WA 1VRTB 4ELTA 4MYUA 4NZ0A 1YJNS 4MTPA 3W1YC 1O5JA 3TVZA 3DYAB 1FXRA 3IC1A 1TUGB 3MCMA 2YWGA 2W01A 1L3TA 1E6YB 3FC9A 2AJ0A 4RX6A 5DRKA 4L6V3 4JI4F 2CZ4A 2UUBJ 4NA3A 4HEA9 2B9EA 3C15B 4DR2J 2M8DB 4F0KA 4PG7A 4V19J 1NB7A 3R3RA 4KJIA 3KJFB 3BBFA 1S77D 3CJ0A 4V1Ak 1NUBA 1N0UA 3FCHA 3CW2C 4RNHA 1R31A 3D1QA 1R0CB 4LIRA 5A8WB 4D3GA 4CNYA 4BWMA 4KT0C 1S1XA 5K8OA 3KY9A 3AB2B 1Q7LB 2CQ2A 3CJKB 3TRGA 2ENNA 4A8FA 4F67A 3OR2B 3QAUA 1VQOS 5H9FJ 3BM7A 2KI2A 2OPQB 1YRXA 2OZUA 5SUHA 1MR7A 4K6RA 3PM9A 3LP1A 4CRJA 4DR7F 2GO9A 4NWBA 2JWNA 1DS2I 2EFOA 4HKQA 7AT1B 4NRTA 3R5BA 4V19X 2VJUA 3CUNA 2DCUB 4NYPA 3BO4A 3RW6A 2GMHA 5BXIA 3NGUA 2M2BA 1TV6A 2QA2A 3VGSA 1W26A 2L48A 1X9SA 4B9TA 1D1UA 3GB0A 3BKTA 1MN7A 1VYAA 2XCPA 4X4QA 1D9FA 1PC4A 4DG1A 2M8HA 4NLYA 1KRVA 2HRTA 5F8GA 4X4RA 4IHGA 4RNOA 4Z37A 3NCPA 3P3DA 3VBKA 4ZP9A 1S1WB 2IMOA 3B78A 3QJJA 5D4OA 3K57A 5DDRC 4ZP6A 2RD5C 2CWHA 4U7CA 3VAIA 3THPA 3VCDA 1S79A 3K5NA 3EM1A 4O3OA 1M1KT 1DY3A 2AZ1A 4AE5A 2YNFB 5T14A 1UPMB 3FS8A 2RAQA 4WFBQ 1FDNA 2I0XA 3M2UB 1F9HA 2QTWA 1SUQA 1ELOA 2BANA 3PYDA 1CE3A 4KYZA 2KB2A 4R5PA 2CPYA 2CJQA 3NGTA 2BMBA 3TVYA 5KFKA 3VAKA 3VBPA 4ZOSA 1H38A 3KDNA 3RBDA 4EYIB 2A6OA 3A12A 1C0UB 1ACMB 2GVZB 5CYJA 2V9KA 2FJDB 3M2RA 2IIHA 2LLZA 3TO7A 2ZM6J 2DGOA 4YB5A 1OS5A 3EZOA 3DLKB 2J6UA 1HNZF 4OYPA 4I56A 1FJGJ 3LPYA 4LFBJ 2L7XA 3BS9A 2LEAA 1VHFA 3NCQA 1RAEB 5G4DA 1RT6A 4LQ9A 2DGVA 2LQ8A 3M6UA 3JQMA 4OZ1A 1FF2A 2GQCA 4QW8A 1N5SA 3MM8A 2OTLS 1QSYA 2MB0B 1Q53A 4FBUA 4YY3J 5J8FA 2XO6A 3KLHA 3CCLS 3I6PA 4MKVA 4W92B 3M8PB 4IOCQ 4IFVB 1XMBA 5D0RA 1SJ3P 2HWIA 1VBZA 1RT3B 4OI2A 1MMNA 1OY8A 3V6KA 1GFWB 1G4CA 3Q89A 1RHRB 2IVYA 1IR2A 3Q8SB 4WYLA 2VDHA 3GOXA 5B0CA 1B0VA 4KGMA 2W24A 4KGZB 1S1UA 1SL1A 1JJ4A 2V5HG 2WAQD 4KTQA 1JJCB 2VG5B 2IVFB 4C2MA 2HGLA 2UVUA 1NPKA 2CPDA 4AC3A 3LQVA 4G3SA 4PUOA 2RUSA 3SI8A 2R2UA 1KQFB 4FS2A 3RRKA 1DFDA 3MF5A 2IA0A 2K3IA 3AH6A 2ROPA 1NJIT 4JV0A 2PE8A 1PBAA 2IUAA 4X4OA 1V5IB 3S01A 3T5HA 4AL5A 2XLIA 4DV5J 2JL9A 5ETMA 2J0SD 1U1QA 3PMOA 3V4IA 3CC4S 2NSBA 3EVMA 3FSCA 4DZ6A 3QAHA 2DB6A 4HTJA 1H3DA 2HWHA 4F3MA 4ECVA 2JF2A 1S1XB 2YWWA 3TOQA 3RBEA 2HBYB 3FBEA 2B0UC 3GCWP 3EVWA 3LA0A 1HW8A 2W2OP 3TX8A 3FRYA 1NK5A 1G97A 4RO0A 3IGJA 2KVIA 5E2QA 1BMOA 1SC4B 2QRRA 3LP1B 1RE1B 3TP2A 2ILZA 1S0MA 1J2VA 1SJQA 1DQ8A 3M8QA 4OIXA 4UOFA 4PG6A 1S6PA 4DPYA 4QIFA 1TV6B 2D9PA 1K73T 2Q43A 3ZTOA 3MTKA 3HMJG 2KHCA 1LXNA 3GYNA 5AJ3J 3FGVA 2ACMA 3T9ZA 4DFMA 2PSZA 2UV8G 1SQFA 2GC8A 4N8NA 4TNOA 3KYLA 2YX7A 4DG1B 2EBGA 3Q22A 5KFBA 4MYOA 4ED2A 2IM0A 2FHKA 2KJVA 1RBOB 2GZOA 2P6SA 2R8GA 3NLCA 4AA7A 5F8HA 2ZWOA 1BQMA 4ELUA 3TOAA 2R7SA 1NHUA 5F8IA 1UVLA 2Y0SD 4LF4J 3WQPA 4A4JA 2HQFA 1WKJA 3GIIA 4CDIA 4DR5F 3ISZA 4DX5A 4QIGA 3QAEA 4OZ0A 4TLQA 1WD6A 1SUQB 2BANB 2E1PA 4M94A 3GU0A 3MM7A 1TK5A 4R5PB 4DR3J 3BF4A 4JI3J 4IRKA 2A2CA 2MJNA 2W4DA 2ZBIA 2XI2A 2RB7A 4LT6A 1HIYA 2FDNA 3R1HA 1S7HA 3P49B 2GVIA 1AN1I 4ZPAA 3U27A 2HHTA 1YRUA 2VG6B 1FERA 4QWCA 4K4XA 1EJ7L 3QO9B 4JP8A 1E6VA 2DXFA 4LRCA 3H59A 3OTCA 4N27A 5K8PA 1R0BG 4Y2IA 3DLHA 4JYAF 4WP8A 4ZCMA 3V81A 2JRSA 3MXHP 2AEMA 4RPFA 5CAAA 2MQOA 1RT6B 2VF3A 1M5OC 3TWZA 3BV8A 5HI7A 2HFSA 1WACA 1QUVA 2AEJA 3MM8B 5RUBA 5ETTA 1TFWA 3HHLC 1U1KA 1KGTA 1U5KA 3JTOA 3IRXB 3KLHB 2YUUA 1OPIA 1KDNA 2DJWA 6FD1A 3MEKA 1EQ0A 1NRKA 3PW2A 1UEVA 1KD1T 1K44A 4DSFA 5JMNA 1J5EJ 4Q7AA 1SKWA 4NLOA 2MPUA 3TISA 3JQYA 4YR3A 4X2BA 3FEYB 1KQAA 4R36A 3T1YF 2BYCA 4KPCA 3ZNJ1 1N32J 2E1MC 1MWZA 1S1UB 4GC6A 1NK4A 3EZUA 1K1SA 1FD2A 1TU0B 2UU9F 1IBMF 2RHSB 1R79A 1W2BR 4PUOB 2OEGA 2DKOB 5CXTA 1YK9A 4U67Q 1HW9A 4BS2A 1ZM9A 2CYYA 2OSRA 1I94F 2DR5A 5KFAA 2NU0I 5DDOC 4F0HA 1U8WA 4DV3F 3BKFA 3O8WA 4NLDA 1LR9A 5F0UA 5AFUV 2WSEC 4IDKA 3D7SB 5L8RC 2YBVA 3GIRA 2UV8A 3U1MA 2IJRA 4QCLA 1XBTA 4CZCA 5K8MA 5ETVA 2SGEI 5KFHA 2IBOA 2CA9A 2AQ9A 2DXDA 4J9PA 2X52A 2RIJA 2ZEJA 3M9NB 5B0GA 2EG1A 4HI1A 5KT2A 2IDEA 4GKJJ 4DR1J 3FUYA 2HVEA 1RAAB 3CULA 1FWYA 1RT5A 5L9XA 1UL3A 4Y3CA 2FHJA 3NEKA 4F4YA 2VD3A 3D6FB 2W2QP 3AY0A 3CCTA 4LSNA 3BJYA 2VPWB 5THWA 5AXKA 5A76A 4J9MA 4I6WA 3OPKA 5B08A 3M8QB 1JXEA 2B4VA 2QT7A 1S6PB 2D7SA 4C0HA 3Q86A 1Q16B 5F8MA 1CS4A 4IH7A 1KK5A 3Q1XA 2VD4A 2FZKB 1MW7A 3PFEA 2VFTA 2Z57B 1YSJA 4ETZA 3EG4A 1PSDA 3ZTRA 3KHGA 2XTJP 2KMPA 2AJQA 2AIRB 4PXEA 3OH4A 1GTHA 2UVVA 4OHZA 2QLXA 1TBRR 3CJ5A 3DOKA 1EZZB 1RLDA 2OPPA 2V68A 1WGCA 3W60A 1FFWB 3OBIA 1UJ4A 1X5SA 1M5PC 1UFKA 1JJHA 3GQ8A 2GQ2A 3W2VA 1AUSL 3OGZA 2OI7A 2XMUA 1BQMB 2RS8A 1FFGB 5KG4A 4WU2A 1TP7A 1N6QA 2Y1RI 2G2OA 3T1AA 1KTQA 3ZTPA 4FF4A 1XK8A 3CDUA 1H7WA 4PPDA 2XEXA 4IRCA 3D00A 1KHWA 2OLWA 3MM7B 1EKRA 3X3UA 1VDDA 4QYZK 3CCVS 4DR7J 2ELIA 1PTQA 4ID5A 1IKYA 2GW8A 3ONQA 5AXNA 3IFEA 1VBYA 3HFZB 5KOXA 5J1EA 3MM5A 1R0RI 2D3O1 3VBLA 3SBMA 2V4RA 3QGHA 5LJ3Y 1YTPA 2E5GA 1B70B 2BM0A 5ETKA 1VQYA 2F7VA 2Z8QA 1UZDA 3HHEA 2N3LA 1E6VB 2HQCA 2NZCA 1LR8A 1UJ5A 4DMZA 2W0WA 4N76A 3POTB 4K8RA 2AQ4A 2G4BA 2WVBA 1CJKA 4P71A 3V81B 3T41A 1U2RA 2ICXA 4OYXA 4J09A 3OFHA 5ETPA 4M5JA 1SL2A 1YP2A 1T9TA 2PGCA 3DK5A 2DGSA 1FEEA 4NX9A 2VDIA 1GXTA 3B82A 2ZHBA 2EFGA 2ODDA 1CULA 1Z90A 3CNQP 4R37A 2KG1A 2E5LF 3CCUS 3J80Y 3TUPA 3L4BC 3Q8QB 3M4XA 1GAOA 2DRAA 4HT5A 3VTIA 2W7OA 1UA0A 3BGOP 4HHJA 1N5YA 1GXUA 5K9FA 3FK4A 1B0TA 4WKRA 4YB1P 3NS5A 3R5GA 1BMQB 4I1TA 4DV0F 2FLPA 2JSXA 4LR8A 3OT9A 2P8IA 2MY8A 2PA3A 4ED4A 1VI7A 2BBEA 1NBEB 4LIWA 5J2NA 1UVIA 4NL5A 1DQAA 4OYAA 1CJTA 2CJ9A 1BLUA 4CWBA 3SQOP 2HS4A 2VUGA 5E0OA 2J9DA 2IHR1 1X4EA 4URSA 4PABA 2QFJA 4USHA 4USIA 3NNCA 5HVHA 4JI7J 3BGLA 3CCES 3VVUA 3H5UA 2CJYB 3H5YA 4U7UK 2Z2LA 4NMXA 1IBKF 2ZBPA 1CVJA 2CQ1A 2HHWA 1BY9A 1UA1A 2HFVA 3UEYA 4ZVSB 1DRZA 3BSOA 3FZBA 3GIKA 3QT8A 3SV4A 2A2DA 4DS4A 2GHVC 5KT3A 4ZVPB 3GILA 1F3FA 1IXKA 2K9HA 2UZ3A 1SI9A 2BXJA 2KFYA 4M95A 5M2RA 2DNRA 4NCAA 2CZVC 2L08A 3E8OA 4FF3A 1HHQA 2CVEA 3T1HJ 3T5KA 2HYIB 4E6UA 1S6QB 4KQLA 4ZKAA 3D0GE 4MJKA 1Q9BA 1APSA 2XQCA 2QA1A 3NWRA 5EWGA 4X4NA 4HTIA 2VKZG 1CT0I 1FTCA 1O6XA 2COLA 4LSNB 3M9MB 3VBMA 4KE5A 3CIMA 1HWJA 1N8RT 4M5HA 1VLYA 1MG7A 3UI3A 2L8EA 2ROGA 2QZ8A 1U4BA 2V34A 2CPIA 5GADI 2QL9B 4RBVA 2AJ4A 1TL5A 3E2EA 3I9ZA 1CS4B 1C4CA 3TX0A 1VBXA 2E44A 2BQ3A 3QIPA 2ASYA 1VK8A 2BRLA 2CDQA 1PC5A 4N6AA 3SEKC 3DXBA 2R9LA 3EVOA 4B9MA 3LTOA 4R0JA 3J7YI 2XS7A 3RB4A 4YMEA 1GK8A 5FUWA 5I4MA 5KG6A 5EUHA 4ZPVR 1P6TA 3W5XA 3HULA 2LDYA 5CQGA 3OH2A 2PDAA 3CMAS 3M6VA 2Q79A 3G6XA 2Z58B 2K06A 2O01C 3U1NA 2HS0A 8AT1B 1FRMA 4RUCA 1N6QB 4FYVB 2XS2A 4Y2KA 1NJZA 1OO0B 1F5CA 3AFGA 1HJAI 5DLFA 1KBEA 2PD1A 1Z4UA 1VS3A 1L5UA 3PCOB 4H4KC 4IR9A 3HP6A 1HA1A 2MQLA 1KLMA 3CCJS 5IV4A 1IKWA 5J2PA 1KVKA 3BBCA 5A8RA 3L7OA 4M2AA 4J9KA 2FUG9 4NLSA 2NU4I 4ED5A 4ID5B 5B0DA 1IKYB 1SSMA 3NAHA 1SH0A 2YKPA 3PKMA 3CGIA 2BR0A 3MM5B 1Y11A 3BRKX 3BGUA 4ZHRA 2P9CA 2CJKA 1M8NA 4O3NA 1Z2FA 2FC8A 4OZNA 2HW3A 1XJWB 3FEZA 1X4AA 5E3RA 2ZVSA 5KTQA 2RJZA 3W65A 1Y9OA 4DL6A 2OMLA 4GO7X 1CJKB 1T11A 2F40A 2WONA 1KLNA 4CH7A 3E59A 2C2KB 1S59A 3N0VA 3CJ2A 1RADB 2HHHF 2X7IA 3CO9A 2NS1B 1ZPVA 1RJJA 2WB4A 2MSSA 2DHGA 1PBUA 4DCOB 4CLTA 2ALZA 1BXNA 4TY8A 2YY3A 5E3PA 3NG8A 1RQ0A 3A8JA 1CULB 4JI5F 1DARA 3L3CA 2O1PA 3QYYA 3OH0A 1QLNA 3AB4B 2HIYA 1W2IA 3MR2A 1R6YA 1OYVI 4UF4A 1UVJA 3AQPA 5DEPA 3H2UB 4QZVB 3S8SA 3H0PA 4M63A 2OD6A 4KGXB 3IWNC 1XX6A 1WC1A 1N5YB 5MLCV 2DVIA 2J9DE 5A6PA 1LFPA 4USUA 2XG8A 3BKUA 3HSGA 2F4VF 4KV8A 4HVZA 3BEGB 3UDEA 4TYBA 3AJDA 1B4SA 3CCZA 2N7CA 2ZITA 3DKDA 2ZZMA 2FVCA 3I82A 4DXLA 2GAGC 5IZHA 1S12A 4USKA 2AWZA 4OZJA 5D77A 2KZMA 1CJTB 2KM8C 1OQ6A 2HQ3A 4MFGA 3QSYB 1ZAXA 3HKWA 1UCNA 1IM4A 1U1MA 3OVBA 5GAEU 2IYIA 5IQQA 4B9UA 2P2CB 4IO1A 1S72S 3TJ9A 1UUCA 2V69A 2DH7A 1HBMA 2A1BA 1LNQA 1FCAA 2FLOA 2XSJA 2GX8A 4LREA 3I0SA 3GQ9A 3KNAA 1YJTA 3OL8A 2CQ4A 1XMQJ 1C0TA 1M5KC 2FZCB 1HR0F 4CYUA 5HBMA 3VV2B 3C6TA 3GCXP 2NPIA 1PO6A 1HI8A 3K59A 1Q5YA 3HVTA 3HLUA 2KMOA 1B64A 1R8AA 2ADCA 4JV2A 2CXEA 3W61A 3MZIA 2UXDJ 1RT1A 3I4PA 4GRSA 4DR4F 1HNIA 2LUYA 4CO5A 3KHHA 1NSKL 1WF1A 4TQSA 3T1YJ 2V1CA 2KDOA 3L7PA 2A0FB 4O3QA 3R7BB 4QR1A 2ZOMA 2BQUA 2CPJA 1U1LA 2HIQA 1O51A 1UAWA 5KFGA 1P1TA 2B9XA 5LXYA 2MDAA 1F0XA 1RU1A 4H4MA 3QIPB 1I94J 4UQGA 3NAIA 1XR6A 2J6TA 4DV3J 2HNYB 2NYHA 4Y34A 4IHHA 3PHEA 5K20B 2K8GA 1RA7A 1RHJB 3NWGA 4NZ6A 4PZVA 3AJ1A 2BACA 3IWLA 4M98A 2HFNA 1CHOI 2O5DA 4QW9A 2VRWB 1YI2S 2PQ8A 4QU6A 2WVFA 3IXCA 2IDLA 1C4AA 3US5A 2UXBF 2JLGA 4UW2A 4RZRA 1QAYA 4OHVA 4DUYF 4Y2CA 2MZTA 4J18A 4O44A 2XMTA 1RAIB 1FX4A 1I5OB 2K7KA 5J2PB 5FUVA 2HMIA 5J2MA 4I7FA 2BE7D 2GA7A 2V0LA 4WTYA 1KK4A 3QGGA 4LR7A 3ICLA 4HDHA 1RISA 2GHPA 2DITA 2ADBA 4ZHRB 2OI2A 4OI0A 1P9QC 4MPIA 2DGWA 2IYGA 1VJWA 4I6AA 2RDJA 2J0XA 2JA1A 4X66J 4NPOA 2JFDA 2IJNA 2JJ4D 4L3KA 2V0NA 4MH8A 1ZM3A 2Y8YA 3LGMA 3CCRS 2VPXB 3KLGA 1UEKA 2M7SA 1RTJB 1NNDA 1IR1A 1UKUA 4HHUA 2XY6A 4YOEA 3NZ2A 4X4UA 2RHQB 4TY8B 3FZ2A 3DN9A 2G9OA 2BJ9A 1DLOB 4DDFA 1JLEA 5FLXU 3DLBA 1XQIA 3CD7A 2FHJD 1P27B 1ZM2A 4ANEA 1NO8A 1RKIA 3DOLA 1KR4A 3OSPA 1TURA 3AQOA 3R0SA 2UUTA 4IOBA 1A0OB 3MR5A 1SPBP 1TKZA 4FN5A 2R7VA 2QC3A 2L9WA 4H54A 3SSSA 3QGIA 3M8SA 3QT5A 2VC1A 1QM9A 4ECZA 5DZ7A 2GIQA 4K5RA 1HV9A 1R6VA 4YR0A 3ZZUA 4CNZA 1PGZA 4MIAA 2C42A 3KJNB 2BUNA 2IBKA 2P2OA 2DHAA 2I5KA 3VGTA 4R7PA 1X5PA 1IWAA 1LR7A 4NEYA 4AFFA 4FPRA 2K7JA 3BYPA 3RTVA 3UN5A 2APOA 2LA6A 2XNQA 4ATNA 1HBMB 4AT1B 4DV1F 3GPAA 4KH0B 3GFXA 1Y5NB 5KFYA 4ECQA 1IN0A 5F9NA 1OCXA 2VICA 3I0SB 3OFEA 5HP1A 5EGYA 3BYRA 1C0TB 3LP0A 3DRSA 2CKWA 4CYUB 4KR0B 4ZVUB 3M2VA 1CQNA 5KFOA 4LF8J 4E2FB 4M2BA 2RRNA 2Z30B 1HPTA 2NREA 1RT1B 5I3QA 5ITHA 3EE3A 2YKAA 1AYEA 2FJWA 4DV0J 4QR2A 1FY7A 3GONA 2KKHA 1KHVA 2WBMA 1F3VA 2IRXA 3M8YA 1FDAA 4GVLA 1T9UA 1D9DA 2DGUA 1FXDA 1GX5A 4F4AA 3GJQB 3OH1A 2MHNA 3KLFB 3P47A 4LF7J 1WTBA 1YU6C 3TO6A 2HVIA 1Q81T 5A0YA 3H4BA 3P45B 4ED3A 2CJXB 1MRLA 2WSCC 5KFJA 3ILLA 3RB3A 3TA2A 3Q8VA 2BEFA 4B9LA 3M30A 2NZ4A 3J7AN 2BE2A 3TAQA 1IBKJ 3MAHA 2NYIA 4DPOA 3SCIE 3EXCX 3JAMY 1YJWS 1HPZB 2V2ZA 7FDRA 2EVZA 1U45A 1VQ8S 2WLFA 3VAHA 4ZVOB 3RJMB 4OYOA 2ZH8A 2IRUA 1SV5A 3TV0A 2CQDA 3N9UC 3RYLA 2FD2A 2I1RA 3GWCA 1S4FA 4ID8A 2H51B 2N52A 2GQQA 4KHPF
chains in the Genus database with same CATH topology
1FF2A 2GQCA 2QSFA 5D4LA 3BSCA 4RU9A 2KH9A 4QW8A 1X9WA 5LSRA 3PO4A 1N5SA 1Y0HA 3MM8A 2OTLS 1QSYA 2MB0B 1N5VA 5J2NB 1RWUA 4C3LA 4OV1A 3R1LA 1Q53A 4FBUA 1N88A 2VC0A 3MECB 4KFBA 4AL7A 5KFSA 4X66F 1LWEA 3V6DB 3MEGA 4QWBA 2QMWA 3EGNA 4DCLA 4FYDA 1QY7A 3KLHA 2L9DA 3CCLS 4RW7B 2JLFA 1JLGB 3I6PA 4ICLA 4RUAA 2V4JB 3KG1A 3M8PB 3FFIA 4K5SA 2QSWA 4O44B 4IFVB 4IOCQ 4W92B 3X1LB 3MD3A 3VZHA 5KFFA 5KFTA 1XMBA 2W9AA 1FA0A 3K0JA 3HHLA 1XN9A 2ZFHA 4DL5A 4M9CA 2C28A 4DLEA 5H9EJ 1LOUA 1FEHA 5HLFA 2HMIB 5I42A 1SJ3P 2DGXA 3RAMA 3U1LA 2VBYA 2HWIA 5BYQA 1RT3B 4OI2A 4ALZA 2AF6A 1VBZA 1MMNA 2UUWA 5J2MB 5DG8A 3OXGA 3V6KA 4I7FB 1HYSA 1JLAA 4Q43A 2LEBA 2FKOA 1YGYA 1JXLA 2IVYA 3E01A 3H20A 4MFBA 1RTDB 2GJIA 2IA6A 3KOAA 4CIOA 1H2VZ 3ENWA 2DH8A 2ZNZA 2YWEA 3Q8SB 4DR2F 4WYLA 1X0FA 5B0CA 3FSBA 4WU3A 2ZH3A 1B0VA 1VGYA 2FIUA 4KGMA 2W24A 4ES3A 3PVXA 3MM6A 3F1XA 1AUDA 2VG7A 2VBXA 4IH6A 1X0PA 2B56A 1S1UA 1U7LA 2W9BA 4L72B 1SL1A 1JJ4A 2V5HG 4RBTA 2WAQD 1SB6A 4MK7A 3JTNA 1DBDA 1KSPA 4Y65A 4KTQA 2J6SA 2VG5B 2IVFB 2AJFE 1WEYA 2LQBA 1TL3B 3HJFA 2NXUA 1U2FA 2E29A 4C2MA 1KN6A 3J7ZT 2HGLA 2XULA 3EPIA 1JNRB 4ED1A 4QBUA 1QAIA 2CPDA 2UVUA 4AC3A 4W90B 3LQVA 4G3SA 4PUOA 1V67A 3R2WA 1TKTB 3SI8A 5F8JA 2R2UA 2I5JA 4Y2MA 1KQFB 4FS2A 2QV6A 1C1CB 4JBCA 1RT7A 3ZZPA 5IWAF 4WCEQ 3V5RA 1NK6A 3RRKA 1S48A 5F9LA 3O3LA 1YQHA 3PR4A 1DFDA 2EFPA 2VA3A 4DL2A 2W9CB 4OX7A 3VAJA 3MF5A 3DM2A 4J9OA 2IA0A 2K3IA 4H4KA 4DFPA 1OPZA 3DMJB 3VALA 3KMSA 3MD1A 3AH6A 2ROPA 1RTHA 4JV0A 1NJIT 3ENQA 2PE8A 2IC7A 5F3TA 2IUAA 3D0IE 3N01A 4L3NA 2XBPA 4X4OA 3S01A 1D8ZA 2I8EA 1HL6A 3BO2A 3KWMA 3T5HA 5KFIA 4YFUA 2VL1A 2LQJA 4NMLA 4TU7A 4AXJA 1HM8A 4AL5A 2XLIA 3TAPA 4I6YA 3CEDA 1KRUA 4RW8B 1QRGA 2JL9A 3B8HA 3D5MA 4EBCA 4FF2A 5KG5A 4YR0A 4I0WA 4HL9A 1U1QA 2J0SD 4EFAC 2KN4A 3PMOA 3V4IA 1JNZB 5KFRA 1JLEB 4XPCA 3HVAA 3I96A 3CC4S 3KK2A 1HHSA 1HHTP 1VQSA 2NSBA 1CEZA 3FMBA 3ITHB 4UUXA 3FSCA 1MROB 2RMLA 3BZQA 3NCRA 5D4NA 3VQTA 5E3CA 4Q0BA 3CT9A 5U2KA 2R7RA 4WE1A 4HTJA 3OVAA 1H3DA 1MSWD 1GX6A 2HWHA 2IU8A 4DL4A 1NK7A 4F3MA 1S0VA 2GFFA 3R5CA 5CD4H 4ECVA 4FS1A 3OJSA 2DR8A 3DOLB 2IM3A 3SSRA 2X1BA 2JF2A 1S1XB 3T9NA 3TOQA 3RBEA 3NNHA 3FEXB 4MKYA 3H2VE 4O4RA 3TVKA 3H98A 3TIOA 4NCGA 1WHYA 2FJEB 1RKJA 2HNDA 3DLEA 1QRMA 1HQUB 3FOQA 4RWXA 3R5AA 4EO8A 1HW8A 3H2LA 3TX8A 5C24B 3FRYA 3UDLA 4EQYA 5D4PA 1S80A 1NK5A 1G97A 4K4WA 2MZRA 3IGJA 4EGLA 2MQQA 3SDEA 1ZOTA 2FLNA 3Q24A 1UEUA 4HZDA 1REVA 2GGPB 5DDQC 2X1AA 2KVIA 3SMZA 3V6JA 5KFZA 3FWWA 5E2QA 3P96A 4LQ3A 4PPZA 1THJA 2QRRA 4BWJA 1UP1A 3UFCX 3BSSA 3DLGA 3LP1B 1Q86T 4QYRA 5EHHA 4TU9A 3HZEA 2J76E 2I2YA 2E7WA 4A8XA 3TP2A 2ILZA 3OL6A 2XS5A 1S0MA 1J2VA 4YDDB 3HZGA 1SJQA 2POKA 1MMLA 1U6ZA 1ZBTA 2DCLA 5LMUF 1DQ8A 1S76D 3M8QA 2E9ZA 1EP4B 4OIXA 4BHQA 3A1YG 3OW2R 5KG1A 2VQFF 2JVRA 2GNKA 4PG6A 1S6PA 1A7GE 1YJUA 2U1AA 4QIFA 1JIHA 1TV6B 4MAKA 1RK8A 2BJDA 2D9PA 5IS2A 4RNNA 4X4PA 1K73T 4LF8F 2Q43A 2CPEA 2ATLA 3MTKA 3N4WA 3HMJG 4OX8A 1U09A 1U47A 1GT8A 2VQEF 3OR1B 4I2PA 2R4FA 3CD5A 3ZZYA 4DFJA 2NR0A 1N52B 2KHCA 2GGOA 1VQNS 1LXNA 3GYNA 4RBUA 1S6UA 3FGVA 3K7RA 3UDCA 3T9ZA 3CJ4A 5L1KA 4DFMA 2PSZA 1KOHA 3KK3A 2MKHA 3LO3A 2UV8G 3RU0A 5J2QA 1X9MA 2GC8A 4N8NA 2ASDA 1C1BA 1HBOB 4TNOA 4H7OA 1IKVA 4O0IA 1FKOA 2P6TA 4BCAA 3KYLA 4DN0A 2YX7A 5KFVA 4DG1B 2EBGA 2X51A 4Q45A 3Q22A 2CJAA 5KFPA 5KFBA 2VBZA 5G0RB 2YWFA 4MYOA 1DTTA 3DGPA 4EYHB 4RLEA 2B6AB 4ED2A 2IM0A 1TL1B 2VASA 3MGJA 1QSSA 3DLLQ 1KLMB 2B4UA 4M5DA 2RVJA 1IKWB 2FHKA 2KJVA 3LWMA 2WLCA 4Q8EA 2P6SA 3V6HA 2R8GA 3NLCA 1UVKA 1F5BA 4C11B 5A8RB 5HP1B 3K5LA 4K4UA 4AA7A 2GIRA 4LF7F 1S0NA 4GO5X 5K5MA 5AE2A 2W8KA 1XERA 3LP0B 5BYSA 1LKZA 2JEJA 1U6FA 5F8HA 2AYBA 1XNRF 2YX4A 2XMVA 3MR6A 3M2VB 1BQMA 4ELUA 5L38A 1Q4RA 5F8NA 1ZAWA 2R7SA 2VH7A 4QPTA 1NHUA 5F8IA 1UVLA 4FZVA 2Y0SD 2CQPA 3RRGA 2MKIA 2ZJRQ 4MIBA 4H4OA 1Y7PA 5FJ4A 1N0VC 4E1KA 3C66A 3PNIA 4NXMF 2ZH9A 1VC5A 4A4JA 2RU9A 5FDLA 3HDSA 1UVMA 4CT9A 4A48A 3JSYA 4QJVA 2OFHX 4XO0A 3PKYA 3GIIA 4DR5F 3ISZA 1JB0C 3MEEA