3FSYA

Structure of tetrahydrodipicolinate n-succinyltransferase (rv1201c;dapd) in complex with succinyl-coa from mycobacterium tuberculosis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
307
structure length
304
Chain Sequence
VTGAAGIGLATLAADGSVLDTWFPAPELTESGTSATSRLAVSDVPVELAALIGRDDDRRTETIAVRTVIGSLDDVAADPYDAYLRLHLLSHRLVAPHGLNAGGLFGVLTNVVWTNHGPCAIDGFEAVRARLRRRGPVTVYGVDKFPRMVDYVVPTGVRIADADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEGRISAGVVVGDGSDVGGGASIMGTLSTHVISIGKRCLLGANSGLGISLGDDCVVEAGLYVTAGTRVTMPDSNSVKARELSGSSNLLFRRNSVSGAVEVLARDGQGIAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional Structure of a mycobacterial DapD provides insights into DapD diversity and reveals unexpected particulars about the enzymatic mechanism.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Tetrahydrodipicolinate N-succinyltransferase
total genus 93
structure length 304
sequence length 307
chains with identical sequence B, C, D, E
ec nomenclature ec 2.3.1.117: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase.
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
A PF14789 THDPS_M Tetrahydrodipicolinate N-succinyltransferase middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3fsyA03
3.30.60.70 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Trimeric LpxA-like enzymes 3fsyA02
3.30.70.2010 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3fsyA01
1SSQA 4IHFA 2WLGA 3OU9A 3GOSA 3BXYA 1SSTA 1G95A 1KRVA 4IHHA 2V0LA 2VHEA 4EGGA 2ICXA 4E6TA 1XHDA 2IUAA 3R1WA 1V67A 2I5KA 1YP4A 2NPOA 4EQYA 4J09A 3R8YA 3R5BA 4M99A 4MFGA 2OI6A 3FS8A 3V4EA 2VD4A 3VBNA 2XATA 3FWWA 1XATA 5U2KA 5DEPA 1J2ZA 2IC7A 1KGQA 3P47A 2W0WA 1KK6A 3ECTA 5F42A 3FSXA 1V3WA 1KRRA 4M28A 3TDTA 2P2OA 3IXCA 2V0HA 4KNRA 3BSYA 4KPZA 4HUSA 4M9CA 3VBMA 2AQ9A 3MQHA 3R5AA 1MRLA 4R37A 3HJJA 3OUPA 4EA9A 4G3PA 1KK4A 5ADXU 4R36A 2W0VA 5L6VA 1KRUA 5L6SA 3R5CA 5ADXV 4MZUA 1MR7A 1MR9A 2WLDA 5DEMA 1KQAA 3P1BA 3TK8A 2Q4JA 4AA7A 2V0KA 3FSYA 5DG3A 1HV9A 3R5DA 4HZCA 1KGTA 4J18A 4E1KA 2IU9A 4KQLA 3D8VA 4EA7A 2WLEA 3R2WA 2ICYA 4M98A 4FCEA 3EG4A 4DCLA 4E79A 4E6UA 3BSWA 1SSMA 3PMOA 4HURA 4KNXA 3GUEA 5AFUV 2QIVX 1KHRA 3FSCA 2V0IA 3D98A 3FOQA 5E3QA 3BRKX 4N6AA 4EA8A 4AC3A 3FTTA 3VBJA 2OEFA 3NZ2A 3KWCA 4HCQA 3I3AA 1LXAA 2FKOA 3DHOA 3KWDA 3OTZA 4N27A 3R3RA 3MQGA 4E75A 2TDTA 3OTMA 4G3SA 3MC4A 1QRGA 5E3RA 1TDTA 3R3IA 4IHGA 1FWYA 3IGJA 3SPTA 3JQYA 5AFUU 3TIOA 4HZDA 2JF2A 4H7OA 4MYOA 1T3DA 1HM8A 3KWEA 3C8VA 1THJA 4R7PA 1QRLA 3BSSA 3TV0A 3Q1XA 3R0SA 4M2AA 4AAWA 2QIAA 3VBKA 2OEGA 4G3QA 3GVDA 1QRMA 4M2BA 2GGQA 5E3PA 1QRFA 4K6RA 3CJ8A 2JF3A 3EH0A 2RIJA 3I3XA 4EAAA 1Z90A 3FSBA 2V0JA 4KPXA 4ISXA 3BFPA 2QKXA 4N69A 1HM9A 1OCXA 3DJ4A 3TWDA 3VNPA 1YP2A 1FXJA 3SRTA 2OI7A 3F1XA 1QREA 4G87A 3VBIA 3VBLA 3HSQA 2GGOA 1KK5A 3T57A 2WLFA 1QQ0A 1YP3A 3TISA 1HM0A 2WLCA 4N6BA 3VBPA 4EABA 2IU8A 3DK5A 3EEVA 1S80A 3ST8A 2OI5A 3OW5A 1G97A
chains in the Genus database with same CATH superfamily
1P9QC 2PMHA 2WLGA 3E3XA 2H4WB 1HNWJ 5F0UA 5CABA 3UPFA 2R4FA 3KHHA 4QWAA 1VQOS 4CWBA 2C2DA 5HROA 1YZ7A 1PAEX 3A12A 2UVOA 4OV6A 4DL3A 3T6JA 2YH0A 2I5KA 2AEJA 2J8AA 1YP4A 3F0NA 2VIHA 1TKZB 4J09A 3TZYA 4X4PA 2RUSA 2B7BB 4HACA 3HVTB 2AP6A 2W9AA 1RKIA 4H4MB 1I3OB 3DM2B 2MHEA 2K1RB 1VOMA 3AD9C 3B82A 4DPXA 5KG5A 4OJ3A 3PW2A 1XERA 5ETSA 4ECTA 1X31C 1DAXA 4F8RA 1Q8LA 5J8FA 3BS9A 1ZA2B 4WFZA 1RDRA 2IAJB 4CLFA 4MPIA 2VFUA 2MSTA 1SJFA 5DGBA 4QW8A 5J2QB 5EGYA 5IQ6A 2YKMA 3PACA 1PCEA 4K2XA 4U9RA 2G0CA 2IRXA 3K58A 2LA6A 3BQ0A 2C2NA 3DRSB 4DV5J 3RB6A 1SJRA 1HNZJ 4NLGA 3VBMA 1OMTA 1FKOB 1KN6A 2JWNA 4LR8A 1MRLA 1KBRA 4FBTA 2GJIA 3GOXA 1B99A 4RPFA 4CH0S 5BYSA 3GWCA 2B4UA 2B51A 2ZWPA 4CO3A 1N5YA 5L6VA 4DV4J 2E29A 4DPTA 3UFFA 4CLZA 5DETA 2WHOA 5KFEA 1RTHA 1RLDA 3P8BB 2RDDA 3MM8B 3Q89A 4MFBA 4P2FA 1NK0A 2PC6A 2IVMA 2RDIA 3K5LA 3QZ7A 1FAQA 3VGVA 2YQ3A 2NU4I 1LWCA 3OT9A 5U47A 2F3CI 4AA7A 1R43A 4K7QA 5K14B 3ZTOA 3KLEA 4IFVB 2V67A 3D1OA 3AT1B 3NGKA 3W64A 1HW9A 1BQNA 2HRYA 4DV2J 1WD6A 2K2PA 1HQEB 1K1QA 1LFWA 3TANA 4Y0FA 1IWGA 1XIQA 1H98A 5AJ3J 2X3DA 1XMQJ 1KOHA 4W4MA 2AJ4A 4RLEA 3ZZYA 1BD6A 4DUTA 4JI5F 2V8PA 4GKJF 2RMLA 2XM3A 2BXJA 4HDHA 3LPYA 4KV8A 2MJNA 3VCDA 5E2QA 3IBCB 3VAMA 1W2IA 4UUWA 2CPZA 3ADAC 2LVWA 4ZKAA 3DLKB 4XTTA 4Y3CA 2DB1A 5DDQC 4Z2XA 5HSPA 2R9LA 2YKNA 3MAQA 4E75A 2HIYA 4PXCA 1ZAWA 1H73A 1TELA 2HLUA 1YQHA 4WKYA 1FWYA 1RT2A 1YJRA 2R7VA 1U6ZA 4ZP8A 1AUDA 3BSAA 2VF3A 5GAEI 2VPWB 3MMAB 2IBOA 1CT2I 4F26A 1N34F 2WOMA 3W8PA 1HBNB 2BJDA 1RI7A 3GQCA 3CIMA 1TUWA 1N36J 4X62F 4HLBA 1LEOA 3IS9B 3IA0A 1C0TB 1RT6B 3Q2SC 2NSCA 1QDUB 3ILJA 5D4OA 5J1EB 1U47A 4PG5A 1VRTB 2QTWA 4DL7A 1RCOB 1FEEA 3OL7A 3CB4A 4OHZA 3CD5A 2WVCA 2ZOMA 4QPXA 2QSWA 4I2QB 1IKVB 2BJ3A 4WP8A 1NAQA 1L5UA 2IY5B 3M2VB 4RR5A 4IH6A 2HBZB 3KJNB 2DTJA 4YHHF 3D00A 2FHMA 4LRFA 2RIJA 2DR6A 4B02A 2BR0A 3UW1A 2R2RA 3BH7B 1SGEI 5L1LA 4A8SA 3THTA 3IR5B 1SKUB 1TUVA 4FPRA 4WPAA 5FDLA 2HNDA 1PSDA 2XEXA 4FYVB 2DCUB 2SGEI 2WTFA 1HQUA 3CCZA 3QMQA 2NXEA 5I3QA 4ED8A 3R2CJ 2KZZA 3TAMB 2R7XA 2CXEA 2MY8A 4L3NA 4Q7AA 3TZWA 1FDAA 1ZS6A 4NPOA 1HMVA 1UTAA 2HAFA 3H4BA 2QQ0A 3QIPA 2W0TA 1S6OA 1G7CB 1T9TA 4CRJA 3OLAA 3MR7A 5CZXA 1IKWA 4ECXA 1HBNA 2RNEA 2DY9A 3PXGa 3CDWA 3CCUS 1RTDA 4E8UA 1G95A 3GSIA 2HGLA 3QZ8A 3ISZA 1REVB 3QYYA 3HHLD 2XMUA 1CT0I 1R8HA 1G6BA 2LEPA 4EWTA 2Q1LA 2NXCA 3PYDA 1S99A 3HO1A 3R8YA 5J1PA 2JHEA 5JMNA 3G8SA 2KB2A 2OI6A 4PG6A 1SJ1A 1W25A 1XNRJ 5DO2A 1IKWB 2ACMA 3KK3A 3BO2A 3W2VB 4OYZA 3U1NA 1Z2LA 2HHHJ 3G9CA 3POTB 1YITS 1JB0C 2AJ1A 1CS4A 1S9FA 2YNFA 3VZIA 3C8YA 3PVXA 1ULNA 3OR2B 4G1IA 1TOTA 4M28A 2GFFA 1OPIA 1HBMA 4C9DA 1ZM9A 3UI3A 3GIKA 4DV1J 4NEYA 3BSYA 3UWTA 1SKSA 3GJTB 4X4RA 4ZIWA 2EKNA 3BGRB 2OVOA 2AJ0A 2WRMA 3ZZRA 2BQUA 4IFVA 1S1XB 3FMBA 4WP9A 2OAUA 4WIQA 5C42B 3UDVA 2ENNA 3ET6A 3BKUA 1T9WA 1I94F 2I6WA 3DOLB 1RT2B 5L6SA 4DS5A 4UUXA 2NUHA 4QIVA 4P75A 4RWWA 5HROB 2MLZA 3SGQI 4O3SA 2JNJA 1XBTA 3VGUA 3H4DA 1RCXB 2E7WA 3MFHA 3ZZUA 4EO8A 2QMXA 3EUNA 1WTBA 3ELHA 4DSLA 4Q5VA 2F7VA 4LQ3A 2R8KA 5THWA 4XO0A 4I2PB 4QU6A 1EHWA 4J91A 1CGII 2GMLA 2GV1A 1NLKL 4CZCA 2ZH8A 3C2PA 1WOOA 3W2VA 4X64J 5IT9Y 3PR4A 1OQ6A 3LP2A 1AUSL 1YRXA 2IHR1 4Y2KA 2GVZB 1H2TZ 1FF2A 4AXIA 4OYBA 4KGMA 2ROWA 4RU9A 5T7LA 3IBWA 3GPAA 2VG7A 3OFHA 1F6TA 2HBQB 4J9PA 1WNEA 5DS7A 3SSRA 4A8MP 3I9V9 2CJYB 3FRYA 1S0MA 2AHOB 2J0QD 3UD4P 1ULRA 2B43A 4RW6A 4TQRA 2ROEA 4KFBA 2CZ4A 2DHAA 1VBXA 1JJHA 2W2QP 3MQGA 2XWYA 5L1IA 1YTPA 2C3UA 2OHDA 3LOUA 3BGOP 3EGNA 3ENAA 2HHSA 3MMBB 3R5JB 2EK6A 2V63A 4IG0B 5DQGA 2NCKL 1U0SA 4NLDA 3M2VA 1UA0A 1VQLS 2J6SA 1S49A 3ILLA 2GMJA 2RILA 5AXMA 2WVJA 3EGVA 4LSNA 3ICLA 2XNRA 2W9CB 4ETZA 1T3DA 2BE7D 1KFSA 1S20A 2R2SA 3BSSA 1M5SA 1VQKS 3PFEA 3UVJA 1VC5A 4LF1A 4Z37A 5KG2A 4M2AA 4FKYA 1UVLA 5CA5A 1QM9A 2ZM6J 3PG9A 3G71S 3N5BA 4P7TA 3GVDA 4PUOA 2V2VA 2R7QA 3M9OB 1JLFA 3SSQA 3D2WA 3Q24A 2N4CA 4LF5F 2JF3A 4USUA 4CM0A 1FHTA 1FWLA 1TL7A 1NZAA 4GKKF 1E6YA 1FO1A 4CO5A 1Y1CA 2CPHA 3DI6A 1OYVI 1RHUB 1RT3A 3NNHA 2CQ2A 2MYFA 4IG3B 4OL8A 2ZH1A 1R31A 3WIUA 2QN6B 5DLFA 2FNFX 3Q23A 4K4YA 1S0OA 3THVA 1TL3B 2F40A 2VUGA 5FJ4A 3C6TB 3UCZP 2DEIA 2AYGA 4PPZA 2H5EA 3TNVA 2DITA 5SUHA 1TP7A 1LOUA 1RABB 5JHWC 1SGRI 4PQUA 2WAQD 3GTYX 4M5GA 4BWMA 3IS9A 4ECUA 3TUPA 4QBUA 4X62J 3I55S 1ZYQA 4C11A 3POTA 2W9BA 1YI2S 2DR7A 2B7CB 1UA1A 1IR1A 1TAQA 2PN6A 3JYTB 1FERA 5RUBA 2UU9J 1FI4A 4B3MF 1JJ4A 1ACMB 2BJEA 5HP1B 2Y9HA 1CJUB 2BM1A 3GB0A 4EMDA 2V8GA 3V4EA 1YZ6A 2CG8A 2FZGB 3U1MA 4DXLA 4TXSA 4FYWB 1M90T 3QQCD 3GFHA 1Q95G 5U2KA 3LP2B 4E98A 1R0RI 2E9ZA 3A3PB 4DCJB 3DRPB 2BVZA 4ZVGA 4C98A 3RUBL 4DL2A 1U1PA 2Y8WA 2Y3YA 2HQDA 4CP5A 4NA1A 3ZO7A 3IR7B 4LSZB 5DQIA 1NDKA 1R8AA 1YSJA 2XZWA 3GYNA 2BDPA 5H9FK 2ZWOA 2GHWA 3HHLC 5HLFB 4EK2A 2KT3A 2BJ1A 1JLEA 5ETLA 2ZBIA 4Y28C 1YK9A 4KKOA 3L3CA 2CWXA 3V81A 4WE1A 3MMBA 2P6AC 3OH1A 4R36A 4IG0A 2VKRA 3KJQB 3LUYA 3TQ1A 4A8WA 4B9SA 3E59A 2D3ZA 1DURA 3QLHB 4DV7F 3EVWA 1RTJA 3PY8A 4M5JA 1LW0A 5C5JA 2M52A 3N5FA 2XS2A 5DG8A 3QWPA 4F2RA 1NPKA 2NS1B 3OJSA 4DV4F 2DK2A 2I8EA 5DG3A 3QAUA 4F4YA 1M8BA 3S8SA 3T1HF 1FDNA 2YWGA 4E1KA 2IU9A 2H51B 5AT1B 1VC6A 3D8VA 1VRTA 2E7XA 3ZZZA 4DPWA 4FS2A 4JBCA 2PI4A 1C0UB 2N7YA 3JQKA 3BSWA 4RW7B 4C0OC 3Q0AA 1NDPA 4FXVA 2DNHA 2IMWP 4KPYA 4I68A 3FFIB 3ISND 1RA7A 2HFUA 4L74A 4DSKA 5KFWA 4ELUA 4KYZA 2LEOA 2FHKA 3VBJA 1REGX 3QO9A 5HMXA 2E5LJ 3QRRA 4NLVA 1RAIB 2VPZB 1CJTB 5ETQA 1O6XA 2BX6A 3GP9A 3V6DA 1F9HA 2E5JA 3KWDA 3RW6A 4DUZJ 1HNIA 1AW0A 3R3RA 3M9MB 1S1TA 2FJEB 4HHUA 5FD1A 1P6TA 2QIFA 5A2QU 4OHWA 2QA4G 4WTOB 3DOMA 2Y8YA 1WKJA 4I6YA 2B9WA 2QRRA 2VRWB 4KHMA 4AT1B 1N36F 3BB5A 1WSVA 4JI1J 2UXDF 1KEKA 1S1WA 3TYTA 3M9NB 2A20A 1Z4UA 2B56A 3O3LA 3HXMA 4OI0A 4D3GA 3C15B 1DARA 1BMOA 2QA2A 4NLYA 5KFNA 2PD1A 4GO7X 4WFBQ 2CNOB 4RX6A 2ZHAA 2ZJPQ 3RRHA 1PC4A 5KT7A 3OVOA 1F2HA 4O23A 4ZPVR 1BQNB 3ZC4A 5BR8F 5HP1A 2CYYA 3PFOA 2OEGA 1D9FA 3GG1A 3CXCR 3BO3A 1CJKB 2GGQA 3G96A 1S72S 2VJVA 2ZZMA 2J9EA 3QFWA 1NUEA 2FIUA 1S7HA 4C3LA 1NK5A 1TK5A 4HI2A 1WHYA 1S1UB 1Z90A 1IBMJ 5CXTA 1BGXT 1OMSA 2RKIA 4X2BA 1Q4RA 1OCXA 1TQLA 5AJ3F 2HMIB 1UUCA 4J9MA 2EBEA 4OYAA 4JI4J 2HNYA 3DC2A 1DBDA 5A76A 1J5EJ 1QREA 2R8HA 3VVTA 1TL4A 4CTAB 3SUCA 1KR4A 1Q53A 2Q43A 1KK5A 2QJ3A 4NYOA 4UOHA 1XN9A 4A46A 3OL6A 1FE0A 2GVDA 2YPYA 2E7VA 1MWZA 2HRUA 2MQOA 4ED0A 2XYPB 2RD5C 3PRBA 4LFAJ 3BSOA 2MZRA 5HBMB 4OX9J 3D9BA 4FVMA 2JEIA 2IMOA 3FCHA 4J9QA 3OW5A 1B4SA 2H54B 4O44B 1U7LA 3K59A 1L3UA 3GOSA 3HHEA 5LJ3Y 3DNCA 1N33F 3JTNA 3M8QA 2N17A 1M5HA 2HNZA 4TYAA 4ZDNA 4EGGA 2DO0A 1TFYA 1RAHB 5F8JA 1WC5A 2IUAA 3D1HA 2K8GA 1H0HB 1OYDA 4NCAA 1Y1BA 4PUOB 3MM6B 4RWXA 4MT1A 1S79A 4MFGA 2H3EB 2VFTA 4JP8A 4PKDB 3KJVB 5B7WA 4DV5F 3WQPA 1PJUA 4B3RJ 5EX0A 2DR9A 3MMJA 5ETRA 2CPEA 5C2GA 2XATA 1GMVA 1RHMB 2V68A 1FXLA 5DAEA 3FKBA 1NK7A 3HVWA 4JYAF 1QTMA 4FZVA 1O51A 5KG6A 5LSRA 2J9CA 4DR3F 2C2EA 1DLOB 3CDEA 3TA2A 4ENOA 2Z56B 3SGBI 1TKTA 3KDOA 3J7YU 4OI2A 1C0UA 1RWPB 3TDTA 2ATCB 3NCRA 4P2SA 2M5YA 3BQ1A 3HVTA 4DLGA 3ZZPA 3Q8UA 2QFJA 4HUSA 2ZH4A 4JV5F 1N4LA 3OUYA 4Q8EA 2VG5A 3TEGA 2XI3A 2P5VA 4IQMA 3UDCA 3CJKA 3GFXA 4A8OA 4U67Q 4M1KA 3IM8A 1BY9A 4B9LA 4LBPA 4F02A 2XQCA 2UZAA 1KRUA 2QQEA 1VJWA 3HT0A 2H5JB 3IAS9 4L76A 2HMIA 2AJQA 3JAMY 2RF2B 2ZDOA 3AAWB 1MR9A 1Q7YT 1GH8A 1WEXA 1EAYC 3ILIA 2E9RX 3DLEB 1RB0A 4U7UD 1SC6A 2J7KA 5HMYA 3FQKA 2YX1A 1APSA 3FSYA 2KKHA 2QX0A 1KRPA 4J37A 1B70B 3DRYA 3VGTA 1YG0A 4X4QA 5LMNF 3DDNA 4K50A 1SCJB 3QIDA 3K5MA 1HI0P 2FDNA 1NK9A 1W7WA 4J9UE 2H65B 8AT1B 2ICYA 2JFKA 1WC6A 3PEHA 4J5OA 3ENWA 4ZK7M 2KI2A 5KFQA 4BS2A 1M5VC 2FY1A 4C4WA 4KNXA 1T94A 1FTCA 1PIEA 2HZAA 1RAOA 1C2PA 1UPPA 2H48B 4HTIA 4KT0C 4UW2A 4A8QA 2IVFB 3CJ2A 4C8OA 1X4BA 2CQ3A 2DNMA 2VD3A 3AA9A 3ET6B 2JVOA 4MKVA 5DJBA 5K8OA 1HBOA 2NU3I 1TVRA 2D41A 2FGOA 2GIFA 3CJ3A 2AJFE 4NWBA 1PTRA 2XHCA 4YY3J 3OVSA 4ZVSB 1T9XA 1HHSA 2DKOB 2P9EA 2RKIB 3GIJA 4P73A 1NJYA 1N5VA 2JXDA 2N1AB 3L4BC 2Z2LA 4C6AA 2V69A 1FWKA 4PR6A 2XCAA 1R8BA 3KHRA 1N5YB 2CPDA 3CMES 2HHWA 3TA1A 1VBKA 3JTPA 2OGUA 3UNYA 5DDPC 2GKTI 4J9LA 1ZPVA 5KT6A 1BUSA 1UEVA 4PQUB 2OPPA 2P9CA 3ISNC 5F8IA 2LDYA 2NREA 2ZBCA 3BSNA 3AQPA 2E5IA 1GTEA 2YH1A 3EGZA 3N6NA 2E1MC 3D28A 2SGFI 3C16A 3IC1A 1SI9A 3CJSA 4OV1A 4ZN3A 1DTTA 3PM9A 2QLBB 5KFRA 2KYXA 3H0PA 4MAKA 4OX8A 4G3IA 4ZJOA 3JSRA 3NWGA 3IGNA 4M5DA 2E9TA 2MJUA 4E1PA 3TQEA 4N69A 3SXLA 2UUBJ 3AOAA 3PKYA 4GMKA 4LR7A 1EZZB 4YB6A 1QUPA 1CE3A 1LR8A 4UF4A 4DSJA 3R1LA 3LP0A 3EYZA 4DFKA 1FTRA 1R27B 3FCVA 2YY3A 4F4XA 2Y0MA 3GCXP 2OTJS 2AEMA 4UXHA 1KBFA 1B7YB 1FX4A 1S6PA 2DH7A 2C3OA 4IFYB 4IH5A 5CYJA 4R8UB 2IU8A 2IJFA 3MMCB 2V8HA 4I64A 4QIWD 3U1LA 1ULKA 1HBUB 4NX9A 4UZCA 3T9ZA 3TUZC 3HVAA 4H4MA 2QQDA 4YB1P 5LMNJ 1RAGB 4KH0B 2FLPA 2GW8A 1MJAA 1RWUA 1MROA 1TKZA 2K7JA 2HZVA 2Y1JA 5DG7A 2V0LA 3K7RA 2N4DA 2DNKA 3OL0A 3N9UC 1C1CB 2OFHX 2HIQA 3A4TA 3H2VE 3W2WA 5KFDA 1NMEB 2DB6A 1Y10A 1PCAA 4X65F 2VICA 5A2QY 4NCBA 4LRCA 2KVQE 3W63A 4YS2A 2NU1I 1XA6A 1S59A 2GO8A 4Y2CA 2VD4A 5IFMA 4DV0F 3BDPA 1HEVA 1IJFB 1PBUA 5KFMA 1WC3A 1T3OA 1V3RA 4YY3F 2KXFA 1UWBA 5EHHA 4C2MA 5HMZA 3BBCA 4RW9B 3NS5A 4YMEA 2HK2A 3VAIA 1OPZA 4GVBA 4M8LA 2NXNA 3C6TA 1PAUB 3PIPQ 1PJ7A 2MZTA 3K8WA 3ECTA 1U48A 2MZSA 3QRQA 3KHLA 3UDEA 2V9WA 1VRQC 4K8RA 2DNPA 1NK8A 4ZLJA 1JX4A 3GONA 1YBTA 4KNRA 3CO9A 3LF0A 3PYEA 1S12A 4FPIA 2LB7A 4MK8A 4M9CA 2WVFA 4IR1A 3TJQA 1EETB 5IZHA 1T05A 4RW9A 4OYXA 4YB7A 3TW0A 3EICA 3HKWA 3B54A 1RA6A 3EE3A 2GQQA 2OI2A 3M8QB 3OXFA 2UVUA 2HHVA 2FLLA 2ELIA 1CJUA 1GXUA 3D6MB 3C46A 2QYGA 2AEFA 3D3BJ 3BR8A 1NDLA 1Y8FA 4NLWA 4P6QA 3Q8YA 4Q2LA 3DOLA 4DL0C 1NH7A 1YKWA 4DBQA 2CFXA 1U6BA 1TUGB 2CZVC 1N32F 5D78A 4NLTA 1LR9A 3K89A 4LF6J 4OZNA 1PJ6A 2YKOA 2AD9A 5LT5A 4AXJA 3D3CJ 5CD4H 1KNZA 1BWEA 1RISA 2ZE2A 3BR9A 1S6UA 3TO7A 2QT7A 3MPVA 3PJXA 4FCEA 4H54A 4KGZB 4M63A 2NPFA 1KS2A 3U7JA 2ZHOA 1C4AA 1Z7KB 3I6PA 3PYFA 2EEYA 4DCPB 4CIOA 2DR5A 1X74A 6AT1B 3D1QA 5FIIA 5JJBA 1QAJA 4UY85 1URNA 3E2IA 3B4VC 4AC3A 2JOQA 5L9XA 4X4SA 2SGDI 2BBEA 3HFZB 4Y34A 1ZH5A 2E66A 4JI5J 1FK9B 3MEGB 4G1PA 4ICLB 2EFPA 2WBRA 3DHOA 2FYXA 2VC0A 1HR0J 1CULA 3DOKA 4LF7F 4FXDA 1T7PA 3NCPA 1U0HA 2R7TA 5LXRA 2TDTA 3G6ES 3VAGA 3V4IA 3OXGA 5DZ7A 2UXCF 2GKVA 2GQ2A 2MKJA 2AJ2A 4AD6A 2A0FB 1U4BA 1TBRR 4X4VA 1RT6A 3W61A 1J27A 2ALYB 4YN3B 4DR4F 3H5YA 4DR2F 2MGZB 2EWHA 2KHCA 3ITHB 2XMVA 1SGNI 2OPSA 3E51A 2D74B 2BW7A 4ZP6A 3TVKA 1Q5VA 2OH2A 3HHNB 3KOAA 2RJZA 2ZH2A 1X8DA 5EDWA 1OVOA 2B6AA 2CNNB 3RBZA 2V2QA 3M6WA 4KQZA 2GX8A 3NS6A 4O3OA 3TAMA 1X4EA 3JSYA 2DRBA 2CUYA 1WJ9A 2HKEA 1Q5YA 4FF1A 1U8SA 2V50A 3FEZA 4DG1A 4XDDA 2ZUAA 3EH0A 2L08A 3UFCX 2HNDB 4M5IA 3TJAA 4F4KA 1WUUA 3K2YA 3AJ1A 3H8YA 1WTFA 3QT5A 5ETOA 1K44A 1TAUA 1YJUA 1WF0A 4MFBB 3DJ4A 1UPMB 3BGUA 5K5MA 3F44A 1FVSA 2B9XA 4GVLA 5A8RA 3UO0A 4RW6B 3SRTA 3CT9A 3BJIA 1XMOJ 2GS8A 3N6LA 2LU1A 5L9NA 2HVDA 5LOQA 1IBMF 3OTEA 3VBLA 3MZIA 4RNFA 4OZ5A 3NGUA 1A6LA 3M6UA 4C7QA 1JLFB 5D6GA 1HNXJ 4RJVA 4Y2IA 3M2RB 5C2CA 5HQLA 3MM7B 4N6BA 3NOGA 4R5PA 1RTDB 2HQFA 4PWWA 4O4GB 2R2UA 4IYQA 4CLLA 3EMTA 4X84A 4RNMA 2ZZNA 2IM3A 5C24B 3CCLS 1WORA 4WZQA 2MQMA 1D8ZA 3CMQA 2GVIA 1MN9A 1KRVA 3JB9k 5IXUA 4DSIA 4CTAA 2XSJA 2Y1RI 3BYPA 1WEYA 4KHRA 1Q8IA 2XRCA 1C1BB 1DTTB 3D5MA 2R3VA 4CO4A 1U49A 1IBKF 4C8ZA 4IQXA 1XMOF 1KTVA 1Q9BA 1X5PA 2DKVA 1SGYI 2M5XA 1Y00A 2L9NA 3DLGB 4QWDA 4WFAQ 4Y2MA 2L48A 4USVA 4CNZA 3A8KA 1QAIA 1WKXA 1XATA 2RQKA 2H1YA 2VASA 2YX7A 3K5OA 5J2NA 1E6VB 1NPPA 3AOBA 1WDTA 1U45A 4N7TA 3P47A 2A10A 1GK8A 3M6VA 2AGPA 2GAGC 1KK6A 3F56A 5F42A 3M8ZA 3LTOA 2W2MP 3TJ9A 2KM8B 2C22A 1KRRA 2ENZA 1XR7A 3T1YJ 1ZTTA 1NJIT 2AYMA 1N6QA 4F4ZA 3EJMA 1LW0B 4BC9A 4NEZA 3OSNA 2HQIA 2CQPA 2J9DA 3QT6A 4CYUA 4FF2A 1WF1A 3OUPA 4P72A 2DNRA 4I2PA 4U7CA 3PZPA 1KLMA 3BN4A 1JLGA 5H9EK 2W0VA 2BOAA 2FY8A 4KR0B 4JI3J 3T5HA 4NXNJ 4ED3A 1RUSA 4OYOA 5CYQB 1HPZA 3PJ9A 5B0EA 3V4IB 4B9UA 2K06A 5T7LB 4I4BA 2CQGA 1TL1A 4DV7J 3CCES 3V6KA 1RZMA 1UFKA 2MKHA 4F7VA 3TX8A 4JI3F 1XC9A 3FBEA 2VOOA 1NDCA 2BQRA 2HWIA 1OY9A 3NG8A 6FDRA 3K5NA 4DQSA 1BWVA 7AT1B 1CSOI 1UW9A 3KHGA 2ZBQA 1SIWB 4V1Ak 3DGPA 5I3UB 1M5KC 2CNLB 2NXUA 1IQZA 2OUGA 4E6UA 2ORWA 2BABA 2LQ8A 5DQHA 3ETMA 2XTJP 3T1YF 4ZVOB 1KLNA 1TL1B 2GMHA 4X64F 2B8QA 1TBOA 2XWXA 2EFVA 4N6AA 4CLTA 3H2UB 1FXDA 3VAHA 1XMBA 4FNHA 1RWMB 1KQGB 2NPIA 3HI9A 2V9KA 3O44A 1ZM2A 5A8WA 2NZCA 4DQQA 2HHTA 1N32J 3P96A 1WG4A 2FKOA 2E5GA 4C48A 5C42A 2VA3A 3FSIA 2VQEJ 4ED1A 2PA3A 3UVJB 1LK7A 1SPBP 3C14B 2N82B 2FJVA 2YQ1A 2QFIA 1MLAA 4WKRA 3GJQB 1FY7A 2ODDA 1QUVA 2V2ZA 1NJWA 1GX6A 4DL6A 1RAJA 1QVGR 1I94J 3KLGB 5M2UA 1IWAA 1W2BR 3OHBA 4DQIA 3KG0A 4H7OA 4OI4A 2I1RA 1J2VA 4DR7F 2JSXA 2OD1A 3KLIA 4M95A 3D0GE 4F2SA 5CCMA 1UL3A 1X4CA 5A8RB 1EIYB 1KSPA 3C14A 2YKMB 2YWEA 3GJRB 2O66A 4ZVEA 4DPYA 5KFHA 5L39A 3C15A 3KK3B 4O0NA 3SV4A 1HYSA 5KT5A 5A8KA 2EPIA 2VJUA 2Q6BA 4Q45A 4DL4A 2VDHA 1QVFR 2DXFA 3M30A 3TRGA 5ITHA 4MKAA 3MEEB 5AXNA 2MXYA 1TU0B 3B8HA 5I4MA 1DFDA 4KIAA 3UN2A 2HFOA 3AXMA 2WLFA 1K47A 2I9SA 2MQLA 5IT4A 4O0IA 4B9NA 2GA7A 2VA2A 2DYAA 2H5IB 4BDPA 2HQCA 5DZ6A 2VL1A 4NCGB 4YR0A 5KFOA 1N6QB 3NAHA 4NI2B 3KMQA 1CQNA 1NXIA 3D67A 2JW6A 1CHOI 2BKOA 3HZEA 3NGRA 4LT6A 3HM9A 3HVRA 2HVHA 1RHKB 4LFCF 5HI7A 2IDEA 2V34A 4IHHA 2OTLS 2NYHA 1KLMB 2ARPF 4KV8B 1P1TA 1KONA 1R6VA 2DNOA 2GGPA 4UY8T 2DIVA 2CPFA 2NPOA 4DSEA 2WW8A 4PG8A 4DPOA 3A8EA 2PA8D 1WHWA 4NL5A 4RBUA 4NI2A 4I0WA 1UAWA 1Y3KA 3HULA 3GSDA 1KKHA 2A1BA 5KG4A 1N5SA 3EPIA 1SL2A 1UETA 1XK8A 4ZPCA 4F4WA 1IKXA 4AL5A 3CC4S 1HD1A 1F9EB 2JC1A 4IOBA 2BE2B 4LF6F 4IFYA 2WCXA 1S4EA 4LJMA 3UE2A 4AFFA 4CLSA 2BM0A 1IQTA 1N0VC 3SSSA 4DX6A 2ZJRQ 3RRGA 4USWA 2RRAA 2KG1A 3CDAA 2R7OA 2B9YA 1G3OA 2VFSA 1U1RA 3R5AA 2WB1D 3KDNA 4PQAA 3G6YA 2HHXA 3QWUA 1RBOB 3MDFA 4URGA 1D3WA 3TA0A 1HIYA 3P3DA 3HMJG 2QSFA 2MSSA 4X4NA 2C28A 2DD8S 1NHVA 3OXLA 1BUXA 1TKXB 2DHSA 4MZUA 3HCXA 3BBBA 2HQGA 4LRDA 3V4MA 1CGJI 4H4OB 5KFAA 1VDHA 4UQGA 4JCVE 1YX2A 4URQU 2OD4A 3VGSA 1ZZNA 2FTRA 3MUMP 2W9CA 3BSCA 2VKZG 1NK6A 3A13A 2A3JA 3R5DA 2IVYA 1KGTA 1EETA 1H74A 1OY6A 2VC1A 3GYXB 2KH9A 2XY5A 2UU9F 2PSZA 4GKJJ 1U1KA 3RBEA 1NEEA 5K14A 4ILMA 1K0TA 3QPIA 4E79A 5EWGA 1RT5B 3CNQP 1ROFA 3QNWB 5T41A 3TUIC 3UN5A 4CLKA 5IM0B 3H40A 3SV3A 2V0IA 3O2IA 3IM9A 4HH0A 2MQ8A 2CRLA 3CCWA 1S1WB 1R0BG 3KUGA 3NZ2A 2ILZA 2U2FA 1HFEL 4OZLA 3SMZA 1TR0A 2RHSB 3I4HX 2CJQA 2OEJA 1YDLA 2J0XA 4MTPA 4WYLA 1KMAA 3K57A 3HH2C 4OYPA 4XPCA 1KQSR 3DMJA 3MEEA 3OTMA 1RSCA 4RNNA 2IA6A 2RU3A 3DU6A 5D3GA 1TDTA 2XMAA 4IHGA 1RAFB 3HFKA 1NPRA 3VF0B 2JLEA 1PPFI 2EFNA 2VZ9A 1D0EA 3ULHA 2BZ2A 3FBFA 1D09B 1MT1A 3DRRB 2W4PA 3TAPA 2JJ4D 2ATLA 3IWNC 1Y5IB 2IPOB 4DI6A 1SUQA 1TMJA 2SGPI 1FRHA 4X4OA 3M6XA 1K7TA 2PFDA 1CLFA 3Q8PB 4X66F 3QTLD 1GMWD 1T9VA 2IRUA 1S7IA 2QL9B 4U8VA 5FLXY 4LF7J 2CPJA 1XR5A 4QR2A 5HATA 1MN7A 4K4XA 1RHJB 2DGVA 2X52A 2GHPA 2HFSA 3DN9A 3GR1A 3UR3C 1GEHA 3MCNA 2OEKA 3PRDA 5AE1A 1U1QA 1RGVA 4ISXA 5FUWA 2ZNYA 1B3TA 1N88A 3TWDA 1NHUA 1PBAA 3DLBA 2UUBF 1KFDA 4GO5X 1YP2A 3B4MA 3UD3P 1HBOB 2LP4A 5D4LA 2OI7A 4KY3A 3TOBA 4IRCA 3KUHA 1R0AA 4FS1A 2J0WA 4M5MA 3NS7B 5HQMA 2ALZA 1XWLA 5C7PA 3AA8A 1XNQJ 2G2ZA 3SZ2A 1HNWF 1P9ZA 3GJSB 2RS8A 4A24A 2RQMA 4DN9A 4EYHB 1TBNA 3DXSX 3R27A 4RUAA 2C2RA 2DNNA 3CC7S 4ILLA 2CQ1A 5IT9U 1BHNA 4GRSA 1XBWA 3I0RB 4U6PA 2D9OA 4QWEA 1Q8KA 1Y5NB 2V4RA 3CULA 4C3MA 3CCSS 4O3PA 3GE9A 1N34J 4I7FA 1XTZA 3DM2A 4URSA 4WF9Q 3IN5A 3AXKA 2ZDPA 2YWFA 1S1TB 2C3MA 3R5BA 4OYWA 2RF2A 2OJ3A 2H4YB 4HT5A 2RT3A 3M4XA 3W2WB 1HPTA 1S1UA 3GQ8A 4OI1A 1IM6A 1SC4B 2WK4A 4ZITA 5DEPA 3CJKB 1Q81T 2VH7A 4JOUA 5ETKA 4Y2AA 4RBVA 1HARA 2E5HA 2HS0A 4LRBA 4AE5A 1NO8A 2AF6A 3N4WA 4N41A 1S5ZA 4MYTA 1HQUB 4PZVA 1JLQA 3H5UA 4E1RA 1R0AB 1X60A 3MM5A 3OFEA 2FQQB 2CDQA 2P2OA 2CJAA 3MCSA 3Q83A 1W3SA 2F4FA 2KRRA 1RLCL 2ABYA 2M9KA 2PEHA 4FYXB 4BHQA 4F3MA 3VALA 2E44A 4ZVPB 2E1CA 3MOZA 3OTBA 2EXUA 2IC3B 4PXBA 3MUTP 4CLYA 1U1LA 1P9YA 4JI1F 1AN1I 4K4ZA 4IDKB 4NYPA 2VG6B 4WXWA 1CVJA 5ETNA 1MROB 1R7IA 2IA0A 4ZVTB 5CQGA 1YJWS 2CWFA 5KT3A 4Q44A 2W4DA 1KQAA 1VLYA 4C0BA 2X1AA 2RQ4A 2I0XA 2CG4A 3TK8A 2DY1A 4WYWA 4ZPBA 4A8YA 1V1IA 2JEGA 4OZ1A 1SV5A 1YRTA 1SXLA 4HZCA 3IR6B 1PJ5A 2ZOFA 3SCLE 2YX4A 2QEXS 4NRTA 4W98A 2NXJA 1WGCA 1AYEA 1VYAA 3E8OA 5E33A 4I6AA 2AGQA 2PFFB 5I42A 4M98A 2QLXA 1EP4A 1OS5A 2Y0BB 3OFFA 3PMOA 3CDUA 3DXBA 1KHVA 1HPZB 2Z58B 2G2YA 3PHEA 2D69A 2WVDA 3PCOB 3MM9A 3BDEA 3DLKA 5E3QA 5BYQA 1L3SA 4K0KJ 2K7KA 1YU6C 3EVOA 5IC6B 2RQCA 3T1HJ 2XLJA 2QL5B 3FZBA 3PHTA 2KFNA 4OQJA 5AXKA 2CDRB 2HQ3A 3FBCA 4C8NA 4ANEA 1HNVA 2XLKA 1FNXH 5HN0A 2ERRA 2G1HA 4P52A 2XNQA 4DR1F 1QRGA 4QJVA 1TKXA 4Q8FA 3QJJA 3QAHA 1EARA 1FXRA 4CCHA 1KVKA 2V4JA 3BJYA 2LMIA 1JK9B 3FEXB 2KG0A 3Q8QB 1URRA 3CJ4A 1DLOA 5K20B 2YNHB 3EDRB 1S6PB 2CQCA 4CLUA 5HO4A 3I0RA 1R8CA 1VK3A 1HM8A 1WWHA 5KFJA 1HLWA 3CO0P 3SEKC 2DNLA 1JXEA 1SL1A 3TV0A 2D1CA 1UCNA 1SKWA 2KMQA 4JI2F 4DMZA 4ZHRA 4LFAF 2BOPA 3TARA 1Y7PA 4QU7A 3J7YI 3NMAA 5K8MA 5DM7Q 1QY7A 4ELVA 2EW9A 2IDLA 5G4DA 2JEJA 1VQNS 2ROPA 4TU9A 4K6RA 1P1LA 2F1FA 4RW4B 4I7FB 2Q79A 3VQTA 4OLPA 3J7Z5 4MMOA 3MM9B 1O8BA 1JKHB 2EK1A 1PKUA 3TZXA 2W4CA 3BFPA 2V0NA 1X7VA 3I31A 4LSLB 3TVYA 5KAKA 3MD3A 4B3OA 1RTIA 3MCOA 1NKCA 1FXJA 4USTA 3WIVA 1TTHB 1F0XA 2V2KA 2UP1A 2PDAA 4CO1A 1Y5LB 4G87A 2D3UA 3M8YA 2BQ3A 4DR7J 4Z7CA 5KFBA 4ZVHA 2OMLA 2XO6A 2JFDA 4USIA 2JLFA 4EABA 4ED2A 2I5JB 3BGRA 3AJ2A 2V4JB 4WP3A 3W62A 3EZ5A 3JSMB 1HBMB 2UXBF 4DL5A 1KWMA 4ID8A 7WGAA 4I1TA 3Q8SB 2BMBA 4AL6A 3CTRA 4DFPA 4ECVA 2FVRA 4PRFA 4JV1A 2W24A 1CS4B 3CVKA 1CEZA 2QLJB 2CQIA 1TVRB 2HVEA 2QG9B 3OFGA 1NU4A 1VJQA 3QO9B 1HJAI 3THPA 4H4OA 1S1VB 4TY8B 3VTIA 3J7A1 4U8YA 4WK3A 2YKPA 3FQLA 1G4CA 3TI0A 3FS8A 1FEHA 5CCLA 1F3VA 4EGLA 3MEDA 5KTQA 3OSPA 3DRXA 2DISA 2MKYA 4PEOA 4C8YA 4Y65A 1WSRA 3IO1A 8RUCA 2P6SA 2FVSA 3CD6S 4QYZJ 4KAIA 1D9DA 4P71A 2OU2A 3UR0A 2W0WA 5KFGA 3RW7A 2GKRI 1IY6A 1OYEA 1B7FA 3C6UB 4RUHA 2C1EB 3M7VA 4K0KF 2YTCA 1E6VA 1RAEB 1CG2A 5C25A 1RTJB 2UUTA 3M8RA 1AZSA 1EX8A 1ZM3A 1R8PA 2KMRA 4KPZA 3HX9A 2Q6CA 3UQSA 1TKDA 2OIHA 4K4UA 3RB3A 4PWDA 3HT3A 2CJ9A 4R37A 2R7WA 1AROP 4USHA 3RB0A 1RKJA 4G3PA 2X3TA 1U2CA 4HHHA 3PKMA 1S76D 5B09A 3NBPB 2GIRA 1D1UA 5KT2A 2KZMA 1DS2I 3DU5A 2JL9A 1FESA 1MR7A 1RHQB 1X4GA 3IMQJ 5GAGI 2FJXA 5DEMA 2XMJA 4DDFA 2Y1LB 2GO9A 4CH1A 1L3KA 4RBTA 2C2ZB 4BCAA 2GGPB 3IWXA 1S4FA 1BLUA 4NZ0A 4TY8A 1S0VA 2ZKTA 2VODA 1PYTA 4LF9F 2HRTA 2M3DA 2WSFC 4TLQA 4B6DA 1OSCA 2N71A 2K3KA 2M88A 2M70A 4WIIA 5D4PA 3ZTSA 3MPDA 2EFOA 3W9IA 2I2YA 1NKEA 4ILRA 2QO3A 4JI4F 1MMDA 4QYZK 3D0HE 3CCRS 5B0FA 2UVVA 4A8FA 5B0DA 2AWZA 3DGPB 4Y00A 5I3UA 4ATNA 1IBKJ 4ED5A 2F9DA 1AFJA 4DLEA 4DEZA 5CAAA 2OEFA 3GV5B 1RWOB 2YVSA 3KWMA 2HBRB 2MKSA 2X7IA 4E2FB 4JB8B 1ZZFA 3I3AA 4IG3A 4QR1A 4N5SA 3KLHB 3LP1B 4HT7A 2UZ3A 1T9UA 2YWWA 3MECB 4JI8F 1JLEB 2XY7A 1SBRA 4M94A 3NNCA 3NCQA 4ZCLA 2RS2A 1V5VA 2VG6A 3LALA 1CJTA 5E3RA 2CQ0A 5IQQA 2VBZA 3M2UA 3ZTRA 2UUAJ 4UTGA 3CIZA 3TUJC 4YQWA 4P74A 1QSLA 1HYSB 4GVBB 1K0VA 3CF5Q 1TL3A 1SB6A 1IJEB 5GAGU 1HNXF 2UUCF 1VQ6S 3NMRA 2ZC4A 3DHXA 3I5AA 4KBIA 1U25A 4NXMJ 1VHFA 3HHLB 4B08A 1YJTA 1RQ0A 1WEZA 3PRVA 3FCWA 4R7PA 2A6OA 1RT3B 1LXJA 3FDSA 2ASLA 1QAXA 2VQEF 4DQRA 1Y3JA 3GR0A 2ZE2B 3G4SS 4ECRA 1N48A 3EX7B 3JXOA 1TL7B 2MEWA 3SDEA 3X1LB 1U2FA 4DV6F 1VCTA 1T03A 2ZH3A 1TZ0A 3CJ8A 4A8XA 2E5LF 2X1BA 3CW2C 1XX6A 3VVUA 1T8EA 1YVFA 2C3PA 1QAYA 2XZTB 2AZ3A 3M1VA 2QKXA 1WC1A 4TYBA 1FJGJ 4XDCA 3T6BA 5L1JA 3LAMA 1R0CB 3JAMU 3EGWB 1H2VZ 1WACA 2VPYB 4DUYJ 3M30B 1U2RA 3DYAA 2VU5A 1X0PA 2PMWA 2CVIA 5D15A 4DR2J 2DCLA 2VV5A 2R7RA 2IYGA 3MGJA 5F3ZA 2F4VF 3IG1A 3CD7A 5L8RC 2B4VA 3GQ9A 3TISA 1LWFB 5DRKA 4DPUA 4LF5J 2ZM6F 3MOJB 2WCYA 2HW3A 1S80A 3L7OA 1P9GA 1K1SA 1HD0A 3A3NB 4N8OA 2QYCA 4IOAQ 3UN3A 3QT8A 1T9YA 2CPIA 4WK1A 3ITHA 4Q2MA 2F9JA 3HPOA 2WOMB 4Y6IA 2DGQA 2FLNA 2Z2ZA 1ZAVA 1CQMA 2G0IA 3LGMA 4L73A 4F0KA 4FBUA 2RAQA 3IBFB 3U02A 3L95X 3NBPA 1H0ZA 1S9EA 2C2MB 2EG1A 5HQ8A 1TV6B 4M99A 1X5OA 2GNKA 2XC9A 4DUYF 3BV8A 1FJGF 3KY9A 2B5JB 1FRMA 1KD1T 1UFWA 3VDPA 4ZCMA 4HH1A 1N0UA 2POKA 1EB0A 2VQFJ 4DS4A 1FARA 4P2MA 2E5RA 1H38A 1KGQA 4R0JA 1IR0A 3AJDA 4LF2A 4DV6J 4TU8A 1FA0A 3VWSA 5DGAA 5DDOC 2KHDA 1UP1A 2FJAB 4FVCA 2OPQA 5LSOA 2BJ7A 2MPUA 4O3RA 3QBCA 3BPDA 3BPSP 3US5A 2HURA 2AT1B 2V0HA 3TAQA 4X4UA 1DTQB 1LQ9A 1U1MA 3UCGA 5IWAJ 1TKTB 3I56S 3LH2S 1FD2A 4R8UA 4Q43A 2KTQA 5CYMB 5HVGA 1Q8BA 3VV2B 5J2MB 3DDKA 2DNQA 4U96A 1UVNA 1KQKA 1B64A 1IN0A 1EKRA 5ADXV 1P27B 2JX2A 5IWAF 1SH0A 1UZDA 4MKBA 4HGUA 2CJKA 1L0SA 3FC3A 5F8LA 2N3OA 4HI1A 3IRXB 1C1BA 1SQGA 2OEMA 4RZRA 5GMDA 2BANA 1ZM4A 2Z30B 2ZHBA 3MM6A 2XHWA 2KT2A 5T14A 1KVJA 3GCWP 3M32B 4GC7A 1NKBA 1RTZA 4CNYA 2QA4S 3KTQA 2ERWA 1RU2A 2I5JA 3EDQB 1SVDA 4KQLA 1LNQA 2CWKA 4ZHRB 3TJ8A 2KN4A 4LREA 4DCOB 3AQOA 3D4JA 4EEYA 2KJVA 2XY6A 2XMMA 3O1LA 1FJCA 1H7XA 3GUEA 4WBFA 3WC0A 1KHRA 4ED4A 3FSCA 3FOQA 3I5BA 2YNFB 3BM7A 1Z2ZA 4L3KA 2V6AA 4YOEA 1JLAB 1JKHA 4WU2A 4J7CA 4PG7A 3FEYB 3GFYA 1K8AT 3QSIA 3OW2R 1REVA 3Q22A 1DHMA 5KFXA 2MB0B 3MI7X 4OX7A 7FDRA 2IIHA 3CJ5A 1PG5B 3PYGA 1NJZA 2O3DA 3MM8A 1NXUA 2HFVA 1RT4B 4PG4A 1FYBA 2IRYA 4NASA 2DGWA 2WVBA 2Z57B 3AB4B 3UGLA 1RWKB 2MKIA 5AFUU 1JLAA 1KDNA 3I9ZA 3LANA 3NGTA 1K9MT 3KG1A 1IVZA 3IG1B 1X4SA 4FYYB 5AE3A 4MYOA 3WBZA 1HKAA 2HS3A 3OTDA 4J9VA 4NYZA 3ZTPA 3V6JA 3RR7A 3BN7A 1W4RA 4DU7A 3CJTA 3EVMA 4IH7A 4KGXB 1KTQA 5GAEU 1PYSB 3HLUA 2K9HA 2HVZA 4N56A 3PW4A 2O1PA 2HAIA 2QIAA 3VBKA 2YUUA 3QAEA 1MSWD 3G82B 4G3QA 1Y4ZB 4ZP9A 1CBKA 4M2BA 1N5QA 1YWXA 3Q86A 3TR5A 2RC4A 4DV3F 1HHQA 3KNGA 3N28A 1H2UX 1U09A 2KMPA 4HEA9 3RYLA 4EYIB 4UOFA 2IYIA 2V0JA 5F0WA 5CYQA 2YKNB 3G2XA 4XAKA 2WBMA 1OSDA 1MMNA 2HG4A 1QE1B 3OVBA 1YJVA 3DCAA 4M5DB 4NLRA 9WGAA 4PPDA 5IOLA 2BKPA 3TP2A 2D9PA 3H90A 5D4NA 1ITPA 5HAOA 1Z1ZA 2FJWA 1NHKL 5F8NA 3WX4A 3ZFVA 1SC1B 3WDOA 2G13A 5KFYA 3EZUA 3VBPA 4C97A 3OUYB 4QZVB 3RAQA 2UUAF 1LWEA 4EZ9A 1RE1B 1SQFA 2EG2A 2QA1A 2OPQB 2KT5A 3HKZD 3ST8A 4C3KA 1VQ9S 1FJ7A 1SKRA 1M0SA 2KL8A 1GTHA 2U1AA 4LF8J 1RFHA 2O01C 2PEBA 3HHLA 2YNHA 4IO1A 3MMCA 5HJXA 1SSTA 5GADU 2J87A 2MGZA 1NSKL 1IY5A 4K4WA 1IM4A 2M8DB 4MKYA 5EX3A 2VHEA 1IKYA 4E6TA 2UUCJ 3Q2TC 5J2MA 2JDJA 3CJQA 1QJHA 5M2PA 2AV5A 3O5TB 2NLWA 3QGGA 4NZ6A 5GAHU 4RNOA 3OL8A 1J5OB 2WB4A 1VQ5S 1IKVA 2FHJD 2MQPA 4DV1F 5IV3A 2LFVA 3RG6A 5H1SV 1SQEA 1U0HB 3L09A 3RJMB 1X9WA 2HK3A 3VR1A 3FWWA 1RWWB 5H9EJ 1FRIA 3V6HA 2N7CA 3C3LA 1FD8A 2KM8C 3OL9A 3OH2A 4I56A 4NLSA 4DV2F 3L7UA 2DHHA 3KXDA 1ZTWA 4YEAA 1JNZB 1MW7A 4ANCA 3GFZA 3A3OB 2AU0A 5LL6d 5KFLA 1I1GA 3MAHA 3QIPB 3H5XA 2DH8A 2VFRA 1GXLA 4G1QB 3MR3A 1IXKA 4NMLA 2QPOA 1LWXA 2AX1A 3M2RA 4X65J 1VQ7S 3NKYA 5LMUF 4CI0B 3MECA 2XYGB 1Q82T 2XG8A 4C8LA 1KK4A 4USJC 1XR6A 3OR1A 3I87A 3WZ0A 3DLEA 1KHWA 3NL0A 1F60B 2V1CA 1EKSA 1NZ8A 4FKXA 4ZN1A 2PE8A 1S1XA 4FXWA 4CDIA 3R1HA 1HNZF 1M8NA 2WLDA 1V5IB 3D68A 3ZNUA 3CC2S 2OKQA 3LGHA 5C25B 2LXFA 1H7WA 1NB2A 3QFHA 4KE5A 4JUZA 3D6HB 5DM6Q 3KK1B 1JMTA 1ZETA 1J5OA 1S10A 4IR9A 4RO0A 4NRUA 4PYDA 2V0KA 3ENVA 4DZDA 1NSQA 5HVHA 5D0HA 2J5AA 5G0RB 1DQAA 2BE9B 3B4DA 3MD1A 1BQXA 5ETVA 2N52A 2FB0A 4UT4A 1B0PA 3MPYA 5JVGQ 4B9MA 1BC6A 5J2NB 1RT4A 4JI6F 3PIOQ 3P5BP 3BO4A 2QMUB 1HQ2A 1ZOTA 2XCPA 2UVRA 4EA8A 3BRKX 2Z8QA 3RB4A 4YHHJ 4CQ1A 4LRAA 3NGSA 5MAOA 2XB2D 3EWGA 2LQBA 1WOPA 4MIBA 2VG7B 1LKZA 2XULA 2MZJA 3PJWA 5HLFA 1HHTP 2W2OP 4KTQA 1M1GA 3P4UB 1NB7A 3VAKA 2P6TA 1HWKA 4FDFA 4P2XA 2CQBA 4DN0A 4K4SA 2V53A 3MEGA 2B8TA 1JLGB 3T41A 4NXMF 1S77D 1Q0NA 3FNNA 3SPTA 5F41A 2SGQI 2BE2A 3GG0A 3J7AN 2KU7A 4FF3A 2EBGA 1UVIA 2NSBA 3LO3A 2BA9A 4H4KC 2NZ4A 2J7WA 2WONA 5LJ5Y 2CJSC 1HI1A 2KRBA 1JNRB 5GMEA 3Q1XA 4F3OA 3ZZOA 4ZVRB 3R0SA 3DLLQ 1U5KA 1DZ5A 4JI7J 4UOCA 1WF2A 2HLTA 3CUNA 3H2LA 2DGXA 4EFAC 4OMFG 5AE2A 2F8MA 1F5BA 4PAAA 3W9HA 2GJ2A 4ES2A 2ZH9A 2F63A 5F8HA 1YJ9S 2DXDA 3I3XA 2MKCA 3VAFA 2EKYA 1UMJA 3LP0B 3FSBA 1H6KX 4A4JA 1RTHB 1WHXA 2OSRA 2ZH6A 1I6JA 1XEZA 1NNDA 2LLZA 4G65A 4OZ3A 3VNPA 3W9JA 3QLHA 3CCMS 4EO6A 3M8PA 1WELA 2XS5A 2J9DE 2PQ8A 5FUYA 1GMUA 1UEKA 1WC4A 1MMLA 4OIXA 3SCIE 2YKQA 3WHIA 1LR7A 3QGHA 4L6V3 1VDDA 1NUBA 1X5TA 2V8DA 1QQ0A 3I82A 2FVPA 1QLNA 1FKOA 1FWPA 1HM0A 2WLCA 1Z2IA 2J9RA 3C19A 4LVNP 3J80U 2PMZD 2XO7A 4L72B 2ASJA 1U1NA 3KFWX 3MWBA 1F2GA 3DLGA 1SSQA 1FFGB 1YGYA 2ZEJA 3DI6B 3DRRA 3FZ2A 3E01B 4Q0BB 4D3HA 1EJ7L 2FJBB 1F9FA 4CLWA 3RR8A 2MHNA 2X1GA 3LGNA 4ZS6A 2HBYB 1XHDA 2WSEC 2ZNZA 4C8KA 1VRUA 2F5GA 2ZITA 1V67A 3IGVA 3OR1B 4JI0J 2OPRB 1B0TA 2DXEA 4EQYA 2BANB 3JTOA 5MLCV 3DMJB 2V4QA 3WC2A 3M1VB 4DR1J 4LFBJ 4R0EA 3AY0A 3W1YC 7FD1A 3OVAA 3KK2A 4Q0BA 4ETXA 2WVEA 5FUXA 1JWWA 4J9SA 1PYOB 2NU0I 2YBVA 4A48A 1IBLJ 2LQ9A 1J2ZA 1W26A 1NM2A 4NA3A 1OY8A 3SQGA 4YR3A 1PILA 1IBCB 1ZBTA 3DDIA 4HVZA 4NLUA 1FCAA 1RU1A 2EVZA 4F67A 3OH0A 3KLGA 1FJEB 1LW2B 3UOEA 5DDRC 4BBYA 3CCQS 1VQMS 3KG4A 2FPHX 4RL1A 3BQ2A 1R3NA 2Q3PA 4DX5A 1FKPB 4AQYF 4SGBI 1LWEB 3MEKA 4I69A 5J1NA 2LQJA 4KFBB 3X3UA 2AQ9A 3GQAA 4FKDA 4OI6A 3SCKE 3HJJA 4ELTA 1NSAA 2XYHB 4G6VB 2D3OR 3BGLA 3HP6A 3PO5A 2V1CC 2DPIA 5D3GB 4TQSA 2W9BB 9RUBA 1MWYA 3NGDA 2ZKUA 1XQIA 2IJRA 3PV8A 2DR8A 4P7VA 4HKQA 2CWHA 1SJQA 1BMQB 2B4PA 3K17A 4IKAA 4PXDA 2FZKB 2LECA 2KVIA 1M5PC 1HV9A 1WG1A 3LWMA 1UWAA 4J18A 1D9AA 2HS4A 3C16B 3MXHP 1GFWB 3N01A 3HHDA 4EA7A 4F04B 1EQMA 4J9NA 2ASYA 1X9MA 3BGFA 2FJDB 4HURA 4LF4F 1A9NB 2B0UC 4CO2A 1Z2FA 4HHJA 2QIVX 3FRZA 4DR5J 4UXIA 3D98A 1CJVB 4EI2A 5DLGA 3JQMA 2DRAA 1E6YB 1SIZA 2AX0A 1Q78A 4P10A 1KOOA 3KWCA 2R8JA 4KHPF 3D54A 1VIXA 3J81Y 1LXAA 3HSJA 4K4TA 2D3O1 1EQ0A 4FP9A 1AXQA 3AH6A 4LF8F 4ED7A 3MAAA 3KJVA 4G3SA 3UEJA 2Z2MA 4KGKA 3NP5A 1WG5A 2YQPA 2JLGA 3NY0A 2NUUG 4DG1B 2ADBA 1N56A 1T03B 1M1KT 2DVIA 4HZDA 1N52B 4LMZA 3CD0A 3KLVA 3OTCA 2CZ9A 3HJFA 3KWEA 3RAMA 4DU8A 3C8VA 4ZCIA 2AIRB 1B0VA 2G2OA 2L3MA 4G1QA 5K9FA 1QRLA 1NK4A 3MAAB 3IWLA 4YUDA 3CCTA 2KFZA 4GKKJ 3AODA 2WGCA 2XI2A 4ZVQB 3KMSA 4ECSA 4ERDA 1XNQF 2L41A 1LXNA 5IT0A 3V5RA 5F8MA 5KFKA 1SC3B 2XSJB 2E73A 1UHAA 4TVAB 2MMYA 2MZ1A 1SH3A 2DIUA 3PNIA 3RRKA 3HDSA 1CJVA 2A2CA 1RT7B 2JC0A 3AOCA 4X4TA 4IOCQ 5C24A 4NLPA 1K7UA 2R7UA 1N54B 2RRBA 3E01A 1JLCA 4V19X 3FVYA 1R6YA 2HFZA 3LP1A 2MQQA 2ZZTA 2MKKA 3UGIA 3VBIA 1FDBA 4M5KA 4MYUA 2GGOA 1N5TA 2DGTA 3T57A 4ZPAA 1V1HA 4OFZA 5GAHI 4OHYA 1CJKA 3A1YG 3OLBA 1OMUA 4C0HA 4RW8A 1PGZA 2C42A 4LFCJ 3GIRA 5EUHA 3DYAB 4X66J 1O5JA 3G87A 4K2JA 2KFYA 1VI7A 2MLYA 1IW4A 2PO4A 2ASDA 1U24A 1KC8T 2V94A 2J7UA 1QSYA 4B9TA 3PDNA 1FNOA 1Q86T 3SQGB 2C3YA 1RWXB 3FGVA 1S6QA 4O3QA 3A8IA 1M8CA 3CMAS 1JJ2R 2LCWA 3R1WA 2XSFA 2BRLA 3QATA 2R2TA 4I2QA 2CIMA 4MK7A 4MK9A 1N4IA 4M5NA 4KGVB 2FC9A 3BEGB 3VBNA 2UVWA 1DTQA 1BE4A 3B6BA 1NH8A 3TO8A 1TBQR 4EBDA 4B3TF 3P49B 2FHOB 1VQYA 5KG7A 1MG7A 1RACB 4ZCKA 4DSFA 1BXNA 3MUVP 2DH9A 5F9LA 1HWIA 1RADB 2LQ5A 5HL7Q 3CWJA 3OJUA 2QV6A 1VMBA 5BR8J 3MR5A 3FSXA 3MCMA 4DR5F 1S0NA 4ZLLA 1V3WA 4YP3A 4JI7F 2YNIA 1FX2A 1KP6A 4ECZA 1SL0A 1ELOA 1VQSA 2B5JA 2J6TA 1OQ3A 5JUMA 1CULB 3DOKB 1TUSA 1FFWB 3MQHA 3G86A 3I0SA 1HNIB 3SQOP 1C4CA 5I3PA 1P8GA 4RW4A 3LA0A 5B0AA 2W7OA 3G8QA 3KLFB 4WCEQ 4QOTA 1JXLA 4OZ0A 1RWNB 4PCQA 1HWLA 2ADCA 4ZA1A 3Q8RB 1CSJA 4HACB 3I32A 4B9VA 4WTYA 3R2DJ 4QIEA 1R79A 3N6MA 1JLBB 1ZPWX 2F8HA 1TL5A 3HSDA 4NMXA 3SFGA 2BKNA 4R5PB 5IS2A 4W90B 2ZOGA 3FJ2A 2VQFF 3GIIA 1LWCB 3SBMA 1Q1KA 2BJ8A 2RUGA 3CGIA 1VBZA 4K4VA 3J7ZT 2RU9A 2X3GA 2RDJA 2FLOA 2X1FA 2W8LA 1GQEA 3R3TA 2FVQA 2G4BA 2ZH7A 1AT1B 4J9OA 2CA9A 1HWJA 4AMLA 3MHYA 4DV3J 1YBAA 2IFXA 3I5CA 3BF4A 4XK8C 4I6WA 3OTOF 1XJWB 3E2EA 3AD8C 4AL7A 5KFPA 1QD1A 4ITSA 5B0GA 3OHAA 4FYDA 2XMKA 2DNGA 3W66A 1UJ4A 2F8EX 3RU0A 2ZFHA 5HK4A 4YDDB 3R3IA 4N77A 5D0EA 3VQSA 3ZZTA 5A8KB 3UGDA 2P9GA 5F3TA 4CLPA 3I4PA 1Y9OA 4HL9A 4B17A 3NOCA 2CQHA 5JVHQ 3AFGA 1AFIA 2BEFA 2PGCA 2M0GB 4NLXA 4K5RA 3M32A 3RGIA 4U7UK 2MQNA 2W1BA 4ER8A 2OO4A 1QSSA 1QE1A 1UVMA 2O5DA 2LXUA 2FHJA 5B0CA 2YWKA 4DFMA 1V9OA 1S1VA 3J81U 1LV5A 4WP4A 5E3CA 3VHQA 2BRKA 2CAJA 5E3PA 3QSYB 2FVCA 2IC3A 2W2PP 3NRBA 3VE5A 1OJ4A 4EAAA 3TO6A 2QLWA 1U8WA 1YBUA 2A6MA 2VDIA 3M8WA 2LA4A 2RE1A 1ZA1B 3A8JA 2FGCA 1A0OB 3TEHB 1RP5A 3KNAA 3P6YC 3F1XA 2VPXB 2DO4A 3BZQA 1CT4I 1LW2A 2OLWA 1T11A 2HHPA 3G8TA 1FRKA 1UW4A 2W25A 4MIWA 3ONQA 1SJ3P 1RXOB 2EC2A 2HGNA 3NAIA 4H4KA 1YP3A 3TO9A 4PXEA 1VFJA 3VDUA 1AA1B 2DJWA 2H9ZA 5E7OB 3W5ZA 4OI3A 3PR5B 2HFNA 3F73A 1MNEA 2L9DA 1U1OA 1WHVA 4ZPWR 1OO0B 2E1AA 1EP4B 1U26A 2ZVIA 3OU9A 1FRLA 4KH1B 5ETTA 5KFUA 3T5JA 4JI8J 3J81j 3H59A 4Z7YA 3CSKA 1IKXB 2KDOA 1TV6A 2MTLA 3V2UC 3RTVA 2HHUA 4OYIA 1SGPI 2DBBA 1FDDA 1M1HA 2A18A 2BJ9A 4O3NA 1FNMA 1Q7LB 3DGVA 5KFVA 1HA1A 4DF8A 1CPZA 2HWTA 4KRWA 5GMKa 1RBLA 3G82A 2YNGA 2JYYA 2Y0SD 4R25A 1TMMA 3PX6A 4DUZF 1U02A 4USKA 5AXLA 3L9ZA 4PYAA 2D7SA 1KQFB 4ES3A 1O0PA 2FZCB 5A6PA 3CE8A 5CYMA 2KO1A 4OHXA 3KKFA 3FMWA 1YHQS 2DHGA 4LVOP 3R7SB 3C66A 4LSNB 2MDAA 3CDBA 2XGQA 1WI8A 1GT8A 3D66A 1UWBB 3EXYA 4V19J 5KG1A 3IRXA 4UZBA 1NCLA 4L9MA 3IXCA 1MU2A 3R9LA 3S7RA 3KK1A 4DOZA 3AHPA 5ETMA 1ICEB 4TN2A 5HVFA 2UV8G 4ZPDA 1HW8A 5KG3A 4DNCA 1JLBA 1DRZA 2QQCA 4W92B 3I96A 4FF4A 3SYZA 4DR4J 4KJIA 3R5GA 3GV7B 2V8VA 3FBBA 3LW5C 4C11B 3GILA 3R5CA 2F65A 4HYKA 1HDLA 1JIHA 2GAHC 1JQGA 1VLOA 2ORVA 2ILYA 1MU2B 3OQ2A 4RNHA 4CT9A 3CEDA 1WI6A 2LYVA 4B3OB 1NSPA 2IM0A 1F5AA 2W7AA 5BJRA 1VQ8S 4WXOA 4K59A 4NXNF 2DRDA 3OTOJ 1N13A 1PTQA 2QZ8A 3F41A 5HANA 4ZMMA 2Y1IA 5KFSA 3OH3A 4GC6A 1KVIA 3S1TA 5IM0A 4A47A 4IO9Q 3T3FA 5J2PA 2EFGA 2R8IA 3DRPA 2WLEA 3LAKA 4TNOA 2CADA 5K8PA 3EG4A 2XMTA 3GYGA 4CH7A 2R8GA 5AFUV 4CO0A 1EWWA 1NBEB 2AYBA 1S9GA 3BYRA 1RT7A 3FTTA 3HFVA 3RZAA 3O8WA 4F4AA 5IC4B 2HGMA 2CPYA 4P9SA 4BWJA 3JYTA 3GMGA 1TGSI 2XLIA 2DGOA 4DF4A 4N27A 1U6FA 3K5PA 4LUBA 1OWXA 2C2KB 4OYMA 3KYLA 3P5TL 2VFVA 4ECWA 1M5OC 2NQPA 2M7SA 5KOXA 1GNKA 1HMVB 3MPWA 5KFFA 4NCGA 4B3MJ 2EC0A 1S9GB 3FK4A 3JSMA 5EN1A 3TIOA 5KFCA 4DWIA 2VOPA 2UUWA 4LR9A 1PC5A 2VBYA 2AW0A 4F0HA 3LWLA 3PX4A 4ZIVA 2L8EA 1WKLA 1YLXA 3QGPA 4KC5A 4CM2A 3H25A 1X4HA 3HK2A 2KXHA 3EXCX 4EU0A 3DFEA 3FC9A 5A0YB 1FT8A 4AAWA 2YNGB 1RT1A 2GQCA 3TOQA 3QJPA 1F5CA 2YXLA 2M2BA 2ZBPA 3BKFA 2HYIB 1GMWA 4KKOB 2COLA 2DNZA 2QLFB 3V81B 1F1BB 2M4MA 1X9SA 2HHHF 3JS9A 5M2RA 2ZD1B 3KUEA 5BXIA 1VBYA 1HR0F 1H3DA 4MIAA 1XMQF 5BYRA 1HM9A 1XNRF 1N8RT 1CC7A 5D8HB 5EWFA 2MLXA 4EUVA 2YKAA 1FK9A 3M05A 4RU2A 3KLHA 5KT4A 2KXNB 1KBEA 1NJXA 4L75A 1IKYB 1FVQA 5CZVA 2HEKA 3M8SA 3T5KA 3J80Y 1YIJS 2XS7A 3H20A 2JVRA 2IAJA 2HZCA 4J90A 2ZC3A 2L7XA 2HVIA 3EEVA 2ACYA 3M2UB 4PWUA 2IBKA 1L3TA 3ZZ0A 5CD4A 1RT5A 3O6QA 4TLRA 2VONA 2OI5A 5LXYA 1G97A 2K1RA 2LKZA 4ID5A 4K5SA 2K3IA 5FDLB 2BUNA 4EBCA 2P2CB 3BXYA 1T0TV 3H5SA 1ZAXA 4YFUA 4IRDA 2ICXA 4OVOA 4HR2A 2SXLA 2VBWA 2CJBA 3PX0A 1RK8A 2LEAA 2QGFB 3CJRA 4M5HA 3SDEB 4KSEB 2FD2A 3HD2A 4M5LA 2UXCJ 4GI3C 4O4RA 2RVJA 4WU3A 3T1AA 2X51A 2R7SA 1X4DA 4MJKA 3BREA 1D8YA 2W8KA 1PO6A 2OELA 2CQDA 1K73T 2ZH5A 1JLQB 4F36A 2QC3A 1JXVA 1FRJA 5E3AA 4RW8B 2QL7B 5B08A 2DT9A 5GVQA 4J9KA 4ZP7A 2R42A 4DR6F 2B8PA 5D0GA 4C8MA 4F3QA 3JSBA 5A6WA 4TKTA 5I42B 1Q79A 5EWEA 3UCUP 2HHQA 1VR6A 2YPZA 5F8GA 1GAOA 5ADZA 2IJNA 3MM7A 3KK2B 3R7BB 2GIVA 1LWFA 1YTYA 3W3SA 2F3JA 1OIAA 1SV5B 2NYIA 4EA9A 1DJ0A 3L7PA 4HTJA 4EZ6A 1S57A 2DHXA 9ATCB 2AGOA 4ES1A 1DQ8A 3Q8VA 2GIQA 4NE9C 5B0BA 3W65A 4OLOA 4KO0B 2YNIB 4MH8A 4ALZA 1VC0A 2G1DA 3ZXWA 5KFZA 2Q4JA 3TZZA 3K0JA 4F25A 3S6EA 3VZHA 4DX7A 2B4OA 3NWRA 3LPEA 4AUKA 2IM1A 1MWQA 1V3ZA 2V5HG 3GIMA 2YQ0A 4ZVUB 3QT7A 1T05B 1UVJA 3TOAA 2GVDB 1LFPA 1X5SA 5CHCB 4OX6A 2CPXA 3R2WA 4DCLA 1SH2A 2WONB 1SSMA 2DNYA 3MTKA 5ETPA 1MJ9A 3MPUB 2AQ4A 4B3SJ 1UEUA 1TURA 4ZLNA 4N47A 3C6UA 2AMCB 5J2QA 1L3VA 2PI5A 2MY7A 4NZ7A 3D7SB 1HNVB 2CWGA 2BV3A 1I5OB 4KB7A 1C1CA 1X4FA 2EI5A 2W01A 5J8CA 4WE1B 2GC8A 5JXSA 3KLFA 1S48A 5HJYA 4B3TJ 4QWBA 1RWVB 5HMWA 5GADI 4XIUA 3UEYA 3OTZA 3IAM9 3HSGA 2GHVC 3R6LB 3I0SB 4UQTA 1FFSB 3W8GA 3W7BA 1RBAA 4CT8A 2KCXA 2GVZA 4YR2A 5L1KA 2OD6A 2DGSA 4DV0J 4OZ2A 3R7NB 3UD5A 4XPEA 1HBUA 3V6DB 3PW7A 2NU2I 2OPSB 5SZTA 3RBDA 2JH3A 1TK0A 4O4GA 4HDGA 3ZNJ1 3JQYA 1UZHA 3GZ7A 3OV7A 1JJCB 2B9EA 2DGUA 2NR0A 2JF2A 3NXZA 2APOA 1V3SA 1HL6A 3P45B 2XZDB 3EPGA 2GJFA 3EZOA 3PTWA 4N76A 1THJA 4AQYJ 4UXJA 4NOHA 1IR2A 1A7GE 1RTIB 2J76E 2KJWA 3EM1A 4RW7A 3SIPB 4ZVFA 1HQEA 2HSEB 5L38A 3MR6A 3RAXA 4RKUC 1FE4A 1YJNS 3DLHA 3ETOA 1UKUA 3H98A 4JV0A 1RHRB 1QRMA 1VS3A 4WJBA 1RJJA 1QRFA 1SGDI 1WOSA 4IDKA 1T02A 4LBIA 3G6XA 1TIHA 2AYEA 3M8PB 3OH4A 2EFQA 4IRKA 2F4VJ 4WZMA 4KPXA 4OJGA 2VBXA 4ID5B 3NEKA 1I51B 2B3TB 3IP0A 4QCLA 2B6AB 3OGZA 3IFEA 3OR2A 1T3NA 4NLQA 4F50A 3MM5B 4QWCA 4FN5A 3HSQA 4PABA 4S0MA 2VHGA 4UOGA 3AB2B 1UVKA 2IM2A 1K7VA 4DJBA 2FUG9 2Z0GA 5G0RA 3R97A 1UVGA 3OD2A 3PO4A 4PWDB 3HD1A 3DRSA 3SEOA 4ZLPA 1NRKA 5D0RA 1BQMA 2QMWA 4QPTA 3H42A 4ECYA 4WFYA 2LUYA 2UXBJ 1RYSA 3DHWC 4LQ9A 4ZPTR 4IHFA 1JLCB 1DS3I 2CJXB 2OPPB 3D6FB 4A8KA 1WKKA 2ZUGA 4KO0A 4DQPA 1VQPS 3MFIA 3ENQA 2O67A 4BLGA 3GQ7A 2N3LA 4QIFA 2JRSA 3N79A 4ICLA 3TX0A 1Q16B 1X4AA 3U27A 3MEDB 1HWUA 3JQJA 3VAJA 1RT1B 2ROGA 2WSCC 3PW5A 1J5EF 2HNZB 2OSQA 2CNKB 3W5XA 1WC0A 2RB7A 2LEBA 1AZSB 1MJBA 2BW2A 2G0JA 2RRNA 2VB6A 4LF4J 4B3SF 1DQ9A 4YB5A 4O44A 2ZVSA 3MR2A 2G9OA 4TY9A 2WZ1A 4QQBA 4B3RF 1VK8A 2W2NP 2JEFA 3FUYA 2CKWA 2IC7A 2HWHA 3CCJS 1H72C 4IUFA 1T95A 3HF5A 3TWZA 2LU2A 3W5YA 4CYUB 2RSQA 3LQVA 5H9FJ 2KYZA 2MZQA 3AD7C 3HHKA 4N8NA 5CH7B 2LDIA 1C0TA 2OMOA 3SFUA 5J1EA 4JI2J 1SUQB 4QR0A 5KG0A 2W7PA 1VGYA 6FD1A 1YJ7A 3T9NA 1GX5A 2LXIA 4DX8H 2L9WA 4QW9A 2ZJQQ 1S97A 2OZUA 1YRUA 2I38A 1QTNB 3QGIA 3UDLA 1Y11A 5ADXU 3T5LA 1X0FA 4LF9J 1RAAB 1G2EA 2E1RA 3BKTA 4DZ6A 2VG5B 1WGTA 2GZOA 2KMOA 4LSLA 2DPJA 4JV5J 2BACA 4OHVA 3WX8A 2J0SD 2QE5A 4LIWA 4I67A 2YWHA 3P1BA 3ILOA 2OPRA 2ZBRA 3MF5A 2Q66A 4DR6J 1VISA 1TFWA 1G1XA 1S9EB 1SGQI 3ZTQA 3RBXA 5L46A 2BYCA 4ECQA 1HI8A 2AZ1A 3IXQA 4WWSA 5FUVA 2RHQB 2A2DA 4DR3J 5E41A 3KJFB 1WDDA 1RYRA 1CC8A 3FFIA 5A0YA 2JZ5A 4KPCA 2DEJA 2XMWA 3BH6B 3TVZA 5KOWA 5LMUJ 4JI6J 2Z4PA 3CCVS 3DOMB 4JV2A 2JA1A 2GCFA 3GU0A 4QIGA 3D6TB 5E0OA 1DY3A 4RUBA 4DHVA 5DG9A 3MURP 1UVFA 1FKAF 3SI8A 2ZD1A 4F0MA 3KLEB 1VRUB 3MTJA 4JYAJ 1R89A 2WW4A 4HCQA 2HPUA 2HNYB 2M8HA 1IBLF 4OJHA 2PIIA 5LSLA 3OBIA 3DLJA 2J8SA 2OP5A 5E5NA 3K8VA 5F9NA 3QRPA 4WFNQ 3MC4A 4NA2A 3CXLA 3H7HB 4YDXA 1WTJA 4OX9F 1BQMB 4ANDA 3QJLA 3CJ0A 2CQ4A 4LFBF 3IGJA 4JI0F 3KLIB 3N0VA 1FRXA 5A8WB 1VQ4S 2PT0A 2UV8A 2P8IA 8ATCB 4OZJA 1N33J 1IUJA 1VIOA 2Z2YB 3NLCA 4WFXA 3B78A 3UNGC 4BC7A 4ZJQA 1ULMA 3GV8B 1UJ6A 4RUCA 3HZGA 2DIPA 4ZOSA 5D77A 4USMA 4EBEA 3G6VA 2BUSA 1Y0HA 1UJ5A 3D0IE 3PEJA 5LM7E 5KFIA 5J2PB 2J6UA 4KHPJ 4LBHA 4OJ1A 1AB8A 2AKWB 2FC8A 3GLJA 3MMAA 4FNIA 4AYBD 3PW0A 2OFGX 1UFLA 4E0DA 4LIRA 3OPKA 3HJVA 3SCJE 2B0GA 4TU7A 1VHIA 3T19A 2C2OB 3IRWP 4ED6A 1SJ4P 2XBPA 4U95A 1TK8A 3NNAA 2RH3A 4NLOA 1S6QB 5HBMA 1LK5A 4ZJLA 5K8NA 5FLXU 3CPWR 4DFJA 3HSZA 3R6GB 2UXDJ 1F3FA 3DKDA 1FKPA 3DK5A 1V6HA 4J9RA 2E1PA 2JZMA 3S01A 5IV4A 2CVEA 5KFTA 2XGPA 4QYRA 3W60A 1GXTA 3BBFA
chains in the Genus database with same CATH topology
1P9QC 2PMHA 2WLGA 3E3XA 5F0UA 3UPFA 2R4FA 3KHHA 4QWAA 1VQOS 2C2DA 5HROA 4DL3A 3T6JA 2YH0A 2I5KA 2J8AA 1YP4A 1TKZB 4J09A 4X4PA 2B7BB 3HVTB 2AP6A 2W9AA 1RKIA 4H4MB 3DM2B 2MHEA 2K1RB 1VOMA 3B82A 5KG5A 4OJ3A 3PW2A 1XERA 4ECTA 1DAXA 4F8RA 1Q8LA 3BS9A 1SJFA 4WFZA 1RDRA 2IAJB 2VFUA 2MSTA 5DGBA 4QW8A 5J2QB 5EGYA 5IQ6A 2YKMA 3PACA 4K2XA 4U9RA 3K58A 2G0CA 2IRXA 4N76A 2LA6A 3BQ0A 3DRSB 3RB6A 4NLGA 1KN6A 1SJRA 3VBMA 1FKOB 2JWNA 1MRLA 4FBTA 2GJIA 5BYSA 4CH0S 3GWCA 2B4UA 2B51A 4CO3A 1N5YA 5L6VA 2E29A 5DETA 2WHOA 5KFEA 1RTHA 3MM8B 1NK0A 4MFBA 2PC6A 2IVMA 2RDIA 3K5LA 3QZ7A 2YQ3A 1LWCA 1FKAF 5U47A 4AA7A 1R43A 5K14B 3KLEA 4IFVB 3D1OA 3NGKA 1HW9A 1BQNA 2HRYA 1WD6A 2K2PA 1HQEB 1K1QA 1LFWA 3TANA 4Y0FA 1H98A 1KOHA 3ZZYA 2AJ4A 4RLEA 1BD6A 4GKJF 2RMLA 2BXJA 4HDHA 3LPYA 4KV8A 2MJNA 3VCDA 5E2QA 3VAMA 1W2IA 4UUWA 2CPZA 4ZKAA 2LVWA 3DLKB 5DDQC 4Y3CA 2DB1A 4Z2XA 2R9LA 2YKNA 3MAQA 4E75A 4PXCA 1ZAWA 2HLUA 1YQHA 4WKYA 1FWYA 1RT2A 1YJRA 2R7VA 1U6ZA 4ZP8A 1AUDA 3BSAA 5GAEI 2VPWB 3MMAB 2IBOA 4F26A 1N34F 2WOMA 1HBNB 2BJDA 1RI7A 3GQCA 3CIMA 4X62F 4HLBA 3IS9B 3IA0A 1C0TB 1RT6B 3Q2SC 2NSCA 5J1EB 5D4OA 1U47A 4PG5A 1VRTB 4DL7A 1FEEA 3OL7A 3CB4A 4OHZA 3CD5A 4QPXA 2ZOMA 2QSWA 4I2QB 1IKVB 1L5UA 1NAQA 3M2VB 4IH6A 2DTJA 4YHHF 2FHMA 2RIJA 4B02A 2BR0A 3UW1A 2R2RA 5L1LA 4A8SA 3THTA 3IR5B 1TUVA 4FPRA 4F4YA 5FDLA 2HNDA 1PSDA 2XEXA 2DCUB 2WTFA 1HQUA 3CCZA 3QMQA 5I3QA 4ED8A 2KZZA 3TAMB 2R7XA 2MY8A 4L3NA 4Q7AA 1FDAA 4NPOA 1HMVA 3H4BA 3QIPA 1S6OA 1G7CB 3OLAA 5CZXA 1IKWA 4ECXA 1HBNA 2RNEA 3PXGa 3CCUS 3CDWA 1RTDA 4E8UA 1G95A 2HGLA 3QZ8A 3ISZA 1REVB 3QYYA 3HHLD 2XMUA 1R8HA 1G6BA 2LEPA 4EWTA 2Q1LA 3HO1A 1S99A 3R8YA 5J1PA 2JHEA 3G8SA 2KB2A 2OI6A 4PG6A 1SJ1A 1W25A 5DO2A 1IKWB 3BO2A 3W2VB 3U1NA 1Z2LA 3G9CA 3POTB 1YITS 1JB0C 2AJ1A 1S9FA 2YNFA 3VZIA 3C8YA 3PVXA 3OR2B 4G1IA 4M28A 2GFFA 1OPIA 1HBMA 4C9DA 1ZM9A 3UI3A 3GIKA 3UWTA 3BSYA 1SKSA 4X4RA 3BGRB 2AJ0A 2WRMA 3ZZRA 2BQUA 4IFVA 1S1XB 3FMBA 5C42B 2OAUA 1I94F 3DOLB 1RT2B 5L6SA 4DS5A 4UUXA 2NUHA 4QIVA 4RWWA 5HROB 4O3SA 3H4DA 2E7WA 3MFHA 3ZZUA 4EO8A 2QMXA 3EUNA 1WTBA 4DSLA 4Q5VA 2F7VA 4LQ3A 2R8KA 5THWA 4XO0A 4I2PB 4QU6A 2GMLA 2GV1A 4CZCA 2ZH8A 3C2PA 3W2VA 5IT9Y 3PR4A 1OQ6A 3LP2A 1YRXA 2IHR1 4Y2KA 1H2TZ 1FF2A 4AXIA 4KGMA 4RU9A 5T7LA 3IBWA 2VG7A 3OFHA 4J9PA 1WNEA 5DS7A 3SSRA 4A8MP 3I9V9 3FRYA 1S0MA 2J0QD 3UD4P 1ULRA 2B43A 4RW6A 4TQRA 2ROEA 4KFBA 2CZ4A 2DHAA 1VBXA 1JJHA 3MQGA 2XWYA 5L1IA 2C3UA 2HHSA 3LOUA 3EGNA 3MMBB 4IG0B 2EK6A 5DQGA 1VQLS 1UA0A 4NLDA 3M2VA 2J6SA 1S49A 2GMJA 2RILA 5AXMA 4LSNA 3ICLA 2XNRA 2W9CB 4ETZA 1T3DA 1KFSA 2R2SA 3BSSA 1M5SA 1VQKS 3PFEA 1VC5A 4Z37A 5KG2A 4M2AA 1UVLA 5CA5A 1QM9A 3G71S 4PUOA 3N5BA 4P7TA 3GVDA 2R7QA 3M9OB 3Q24A 1JLFA 3SSQA 3D2WA 4LF5F 2N4CA 2JF3A 1FHTA 1NZAA 4GKKF 1E6YA 1FO1A 4CO5A 2CPHA 3DI6A 1RT3A 3NNHA 2CQ2A 2MYFA 4IG3B 4OL8A 2ZH1A 1R31A 5DLFA 3Q23A 4K4YA 1S0OA 3THVA 1TL3B 2F40A 2VUGA 5FJ4A 3C6TB 3UCZP 2AYGA 4PPZA 2H5EA 3TNVA 2DITA 5SUHA 1LOUA 1TP7A 4PQUA 2WAQD 4BWMA 3IS9A 4ECUA 4QBUA 3I55S 1ZYQA 4C11A 3POTA 2W9BA 1YI2S 2DR7A 2B7CB 1UA1A 1TAQA 2PN6A 3JYTB 1FERA 4B3MF 1JJ4A 2BJEA 5HP1B 2BM1A 3GB0A 2V8GA 3V4EA 3U1MA 4TXSA 1M90T 3GFHA 5U2KA 3LP2B 4E98A 2E9ZA 3DRPB 2BVZA 4ZVGA 4C98A 4DL2A 1U1PA 4NA1A 3IR7B 5DQIA 1R8AA 1YSJA 2XZWA 3GYNA 2BDPA 2GHWA 3HHLC 5HLFB 2KT3A 1JLEA 2ZBIA 4Y28C 4KKOA 3L3CA 3V81A 4WE1A 3MMBA 4IG0A 4R36A 2VKRA 3LUYA 3TQ1A 4A8WA 4B9SA 2D3ZA 1DURA 3QLHB 4DV7F 1RTJA 3PY8A 1LW0A 5C5JA 2M52A 3N5FA 2XS2A 5DG8A 3QWPA 4F2RA 2NS1B 3OJSA 4DV4F 2DK2A 2I8EA 5DG3A 3QAUA 3S8SA 3T1HF 1FDNA 2YWGA 4E1KA 2IU9A 1VC6A 3D8VA 1VRTA 2E7XA 3ZZZA 4FS2A 4JBCA 2PI4A 1C0UB 2N7YA 3BSWA 4RW7B 4C0OC 3Q0AA 4FXVA 2DNHA 2IMWP 4KPYA 4I68A 3FFIB 3ISND 1RA7A 4DSKA 5KFWA 4ELUA 2FHKA 3VBJA 3QO9A 5HMXA 4NLVA 2VPZB 3V6DA 3RW6A 1AW0A 2E5JA 3KWDA 1HNIA 3R3RA 3M9MB 1S1TA 2FJEB 5FD1A 1P6TA 2QIFA 4OHWA 2QA4G 3DOMA 4KHMA 4I6YA 2B9WA 2QRRA 1N36F 3BB5A 2UXDF 1KEKA 1S1WA 3TYTA 3M9NB 2B56A 1Z4UA 3O3LA 3HXMA 4OI0A 4D3G