3FSYA

Structure of tetrahydrodipicolinate n-succinyltransferase (rv1201c;dapd) in complex with succinyl-coa from mycobacterium tuberculosis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
307
structure length
304
Chain Sequence
VTGAAGIGLATLAADGSVLDTWFPAPELTESGTSATSRLAVSDVPVELAALIGRDDDRRTETIAVRTVIGSLDDVAADPYDAYLRLHLLSHRLVAPHGLNAGGLFGVLTNVVWTNHGPCAIDGFEAVRARLRRRGPVTVYGVDKFPRMVDYVVPTGVRIADADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEGRISAGVVVGDGSDVGGGASIMGTLSTHVISIGKRCLLGANSGLGISLGDDCVVEAGLYVTAGTRVTMPDSNSVKARELSGSSNLLFRRNSVSGAVEVLARDGQGIAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tetrahydrodipicolinate N-succinyltransferase
publication title The three-dimensional Structure of a mycobacterial DapD provides insights into DapD diversity and reveals unexpected particulars about the enzymatic mechanism.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 93
structure length 304
sequence length 307
chains with identical sequence B, C, D, E
ec nomenclature ec 2.3.1.117: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase.
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
A PF14789 THDPS_M Tetrahydrodipicolinate N-succinyltransferase middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3fsyA03
3.30.60.70 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Trimeric LpxA-like enzymes 3fsyA02
3.30.70.2010 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3fsyA01
3OTMA 3R2WA 2V0HA 1QQ0A 3PMOA 4M28A 4KPZA 3VBLA 5DEPA 4E6UA 3BRKX 3DHOA 3FSXA 3FSYA 4H7OA 2V0LA 2WLFA 2WLEA 4EA8A 2V0JA 3R5AA 2JF3A 1SSQA 4N6AA 5E3RA 1HM9A 3BFPA 1LXAA 2WLCA 2OI7A 3HJJA 5AFUV 5F42A 3MQHA 3R8YA 3DK5A 3P47A 3VBKA 2VD4A 1HM0A 2AQ9A 2QIVX 3FSBA 3CJ8A 3SRTA 1HV9A 1YP4A 2W0VA 3EEVA 3NZ2A 4E79A 3VBNA 1MR9A 3EG4A 4E6TA 4MFGA 3VBIA 4ISXA 1Z90A 1G97A 4G3PA 4KNXA 1MR7A 2OI6A 1YP3A 3FSCA 3R0SA 3R5CA 3VBJA 4N6BA 3VNPA 3Q1XA 2P2OA 4J09A 4R7PA 1KHRA 1KRRA 3SPTA 4G3QA 3GVDA 1KRVA 3P1BA 4HURA 1KRUA 3FS8A 4K6RA 4EQYA 2V0KA 1QRMA 3R5DA 4EABA 3BXYA 4FCEA 3ECTA 4N69A 1KK6A 1THJA 4AAWA 4IHHA 4N27A 2ICYA 2FKOA 4M2AA 3R5BA 1FWYA 1MRLA 2W0WA 4M99A 3D98A 4EGGA 3ST8A 2Q4JA 1G95A 5E3QA 1YP2A 2WLDA 3DJ4A 3F1XA 1KK5A 2OEFA 2OI5A 4J18A 1OCXA 3TV0A 1KK4A 3BSYA 3EH0A 4AA7A 4M98A 4DCLA 5L6VA 2IC7A 2IU9A 5ADXU 5E3PA 5U2KA 4AC3A 2ICXA 4HCQA 3FWWA 3TWDA 4KPXA 2TDTA 4HZCA 4M9CA 4EA7A 3T57A 4G87A 2QKXA 2NPOA 3OTZA 3IXCA 1QRFA 3D8VA 1V3WA 3TDTA 3IGJA 1QRGA 1J2ZA 4G3SA 1V67A 4HUSA 1XHDA 2GGOA 1FXJA 2XATA 3BSSA 3I3XA 1T3DA 3V4EA 3TIOA 3OUPA 2QIAA 4MZUA 5AFUU 3R3IA 3MC4A 3FOQA 4KNRA 2GGQA 3FTTA 2IUAA 3VBMA 1QRLA 5DEMA 3TK8A 2JF2A 3MQGA 4R36A 2IU8A 2RIJA 1KGQA 5L6SA 3R3RA 2V0IA 4HZDA 4M2BA 3R1WA 1TDTA 2WLGA 4EA9A 3OW5A 4IHGA 3TISA 1KQAA 2VHEA 4E75A 3VBPA 1SSTA 3BSWA 3KWDA 4IHFA 3C8VA 4R37A 3I3AA 4MYOA 5DG3A 4EAAA 2I5KA 3KWCA 1S80A 3GUEA 3HSQA 2OEGA 1HM8A 3JQYA 1QREA 3GOSA 1XATA 4E1KA 3KWEA 3OU9A 1SSMA 4KQLA 5ADXV 1KGTA
chains in the Genus database with same CATH superfamily
3R2WA 1ZPVA 2ATCB 3NOCA 1HI1A 4EO8A 4UZCA 2LQJA 1CGII 3GSIA 2UUAF 1H72C 4X4RA 4ZIWA 3DRRB 4EZ6A 2XS7A 1HWUA 3MMBA 1I3OB 4ZJQA 1I94F 1JLEA 4R0JA 1VRTA 3NCPA 1SIWB 1S0OA 2ZITA 5DG8A 4GVBA 2OFHX 1UVJA 2KU7A 2ZFHA 4IRKA 1L3VA 4JI2J 3MEDB 1RTJB 2HRUA 3CMAS 3KG1A 4ETXA 2JEIA 1UMJA 2QLJB 2WVFA 2JC1A 1EWWA 3G96A 3V6JA 3UD4P 2OEFA 4KPCA 3VAIA 3TNVA 2D3UA 4PXEA 4HZCA 2YWWA 3OTZA 3W65A 1S9GB 4DQRA 4J9OA 4K4YA 2JZMA 3BEGB 1HNIA 4B3OB 3H8YA 3DRPB 4DV4J 2RDIA 1U2FA 2HFOA 1U1KA 2CQGA 1KQAA 3BN7A 4CLLA 3AD7C 5KFAA 3OL7A 3J7YI 4ED8A 4RPFA 3M8RA 1SSMA 2WTFA 2Y8WA 4HLBA 3J7ZT 2CPDA 3DRRA 1T02A 3RBEA 1YJUA 3H2LA 4QU7A 3M30B 4URGA 1FRMA 3CDBA 2E1MC 3CWJA 3IA0A 4IG3B 4I2PA 4U8VA 3VVTA 4DPWA 2ZH1A 2OI6A 1HEVA 2DGVA 3MEDA 3HFZB 5KT2A 3PY8A 2LMIA 1QTNB 3E2EA 4RNFA 2YX1A 2QMXA 4IH7A 3HVAA 2OH2A 2Z57B 3RAXA 4CO4A 1FWKA 1YRUA 1N6QA 1D0EA 1X0PA 3MUTP 3FFIB 2GJ2A 5EX3A 3MI7X 1K7VA 3KJFB 3D00A 4C3LA 2EK6A 3FZ2A 2FLOA 4KT0C 4O3QA 4P52A 4ELTA 5ETLA 3K5OA 3QRRA 3I3AA 1TOTA 4Q5VA 4QW9A 1FTRA 2Q66A 1JB0C 4FYDA 2O67A 1S79A 3KDNA 1RSCA 3HP6A 4KQLA 4L9MA 2UXDJ 2I5JA 3HZGA 2FQQB 3C16A 3Q8RB 3R1HA 1TU0B 4F0MA 1SXLA 4MIBA 4CLSA 3EG4A 2V63A 3FC3A 4P2MA 1FXLA 1B70B 2R42A 4AT1B 1HNVA 3WBZA 5JVGQ 4N6BA 4WKYA 1PJ7A 2QA4G 3M32B 4FZVA 4JUZA 1G6BA 3KUGA 3TAPA 5KT5A 1GEHA 4IH5A 4DUYJ 2DH7A 3QAUA 2XMAA 1YP2A 3DJ4A 3BO3A 1RTIA 2R7OA 4MKBA 2R8GA 2EKYA 2DPIA 6FDRA 2NU0I 4U8YA 4IDKB 1RE1B 1KTVA 3SFUA 3HHLC 3FFIA 5SZTA 2KKHA 4H4KC 3FMBA 3CDUA 1UEVA 1IBKF 1P6TA 4OHZA 2XI2A 2N3LA 3TX0A 1UW4A 2CXEA 2W2QP 3I87A 4I4BA 1UJ4A 2ASDA 2WCXA 1DTQB 2CWKA 1D8YA 3RRKA 3GILA 5J1EA 3P6YC 2NXCA 2FZCB 2GO8A 4H7OA 1HFEL 3TAMB 5K14B 2W9CB 2ZE2B 5IC6B 2FDNA 1IR2A 4B3MJ 3OFHA 2QEXS 2FY8A 2GJFA 2VA3A 4L72B 1BWEA 4DF8A 2DB6A 2QSFA 1SUQB 3TW0A 1TMJA 1Q81T 4YR2A 5CD4H 3CJ0A 3JTNA 2AT1B 1CLFA 1BQNB 1RBOB 2DEIA 2UZ3A 2FJDB 1HQ2A 4EFAC 3OBIA 2HVDA 3DLEB 1U0HB 1TBRR 4DPOA 2HHVA 2DPJA 1PYTA 5J2QA 4DCLA 3I0SB 4OMFG 4YOEA 4M5KA 4QWEA 3W5ZA 1NDCA 2W25A 3OUPA 3EZUA 2PI4A 3UCUP 3LQVA 1NM2A 3IMQJ 1WC6A 4RNOA 4NZ6A 3AODA 3OSPA 3ELHA 2Y1RI 1JLGB 3VGUA 4B02A 4HI1A 1X9MA 5D4LA 2K3IA 1I5OB 1U25A 2Y9HA 3BSWA 1HBMA 4DV5J 2BJ7A 4KO0B 3D5MA 4EAAA 2UU9J 2PQ8A 1ZAWA 1JKHB 4KV8B 1VK8A 4DL0C 1F3FA 2JWNA 3BGFA 5DJBA 5H9EJ 1VQ4S 2GHVC 4HDHA 2EC0A 5CXTA 3MMAB 3FBEA 5K14A 4DJBA 5DM6Q 2ZE2A 1OPIA 3MPYA 2AQ9A 2FGCA 1SQGA 2V4RA 3QFHA 2CJAA 2WB1D 2OD1A 1HR0J 4Y00A 1T8EA 3OL9A 2OPRA 3M7VA 1V9OA 3UWTA 4Y28C 5L9XA 1UZHA 3LPYA 3DLEA 4Q8EA 1JQGA 3BH7B 1U0HA 4I69A 4DR2F 2YQ3A 2ZM6J 1L3UA 1RKIA 2ZH7A 4ZKAA 2X51A 4HUSA 1CSOI 3DOMA 3I32A 1SL2A 1RKJA 1XNRJ 1U24A 2YKQA 3DXSX 3BSCA 1RAEB 2KT3A 3Q8UA 4B3RJ 2QN6B 3R3RA 2XNRA 1LR8A 2A6MA 4WZQA 3KLVA 2MMYA 3ITHB 1OQ6A 3BO2A 3VTIA 2VPXB 5DG3A 3PRVA 3ZNUA 4R5PB 1N5YA 1X74A 5KFYA 3TP2A 3RB6A 5DDQC 3LW5C 1NDPA 3QYYA 1N0UA 3BRKX 1YBAA 4KHPJ 1PPFI 3MMAA 4DX5A 1X5PA 1N52B 4ZK7M 1JLQB 1Z1ZA 3U7JA 2O3DA 7FD1A 2FJVA 2VQEJ 1QE1A 3R5JB 4URSA 4ECSA 5KFXA 7AT1B 4XK8C 4SGBI 3LUYA 2UUTA 2HVZA 4ZVHA 4M2AA 2HMIA 4GC7A 1FWYA 2IJNA 3HULA 4M5JA 3A12A 1SC4B 1Q82T 5IWAJ 2OTJS 1FFSB 1KHWA 2C2KB 1RHKB 5FUYA 1V5VA 4JI0J 4MJKA 2CWGA 1MU2B 2CJBA 2CQIA 1F5BA 4LFCJ 5I42B 4DR3J 1T9XA 4QPXA 2ZJRQ 2H51B 4L76A 3ET6B 4X4SA 1H7XA 3SYZA 5HATA 5EN1A 1KQGB 4MAKA 4G6VB 2OPSB 4EK2A 3GSDA 1HNWF 2VHEA 4H4OA 4J9MA 5HL7Q 1R8CA 3KWCA 4DZ6A 2AGOA 5C42B 3D67A 1TKZA 3VBLA 1WGCA 4QOTA 3UN2A 4O4GA 2WBMA 2ZHAA 2FLPA 3E01B 2POKA 2XCPA 1FJCA 3G9CA 1TVRB 2HNZB 4NLSA 1L5UA 2MB0B 5L39A 4G3PA 1YRXA 1UPMB 1REVA 1NDLA 1AB8A 4Q7AA 3OVOA 1ZZNA 3TRGA 4CH7A 4TQRA 1ZAXA 5J8FA 2YNFB 2XC9A 1DHMA 1VCTA 3PW0A 3CJKB 3UN5A 3EH0A 1GT8A 1S72S 4Q8FA 1JJ2R 4X62J 3BSSA 1HMVB 3MPUB 2YWKA 4L73A 5EX0A 2VASA 2PFDA 4P71A 5L1JA 2E7VA 4TU8A 2R7WA 3OL6A 2CJYB 4I0WA 4OHXA 4F4AA 1S1WB 4JI8F 2GMLA 4TU7A 1O6XA 5G4DA 2MSSA 2N1AB 2W7OA 1WDTA 3EMTA 4JV1A 2JL9A 3EM1A 1FX4A 3M8PB 5DEPA 2DNQA 3T1HJ 4DX7A 3H4BA 3LA0A 4I56A 2G0JA 3DI6A 3M05A 2MLZA 1J5EJ 4J9UE 4LSLB 3G2XA 1NJZA 3S6EA 2HNZA 2C2NA 3BPSP 2XSJB 2VG6B 2XMTA 3FEXB 2HFZA 3MURP 5HQ8A 3QT8A 3C66A 1HWLA 3MCNA 1PGZA 3FS8A 2VQFF 3ZZ0A 6AT1B 3TJ8A 4JV0A 2D69A 3R3TA 5IT9U 4F3QA 2YNFA 4DV2F 3CJKA 3ILOA 2BE2B 2NSBA 5H9EK 2B7BB 2GVDB 4N76A 1NH8A 5EWGA 4GKJF 3HHDA 1HMVA 2VV5A 3DLGB 2LU2A 4CRJA 2XY6A 3EGZA 4ED5A 3R3IA 2EFNA 2XMUA 3RJMB 3UD3P 5KAKA 2V94A 4HL9A 2KYZA 2YKOA 3EDQB 2DHXA 3PYFA 2B4PA 4O3PA 4RW8B 2DIUA 4MYOA 3OHAA 3W8PA 4CO5A 5HMXA 2KZZA 4UXHA 2IFXA 1HI0P 4MK8A 4NLUA 1WGTA 2WLFA 5K8NA 1HM9A 2V53A 3BFPA 2DEJA 1C2PA 1DS2I 4LSLA 3KFWX 2XGQA 4P74A 4WYLA 1C0TA 2UUCF 1GQEA 4DR6J 1RBLA 3A8JA 1RT5A 4LRFA 4X65J 3RW6A 5JHWC 3JSBA 3L7UA 5ETVA 1DRZA 4DR5F 1UVMA 2HSEB 4ETZA 5L6VA 1KQSR 5DRKA 2AD9A 3GFZA 4RKUC 2GVDA 2M7SA 2RHSB 1R0BG 2MKSA 4UOHA 1JWWA 4S0MA 2NXUA 2AQ4A 4A4JA 1CT2I 2ZZMA 4RR5A 3JSRA 4ED7A 4MK9A 2AX1A 1E6YB 3C6TB 1VDHA 3FMWA 4IG0B 3UFFA 2LA4A 3MAHA 1FO1A 3EVMA 4P72A 2UVUA 2I6WA 4X4QA 1NSKL 4RW7B 2E7XA 2VD4A 1KMAA 1XERA 1FF2A 3PNIA 2IM2A 1NUEA 2LB7A 1YJRA 3KHHA 1JLCB 3C2PA 3PW7A 3KLHB 4F67A 5J2NA 2W0TA 4CNZA 4HURA 1A7GE 3D9BA 3GYNA 3MPDA 3OW2R 4LFBJ 3CCUS 2MZSA 1WSVA 3DOLB 3KK1B 4RU9A 3ZTRA 2ZH2A 2UXCJ 1IY6A 2V8VA 2E5GA 3DGPB 2V9KA 3PTWA 2OELA 3M9NB 4A8KA 4LBHA 2DT9A 2CPHA 5I3QA 1S1UA 3OLBA 3CF5Q 4NYOA 2OIHA 5HO4A 5L6SA 1S1TB 2FJAB 3QNWB 4R8UB 1NJIT 4DL7A 1TDTA 3AY0A 2HW3A 2BACA 2WOMB 5F0WA 1E6YA 3K5NA 4FKYA 3C6TA 2OUGA 7WGAA 4IG0A 2AGPA 5L1IA 1VQOS 4IR1A 1TL3A 1JLFB 1VBKA 3T3FA 3R5AA 3ZZUA 2YNHB 4RW7A 4ECYA 3OVBA 4LVOP 2ERWA 2VA2A 3I5CA 4DUZF 4RW4A 5KFQA 1CJKB 3HFVA 4UQGA 2FLLA 3MM7A 1RAIB 5A2QU 3C19A 4MIAA 2WW4A 3B4VC 3MDFA 4P9SA 1VDDA 3RRGA 3D98A 4O3NA 3PFOA 4X64J 1LWEA 3C46A 1JNZB 1PYSB 4WF9Q 2QG9B 4WU3A 1WELA 2XMKA 3TA2A 5B0BA 3TO8A 2VG7A 5IV4A 1LFPA 2MLYA 4N5SA 4U67Q 1FJEB 1VJWA 3HFKA 2YNIA 3GWCA 3J81U 5CAAA 2VPYB 2Z8QA 5FIIA 3FZBA 2FB0A 3BGUA 1LW2B 3Q83A 2WOMA 7FDRA 3KWDA 3FK4A 2EWHA 2WAQD 3AQOA 5GAHU 2FC8A 1RAHB 1HBOB 2BANB 2ZNYA 4FF1A 2LQ8A 3SFGA 3SDEB 5D0EA 1IBCB 4FXVA 3R2DJ 2OI2A 2YNHA 1BXNA 1LXAA 1NK6A 2JXDA 3KHRA 4KYZA 4XDDA 1LEOA 1OSCA 1XNQF 1OO0B 2V5HG 4CLTA 4WXOA 2EVZA 3P45B 4ED3A 2HAIA 3HZEA 1IWGA 1N33J 4UUWA 4O3RA 1HYSB 1D1UA 2DY9A 4FKXA 5E3QA 2JZ5A 1SVDA 2IRYA 1Y9OA 4AC3A 2HEKA 2Z2MA 2DGUA 1KBEA 2E9RX 3T1YJ 2DTJA 3D0GE 2XO7A 2QIAA 2KXNB 5E0OA 4L74A 5GADI 3S1TA 2KJWA 4G3IA 4CO3A 1XMOJ 3NNCA 1T9YA 3AOBA 1VRQC 3GIKA 1LW2A 3FC9A 4NEZA 2LQ9A 4JI4J 4ZITA 4CQ1A 3BDPA 3VF0B 2V68A 2Y1IA 3PR4A 4I2QA 3T6BA 4GKKF 4CDIA 3QJJA 4JI5J 1IM4A 1IJFB 1Z2FA 1JLBB 3F56A 2V8HA 1ZTWA 4DI6A 3JQKA 5A0YA 3CJ8A 1UCNA 3G8TA 3ETMA 4X4PA 3ENWA 3PKYA 4RW9A 4OJGA 4NZ0A 1XR6A 1WUUA 3Q8VA 5CYQB 4R0EA 3UNYA 4DV4F 1SH2A 3I55S 1FDDA 1KFDA 1HYSA 1DQ8A 4N77A 3SCKE 2DXEA 1RAFB 2IVMA 2B5JA 3C8YA 1B64A 2ASJA 2L48A 2DIVA 4NCBA 4YB1P 3J7AN 2GS8A 1H6KX 4ELVA 4FNIA 3IWNC 2IUAA 2GFFA 2XRCA 4DL5A 4DL2A 1SJQA 4PG4A 3KMQA 1N5TA 2B43A 4JI1J 3N5BA 2K1RB 1CJTB 5E5NA 1XC9A 4I64A 4R37A 1M8BA 2DNNA 3DU5A 1R89A 2MY8A 3DXBA 2ZOFA 4QZVB 5KFMA 3CD7A 2C28A 3OTBA 4M94A 4WKRA 3BGRA 1QUPA 4PRFA 3GPAA 2OI7A 3I82A 3NLCA 3DLBA 2F9DA 2HRYA 1EARA 3CCQS 4E79A 2B8PA 4DV6J 3K5MA 2CPJA 4LRDA 3LGNA 3DOKB 3GFYA 2VKRA 3M9OB 1AFJA 2XMWA 4F04B 3CCSS 2JSXA 2J9EA 2Z30B 3SQGB 4USMA 3TUPA 4DR4J 2UXDF 2RAQA 3MAQA 1TELA 3IXCA 2GMJA 2F1FA 1V67A 1FXJA 2BUNA 4LSZB 5F3TA 2LEAA 2HFSA 1S99A 2NU3I 1MJBA 1MWZA 2X7IA 2DHSA 4MYTA 1MWQA 5DQIA 2WVCA 4A8MP 1FFGB 4Z37A 2HHTA 5KFSA 1IQZA 3OL8A 4J91A 3VBPA 5GMEA 1QSYA 1R43A 2DH8A 3AD8C 4DUYF 4RNNA 4E1KA 3TARA 1M8NA 1TAUA 4OI6A 4C9DA 1R31A 4L3NA 2M8DB 1NAQA 4BLGA 1BWVA 2LECA 2VU5A 1GAOA 3SSSA 3I4PA 3UD5A 1IVZA 3H0PA 2IBOA 1NKBA 3EEVA 1K9MT 3N79A 3KLIB 4WK3A 5CYMB 1X60A 5LSRA 2DO4A 1R79A 3D54A 3UDCA 1VR6A 2J6SA 1R6YA 1OJ4A 2DR8A 2M70A 4K4VA 5BYQA 2WLDA 4ID8A 3UI3A 2AJ1A 1AXQA 3LOUA 1VJQA 1PAEX 3UOEA 3OVAA 3KLEA 4FYVB 5FUWA 2B4OA 3FRZA 5F3ZA 4B3MF 1J5OB 3MR3A 4F4KA 1M90T 1D8ZA 2VOPA 4HGUA 5BJRA 2CVEA 2C3PA 2QIFA 4ECUA 2JA1A 1GMVA 2DGSA 2ENNA 4V19J 2JVOA 5ADZA 2F4VJ 4NLGA 3W5XA 3P8BB 2DCUB 1S6QB 4NCAA 1WDDA 2XI3A 1RQ0A 4O44A 4OI2A 3DYAB 3LP2B 2C2EA 1NK0A 3ZXWA 1N8RT 2QL5B 3B4DA 2QIVX 3SRTA 3K8VA 2NPIA 1S20A 5A6WA 4CZCA 2I1RA 2R7UA 2B3TB 2HHUA 1EQMA 4WE1A 1VYAA 1OMUA 2R9LA 1HNZJ 3EGNA 4KPYA 2W0WA 4DV5F 5KFLA 1TL7A 2Y0MA 4DR7J 5THWA 5LJ3Y 3THTA 1EETA 1T7PA 3S01A 3LWLA 1LKZA 4X84A 2FC9A 5J2PA 2VODA 4PYDA 2B9WA 1CJVB 2FY1A 4Z2XA 4NRUA 5HBMA 2IAJB 2CQPA 1WOSA 3KK2B 2MQNA 3UEJA 3GCXP 1WC3A 4LVNP 4IQMA 2K8GA 2ZUGA 3SXLA 4JBCA 1HBUB 3VAMA 4FVMA 4LF5J 4YB7A 3VZIA 1XIQA 2F7VA 3UGLA 2MZJA 3LP2A 1CEZA 1EAYC 1C1CB 4ZCMA 3LGMA 4KGXB 1LW0B 1S9EB 1YP4A 1XNRF 3QZ7A 3QRQA 2CPZA 1RXOB 3PZPA 3GB0A 4K8RA 3QMQA 4DFJA 4C8MA 5LOQA 4G3QA 3ILIA 5DDOC 4DEZA 3M1VA 3IM9A 2J6UA 4ZOSA 4WBFA 4ZVSB 3H40A 5A8WA 4HCQA 2H1YA 4OHWA 3FBBA 3GIRA 2HBZB 2VFSA 2CJ9A 3NS5A 4KHPF 2QT7A 1EJ7L 1E6VA 4IFYA 4OX6A 5AT1B 4UF4A 1CJVA 2VQEF 2IAJA 5GAGI 4HEA9 4M5LA 1V1IA 3O2IA 4RO0A 2UVVA 1P9ZA 3NGKA 3V81A 2M0GB 3IRWP 4KGZB 3CIZA 1RB0A 4C8LA 4ZPCA 2D1CA 4LR9A 3MAAB 4J7CA 4TLRA 2X3TA 2HHHF 3U1LA 4RNMA 2RKIB 2IA6A 3TZWA 2CQCA 4QPTA 1YJWS 2A0FB 1S0NA 3MEEA 5KFEA 1C1CA 3IM8A 2A10A 3R5GA 1UFWA 1MR9A 2OD6A 5DDRC 4BCAA 1VK3A 4DR3F 4CLKA 3D66A 3KDOA 2HZAA 1C1BB 1PC5A 1AW0A 1S1VA 3SGBI 5G0RB 3BKFA 1LV5A 2G0IA 1WWHA 2FJXA 1AFIA 1YWXA 3SZ2A 2KFNA 4N56A 1HD1A 5J2MB 4N8OA 4DQSA 2O5DA 1T95A 5DLFA 5T7LB 3KLGB 3W61A 3OH1A 1TV6B 1JXVA 1YI2S 4RNHA 5IQQA 2V69A 3HVTA 4KFBB 2FIUA 1M1HA 4DCJB 2ZUAA 4C0OC 2QSWA 1VQPS 1RWXB 4PCQA 1MMDA 3MAAA 1TL1A 4NXNJ 5KT7A 3V6DB 2A2CA 4B3TF 4WTOB 2D3O1 1S80A 4C8OA 4LF2A 5ADXV 2HVIA 2OSQA 1LQ9A 2W9BA 5J8CA 3W7BA 2EG1A 4PXDA 3OH3A 4AL5A 3GG0A 1F60B 2CUYA 2EFVA 5L1KA 2JFDA 1NB2A 1Q86T 1C0UB 4UQTA 3R0SA 3PDNA 3ENVA 3V2UC 4HT5A 2OD4A 1C1BA 3W3SA 4GI3C 2W1BA 4LFAJ 4I6AA 3WC2A 4I6YA 4QYRA 1SGPI 1HD0A 5LJ5Y 1URRA 1P9YA 3LTOA 3POTB 2DISA 2IIHA 3HT3A 1R8BA 3H5XA 1IKVB 2K9HA 1X5SA 2WVJA 1U1OA 2HVHA 4PG5A 3ICLA 3NWRA 3T1HF 3V4IB 4C97A 1FVSA 1HWIA 1EP4A 2J7WA 1U0SA 2DD8S 1HQUA 3QQCD 1TV6A 1RK8A 4F7VA 1RTDA 4MMOA 3FEZA 3NS6A 4KFBA 4YUDA 2CQ0A 3TQEA 2BJ9A 5IFMA 1LK5A 5A8KB 4FBUA 4PWDB 2EW9A 4NMXA 5F8LA 2ASLA 1JXLA 1CC8A 1FKPB 1I1GA 3GE9A 3PYDA 3G82A 1LWXA 4ER8A 2DITA 3K89A 2MQMA 4HT7A 1TTHB 1VQLS 3FSYA 4F2RA 2PMHA 4WYWA 1FA0A 2D9PA 3PV8A 5HANA 1TGSI 4KH0B 4QR2A 2KM8B 1UUCA 1RZMA 3KUHA 2JHEA 4USJC 3M6WA 5KFJA 3CJSA 3BJIA 3GMGA 1N88A 1TUWA 1KRRA 2RU3A 1QAYA 4NI2B 2IC3B 1WG5A 2UXBF 2ADBA 4OJ1A 2KI2A 2D74B 5JMNA 1IKVA 1YU6C 2ICXA 2UVRA 1X0FA 4O3OA 3AHPA 4PR6A 1HWKA 2AF6A 4LRAA 1UJ5A 3VGTA 3TOAA 1IN0A 3BO4A 1VRUA 2BMBA 1NZAA 1FWLA 1VISA 2HKEA 3QT5A 4DR6F 1EKRA 2B7CB 2GKRI 1SKSA 5A8KA 4UOCA 2QLBB 4IOAQ 2M8HA 3MM5B 1DQ9A 2M88A 5HN0A 3EWGA 1DTTB 4V1Ak 5J1NA 4H4KA 2D9OA 4EA7A 3AT1B 2KCXA 3MM9B 4TY8B 1S7IA 3TVYA 3GFHA 1N5VA 1UVKA 4O0IA 3A3NB 4LJMA 4IRDA 1X4GA 1L0SA 1XQIA 3TVZA 1Q7LB 4ISXA 2UUBJ 1U09A 2F8EX 5HLFB 4ZVPB 3W5YA 4HHHA 3VNPA 3VAKA 5KG6A 1UVFA 1PSDA 2P8IA 1NMEB 2CAJA 2IC3A 4ICLB 4JI6J 3PYEA 3TV0A 4P7TA 3ZZOA 5KFNA 2MZQA 1WHWA 2BKNA 3EZ5A 3IBFB 4M9CA 3GJRB 3FCVA 3QIPB 3QGGA 3ZNJ1 1XHDA 5HQMA 4DU7A 4JI7J 1ZETA 4C0HA 4NRTA 5F8HA 2MLXA 3IO1A 2IJFA 2BM1A 2FUG9 3FUYA 4ZPBA 4IFVB 2IHR1 3LO3A 3PFEA 3GV7B 2NZCA 2AJ0A 4P7VA 5D6GA 2XGPA 2VBWA 5I3UA 4TN2A 2CZ9A 4KH1B 3T19A 3W62A 2PGCA 1VLOA 3IFEA 4FN5A 3CCMS 2RQCA 3FCWA 2OPPB 1RT6B 1HA1A 2RT3A 2VICA 3FCHA 4EUVA 4YP3A 3GU0A 3D1QA 2V0HA 2UXCF 2BUSA 2OP5A 3TJQA 5KG0A 1FX2A 4OX8A 1R0AB 3J7YU 1U1PA 2C3YA 8RUCA 4QBUA 1SH3A 1VHFA 3RUBL 2DR5A 2QLWA 4CLWA 1SJ3P 4DV1J 4LF4J 3SSRA 2G9OA 5B0FA 4IUFA 3D3BJ 1ZA2B 4J37A 3UO0A 1GXLA 2FHJA 1SL1A 1T05A 2GA7A 2ZNZA 1T03A 2LKZA 1X4BA 4I67A 2OPQB 2TDTA 1RT7A 3LAKA 3I31A 2B6AB 1P1TA 3Q8SB 2XATA 1C4CA 4OZ2A 1XMQF 3R27A 4IOBA 2Q79A 2CRLA 2N52A 4NXMF 2XLKA 3CCES 4WIQA 2LXUA 2RIJA 4P10A 2GVZA 1K7TA 3GJTB 2MQOA 3HO1A 1FKOB 2FZKB 3RG6A 4M63A 2BRLA 2Q6CA 1RT6A 3QIDA 3UE2A 2XHCA 5F8IA 5C2GA 2LLZA 5EGYA 2V8DA 5E41A 2JX2A 2WSFC 4YMEA 1R0AA 2HK3A 1KRPA 2OMLA 5DETA 1JLAA 5F9LA 4CCHA 5CH7B 1N32J 3G87A 3UNGC 1ZTTA 3GR0A 1VQ9S 2P2OA 3C15A 3QT6A 1NJWA 2HFNA 2CIMA 2RS8A 4TXSA 4EABA 2DRDA 4YEAA 1VI7A 2CZVC 1TKXA 4I68A 3O1LA 3W2VB 3DM2B 1RUSA 4DPUA 2ABYA 5ETPA 2BX6A 3A8KA 1N36F 3ULHA 2V9WA 2F5GA 2XMVA 1B3TA 4BDPA 2NU1I 1RT2A 3OR1B 5CCMA 3FJ2A 3PX4A 3MR7A 2DNLA 4OYOA 3NBPA 3K58A 3MTJA 2AJFE 2BRKA 2QO3A 3EPGA 4PUOA 2DVIA 2APOA 1FKOA 1FRXA 3BQ2A 4IYQA 1OPZA 1DS3I 1TZ0A 2KRBA 3JTPA 3P96A 3ISNC 4BWJA 2HBQB 4ANEA 1IY5A 3GQ8A 3KJVB 4ECQA 4UOGA 2QQDA 4C3MA 2GO9A 3IS9A 3NL0A 4OX7A 2J0QD 5DLGA 3HH2C 1N5QA 2YKMA 1R0CB 3FKBA 3IN5A 4X66J 2D41A 2BOPA 3VWSA 1S10A 5IT4A 2FVCA 5CABA 3W2VA 1SKUB 3DM2A 5L9NA 3T57A 3I0RB 1KSPA 1JK9B 1IR1A 3N6NA 3W60A 4USHA 2Z2LA 2AKWB 4A47A 3BREA 2ZKUA 2CPFA 4ZVFA 2ROPA 4DN9A 2GGQA 2QRRA 4KGMA 4ED2A 3SI8A 5KG5A 4WFBQ 4YR0A 1FVQA 1N34J 2V8GA 2VFTA 5DDPC 2RF2A 1U2CA 2GX8A 1M5HA 1ULRA 4TQSA 1FHTA 3DNCA 4NLOA 2V4JB 1H38A 1MROA 5BR8J 4AE5A 1UTAA 1SV5A 3N6MA 1K44A 3LP0B 2DJWA 4DV7J 3FBFA 2PD1A 3KJNB 2FHJD 2W0VA 5GMKa 5FLXY 4C0BA 2BOAA 1PBAA 3NAHA 3GIJA 2QFJA 5E3CA 3HKZD 2Q1LA 1ZM2A 2DGOA 2JRSA 2PSZA 1KHRA 5HP1A 4KQZA 2VJVA 4TU9A 3NRBA 1NJXA 4CLZA 3C14B 3M6VA 4CIOA 1Y3JA 2DY1A 2HQDA 4QR0A 1DLOA 1UVLA 4RBTA 1ULMA 3Q24A 1TUSA 1QRGA 2E1AA 2MKYA 4HYKA 3Q8PB 1EKSA 5ETRA 2YX7A 5HQLA 3P49B 2J9DA 3IG1A 3VDUA 5ETMA 1D09B 2U1AA 1ITPA 3CEDA 1CT4I 2QZ8A 1UEKA 4RWXA 2XZWA 3DLJA 4ZMMA 1NNDA 4G1QB 2ZJPQ 2RRNA 2RB7A 4H4MB 1WC5A 1OQ3A 2FVQA 3BZQA 4OIXA 2CJSC 5LMNF 2W24A 3NGRA 3HHKA 4F4WA 2MZTA 1HV9A 2ZHOA 1J2VA 2LU1A 2JFKA 4I7FA 3WQPA 1MNEA 1KTQA 1FEEA 1N0VC 2HQGA 5L46A 4M5DA 3UCZP 4LIWA 3C14A 5L8RC 3MCMA 1CE3A 4K4XA 1T3OA 3HSGA 3J80Y 1T94A 1IKXB 1SGNI 3EGVA 4EYHB 5HVGA 2HPUA 4RW6A 3RBXA 1TMMA 3C6UB 1N54B 2UUAJ 2XNQA 2WONB 3HVWA 1KLMA 3PX0A 3EICA 5FDLB 4E75A 2MQLA 2SGEI 1Y5IB 4RUBA 3AB4B 4ZP6A 3V5RA 2J9DE 4N8NA 3OU9A 5DG7A 3T9ZA 4NLDA 3P3DA 4A8QA 2LDIA 1UFLA 3H59A 3IAM9 1VOMA 2O1PA 4MH8A 1WF1A 1D9FA 3DMJA 1D9DA 4CH0S 3D0HE 1PC4A 4CM2A 4CTAB 3DKDA 2BYCA 4A24A 1FRLA 4P75A 4WWSA 5C25B 1IBMF 3Q8QB 5T41A 2D7SA 1S6PB 3NCQA 3G71S 3M2RA 2BJ3A 1Q0NA 4EZ9A 3MZIA 2RH3A 1PBUA 1NLKL 1XBTA 2HNYA 5LXYA 2NXJA 3FWWA 2YWGA 1Q8LA 5F8NA 4Y2KA 3K17A 1CS4A 2E5IA 1M0SA 4DR1J 1WD6A 1FJGF 4EWTA 3US5A 1S1XB 4G1PA 3VBMA 2YXLA 1L3KA 3G8QA 4TYBA 4C48A 4DSIA 2WONA 3R7BB 3E59A 2F8HA 5FDLA 4OHVA 2EC2A 2MYFA 4H54A 1RYRA 4IHFA 4P2SA 1S7HA 5KTQA 3PW4A 4E98A 3IGVA 4R36A 2L7XA 2J7KA 4O23A 3JYTA 4QWAA 5IS2A 1BMQB 2CQ4A 5IM0B 4DG1B 2FGOA 2VL1A 4WU2A 1BD6A 2QMWA 4EBEA 3DDIA 4LF9F 2ROEA 1KRUA 3PJXA 4DXLA 3BR9A 1M5OC 1KK6A 3TEGA 4UUXA 1S6PA 4M1KA 4OYWA 1OYDA 1S57A 1HPTA 3DDNA 5D78A 4LF5F 1T0TV 5K8PA 1RT4B 4KPXA 4QYZJ 1KP6A 3W66A 1TUGB 1V3RA 4KHRA 2XYGB 1UA1A 2W2PP 1WC0A 3UVJB 5EDWA 1U6ZA 1LWFB 3RGIA 3RB4A 5IC4B 3GZ7A 2LFVA 4CNYA 4MTPA 3T5KA 3ADAC 2V2VA 3VDPA 3OR2B 1SSTA 4LRBA 2L9DA 4YB5A 5K5MA 3A13A 3I4HX 3JQJA 1RAJA 3AXMA 5JJBA 1DZ5A 1W26A 2C2MB 1CQNA 4ZLJA 4CH1A 2H54B 4QCLA 2H5EA 4A8XA 2GHWA 1MJAA 3RR7A 1WHXA 1RTJA 1QVGR 3RAQA 3Q22A 1FYBA 2ERRA 3K2YA 4M5IA 2KMOA 1H0HB 4U7CA 3TAQA 2P9EA 5IM0A 4JP8A 1BC6A 3RW7A 5F0UA 2W2OP 3D2WA 3CVKA 1ZAVA 4OJ3A 2CWHA 2QPOA 3LP1B 3M6UA 4JI3F 4CO0A 2XG8A 3P1BA 1S9GA 1WTJA 3F0NA 2FKOA 2R8KA 4ERDA 3SCIE 1U26A 4B3OA 2OI5A 1O8BA 1IUJA 2L3MA 5KOWA 1RCXB 4PQUB 3DRPA 3T6JA 3TWDA 2BV3A 1IBKJ 3Q0AA 4IR9A 1S0VA 2R7TA 3CJ3A 2R2TA 2CNOB 2GIVA 4XAKA 2V1CA 3NAIA 3CTRA 3OUYB 1FCAA 1WACA 4B3SF 3L09A 4X4OA 4NE9C 3BBCA 3CDAA 1NEEA 3M30A 3MM6B 3U1NA 5AXNA 1RWVB 1Y0HA 4IG3A 5IOLA 2KFYA 1Y00A 3CULA 2I9SA 4OX9J 2EBEA 2K3KA 3DHXA 2HHWA 3SIPB 3PW2A 5HJYA 1HM0A 5D0GA 4DZDA 3A4TA 2IM3A 2ZOMA 3NZ2A 2NR0A 4C11B 1F9HA 2VFRA 1YP3A 1C4AA 4GMKA 3LP1A 1R0RI 3FNNA 1IXKA 3HHLB 4W98A 4RUAA 4NXNF 3TO9A 1SC1B 4ZVGA 3MR5A 4PQUA 5U2KA 3K57A 2NPOA 4PWWA 2EI5A 2QA4S 3IGJA 1T3NA 4IH6A 2NSCA 5KT4A 2KMRA 4QIEA 2VJUA 3CD0A 2GW8A 3O5TB 4YY3F 3OUYA 4W4MA 1H2UX 4ECTA 4ZP9A 1SGQI 3UPFA 1YTYA 4OYMA 2DNMA 1PTQA 4N47A 3OXFA 3KXDA 4MK7A 2N17A 1QQ0A 1YITS 1PJUA 3M32A 1VFJA 3H20A 4CWBA 4FBTA 1S6UA 4HH0A 2JC0A 3M8ZA 3VBKA 1KBFA 1K1SA 4K59A 5AE1A 1OMTA 3AAWB 4DR2J 4ZLNA 1OS5A 3N28A 2RMLA 3NWGA 1BGXT 4IDKA 2V50A 4Y34A 4XTTA 3KWMA 3EE3A 5M2PA 3HSDA 1FNOA 2J9RA 2O66A 3OFGA 2CJKA 1Q5YA 3I9V9 3K5PA 4ZN3A 1U02A 3CCJS 2R7XA 4ZJOA 4Y6IA 3CIMA 5HVHA 2GQCA 2YNGB 2WVEA 1Q8KA 2HFUA 4FF3A 1DTQA 2W4DA 2M9KA 3S7RA 1F1BB 1JNRB 1SIZA 1VMBA 2RQKA 2LCWA 3BV8A 3QWPA 2DCLA 4AQYJ 3KG0A 3THPA 3TAMA 3MOJB 2W9CA 3GJQB 2A1BA 1GK8A 2W01A 4W92B 3U1MA 3HHEA 1RACB 1SUQA 1P1LA 1X7VA 3DHOA 4QYZK 4NEYA 2CQHA 1BQNA 2LVWA 4LSNB 2OKQA 2CQBA 1Q8BA 1P9QC 3EDRB 3OD2A 2JYYA 1NB7A 2GKTI 2RUSA 2YKPA 2N4DA 2MKJA 2CPIA 3I0SA 3QGIA 4FXWA 2QC3A 1YJTA 5B0DA 2VG5B 2ZVIA 1Y8FA 1Y5NB 3PHTA 1THJA 4NCGB 3CNQP 3DU6A 1KK5A 2ZD1B 3HJFA 2J0XA 4KRWA 2AP6A 4M5MA 1JLGA 2DXDA 2BQRA 3DN9A 3T5LA 2GNKA 2L9WA 4KO0A 3TEHB 1Y7PA 2VFUA 4ZP8A 1TFWA 4KV8A 1JKHA 4KNRA 2YH0A 3OXLA 1MWYA 2WGCA 5DEMA 2PMZD 3GIMA 1WHVA 2R2RA 2CQ3A 4MKVA 3OJSA 5DQHA 2NU4I 2RDJA 4CYUB 4LF6F 4EA9A 2BBEA 3OFEA 3Q8YA 1YDLA 5GADU 3TWZA 2ZBCA 5MAOA 1VQ8S 2ADCA 4JI6F 1XX6A 1GMWA 4KKOB 4HACB 2HG4A 4RWWA 4ZA1A 4JV2A 3CO0P 2R8HA 1VQYA 2DRAA 4USTA 5DQGA 2XS5A 3A8IA 4DL6A 4NX9A 2EBGA 3VAFA 1TK0A 5IQ6A 1PJ6A 2ZEJA 2G2YA 4FKDA 2AJ4A 1OY8A 4K6RA 4PKDB 1QRMA 1RU2A 2YWHA 2WBRA 4M99A 4USUA 2FVPA 3HLUA 2E29A 2XZDB 4MFBB 1T9WA 1RABB 3KHGA 1NRKA 4JI8J 1RDRA 3PIPQ 3BKUA 2DNGA 3ITHA 1VC5A 3BF4A 2ENZA 2HZCA 4ES3A 1X4HA 5DS7A 4R5PA 3MXHP 2EG2A 1V3SA 5RUBA 4DV1F 5D4PA 1JLQA 3MM8B 3CW2C 1X5OA 3NGUA 1RTHB 3VR1A 3GYXB 2J0WA 2ZBIA 1S0MA 2MQ8A 3H5SA 2X1BA 3MD1A 1LWCB 3SBMA 3M8SA 2SGDI 5CA5A 2N7CA 1JIHA 4DV2J 3GV5B 4JB8B 3L7OA 1YVFA 1LR9A 3F41A 2PN6A 1MU2A 2OTLS 2PIIA 2NYIA 1OYEA 2DB1A 5I42A 3H2UB 1VQMS 3ET6A 4C98A 5ADXU 2ZOGA 1JJCB 2LYVA 2QKXA 2ZH5A 4YN3B 1V3WA 5E7OB 2OPSA 3H5YA 2CADA 5DAEA 2LXFA 4NLRA 2V34A 5C42A 2LEBA 2E5LJ 3I56S 4QR1A 4UOFA 3QSYB 1RP5A 4Y0FA 2W8LA 4QIGA 2CWFA 1CC7A 1Z2LA 2R7RA 3SV4A 3W9HA 1S77D 4HZDA 2ILZA 5HK4A 1X31C 4F25A 5DGAA 3E01A 4U6PA 1O5JA 4HR2A 1TVRA 4WP8A 1RTHA 2AEFA 4Y2MA 4ZLLA 2UUCJ 4U9RA 2HWHA 1F9FA 2NREA 4ID5B 3ENQA 4OZ1A 4ECXA 2HVEA 2X1GA 2CA9A 3MUVP 2MQQA 1FI4A 1QTMA 2B0GA 4ZS6A 2DHAA 4AD6A 4DR5J 1IWAA 3OTOJ 3NEKA 3LWMA 4ED0A 1AUSL 2XMJA 3AXKA 2FLNA 2BJ8A 3A1YG 4DCOB 3O8WA 1KOOA 2MGZB 2HWTA 2HNDB 1HPZB 1MJ9A 1Q53A 1NHKL 2Y0SD 2VRWB 3MMCB 2VF3A 1X4DA 4ZPAA 2KVIA 3AQPA 5E3PA 5ETQA 1NSQA 3J80U 3TA1A 1S1WA 3EZOA 4K0KJ 1W25A 1XBWA 1H7WA 1X4AA 3R2CJ 2UZAA 2G1HA 2MZ1A 5FUXA 1AZSB 3KJQB 1BY9A 5K9FA 1GMWD 1WG1A 3TA0A 5F8MA 3SEKC 3NGDA 3M8PA 1VC6A 5AJ3F 4K7QA 1UWBB 1U5KA 2NU2I 4BWMA 4DSLA 2KG1A 1WI8A 2MKKA 3OW5A 3RB0A 5ETTA 2X52A 2XSJA 1XATA 2VG6A 1AA1B 1KONA 2ROGA 2KT2A 2E9TA 3NCRA 1T9TA 4JCVE 3H25A 1WKKA 2IPOB 2R8IA 2GIQA 2WK4A 1UFKA 4A8FA 3KYLA 2QV6A 2AYMA 2HAFA 2CFXA 3E51A 3UR3C 1CJUB 2BE2A 2KHCA 1SCJB 3CO9A 3H42A 3HI9A 3QGPA 5LMUJ 1HPZA 3KLFB 4ILRA 2W2MP 3DLGA 1VBZA 1UPPA 4URQU 4LF7J 4O4RA 2Q3PA 3QBCA 4KBIA 2MHNA 1N34F 1SKWA 3KUEA 2IU9A 3B78A 3DRXA 2K7JA 2WVDA 4RL1A 1QRFA 4RW8A 3V4EA 1RJJA 2GJIA 1WHYA 2YPZA 3CMES 2H65B 4DV7F 2ZH6A 1QRLA 3ZTSA 2W7PA 4NA1A 3UDEA 1KC8T 4USVA 4WJBA 1NBEB 2F63A 4LMZA 3Q89A 4USWA 1IM6A 1V5IB 1VS3A 2RE1A 1HQEB 4LIRA 4A8OA 2HZVA 1S76D 4EA8A 4PG6A 3MPVA 3R8YA 4PXCA 1WG4A 2B9YA 2C3UA 2ALYB 2Z2YB 1WTBA 3BKTA 2YH1A 4WZMA 1KN6A 4MKYA 2H4YB 1BQMB 2SXLA 2E1CA 2AV5A 4QQBA 3GVDA 3MMBB 3QWUA 3BXYA 4N69A 1JLEB 1VRTB 3VQSA 3RZAA 1FWPA 3SV3A 4GVBB 3TOQA 1BUXA 1CPZA 4J9QA 2RS2A 3EGWB 1YJ7A 3K7RA 2KRRA 3CCTA 3HHNB 3TYTA 4Y2IA 1UETA 2DNPA 2AEJA 2WZ1A 1V6HA 4XIUA 1MMLA 2AEMA 5B09A 1RHJB 4J9KA 4M2BA 2VUGA 2BR0A 1V3ZA 5GAGU 3N5FA 1RHQB 1UAWA 1VBYA 1IR0A 3GTYX 4K5RA 1JLCA 2E7WA 2VONA 4Q45A 3KLHA 2V0JA 5EWEA 2PE8A 4ZVUB 4NLTA 3JTOA 3LALA 3U27A 4PEOA 1YKWA 3DOLA 3LANA 3KK1A 1KDNA 4QIVA 3MEKA 3FSCA 5KT6A 2GMHA 3DGPA 1BQMA 1GTHA 4DOZA 1S48A 3GQAA 1N4IA 2IY5B 1PTRA 2JOQA 1ZOTA 3RBDA 4WFNQ 1IKWB 2EFOA 3O44A 1NK4A 1HHQA 4I2PB 2B4UA 4AA7A 3WX8A 3K5LA 2YVSA 2DBBA 4LF8J 2QLXA 2IC7A 3PRDA 1S1TA 4R8UA 4YR3A 1FARA 2AW0A 5CYJA 1ZBTA 3FSIA 1BE4A 3NKYA 5KFFA 2X3GA 3DFEA 4GKKJ 3HF5A 1JLFA 2O01C 3JQMA 2RC4A 2Z4PA 1XR7A 1N6QB 4ECZA 1K0VA 4DL4A 5B0CA 2XB2D 3PCOB 2VBZA 4ZDNA 1CJKA 3QJPA 2KYXA 3I5AA 3TZYA 3BM7A 4UW2A 3L3CA 1U49A 3CDEA 2GC8A 4WP3A 1F3VA 3AH6A 4RU2A 4LBIA 1A6LA 1SSQA 3CPWR 2PFFB 3JSYA 2XY5A 3MD3A 4ZVRB 4UY85 5HROB 4DR1F 1RU1A 5L38A 4B9VA 3HT0A 3QPIA 2V1CC 4XDCA 1GNKA 1YJ9S 3H2VE 1Q16B 2I5JB 4RBVA 4J9VA 1UZDA 4DX8H 3C16B 3QO9B 2V0KA 2MTLA 1T11A 3GCWP 2Y1JA 1K0TA 1UVIA 1IKWA 1M8CA 3HX9A 2DKVA 4OZ0A 2IM0A 4Q44A 1HNVB 2QYGA 2KVQE 4G87A 1EIYB 2C2RA 2HGMA 2IJRA 1OWXA 5A2QY 5L1LA 4JI2F 4DSKA 3HVRA 2PEHA 5K8MA 5KFIA 3K8WA 3A8EA 1HBOA 1BLUA 2BANA 1PAUB 1RTIB 3CXLA 3SDEA 2MKIA 1CGJI 4USIA 5LM7E 3SSQA 3BYRA 4E8UA 4ENOA 3KWEA 1OY6A 4LRCA 1TIHA 2AJ2A 4C2MA 2G13A 2AU0A 1VQ5S 4EMDA 3G6XA 2ZHBA 3ISZA 5DGBA 5CCLA 1WKXA 3J81Y 1U6FA 2B8QA 2DHGA 1H73A 1U1NA 1VC0A 5HROA 5KFOA 3RRHA 1UVNA 3OTEA 5KFUA 4IKAA 5J1EB 2JW6A 4DL3A 2FHKA 3M2VB 1TQLA 3EX7B 2X1FA 4J09A 4DFMA 2FNFX 1PG5B 2IA0A 2K7KA 3IBCB 4DV3J 3QO9A 2G2OA 1ZH5A 4W90B 2ICYA 4PPDA 2DNOA 2Q4JA 2CPXA 3ENAA 3ZZZA 5EWFA 3D68A 3H5UA 2J8AA 1B7FA 2HQCA 5DM7Q 2HQFA 5GMDA 2UVOA 1NDKA 2P9CA 1F5CA 3TIOA 1I6JA 3PRBA 1FDNA 3SGQI 2VC1A 2KZMA 1Q79A 2K2PA 3FTTA 2RQ4A 4N7TA 3CUNA 3Q2TC 5J2QB 5GVQA 4DLEA 4DWIA 4ZCKA 1MN7A 3BH6B 3JSMB 1JLBA 1XTZA 3B8HA 3NS7B 3JAMY 1TK5A 4BS2A 4ZPWR 4WTYA 5KG3A 4Q43A 5KFBA 2DXFA 2F8MA 5CYQA 2WLEA 4FNHA 1X4FA 1DY3A 2B9EA 1HBMB 4CT9A 3BYPA 4KJIA 1SJFA 2BA9A 6FD1A 1WKJA 3OTCA 2HLUA 4HHUA 4KNXA 2LEPA 1IJEB 3AOAA 2KO1A 3R5CA 1WSRA 1FNMA 3M2VA 4KB7A 4NLYA 2ARPF 1U1RA 3G6ES 2OU2A 4C8YA 4EGGA 1VQKS 2BKOA 2NYHA 1F2HA 5D0HA 3MF5A 1WNEA 2ZH9A 2NS1B 4QWBA 4J9RA 5ETNA 2K1RA 4HTIA 1CJTA 2OPRB 4OX9F 4ELUA 3DC2A 1M5PC 3D4JA 2LDYA 3WIUA 4NLQA 1X4EA 1SQFA 4ZPDA 1LFWA 2CJXB 1XEZA 3QAHA 1YJVA 3UQSA 2HGNA 1QAJA 4GO7X 4QWCA 3JSMA 3DOMB 1FK9B 4J9LA 2CNNB 3QJLA 5GAEI 1JX4A 3GP9A 2VZ9A 3D6TB 3DOKA 3EVOA 1HBNB 4Z7YA 1NCLA 2VPWB 1PCEA 2V8PA 5AFUV 4ANCA 3TX8A 3J7A1 2BDPA 4WFZA 5DZ6A 3PG9A 4DV0J 1HHSA 3TO7A 4DHVA 4KE5A 3SQGA 4KY3A 1N5YB 2XYHB 2F9JA 3N4WA 1RWPB 2E73A 4CLYA 2XY7A 2FD2A 4MPIA 3NMRA 4YB6A 4LUBA 2GIRA 2QX0A 4WFAQ 2HS4A 4OI0A 1QE1B 1T9VA 4CI0B 2ZH3A 5AXMA 4FVCA 1S12A 2RVJA 3VVUA 9WGAA 4K5SA 2N71A 3TUZC 1TBNA 4J9NA 1WF0A 1ZM9A 2HMIB 2OO4A 1IBLJ 2AZ1A 1XMBA 2V2ZA 2GZOA 1BUSA 4XPEA 2C2ZB 3MWBA 3M6XA 3GG1A 2R7QA 3TI0A 1R3NA 1SGRI 1FK9A 4FXDA 2RILA 2XEXA 1NUBA 2OEGA 4EI2A 3KLIA 1FD8A 1LXNA 5CYMA 1Z4UA 2NZ4A 1SI9A 1VIXA 1HBNA 5E33A 1ZS6A 4DNCA 4RJVA 4YHHJ 1VQNS 4Y65A 2WLCA 2C1EB 2FZGB 4H4OB 4EEYA 1XN9A 3HSJA 4FS2A 3AA8A 5KFCA 3WIVA 2UU9F 1SJ4P 3PX6A 1TKZB 2NQPA 2NPFA 5KFTA 4AQYF 2J6TA 3UW1A 4O4GB 3H90A 2VH7A 3MOZA 5K8OA 4X2BA 2JLFA 2G4BA 3R5BA 1HL6A 3BB5A 3F44A 3T9NA 1J5OA 2CPYA 4J5OA 2Z58B 3BSYA 1HR0F 3ZZYA 1NK5A 1Q95G 5IXUA 1REVB 5KFVA 2DIPA 2BEFA 2AMCB 3NP5A 4U96A 2ROWA 3ZTQA 2HHHJ 3OH2A 1S6QA 1FXDA 1SH0A 2ZM6F 4DSEA 1FESA 3DYAA 3PXGa 2AIRB 4YS2A 2E1RA 1CHOI 3KG4A 2DNYA 3HKWA 1JXEA 1QREA 2VC0A 3OH0A 4P2XA 2QTWA 3IR6B 3ISND 4B3RF 3AJDA 1FNXH 4C6AA 3E3XA 2KMPA 4QW8A 1MN9A 1UHAA 2P9GA 2WCYA 2ZH4A 3VE5A 4MFGA 4OI4A 2B4VA 1MT1A 2Q43A 1R8PA 3GLJA 3Q1XA 2EPIA 4D3HA 2GGPB 5F41A 3DI6B 3I6PA 1UEUA 3L95X 2XULA 3W9JA 1NPKA 4WFYA 1ZM4A 2XLIA 3ST8A 3CCZA 3MPWA 2YBVA 3KK2A 3AB2B 3EPIA 8AT1B 2HGLA 1PIEA 3IR7B 2DR7A 4ZLPA 3MGJA 2DR9A 3I3XA 1TURA 4B3TJ 1HBUA 3VV2B 4C3KA 2KXFA 3GJSB 5KG7A 4QJVA 5T14A 2HBYB 3BS9A 5IWAF 1FDAA 4OZLA 3D6MB 3T5HA 1EZZB 2C22A 1SJ1A 3KK3B 2N4CA 2C3MA 4JI0F 2PA3A 4KHMA 4FF4A 1LW0A 1S9EA 2CNKB 5A8RB 4LFCF 2ATLA 2WRMA 1RBAA 3BDEA 3IC1A 3TANA 2D3OR 4DFKA 2RDDA 4CLFA 3HJJA 3I5BA 1KQFB 2H3EB 1FDBA 1JJ4A 3LPEA 3G6YA 2K06A 2WSCC 5FD1A 1WI6A 1RAAB 3CD6S 1Z90A 1G97A 4QIFA 5M2UA 2XWYA 2CYYA 2GGPA 3MUMP 3R5DA 3TOBA 4DPTA 4N27A 1H2TZ 3N0VA 2ILYA 2J8SA 3QT7A 4WP4A 4RZRA 2ELIA 1C0TB 4TLQA 1U7LA 2FHMA 4UZBA 1RT5B 2RSQA 1EX8A 5HAOA 2DGQA 2ZH8A 2FHOB 1K1QA 1KVIA 1NHUA 2AJQA 2CG4A 3FOQA 3DLKB 1KQKA 2BVZA 2RKIA 1EQ0A 2JF2A 1ULNA 4TKTA 2L08A 1RWOB 3THVA 1HJAI 5KFHA 2OVOA 2DGXA 3JB9k 1PYOB 3KK3A 3UR0A 3GFXA 4X62F 2F3CI 1VIOA 3FRYA 2XSFA 4ZVEA 2WB4A 5A8RA 3OFFA 1YJNS 1HIYA 2NUUG 1WORA 3HDSA 2UXBJ 5G0RA 1FRHA 2LQ5A 2P2CB 2AX0A 4OVOA 3W8GA 3JXOA 4FYXB 4B9LA 2E5LF 1VGYA 3HD2A 1TL5A 3EVWA 5J2MA 1NK8A 3TZXA 2KDOA 1Y1BA 4X4NA 3VHQA 2XHWA 5T7LA 3KLGA 4FCEA 4ILLA 3OPKA 1UW9A 1J5EF 1Y10A 1PJ5A 3HJVA 3HK2A 2EK1A 3NMAA 1X4SA 3J81j 2A6OA 4JYAJ 4B6DA 2HLTA 2VHGA 2BQUA 3R97A 5J2NB 3SMZA 1QUVA 5DZ7A 4E1RA 3TZZA 4WXWA 3V6DA 2KTQA 3MC4A 3DLKA 2H5IB 1S59A 3OTOF 2SGFI 3V4MA 4XO0A 5LSOA 5D4NA 3U02A 1PO6A 4B9TA 1S1UB 3GOSA 4JV5J 1WOPA 4A46A 1C0UA 5ITHA 2M2BA 3UGIA 2ALZA 2CDQA 1K8AT 1SQEA 4K0KF 5KFKA 3POTA 2MEWA 2E5HA 4K2JA 4L3KA 1IQTA 4K4TA 3L4BC 3H98A 1K7UA 5EUHA 4K50A 1TL3B 2A18A 3SPTA 3V4IA 2F3JA 4DF4A 1GH8A 4YDDB 4RW4B 2W4CA 3MM7B 5B0EA 3LF0A 1YTPA 3EXCX 2BM0A 3O3LA 5U47A 4C8KA 1SGYI 2J76E 3CCRS 3ILLA 5J1PA 4X65F 4PWDA 2Y0BB 3CJ4A 2KMQA 1FKPA 4MIWA 4ECWA 3HXMA 1LWEB 2BE9B 2SGPI 1TK8A 1WOOA 4OFZA 2M3DA 3OL0A 1KGQA 1RAGB 4YFUA 4NYZA 1P8GA 1Y11A 2VG7B 4IHGA 1G3OA 5LMUF 3CT9A 4PWUA 4KIAA 2MKHA 1G2EA 3K0JA 1DBDA 4LF7F 1S4EA 1TBOA 4IRCA 4KSEB 3UDLA 2YNIB 2JF3A 1OSDA 2W4PA 1Y4ZB 4NI2A 4DFPA 1GTEA 2H4WB 2HWIA 4F4YA 4IO9Q 2KHDA 1U2RA 3MCSA 4DBQA 4ZCIA 5ETSA 3CJRA 3CB4A 4LR8A 4BC9A 4F36A 2W2NP 1NPRA 3T1AA 3CJ5A 1S49A 2OSRA 2W7AA 2J5AA 5CZXA 1FFWB 4WP9A 2ZC4A 1XMQJ 2H48B 4O3SA 2JNJA 2KB2A 2JLGA 3NY0A 1G95A 1YGYA 5DO2A 2IDLA 4NXMJ 2XLJA 4X4UA 4AXIA 4ECRA 2JDJA 2CVIA 2A20A 3RR8A 1WEYA 4TYAA 1DARA 2A2DA 1S9FA 1NXUA 2MSTA 5C2CA 3MM5A 3AD9C 1ZM3A 5HMZA 4MYUA 3D6FB 1AUDA 4LFBF 4D3GA 1DTTA 2JJ4D 5D8HB 1G7CB 2E5RA 4F0KA 5CD4A 3MM9A 4TY8A 2V0IA 1YSJA 4CT8A 2WLGA 5JXSA 4FDFA 3PIOQ 3CCWA 3I9ZA 5ETKA 5KFDA 3CGIA 4B9SA 2I5KA 4O0NA 4IHHA 5HLFA 1U4BA 2SGQI 2QE5A 3TJAA 3UFCX 1HW9A 1QVFR 4XPCA 1CSJA 1CULB 1FJ7A 3PACA 4ICLA 1QSSA 4Q0BB 4OYIA 1X4CA 3N01A 2GKVA 1U1MA 1O51A 3KTQA 3NGSA 2HQIA 1MR7A 1VBXA 4I2QB 1KD1T 2I2YA 3QIPA 4PYAA 3B54A 4ECVA 1KRVA 1N36J 4ZVTB 2YUUA 3IRXB 4IFVA 5A0YB 2AYGA 4RW9B 2AZ3A 2OZUA 1LK7A 4JOUA 2GQQA 5KFZA 3TDTA 1S5ZA 2B9XA 2OPPA 2PDAA 3VAGA 4X64F 4CLUA 3DRSB 3RB3A 3DDKA 1GX5A 2B5JB 5LXRA 4Y2AA 1KS2A 1HHTP 2RHQB 4NLPA 1OY9A 1Y1CA 3JAMU 1NKEA 2J7UA 1GXUA 1RWKB 2CG8A 3FQLA 1OMSA 4I6WA 1NSAA 3CCVS 4LF8F 1NKCA 3OQ2A 1KKHA 1MLAA 3R6LB 3UN3A 2V2KA 2HIQA 4AL7A 1CULA 3BQ1A 4Q0BA 4E6TA 4V19X 2UV8G 2MQPA 1UVGA 4UTGA 2OPQA 2BKPA 3QAEA 4R7PA 2G1DA 4U95A 2B6AA 3BGRB 2PMWA 4NASA 3CC2S 3W9IA 4ZIVA 3R1LA 3IRXA 1X5TA 3L9ZA 3M8YA 2QL7B 2CQ2A 3MFHA 5B7WA 3NG8A 3CCLS 2J87A 1N33F 3IR5B 2ZBQA 1U1QA 4DS4A 3AA9A 2HHXA 4Q2LA 1NK9A 3DRSA 4FYWB 1YK9A 4IO1A 4M5HA 3DLLQ 2LP4A 3VALA 2I8EA 1O0PA 3T1YF 3AOCA 1W4RA 3AJ1A 2R2SA 1FRKA 3C8VA 4L6V3 1H2VZ 3GONA 3TO6A 1ZA1B 3GIIA 2IVFB 4ED1A 1XMOF 2Y1LB 4F3OA 2IYGA 3ZTOA 2OJ3A 2GV1A 2PI5A 5HI7A 4JI4F 3VBNA 1YHQS 2FPHX 4ZPTR 4JI5F 4FP9A 3RBZA 3F73A 4C4WA 3SCLE 1ULKA 3OR1A 2IM1A 1RAOA 4OLPA 4GRSA 3QATA 5F8JA 2UP1A 4GC6A 2IVYA 3GQ9A 4OV6A 4DUTA 1UWAA 1LR7A 2V2QA 3D8VA 1AT1B 4FS1A 2Z56B 3BPDA 4ITSA 2R7SA 3R6GB 1B0TA 1FEHA 3BSAA 4DS5A 2L8EA 4UY8T 3MQGA 3ZTPA 4OV1A 3D7SB 5LMNJ 4OZ5A 4RLEA 3R1WA 2CNLB 3KLEB 1DURA 4DV3F 1XJWB 4KTQA 3QZ8A 3PO5A 1QSLA 3KJVA 4P2FA 5I3PA 4J9SA 2OAUA 2CZ4A 4NOHA 3M8WA 4UT4A 4NWBA 4JI1F 4NMLA 3BBBA 1UP1A 1J27A 4DCPB 3ZZPA 2Z0GA 5D77A 3P47A 1RYSA 4Y2CA 2XO6A 2DYAA 5CQGA 3I0RA 1ZPWX 1UKUA 4FPRA 4O44B 4F4XA 1F9EB 3G8SA 2YY3A 4EGLA 4DN0A 2NXNA 1Q1KA 4ZPVR 4BHQA 3QSIA 3DCAA 1WC4A 3OH4A 2KFZA 1Q5VA 5LT5A 4DV6F 3HPOA 3PM9A 1WEXA 5CHCB 2GAGC 1AROP 2MKCA 2CDRB 4G3SA 4WE1B 2HIYA 1U1LA 3HD1A 4ZJLA 4X4VA 3FBCA 4USKA 4C8NA 4U7UD 2ZDOA 1TL7B 1F0XA 1NHVA 2B56A 3W1YC 4DR4F 1EETB 2QQCA 2V4JA 1YG0A 2BJEA 3WZ0A 3TUJC 3IGNA 2M52A 4A8YA 1FY7A 4ATNA 2FJEB 5J2PB 4OJHA 5A6PA 3LP0A 4YQWA 2PO4A 1Q4RA 3DRYA 5HBMB 1RWNB 3SEOA 2CQ1A 1RTZA 3G4SS 2EFPA 3WDOA 4AYBD 2QYCA 2ZWPA 2DGTA 2HS3A 2JEGA 1U47A 1NU4A 2ODDA 1NPPA 1IBMJ 3BQ0A 1TUVA 2IBKA 1G4CA 1XR5A 3IBWA 3NXZA 3OVSA 2QQ0A 2DGWA 1SGDI 3UCGA 2PC6A 2WSEC 1ZZFA 3MR6A 4NA3A 2ACYA 1W3SA 3AJ2A 1HNXJ 3WX4A 4F2SA 1N13A 2OEJA 1FJGJ 2AYEA 1IW4A 1XWLA 4ZVQB 2KXHA 3ETOA 3J7Z5 3OJUA 2UVWA 1BQXA 2BQ3A 4IOCQ 3R7SB 5JVHQ 1I94J 1KBRA 2GGOA 4U7UK 4G1QA 3M1VB 3D1HA 3TUIC 2KJVA 4H4MA 4HVZA 4DV0F 1CBKA 4GVLA 1S97A 1ACMB 1VHIA 5A8WB 3CSKA 3RTVA 3FQKA 4ES2A 2P6TA 1E6VB 4CP5A 4IFYB 4B17A 2FVSA 3GQCA 4GO5X 3CMQA 3MR2A 3GQ7A 3TVKA 2WW8A 2BJ1A 1FE0A 1Z7KB 1FERA 4C8ZA 1QD1A 3PW5A 2IMWP 1LXJA 1N4LA 3V81B 1RGVA 4LF9J 1X9SA 4G1IA 3MEGB 3PO4A 4OHYA 3ZC4A 4X4TA 2I38A 1V1HA 1TKDA 2F4VF 5JUMA 4UXJA 1N48A 1IBLF 1FKAF 3VBIA 1VQ7S 3PEHA 1HW8A 2R4FA 1KNZA 2Y3YA 4LF1A 4NLWA 1IKXA 4WIIA 3MEEB 3E2IA 5KFRA 1KLNA 3R7NB 4WCEQ 3CJ2A 4J18A 2ZJQQ 2VBYA 2FYXA 1FTCA 2YX4A 1W7WA 2B51A 3C6UA 3EYZA 1RLDA 3LH2S 1FRIA 1R8AA 2VKZG 1FD2A 4YHHF 3KNAA 2I0XA 3KY9A 3CD5A 1RHMB 1S1VB 1NO8A 1HNZF 4AUKA 5KFPA 4HI2A 2XQCA 2RQMA 3TK8A 4OYBA 4DR7F 3BJYA 4F3MA 2ZBRA 1URNA 3MFIA 2IRUA 3MECB 2P6AC 4DSJA 2E66A 1D9AA 4HTJA 3KOAA 1TAQA 4F26A 2LA6A 3HVTB 5HMWA 2LUYA 4RUHA 4CTAA 4E6UA 4RBUA 2J0SD 1N5SA 4JI3J 1VQ6S 5BYRA 3WC0A 5C25A 3MEGA 4B08A 1BMOA 2UV8A 1SKRA 1TL1B 4ZN1A 4YDXA 4A8WA 1CG2A 1RWUA 5KG2A 2M5XA 4UXIA 2AYBA 1YBTA 1CT0I 3MMJA 4QWDA 2W9BB 1RT3B 2XWXA 2FVRA 1FE4A 1S1XA 3ONQA 1OCXA 4B3SJ 4M98A 3OTDA 3RAMA 1I51B 2BXJA 1B7YB 2QA2A 4A48A 2D3ZA 4F8RA 3MCOA 1R6VA 1UL3A 1RHUB 2ACMA 4DQQA 2L41A 4P6QA 2CJQA 5GAHI 4F4ZA 2MPUA 2CKWA 1HWJA 3MECA 1APSA 1KR4A 1EP4B 1RA6A 2H9ZA 1HQUB 4DG1A 3QRPA 2GCFA 1RTDB 1U8WA 3PMOA 1CVJA 2XBPA 3VAJA 5D4OA 5MLCV 2ZKTA 2MJNA 2C42A 2EKNA 1H98A 1RLCL 2HHQA 3G82B 3OV7A 2HHPA 4OI1A 1MSWD 3M2UB 3FDSA 1RT4A 3IWLA 4PPZA 3TR5A 2DKOB 2MXYA 4EQYA 2C3OA 5HJXA 1RT3A 3UVJA 1LWFA 3KMSA 3F1XA 3OXGA 4OQJA 4DX6A 4YY3J 3VCDA 4KC5A 3PVXA 4E2FB 2OEKA 1R7IA 3ZZTA 4M5NA 3OR2A 1F6TA 1L3SA 1Q9BA 2Q6BA 4HKQA 2KN4A 3GV8B 1M5VC 2G0CA 5A76A 3CJQA 3ZFVA 1M5KC 4R25A 3VQTA 4CO2A 1GMUA 1YQHA 4PG7A 5B0AA 4NZ7A 2RNEA 3IWXA 4OL8A 3BGLA 1GFWB 2OLWA 4NYPA 1T9UA 2QQEA 2U2FA 3RYLA 1VRUB 1A9NB 2HS0A 1FRJA 4PG8A 8ATCB 1TKTB 2GAHC 3CXCR 4ZP7A 2YKAA 2DNRA 4LBPA 5HSPA 1YRTA 3FVYA 2ZC3A 2YQ1A 2EFGA 1M1KT 3CJTA 1VLYA 2JVRA 3IAS9 3M2UA 1TFYA 4AMLA 1U45A 4DDFA 4EYIB 1PKUA 3JS9A 2HHSA 4DMZA 2COLA 2KM8C 2MJUA 1ROFA 2BJDA 1W2IA 2XMMA 1S4FA 3H7HB 1YZ6A 2BZ2A 1NJYA 4PZVA 1LNQA 3MM6A 2IDEA 4LFAF 2AWZA 4MZUA 5AFUU 1WEZA 4RUCA 1NH7A 4J9PA 3GR1A 2EEYA 1QLNA 2C2OB 3UEYA 2E5JA 1MG7A 4E1PA 3PEJA 1QJHA 4Z7CA 3FGVA 1RHRB 9RUBA 2VPZB 2F40A 4HH1A 2YWEA 1R8HA 1M1GA 3G6VA 3I96A 1ELOA 3M8QB 4C11A 2NXEA 3JQYA 2IYIA 1KEKA 5B08A 3EUNA 5DG9A 2RJZA 4J90A 1TKTA 4JYAF 4M8LA 1IKYB 3BSOA 2E9ZA 5I3UB 3V6KA 4DPYA 2QA1A 5E3RA 5D0RA 3HHLA 3HSZA 1F5AA 1PCAA 1BHNA 2KT5A 1RWWB 4DSFA 4C7QA 3KHLA 2F4FA 1M5SA 5KOXA 1JMTA 1R27B 2ZBPA 3X3UA 2QMUB 3SUCA 3ECTA 2YKNB 1Y5LB 5E3AA 3OSNA 3QLHB 3OLAA 1S6OA 4LR7A 1RI7A 4NA2A 4KGVB 2VD3A 2HURA 2YTCA 4JV5F 5E2QA 4ED4A 5KT3A 1YLXA 2ZZNA 2H5JB 2X1AA 4LF6J 1WTFA 3V6HA 1PILA 1Y3KA 2VFVA 3NNAA 1T05B 3TQ1A 1T03B 1QY7A 4EBDA 1RT7B 4AXJA 1U6BA 5IV3A 2MDAA 3LGHA 3PKMA 2RD5C 2W9AA 2ZVSA 4ES1A 4B9UA 3H4DA 1HM8A 1RADB 3M8QA 2B8TA 4M28A 1WKLA 1IKYA 2V0LA 3Q23A 2GVZB 4MKAA 3O6QA 3DK5A 4FYYB 2N82B 4NLXA 1TL4A 2CPEA 4NL5A 1DQAA 2VBXA 1WF2A 1HNWJ 4M5GA 3CDWA 2YNGA 1HKAA 1SPBP 3VGSA 2YKNA 1FT8A 5KG4A 3QLHA 1SC6A 2DHHA 3D6HB 4ZHRB 1EHWA 1JLAB 2DNHA 3PYGA 2HRTA 2VOOA 2UUBF 3OGZA 1H74A 4CO1A 2NLWA 3C15B 1KHVA 4ZVOB 5D3GB 1T3DA 3MHYA 2HYIB 3L7PA 1TKXB 2RRBA 1TR0A 2GQ2A 2Y8YA 3CC4S 1RFHA 4ANDA 1P27B 3IP0A 1WJ9A 1U48A 1QM9A 4KAIA 3OHBA 5H9FJ 1D3WA 3G86A 4OYPA 4OZJA 3SQOP 1HI8A 2RUGA 3A3OB 2RU9A 3TISA 4LSNA 4JI7F 4CM0A 2FTRA 1SL0A 1RT2B 3ZO7A 3Q2SC 4QIWD 1Q8IA 2PEBA 1RCOB 2R2UA 3OTMA 2YQPA 4KPZA 4AL6A 3NBPB 4HHJA 2VG5A 4N6AA 4K4ZA 4NCGA 4PUOB 3BN4A 4B9NA 2JH3A 2ZDPA 1B0VA 4PAAA 3FSBA 3IXQA 2ZD1A 1KVJA 5KFWA 2JLEA 4A8SA 3VBJA 2M4MA 3E8OA 2BW2A 1W2BR 1QAIA 2MHEA 5IZHA 2P5VA 1FXRA 2Z2ZA 2XCAA 4TVAB 4ZHRA 1KK4A 3OT9A 2M5YA 2FJBB 2E44A 2OEMA 1OVOA 4LF4F 4CYUA 3IS9B 1J2ZA 2E1PA 5D3GA 1YX2A 2YKMB 3R9LA 4WFXA 3K59A 3ZZRA 1AYEA 2AHOB 4KKOA 4IQXA 4HACA 5FJ4A 2QFIA 2MY7A 4ALZA 3WHIA 1YBUA 2LQBA 1RWMB 1LOUA 5AE2A 1SB6A 2VQFJ 3M4XA 2B0UC 5FLXU 3HHLD 3DGVA 4OLOA 5F8GA 2X3DA 4DQIA 2WHOA 1SC3B 5AXKA 1GXTA 1YZ7A 2XM3A 1SJRA 2JEFA 2GIFA 1TP7A 1K73T 2ORVA 5C24B 3FSXA 3D0IE 2PA8D 2C2DA 4GKJJ 2HQ3A 2QJ3A 4DQPA 1X8DA 2DO0A 3W63A 5CZVA 2XYPB 3MTKA 1NZ8A 5ETOA 4MFBA 2RF2B 5KFGA 2RRAA 3KNGA 5KG1A 2KL8A 4KR0B 2BE7D 3D28A 1VQSA 2QL9B 4EU0A 2XZTB 1MROB 4K2XA 1X9WA 1Z2IA 3UGDA 2V0NA 2VIHA 5EHHA 1SV5B 4EO6A 1DAXA 1KVKA 3W64A 5AJ3J 1N32F 4L75A 1B99A 3DLHA 4ED6A 4CLPA 3HMJG 3B6BA 5HP1B 4M95A 3MM8A 2VB6A 2KH9A 2HFVA 3EXYA 1REGX 3NOGA 1MW7A 2KG0A 4RX6A 1LWCA 5LSLA 2VDIA 1NSPA 1RT1B 1CQMA 1DLOB 5D15A 3TJ9A 3D3CJ 4OZ3A 1U8SA 4P73A 5C7PA 3B82A 4QU6A 3N6LA 5BXIA 4F02A 1K47A 2HK2A 2VDHA 3PJ9A 3IG1B 1KGTA 2EXUA 1H0ZA 1OYVI 3VAHA 3Q86A 1UA0A 5C24A 3ILJA 2L9NA 3NGTA 3S8SA 2NUHA 3PHEA 5SUHA 1KWMA 4WPAA 3DHWC 5GAEU 3P5TL 1P9GA 3MQHA 4BC7A 2BW7A 4K4SA 1L3TA 2V6AA 3HCXA 3HM9A 1KFSA 1FAQA 4ILMA 1TBQR 3RU0A 1WC1A 1N56A 4N41A 2UUWA 2AGQA 1RISA 3QTLD 4F50A 1MRLA 1XA6A 1NK7A 1ICEB 4I7FB 4NLVA 4I1TA 4PXBA 4HDGA 4NPOA 3GYGA 4PABA 1HARA 4DLGA 4OYXA 1JJHA 4M5DB 1QAXA 4LT6A 2QGFB 2QLFB 2F65A 3CE8A 4OYZA 2N3OA 4X66F 2R7VA 3KKFA 2GHPA 2MZRA 4ID5A 2DNKA 9ATCB 1RT1A 4B9MA 2HBRB 3P4UB 2V67A 3W2WB 1G1XA 3PJWA 2LXIA 3VZHA 4K4WA 2P6SA 3N9UC 2R3VA 1AN1I 4RW6B 2A3JA 5IT0A 2MGZA 1B0PA 5I4MA 2HNDA 3LAMA 2WVBA 4OI3A 1KLMB 1OIAA 3MMCA 1DJ0A 5F42A 2NCKL 2G2ZA 2BABA 2J9CA 2R8JA 4LREA 3X1LB 2ASYA 4AFFA 5H9FK 2OMOA 1QDUB 5H1SV 2DNZA 4FPIA 3VGVA 4KGKA 4AAWA 5BR8F 2DRBA 3T41A 2XTJP 1AZSA 2XS2A 3DMJB 3C3LA 1YIJS 3CC7S 4Y3CA 4FF2A 5BYSA 5IT9Y 1Q78A 3B4MA 5LL6d 3PR5B 1UWBA 1F2GA 2DK2A 2IMOA 3D1OA 4Q2MA 1Z2ZA 4DUZJ 4OZNA 2OFGX 3M2RB 3QGHA 5F9NA 3EJMA 3UDVA 2OGUA 1HLWA 2HNYB 4TNOA 4LQ9A 4WK1A 2YPYA 3W2WA 1CS4B 2JEJA 2EFQA 2DR6A 5M2RA 1Q7YT 1XK8A 2CWXA 1CJUA 4ZCLA 3BGOP 3A3PB 1A0OB 4DU8A 2FJWA 3KLFA 4DPXA 3T5JA 2N7YA 2ZWOA 4MT1A 4G65A 3BR8A 4LQ3A 1HDLA 2OHDA 2YWFA 2GVIA 2DH9A 1MMNA 4TY9A 2CQDA 4BBYA 3QFWA 3JYTB 3BSNA 1H3DA 2YQ0A 3NNHA 2LEOA 1SBRA 2W8KA 5C5JA 2PT0A 3GOXA 3BBFA 2IRXA 1DFDA 5K20B 5AXLA 1UJ6A 2V4QA 2ORWA 4OYAA 3FEYB 4PQAA 5HVFA 3P5BP 5HMYA 5FUVA 1B4SA 1HNIB 4F0HA 5B0GA 1XNQJ 1HQEA 2IU8A 1SGEI 4EBCA 3M9MB 3AFGA 1ZYQA 4K4UA 1HNXF 1RA7A 1NXIA 5AE3A 3GUEA 3SCJE 3HSQA 4E0DA 1GX6A 1EB0A 1KOHA 2ZZTA
chains in the Genus database with same CATH topology
3R2WA 1ZPVA 4YB7A 5HLFA 2HG4A 1HI1A 4EO8A 4RWWA 4ZA1A 1U4BA 3VZIA 4JV2A 2LQJA 2F7VA 2QE5A 2UUAF 2R8HA 3UFCX 4X4RA 1HW9A 3DRRB 4EZ6A 2XS7A 2MZJA 1HWUA 3MMBA 1VQYA 3LP2A 1QVFR 4XPCA 1CEZA 1I94F 1CSJA 1JLEA 1FJ7A 3PACA 1VRTA 3NCPA 4ICLA 4R0JA 1C1CB 4ZCMA 2DRAA 3LGMA 1QSSA 4Q0BB 1SIWB 1S0OA 1LW0B 1S9EB 1X4CA 5DQGA 2ZITA 1YP4A 2XS5A 5DG8A 1XNRF 3N01A 3QZ7A 2OFHX 4DL6A 1U1MA 2CPZA 4NX9A 1UVJA 2EBGA 3VAFA 1TK0A 2KU7A 1O51A 5IQ6A 3KTQA 2HQIA 1MR7A 1VBXA 4I2QB 2ZFHA 3PZPA 4IRKA 1KD1T 3GB0A 1L3VA 2AJ4A 2I2YA 3QMQA 4DFJA 4C8MA 3QIPA 4G3QA 4ECVA 1KRVA 4K6RA 3MEDB 4PKDB 1RTJB 1QRMA 2HRUA 5DDOC 3CMAS 3KG1A 4ETXA 2JEIA 1UMJA 4DEZA 3M1VA 3IRXB 2YWHA 2WBRA 2JC1A 4IFVA 4M99A 5A0YB 3G96A 2FVPA 3HLUA 2E29A 3V6JA 3UD4P 2OEFA 2J6UA 4MFBB 2AYGA 4RW9B 3VAIA 4ZOSA 3TNVA 2D3UA 4PXEA 3KHGA 3H40A 5A8WA 4HCQA 4OHWA 1LK7A 4HZCA 1NRKA 4JOUA 2VFSA 2CJ9A 3NS5A 3OTZA 2GQQA 4KHPF 2QT7A 1E6VA 1RDRA 5KFZA 3TDTA 4IFYA 3PIPQ 4OX6A 2DNGA 1S9GB 2B9XA 3ITHA 1VC5A 2OPPA 3BF4A 2PDAA 2HZCA 4ES3A 4DQRA 4J9OA 1X4HA 5DS7A 3BEGB 3VAGA 4R5PA 4K4YA 1HNIA 2VQEF 4B3OB 4X64F 3DRSB 2IAJA 5GAGI 4HEA9 3RB3A 3MXHP 3DDKA 3O2IA 2UVVA 2EG2A 1GX5A 3NGKA 3V81A 2B5JB 5LXRA 4Y2AA 3H8YA 1KS2A 1HHTP 3DRPB 4NLPA 2M0GB 1V3SA 4DV1F 2RDIA 5D4PA 1U2FA 2HFOA 3IRWP 1JLQA 2CQGA 1U1KA 1NKEA 3MM8B 3CIZA 2J7UA 4C8LA 1KQAA 2D1CA 4ZPCA 3BN7A 1GXUA 1X5OA 1RTHB 3VR1A 4TLRA 3FQLA 5KFAA 3OL7A 3J7YI 2HHHF 3GYXB 4ED8A 3U1LA 3M8RA 2J0WA 2ZBIA 1SSMA 2WTFA 1S0MA 4RNMA 4I6WA 3H5SA 2RKIB 3CCVS 2X1BA 3MD1A 2IA6A 2CQCA 4HLBA 1LWCB 4QPTA 3J7ZT 4LF8F 1YJWS 1NKCA 3M8SA 3OQ2A 2CPDA 3DRRA 1T02A 3RBEA 1YJUA 3H2LA 5CA5A 1S0NA 2N7CA 3M30B 4URGA 4QU7A 3MEEA 1FRMA 2V2KA 5KFEA 2HIQA 3CDBA 4AL7A 1JIHA 1C1CA 2E1MC 3BQ1A 4Q0BA 3CWJA 3IA0A 2A10A 3GV5B 4IG3B 4I2PA 1UFWA 1MR9A 4E6TA 2OD6A 4V19X 5DDRC 2UV8G 4BCAA 2MQPA 1VK3A 2ZH1A 4DR3F 3L7OA 2OI6A 2OPQA 3QAEA 2DGVA 1YVFA 1C1BB 4R7PA 1PC5A 2G1DA 2B6AA 3F41A 1AW0A 3BGRB 3MEDA 3CC2S 1S1VA 5KT2A 2PN6A 1MU2A 5G0RB 3PY8A 3R1LA 2OTLS 1LV5A 2LMIA 2NYIA 2PIIA 3IRXA 1X5TA 2DB1A 3E2EA 2CQ2A 5I42A 1WWHA 3H2UB 2FJXA 4RNFA 2YX1A 2QMXA 1VQMS 3MFHA 4IH7A 1AFIA 3HVAA 4C98A 5B7WA 2OH2A 5ADXU 1YWXA 3SZ2A 2ZOGA 4CO4A 4N56A 3RAXA 2KFNA 5J2MB 1HD1A 2LYVA 2QKXA 3NG8A 4N8OA 2O5DA 1YRUA 2ZH5A 4DQSA 3CCLS 1T95A 1N6QA 1V3WA 5E7OB 5DLFA 2OPSA 1D0EA 3H5YA 1N33F 5T7LB 3KLGB 1X0PA 3IR5B 3MUTP 2LXFA 3FFIB 1TV6B 4NLRA 1YI2S 2GJ2A 4RNHA 1U1QA 3MI7X 5EX3A 5C42A 5IQQA 4DS4A 3AA9A 2LEBA 2HHXA 4Q2LA 3I56S 1NK9A 4QR1A 3DRSA 3HVTA 4KFBB 4IO1A 1RP5A 2FIUA 3DLLQ 4Y0FA 2W8LA 4QIGA 2R7RA 1CC7A 1Z2LA 3SV4A 4C0OC 4C3LA 3VALA 2QSWA 2EK6A 1S77D 4HZDA 1VQPS 2I8EA 3FZ2A 2FLOA 1O0PA 2ILZA 4PCQA 3T1YF 1MMDA 4KT0C 4F25A 5DGAA 4O3QA 3E01A 3AJ1A 2R2SA 4ELTA 1TL1A 1FRKA 3C8VA 3K5OA 1H2VZ 1O5JA 2A2CA 4L6V3 3I3AA 1TVRA 5KT7A 4U6PA 1RTHA 3V6DB 4Q5VA 4QW9A 1FTRA 4Y2MA 2Q66A 1S80A 1JB0C 4FYDA 4C8OA 2O67A 4U9RA 1S79A 3GIIA 3HP6A 4KQLA 2HWHA 5ADXV 1F9FA 2IVFB 4ED1A 2NREA 4ID5B 1XMOF 3ENQA 4OZ1A 4ECXA 2HVIA 2I5JA 4F3OA 2OSQA 1LQ9A 2X1GA 2IYGA 3HZGA 2W9BA 3MUVP 2MQQA 3W7BA 3Q8RB 2EG1A 1QTMA 3R1HA 2B0GA 4PXDA 4ZS6A 2DHAA 2OJ3A 2GV1A 2PI5A 5HI7A 4AL5A 3GG0A 4JI4F 1SXLA 4MIBA 1F60B 3VBNA 3EG4A 2EFVA 5L1KA 2JFDA 1YHQS 2FPHX 3LWMA 4ED0A 1Q86T 1FXLA 1C0UB 2XMJA 4ZPTR 4UQTA 2FLNA 3R0SA 1HNVA 3A1YG 3WBZA 3PDNA 4N6BA 1KOOA 3O8WA 2MGZB 5JVGQ 2HWTA 3ENVA 4WKYA 3M32B 2QA4G 3V2UC 4HT5A 2OD4A 1C1BA 3RBDA 3W3SA 4JI5F 2HNDB 4FZVA 4FP9A 1HPZB 1Q53A 4JUZA 3F73A 1G6BA 2Y0SD 3TAPA 5KT5A 3MMCB 4C4WA 3SCLE 4I6AA 3WC2A 4I6YA 4QYRA 1HD0A 4IH5A 5LJ5Y 3OR1A 1URRA 2IM1A 2DH7A 3QAUA 4OLPA 1YP2A 3DJ4A 3POTB 2DISA 3HT3A 5F8JA 1X4DA 2UP1A 1R8BA 3BO3A 4ZPAA 3H5XA 1IKVB 1RTIA 2R7OA 4MKBA 2KVIA 4GC6A 3AQPA 1X5SA 5E3PA 2IVYA 1U1OA 2R8GA 2EKYA 2DPIA 2HVHA 4PG5A 3TA1A 6FDRA 3ICLA 1S1WA 3T1HF 3V4IB 1FVSA 1HWIA 3D8VA 4C97A 1EP4A 2J7WA 1W25A 4IDKB 1XBWA 1H7WA 1X4AA 1KTVA 2DD8S 1HQUA 3SFUA 2UZAA 4FS1A 2MZ1A 3HHLC 4ITSA 3FFIA 1TV6A 1RK8A 1BY9A 1RTDA 2R7SA 1B0TA