3FSYA

Structure of tetrahydrodipicolinate n-succinyltransferase (rv1201c;dapd) in complex with succinyl-coa from mycobacterium tuberculosis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
307
structure length
304
Chain Sequence
VTGAAGIGLATLAADGSVLDTWFPAPELTESGTSATSRLAVSDVPVELAALIGRDDDRRTETIAVRTVIGSLDDVAADPYDAYLRLHLLSHRLVAPHGLNAGGLFGVLTNVVWTNHGPCAIDGFEAVRARLRRRGPVTVYGVDKFPRMVDYVVPTGVRIADADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEGRISAGVVVGDGSDVGGGASIMGTLSTHVISIGKRCLLGANSGLGISLGDDCVVEAGLYVTAGTRVTMPDSNSVKARELSGSSNLLFRRNSVSGAVEVLARDGQGIAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional Structure of a mycobacterial DapD provides insights into DapD diversity and reveals unexpected particulars about the enzymatic mechanism.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Tetrahydrodipicolinate N-succinyltransferase
total genus 93
structure length 304
sequence length 307
chains with identical sequence B, C, D, E
ec nomenclature ec 2.3.1.117: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase.
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
A PF14789 THDPS_M Tetrahydrodipicolinate N-succinyltransferase middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3fsyA03
3.30.60.70 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Trimeric LpxA-like enzymes 3fsyA02
3.30.70.2010 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3fsyA01
3OUPA 3P1BA 1QREA 2W0WA 4KPZA 4G87A 4R7PA 3VBIA 1HM0A 1MR9A 4AAWA 2QKXA 4IHFA 2WLGA 3GUEA 4E6UA 4G3SA 3VBNA 3FTTA 2V0HA 3T57A 2OI7A 3BSSA 2OEGA 2V0IA 1KRRA 2JF3A 3VBPA 4K6RA 1SSQA 2WLCA 3FSCA 1KRVA 3R5AA 5DEMA 4E79A 5E3QA 4ISXA 4AC3A 1MRLA 3OU9A 1KQAA 1V3WA 2V0JA 4G3QA 4R36A 4E1KA 3SPTA 3R5DA 3GVDA 3MC4A 4M2BA 4MFGA 1KK4A 4EA8A 1YP2A 3R5BA 3TDTA 3R3RA 3EH0A 2AQ9A 3HJJA 2W0VA 2VHEA 2ICXA 3MQHA 5ADXV 3FWWA 3FSYA 1TDTA 4HCQA 3VBKA 4E6TA 1QRMA 2Q4JA 3I3AA 5DEPA 3SRTA 1YP3A 4HZDA 1QRLA 2VD4A 3VBLA 3NZ2A 2FKOA 2IUAA 3IGJA 3KWEA 3FOQA 4KNRA 5DG3A 1HM8A 2V0LA 5F42A 2I5KA 2OEFA 2WLDA 3R0SA 3ECTA 2RIJA 3R2WA 5ADXU 3EEVA 2QIAA 1MR7A 1LXAA 4J18A 5AFUV 3TIOA 3P47A 1KK5A 4KPXA 4M99A 3PMOA 4G3PA 4E75A 4HURA 4HUSA 3D8VA 1KGQA 4EA9A 5AFUU 4EGGA 1G97A 5L6VA 3D98A 3I3XA 3OTZA 2IC7A 1YP4A 2IU9A 3BFPA 3KWDA 4FCEA 3FSBA 2WLFA 3EG4A 3BXYA 3V4EA 1Z90A 1T3DA 3DHOA 5L6SA 1KGTA 3ST8A 1KRUA 1FWYA 3CJ8A 4N27A 1SSMA 3GOSA 5U2KA 2OI6A 1KK6A 1OCXA 3R5CA 2V0KA 3BRKX 3TWDA 2WLEA 4R37A 1XHDA 2XATA 3VBMA 1V67A 3MQGA 2ICYA 1HV9A 4EABA 2P2OA 4H7OA 3HSQA 3KWCA 2JF2A 3VBJA 5E3PA 4EQYA 3R1WA 1S80A 3VNPA 2TDTA 4MZUA 3TK8A 4EAAA 4KQLA 3JQYA 4M9CA 1KHRA 4MYOA 4N69A 3BSYA 1QRGA 3DJ4A 2QIVX 1FXJA 2NPOA 3R3IA 4AA7A 4IHHA 1QRFA 3OTMA 1THJA 4HZCA 4IHGA 2OI5A 3FS8A 4N6BA 4N6AA 3TISA 3F1XA 3FSXA 3TV0A 1XATA 4KNXA 2GGQA 2IU8A 3IXCA 3OW5A 4M98A 4M2AA 1SSTA 3R8YA 3Q1XA 3DK5A 1G95A 1HM9A 4J09A 2GGOA 4M28A 4EA7A 1J2ZA 3C8VA 4DCLA 3BSWA 5E3RA 1QQ0A
chains in the Genus database with same CATH superfamily
1R3NA 4G87A 4PWUA 2DGTA 5BR8J 3AB4B 2PC6A 3MMCA 5IQQA 2G4BA 4LMZA 3A8EA 5IT9U 4LFAF 2YNFA 4M5IA 3MAQA 1X4DA 5HAOA 1HQUA 1OPZA 3JSMA 5J2MA 3VBNA 3FRZA 2R9LA 4P52A 5B0DA 5DM7Q 5E3CA 5K8MA 2F8HA 1TL4A 3JAMU 1U0HA 3DGPA 3OQ2A 4G1QB 3SCJE 4TQSA 3G71S 2GV1A 4KTQA 4DR6F 2RQ4A 2JF3A 3O2IA 1XBTA 1SGPI 1LK5A 3FSCA 3R5AA 4JB8B 4KH0B 1B3TA 4B3OA 5E3QA 1C0TB 2XHWA 2OU2A 1CJVB 3IM9A 1XJWB 1F5AA 2M4MA 3F44A 5T41A 3RZAA 5HJYA 3DLEB 3UDVA 4X4TA 1TGSI 1N36J 2VODA 1M5PC 1NPKA 2V0JA 4G3QA 2DKOB 3D9BA 4OV6A 5AXMA 3MTJA 3J7ZT 4NZ6A 3VAHA 1WKXA 1CBKA 1JLCB 3IFEA 4IO9Q 2CZ9A 4DV7J 3QJPA 4LQ9A 3M7VA 3QSIA 2CKWA 5LOQA 4K7QA 4Q44A 3M8QB 3GQCA 3UQSA 4RLEA 1NJIT 4LSZB 5B08A 1DQAA 1NLKL 1Q8LA 1VHIA 1GX5A 2RILA 2GX8A 4DDFA 2CWXA 2MKKA 3OXFA 1URRA 4PEOA 3DRSB 3I5BA 4RO0A 4U7UD 3HJJA 1JNRB 2RS8A 1EP4A 5ADXV 3L09A 2YUUA 1EB0A 3CCTA 1HMVB 3UW1A 5JMNA 1N5VA 1HW8A 2HW3A 2IVMA 4C3LA 1FJCA 2R7XA 1DARA 3OTOJ 2LQ5A 1IKYA 3TR5A 3KDNA 2XYPB 3EGVA 3I0RB 5E2QA 1QRLA 2NS1B 3WX4A 1WOSA 3TUIC 4EFAC 1YKWA 2ZH5A 1RABB 1NK4A 2FVSA 3VDUA 1IW4A 1YWXA 1XMQF 2HGNA 3EVMA 2N71A 1NH8A 3HDSA 5HMYA 3MPVA 2RKIA 1H72C 5DG3A 4FYYB 1Z2FA 3BPSP 3DYAB 2KMPA 4F3QA 2E9TA 1Y00A 1ZA1B 2GAHC 4QIFA 1UPMB 2AZ1A 3C15A 4UOFA 3VHQA 2DCUB 4A47A 1JLBA 1TKTA 4F0KA 3WC2A 1XNQF 1WC6A 5HATA 3LGNA 1V6HA 3C2PA 4G3PA 3WC0A 4V19J 4H4OA 5H9FK 4P9SA 2W2QP 5L6VA 1VRTA 2XYGB 5A6WA 2UVOA 4UXJA 1RTHA 3CTRA 3SZ2A 2IU9A 1YSJA 3A4TA 5K14B 3KHGA 2MPUA 1XN9A 1S6OA 2KZMA 3F56A 3IS9A 4QYZJ 2RDIA 4FYWB 4LF1A 1MJAA 4RUCA 3CEDA 2R7WA 2FDNA 4J9OA 1FD2A 1T9YA 2IM2A 4UXHA 4NYZA 1KDNA 4ZJOA 2MQNA 3B4DA 2LB7A 5IC4B 3US5A 4DV3J 2WVJA 2ZOGA 1GH8A 2V0KA 1X5PA 4MK7A 5A2QY 2R7TA 1H0HB 2DRDA 2DRAA 2ZZMA 3LP0A 4YS2A 1VFJA 1BQMB 4RBVA 3ZTOA 4I1TA 6FD1A 1FT8A 5KFAA 5B0BA 4EQYA 3PW5A 1FCAA 4NZ7A 2Y1IA 3ADAC 4BS2A 2KT2A 3OXGA 3GFHA 3LWLA 4C8ZA 1F2HA 1YITS 2G0JA 2G0CA 2N3LA 2M5YA 3GJRB 4FDFA 4L75A 4MK8A 4O44A 1PGZA 4PUOA 1X5SA 3TA2A 5CYMB 4UUXA 4HZCA 2GHVC 4UOHA 2HK3A 3CC2S 1N32F 2G13A 4WP4A 3R27A 1PC5A 2P5VA 1S9FA 2YTCA 2VUGA 2YWEA 4LF5F 5M2RA 3R8YA 1KTVA 1VCTA 3AAWB 4JOUA 1EETA 2MSTA 3I4PA 4ZPDA 2D9PA 3VF0B 3GFXA 2JX2A 1MROB 4RKUC 2D41A 3M9OB 4M28A 4EBCA 3PM9A 1SQGA 1NDPA 2DGXA 5KG6A 5GAGI 1KRPA 2P9CA 1CGII 3C46A 5CA5A 3IA0A 4KPZA 4KE5A 4O4GB 4AXIA 4IOCQ 4PR6A 1HMVA 2SGPI 1RAOA 3KDOA 5J1EA 1IBCB 3NP5A 2OPQA 1DTTB 1J5OA 1N52B 3CMQA 3OFHA 3PV8A 3EZOA 3FTTA 5B7WA 1N8RT 4WFYA 2KN4A 3NCPA 2KU7A 3D28A 1XMOJ 4ED1A 2GNKA 3SDEB 2OEGA 2CJQA 3KK1A 1OMUA 1UVFA 5LMUF 3THVA 3VBPA 3GSDA 3B8HA 3T41A 2RDDA 2GIRA 3OT9A 1S0VA 4J9VA 4I6WA 4J9NA 3CDBA 2BA9A 3PX6A 5AXLA 3BGRB 4P6QA 4N41A 2C3PA 3M8ZA 2XSFA 3UN5A 1PYSB 2X1BA 3KMSA 4H4OB 3QGGA 4GO7X 2JEFA 1NPPA 2B51A 3ILIA 2HFZA 3W7BA 4YR0A 4ICLB 1XBWA 4RW8B 3IGVA 4JI8F 2J7WA 3PY8A 3AXMA 3NEKA 1RTHB 2CZVC 4ECSA 4JI0J 3KUEA 2LUYA 1YLXA 5DGBA 2F4VF 3NY0A 1S99A 1NHKL 3ZO7A 3AD9C 2GW8A 1DBDA 2JLEA 5K8PA 2MKIA 2E73A 2ICXA 3GIMA 4JV5F 4C11B 1IR2A 2HSEB 2XG8A 1Q4RA 2G2OA 2FHMA 1K73T 3NGDA 3QRRA 1QE1A 4JI3J 5C24A 4F4ZA 3M8SA 1VS3A 2AYMA 1HI8A 3KJFB 1NJWA 2E5GA 4OYOA 4USWA 1O6XA 5KFRA 4RW4B 2AF6A 1RHQB 3SV4A 1O51A 2I5JB 4ZCKA 3U1LA 5H9EK 2ASLA 4IO1A 1YBUA 2ZH6A 2RVJA 3QLHA 4Y00A 4NLUA 3QZ7A 1VBZA 4B9LA 2HWTA 4TU7A 1RTIB 2ZITA 1TL7B 1S0OA 2LVWA 1ITPA 4K4YA 2B6AA 3EEVA 1J2VA 2CADA 3CD7A 4IG3A 1XK8A 2QMUB 1ZAVA 4X66F 4C8OA 3P49B 2P9GA 4C8MA 2CQ4A 2UVVA 4KHPF 4TXSA 2C2DA 5AFUU 2XMMA 3I6PA 2AEJA 5CXTA 2DYAA 1KOOA 1WACA 4J9LA 3LO3A 1K47A 3FSBA 2MQ8A 3MEEB 2WLFA 3R2CJ 4QR1A 3FNNA 4HHHA 2KFYA 2R7OA 1BY9A 3CIMA 3GCXP 1I5OB 1H7XA 3BF4A 1B0PA 3M2VB 4CLKA 2CNKB 4G3IA 3GOSA 5U2KA 5EWGA 4TU9A 2W9BA 1S1UA 2UU9J 2C2NA 5IWAF 2Z0GA 2DNMA 3IMQJ 1QSYA 2BQ3A 2GC8A 2MY8A 3BREA 1V67A 2OSQA 3M1VA 4A46A 1QTMA 1T03B 2HVHA 1YGYA 1HV9A 3DMJA 4KGXB 3T3FA 1WHXA 2KJVA 4IH6A 4DR2J 2Y8WA 2D74B 2IDLA 3M30B 3AQPA 5T7LA 4DN0A 2ADBA 3PYGA 2CZ4A 1S80A 2CXEA 2MLXA 1VDDA 3PYEA 3JQYA 4BBYA 2GGPA 2I8EA 1KHRA 4HT5A 4MYOA 3HHNB 1HQUB 1H6KX 4JYAF 2DKVA 3CJSA 4RBUA 1X31C 3HHLD 5DG8A 3NAIA 2NSCA 1HHTP 3VE5A 2F63A 3DGPB 4G1QA 4Y3CA 4CM2A 3BQ2A 1VQ9S 4PAAA 2B4UA 2GIQA 3MPUB 4WP9A 3AH6A 4KIAA 3WHIA 1HPZB 2QEXS 2HHTA 5HANA 4DPWA 3G6ES 5I4MA 4DQPA 1G3OA 3OW5A 5ETLA 2VIHA 1SSTA 2I0XA 2D1CA 4ILRA 2J0SD 3D1QA 3BSOA 1FFWB 3C14B 1UPPA 4F3OA 3IAM9 2Q1LA 1TQLA 2HBYB 2K1RB 2YVSA 4N5SA 1HWUA 1N0UA 3H0PA 1X4FA 4FXDA 2W25A 4LF4F 2HHWA 4X4SA 3P1BA 2M8DB 4DR6J 1CJTA 5DLGA 4Y2IA 1JB0C 2HKEA 3TO9A 1MMDA 1UL3A 1FNXH 1SH2A 2CFXA 3T5LA 5BXIA 4ZVFA 3DRSA 1RBAA 3D6FB 4WKYA 2DNKA 3BJYA 2QLWA 1N6QB 2XLKA 4PQUA 2B8QA 1FESA 2L9WA 3I0SB 4USVA 1S49A 4CLZA 1CQNA 3PRDA 2OPPA 4ATNA 2N4DA 4HEA9 2IFXA 1GXLA 1MMLA 2J76E 2MSSA 4CNZA 3C6UA 1U02A 4ZITA 4LQ3A 1F6TA 2UP1A 2C2KB 1R6YA 3WIUA 4ED2A 2V9KA 1R7IA 2CPIA 3U1NA 2X3DA 4JI7J 4F4XA 2MZ1A 2JFDA 2K2PA 3DYAA 4NXNJ 2KO1A 2YKQA 3CCZA 3O1LA 3R5DA 2KYZA 1IXKA 3RRKA 3TUJC 3C15B 4YUDA 4Q8FA 3EMTA 3LALA 1WKLA 1C1CA 5CYQB 1M5KC 2G1HA 3KK2B 1U24A 4LRFA 1CT2I 1WSVA 1W3SA 4ZVRB 3G8QA 2VG6A 3MEEA 4K5SA 1E6VA 4NYPA 5KOXA 4NLDA 3CJ3A 1XMOF 4NLYA 4ZPAA 1TIHA 1WF0A 3GYNA 4OJ3A 1GMWA 1RWKB 4E6TA 1Y9OA 3CJ2A 3VBKA 3VAKA 2CJBA 4ANEA 4B3SF 3K8VA 4DS5A 3KNAA 2BMBA 2CQDA 3FKBA 2DBBA 4FPRA 2V0NA 1RT3A 1U09A 4JBCA 2FHJA 1RWOB 5HQMA 3CF5Q 3MTKA 3OPKA 3NZ2A 1JLFA 3M4XA 4M5HA 1R0AA 2RC4A 1OSCA 3NRBA 2NCKL 4KBIA 1WI8A 2JZ5A 4LF2A 4LRCA 2VC1A 2XEXA 1YJUA 1JLAB 4FVCA 3N5FA 1DTQB 2Y1RI 2AWZA 3LP0B 1U45A 1FY7A 2PSZA 4NXNF 2OTJS 2QIAA 2SGEI 5FUWA 1KFDA 1NKCA 2N1AB 2ZWPA 2O01C 5GADU 2ASJA 2M7SA 1SKSA 1N5SA 3AB2B 4B9TA 4KHRA 4NOHA 5L9NA 2QFIA 2ZHOA 1S72S 3KWDA 3SXLA 1TBRR 5E33A 4ALZA 1LFPA 3RYLA 5A8WB 4ECVA 1YTYA 4MTPA 2Y0MA 4IYQA 4MKYA 4DFJA 2AJ1A 2IBOA 2FGCA 1KP6A 2FUG9 2GVDA 4LIRA 4PXDA 3W60A 3FMWA 2VJUA 2GJ2A 4A8MP 2BBEA 2F65A 2GKRI 2ZNYA 2ZH2A 2QTWA 2CQ2A 1EETB 4B3TJ 4I2QA 1AUSL 5D8HB 4GVLA 1K0VA 4P73A 2RB7A 4R0EA 3GV8B 2BR0A 4CLPA 2XMKA 1OSDA 2M52A 5KFWA 2CJKA 3HVAA 1BMOA 2QRRA 5AJ3J 2JF2A 2DIUA 2WW4A 1U0SA 4X4UA 4UQGA 1TL3A 2LFVA 3H20A 1N6QA 4PQUB 3RW6A 2E5HA 2EBEA 4XPEA 1S4FA 1FERA 1KQKA 3MAAA 4A8YA 2LA6A 5A8RA 2J9RA 3C6TB 1HNIB 1U1LA 4IRDA 3OLAA 4JI5F 2KMQA 3SGBI 4A24A 1WD6A 1TR0A 1ZM9A 3DLGA 4RNOA 1N36F 2OEKA 1TP7A 4NI2B 4ECTA 5J2NA 1MSWD 2XM3A 2W2PP 4U8VA 4DV1F 4M94A 2FHKA 1S6QB 3QO9B 2IMOA 3KHRA 4QU6A 1DQ8A 3FZBA 4KGZB 3DK5A 5IV4A 5G0RA 1G95A 1FE0A 3CD5A 5EUHA 4C98A 5KFNA 4EA7A 3JSRA 2DNZA 1QSLA 1SJ1A 2VG6B 3TYTA 4K0KJ 5JVGQ 1NXUA 1QREA 4CH7A 4EWTA 3VBIA 5CABA 4ZVGA 2OVOA 3HT0A 3UCZP 4F4AA 2YNGA 1FJGF 1VYAA 5KFEA 2HNYB 3G6VA 4BC9A 1V3SA 5HBMA 1OYDA 1QE1B 5C24B 3GIKA 7AT1B 2FLLA 2PO4A 2OPRA 2YNHA 4FYVB 2V1CC 2AJ4A 2CDQA 1ULMA 4Y2CA 1X9WA 4RL1A 1UETA 3QMQA 5D4PA 3RBEA 2QYGA 4KHPJ 1DTQA 1KOHA 1QSSA 3H2LA 2FVCA 4ZVUB 3OR2B 5DZ7A 5L9XA 4F7VA 4NYOA 8ATCB 1V3WA 1MJBA 4E1KA 1Q8BA 5KTQA 1HLWA 3PO5A 4DX6A 2RS2A 3OJUA 4QJVA 4O0IA 2KG1A 2E9ZA 3M8YA 3T6JA 4Y28C 1DLOA 2DGUA 1SQEA 2MMYA 4IG3B 4IQMA 4E8UA 5IS2A 3V81B 1FK9A 4KGMA 1NPRA 2IM0A 3U02A 2AQ9A 5KFPA 3AA8A 3MR5A 4DX7A 1BWVA 4CO1A 1NHVA 3ENWA 4TY9A 2F3JA 4F04B 5AE3A 1Q79A 1YG0A 1CS4A 1HNVB 5KFCA 2ATLA 1HNXJ 2HQ3A 3NBPB 4DR7F 5A0YB 2MLZA 5GADI 2R3VA 3JTNA 5EWEA 3PRBA 4BWJA 2J0XA 2KFNA 1M5HA 4ZN3A 2ZBIA 1TFWA 2X3TA 2VZ9A 4RW6A 2D3OR 5J1PA 2R7QA 3FJ2A 1X4HA 2BANB 5F42A 1FE4A 1RU1A 3DM2A 3FOQA 4KNRA 3KNGA 1HM8A 3MCNA 4NLVA 3ZZZA 4YOEA 1YHQS 3G87A 4Z7CA 2Q79A 4ELVA 2Z56B 4TQRA 2LLZA 4YB7A 1T7PA 1PSDA 1AW0A 4ZPVR 1NSKL 1W7WA 2HS0A 2PIIA 2APOA 1S9EB 2QL5B 1T95A 3ETOA 4USHA 4YY3F 2AZ3A 3BV8A 3G8SA 4ECXA 2VG7A 2FB0A 5DGAA 1V5VA 2CG8A 2MY7A 4WJBA 3RB4A 2CWHA 1HNIA 1ZM4A 2HHXA 4HURA 1FDBA 3KLIA 3NG8A 4K5RA 3T9NA 3D8VA 1KTQA 4MYTA 4CO2A 1KBEA 4QWEA 1WG5A 1UWAA 2UUBF 3KOAA 4WZMA 3DOKB 2MDAA 4CLYA 4RBTA 3QFHA 5L1JA 1J5EJ 1FEHA 3H5SA 1SGEI 3MM8B 3DI6A 4Y0FA 1RZMA 1Z90A 1WTFA 4RNFA 5A76A 5K20B 5L38A 1RT6A 3PXGa 1KGTA 2D9OA 2G9OA 7FD1A 1U1PA 1XTZA 1TK5A 1UFLA 2HK2A 1WGCA 3S1TA 2FHJD 1Y4ZB 3V6HA 2W9CB 2QL9B 2DT9A 5A2QU 2LEOA 4OJGA 4UUWA 1TURA 4DG1B 1NJYA 2UUCF 3TWDA 4QWCA 1KHVA 2CQ0A 3TO6A 4KR0B 1WG4A 1XR6A 1R8CA 3DRXA 2ICYA 2WOMB 2KXHA 1CULA 5DRKA 2P2OA 3KUHA 1FRMA 3PKMA 1FTRA 2LKZA 3EUNA 2VFSA 4FPIA 3MFIA 2AX0A 2HNYA 4HL9A 3GOXA 5J2PA 1SJ4P 2FJXA 3TAMA 3DDKA 2Y0BB 3ET6A 3N79A 1FXLA 4M9CA 5EDWA 1CHOI 2WB1D 3B82A 2YKAA 4F25A 2YNHB 3BSYA 3IBWA 2FYXA 1X60A 2RHQB 1Y8FA 2V69A 2WONB 2XZTB 3RBZA 3RR7A 2R2TA 3JQMA 3O3LA 1GNKA 4N6AA 4OYAA 3OR1A 4Y34A 2XY6A 1HNXF 2JVOA 2YY3A 3OVSA 1X8DA 4H4MA 4NLWA 4QQBA 4C8LA 2PE8A 2LXIA 3M32A 3OXLA 3KMQA 1RHRB 4CH1A 1MT1A 1VLOA 2E29A 5I3PA 5IZHA 3KG1A 5KG2A 4U95A 3CDAA 4IDKA 3NNAA 2XNQA 5AXNA 1EHWA 4OJHA 2YNIA 3J7Z5 1NDLA 1REGX 5L1KA 2AHOB 2H1YA 1IWGA 3N6NA 3KK2A 2GJFA 2PEBA 4I64A 4NCAA 2RMLA 3ISND 3NBPA 5F8IA 4ZS6A 5JVHQ 2BKOA 1NK7A 2N17A 1F5BA 2R8KA 3I5AA 2MTLA 2RE1A 3MEGB 5CZVA 2RSQA 1FXDA 1E6YB 3B6BA 3JXOA 1T9TA 4KFBA 4O3NA 3FEXB 1FDAA 4KQZA 4Y2MA 1WEYA 2E1PA 3M8WA 3TZXA 4NMXA 2Q43A 1KVIA 4B3MJ 1F9EB 2VFUA 2ZOMA 3IR5B 2PFFB 5DLFA 1MLAA 4O0NA 4W90B 4XTTA 4Q2LA 2A2CA 4X62J 1N5TA 1SKUB 1QAYA 2C22A 1XNQJ 3QJLA 2HG4A 3T9ZA 2Z2MA 4IUFA 4OZ3A 2CJ9A 4DJBA 3AT1B 1LWXA 2C42A 1KFSA 2EG2A 1QM9A 1GMUA 2K3KA 3ITHA 3TANA 1AUDA 1GXUA 1HI1A 2QQEA 2NZCA 2V2KA 4NMLA 4UY8T 3NMRA 3HO1A 3LPYA 1OIAA 1MU2A 3P6YC 3OSPA 1FWLA 3TVZA 1FEEA 3HX9A 3H7HB 1Q8KA 1N48A 2PI5A 1GTEA 3R3RA 2Z2ZA 3CWJA 3JYTB 3MM8A 3ILJA 3MPYA 4X64J 2MJNA 1HBUA 3OTDA 1B0TA 2AEMA 3OTOF 1X9MA 4ZLNA 2QFJA 1QLNA 3WIVA 4DR4F 3UGDA 2BE9B 2FD2A 4MIWA 3FSYA 1JQGA 2VHGA 4JI8J 1KNZA 2YKMB 2ASDA 5A8WA 2M70A 4JCVE 3KLHB 2VPXB 3W64A 3B78A 2MZSA 1T05B 2EC2A 1XERA 4LVNP 3VZIA 1WKJA 1CJUA 2DGOA 2OKQA 2VDIA 4A8KA 4I69A 4D3HA 5IT0A 3H5YA 3EYZA 3GB0A 3ENQA 5E5NA 5E0OA 5AFUV 2QLJB 1U25A 2VG5B 5C25A 1VC5A 3IC1A 1IQZA 1C0UA 4I68A 4LR7A 2G2YA 3KKFA 2QA2A 2F5GA 2FQQB 2OPSA 2Y3YA 1XR7A 2ZE2A 3FCWA 3Q8PB 4OI0A 1CLFA 3HF5A 1U2CA 2BJ8A 4K4VA 1F9HA 1WC3A 2DB1A 3LP2A 3ZNJ1 4CI0B 2QA4S 3T1YJ 3QRPA 2KTQA 1LWEA 3LANA 3BXYA 1RHUB 3VCDA 5AE1A 4ZDNA 1F0XA 3HD2A 1R27B 2CPFA 2W8LA 4CO0A 3DU6A 1NJXA 1HBNA 3CJ8A 1NBEB 3B54A 2ZBQA 4M5DA 2HFUA 3DHWC 4DPUA 3BR8A 3EICA 4ZLPA 2JLGA 1RWXB 4ZP6A 4DPXA 2ZBCA 1I3OB 2OLWA 2RQCA 2OJ3A 1BUXA 1LW2A 2NU4I 2XLIA 1MNEA 3MEKA 3NGTA 3SI8A 5EWFA 3CJQA 3CD0A 1B70B 4EMDA 1SJQA 3DLBA 4K4UA 2XSJB 2UUWA 1H3DA 2YPYA 3HSQA 1SC3B 4FXWA 1FRXA 3RBDA 2AMCB 2UUBJ 4OHWA 1RTDB 2NR0A 1WTBA 5HI7A 4KFBB 2HQIA 2UVUA 4C8KA 2TDTA 1S1TB 3EE3A 2W1BA 1RKIA 2DGQA 2WBRA 4WK3A 1RBLA 1S0NA 2YNGB 2HHHJ 4I0WA 2L41A 3OSNA 4WU3A 5DETA 1UMJA 3SBMA 3MECB 3PCOB 2K7JA 4CLLA 1L3TA 1DFDA 1GX6A 2HNZA 2IC3A 5IC6B 3ZZYA 4K8RA 5HBMB 5LXRA 4WFBQ 2V4QA 1WC1A 1U5KA 2W01A 4FP9A 4V1Ak 2XI3A 3OH3A 2WBMA 4DV3F 4XO0A 2GVZB 2E1RA 5KT5A 2IRUA 1V1HA 2A6OA 2J8AA 2NXEA 1RHMB 2HRYA 4DL5A 1EZZB 3A12A 4M5GA 1HM9A 1KLMA 4J09A 2GGOA 2FPHX 4KH1B 1Q0NA 4ECYA 1JX4A 3H2UB 3G2XA 4TLQA 3TA0A 2B7BB 1UUCA 5KFQA 2W0WA 1N4IA 1TOTA 4E1RA 4SGBI 1RBOB 3FQKA 4NZ0A 2CQBA 5H9FJ 3GYXB 2DNNA 3L7OA 3VGTA 1F3FA 1JXVA 4W92B 4R8UA 2AV5A 4A8WA 1IVZA 1R0BG 3M8RA 4OYZA 3OLBA 2DVIA 3TX0A 1S6PB 3MM7B 4IG0B 2HFOA 4OYMA 1YJTA 4GVBB 3GQ8A 3FBBA 2CQHA 3UVJB 5I42B 3OV7A 2UXCJ 1RT4A 4K4ZA 5KFJA 1SBRA 1SH3A 3RJMB 1G4CA 4PXBA 1EX8A 1Q53A 3BGLA 4ANCA 5ITHA 4MK9A 4L73A 1LKZA 1HJAI 3IG1A 3J80Y 3DXBA 1CSOI 5DAEA 5KFKA 3OUYA 3QQCD 4O3RA 3GVDA 2DHAA 3IAS9 1U8WA 4NA1A 2DNHA 2DGVA 2ROPA 3K2YA 3TVKA 4F2SA 2VG7B 4QIVA 5KFOA 3H4BA 3H8YA 3T5JA 3UR0A 4LFBJ 2E7VA 2ZNZA 3BN7A 1IY5A 3OH0A 2GO9A 5F8GA 2R7RA 4WFNQ 4JI3F 2MYFA 3PFOA 3CDUA 1UVNA 3V5RA 2ROWA 4WIIA 1RYRA 2GO8A 1M8BA 1Q95G 4PCQA 1TKZB 3JQJA 1WOPA 1FRLA 2VD4A 1KQGB 3HHLB 4G6VB 3H5XA 2IAJA 5KFHA 2I38A 1SGDI 1LOUA 1Q5VA 1X5OA 2W9CA 3T1HF 2ZZNA 4EYHB 2PQ8A 2LYVA 1XMBA 2J9DE 2SGFI 2DHHA 3R0SA 3M6UA 2HNDA 3RB0A 3R2WA 3U1MA 2KJWA 4P7TA 3IN5A 1IBLJ 3Q89A 3K5MA 4B02A 2DR5A 4HI2A 4ZVSB 3GYGA 5IV3A 4HKQA 3PMOA 4PWDB 3R3TA 1Q16B 1S1VB 3MECA 1HD0A 1VMBA 2DO0A 4J91A 3CB4A 3CJKA 4G1PA 2HHUA 4I2PA 5JJBA 1W4RA 4A4JA 2HWHA 4AUKA 1P9ZA 3ZZTA 3D98A 4NEYA 4NCGB 3ZZUA 4WZQA 2B0UC 3TUZC 1FKOA 1FWPA 2GVZA 2X1GA 2VQEJ 3EG4A 1SJFA 1HNWF 4ELUA 5L6SA 1T3DA 3DHOA 1ZYQA 1UW4A 2KG0A 4YN3B 3D6TB 1T9WA 2DXDA 2YX7A 3OD2A 2CJSC 3DLEA 1NK0A 1RA7A 1I6JA 3DXSX 2A0FB 1ZAWA 3Q8YA 3GJSB 2YWKA 1GMWD 3SIPB 1NK9A 2FJWA 2KM8B 1JLCA 2E5JA 2KT5A 2MHEA 4FVMA 1MN7A 1N54B 1ZS6A 2CQCA 2CQPA 3FCHA 4OIXA 3BBCA 3VQTA 4Z37A 1HDLA 1LR7A 2Y9HA 5LSOA 1NZAA 1D0EA 1S6PA 3MPDA 3MM7A 4EAAA 3VVTA 3HMJG 3CCUS 4MIAA 3TEGA 5L1IA 4YHHF 2VL1A 3MEDB 3P96A 4N69A 3MEGA 1TL1A 5C2GA 1TKXA 6AT1B 1RT4B 3IBFB 3TWZA 3AOBA 1VIXA 1NSQA 2V8GA 2H9ZA 4O3QA 2IMWP 4B9VA 4CCHA 4I6AA 2ERWA 2OI5A 3FS8A 2Z8QA 1RWMB 1RAFB 4LF8J 3PRVA 4Q43A 1FJEB 4B9MA 1PAEX 3HVTA 5DS7A 1X4GA 2GGQA 2HIYA 2EFVA 5CD4H 4M8LA 2PDAA 2JFKA 4X66J 3IP0A 4UZBA 4QWAA 3Q1XA 2VPZB 4KV8A 3PX4A 3ITHB 2M8HA 3C16B 1N34J 1SKWA 2FJEB 1HA1A 3WQPA 3NMAA 1NSPA 1QQ0A 5F9NA 5E41A 3OUPA 2BJ1A 2KMOA 5ETTA 5HN0A 1QD1A 1O5JA 4AMLA 4ZCIA 1HM0A 2B43A 4URQU 2HHHF 1I51B 2L9DA 2LQ8A 3VGVA 5HVGA 4IHFA 4M5LA 2WLGA 4RW9B 1YRTA 4RUHA 1P8GA 4FS2A 5LSRA 4QIGA 4CLTA 1S1WB 3IR6B 4OZ5A 2V0IA 3I56S 1DAXA 2O5DA 3W2WA 4JI7F 5LT5A 1LQ9A 2UV8A 4KGKA 4B17A 2EK6A 4JV1A 1IKWB 4E79A 2KDOA 2V2ZA 5KG7A 2ZDOA 4HHUA 4ISXA 2J0QD 1EKRA 2F1FA 1HARA 4NLXA 2DITA 5LM7E 1NCLA 4RWWA 1WHYA 4DU8A 4XPCA 1T05A 4OLPA 2J7KA 1BGXT 2X1FA 4ES1A 2QZ8A 3OFGA 1S57A 3PJXA 3J81U 4ILLA 2RJZA 3QJJA 4PWDA 1WSRA 2FC8A 3O5TB 4I7FA 4TLRA 5I3UB 2BOPA 2R8JA 1K9MT 5FUVA 2J0WA 2DNGA 3R5BA 3CGIA 2ZUGA 1UVLA 4NCGA 3FDSA 4I67A 4GKKF 3HHLC 5GAHI 3TNVA 2KCXA 4WP3A 2P6AC 1DJ0A 1LWCB 2GS8A 2PA3A 1NH7A 3KG0A 5DZ6A 5RUBA 3BQ0A 4ED8A 2I9SA 2XS5A 2V67A 4NWBA 3MM5B 4DX8H 2OI2A 3TOAA 3ZTSA 5FJ4A 1UZHA 2CJXB 4A8FA 3B4VC 1LWEB 2XQCA 3BDEA 4UT4A 2H48B 3K7RA 4UW2A 2IBKA 4OV1A 3VBLA 1F1BB 4F0MA 1JKHB 4DXLA 4F8RA 4LF5J 4L3NA 4HR2A 2BOAA 3EDQB 4Z7YA 4M63A 1PTRA 2J8SA 1FD8A 4R0JA 4DV0J 3BB5A 4ZCLA 3TAPA 2RHSB 2OD4A 3PVXA 1R31A 2EVZA 2WVCA 2YX4A 2R7SA 2RUSA 4LFBF 1HBMB 2C2ZB 1XNRJ 3GTYX 4GKJF 4ZOSA 1V5IB 3CC4S 4X2BA 1TL1B 4P71A 4ZPCA 2GMJA 4BHQA 3UI3A 3VQSA 2WSEC 2DRBA 1MMNA 4CLUA 3KY9A 4UQTA 3LPEA 2OPQB 5J1EB 2W7PA 2V8VA 3FFIA 2WTFA 1HYSB 1F5CA 4GKKJ 9RUBA 1VRQC 2Y1JA 1L5UA 1JNZB 5FUYA 1S79A 1A7GE 4K2XA 1RB0A 3SDEA 2E5LJ 1S9GB 1VRUB 3WDOA 1LEOA 4OYXA 1ELOA 4ZVHA 4DQIA 5BJRA 2MXYA 3NCRA 4CRJA 1Z2IA 3V6JA 1GTHA 1SCJB 2PGCA 3L95X 4EUVA 3J7YI 1U1RA 8RUCA 2BABA 3K5NA 3GFYA 4LF9F 3AXKA 2OI6A 2LQBA 1PO6A 3BH6B 5JUMA 3W9HA 2VQFF 3VDPA 2XATA 1VQ4S 1XQIA 3F0NA 2VKZG 3HKZD 2A20A 4ICLA 2BDPA 5AXKA 3FRYA 5F8MA 2OO4A 1W25A 1TBOA 1ICEB 2DISA 4IR1A 4FF1A 3S7RA 3ZXWA 2GMLA 2BKNA 3OBIA 5GMDA 3OW2R 4PABA 1MWZA 4EK2A 4R5PA 2VRWB 4USJC 5D4OA 3TOQA 4RU2A 2W7OA 3V6KA 4C11A 2O1PA 1VHFA 4JI0F 2MGZA 2ZM6F 1LV5A 3NKYA 1YZ6A 4IG0A 2VB6A 4N6BA 1JXEA 4GVBA 4WTYA 1M5SA 3UVJA 2BE2B 5I42A 1NJZA 2JC0A 1PCEA 3KFWX 4X84A 3LGHA 5KT4A 4HACA 4EI2A 2ZBPA 1N5YB 3ZTPA 1P9YA 4OVOA 2J9DA 3QNWB 2AGOA 4J5OA 4YR3A 4NASA 4Y2KA 4IH5A 1YU6C 2N7CA 4DCLA 1D3WA 3SUCA 3Q8UA 5HK4A 2FY1A 3A3NB 4F0HA 2NU3I 2E7WA 1U7LA 3OL6A 4LIWA 2ZC4A 3BS9A 1PYOB 4Y6IA 3RAXA 2V8HA 1U6BA 5L1LA 2BRKA 3MM5A 3RU0A 1GK8A 4NRUA 1H2TZ 1KQFB 4ES2A 2WK4A 4N8NA 4F4WA 1X9SA 4MIBA 2QQDA 3UDLA 4I6YA 5FIIA 3S01A 2A10A 4C7QA 4XAKA 5DO2A 2H4YB 3H98A 3EWGA 3IWLA 2W7AA 5D0GA 3JSBA 5FLXU 2R2RA 1DHMA 3Q8SB 3OFFA 4WIQA 1SSQA 2MQLA 1WEZA 3DRRA 2BRLA 3CIZA 2OIHA 4J9MA 4AC3A 4P10A 4A8OA 2IAJB 4AQYF 3N5BA 3QZ8A 3VAGA 4DQQA 3PYFA 1SL2A 4EZ9A 1UVKA 4ZJLA 1TZ0A 3QYYA 3Q0AA 1U6ZA 4AL7A 4MFGA 3QT6A 1T9VA 2RUGA 2Z30B 1CE3A 1Q7LB 2DHXA 2GIFA 4LRDA 4DLGA 2MKSA 3CDWA 2N82B 2ACYA 1TBNA 2JL9A 2Y0SD 5KG4A 2X51A 4QBUA 2ERRA 3E2EA 3EH0A 1R89A 3K5OA 3R5JB 4MAKA 2DGWA 1M90T 1YJ7A 2GGPB 4I2PB 2ATCB 3PYDA 2LP4A 4USIA 4U67Q 4RU9A 2NU0I 4LSNA 4F2RA 3UGLA 1BE4A 1FTCA 1R8AA 3I3AA 4MT1A 3PO4A 4J37A 1H74A 3DLKA 3PIOQ 1YBAA 4AYBD 2LQ9A 3QT8A 2QJ3A 4NA3A 4DV5F 2G2ZA 5KFSA 2YQPA 3TJ8A 3V6DB 4M5NA 5KFUA 1EWWA 5CHCB 1MN9A 5KFTA 2CWFA 2XMTA 4CWBA 2OMLA 1EAYC 3C14A 3NGKA 4UOCA 3O6QA 5ETVA 4CO5A 1C4CA 3BGFA 1SV5A 2B5JA 4KO0B 3KJNB 1U2RA 2MKCA 3MMBA 3TQEA 3TO7A 4K4TA 2LEBA 3V4MA 4WYWA 2SGDI 4USTA 4LBPA 5ETMA 2FNFX 3GJTB 1U2FA 2EI5A 4X4OA 2F3CI 1VQPS 4MKAA 5IWAJ 3MR3A 2POKA 2M3DA 4ZHRA 1FX2A 2C2MB 2W2MP 1KQSR 5F9LA 2KI2A 2GZOA 3LW5C 1S12A 4CP5A 3HFZB 2ROEA 3NOGA 2DY1A 3ELHA 4RUAA 1R8PA 2W4DA 2IVYA 4FCEA 4WK1A 4J9RA 4DPTA 5ETRA 5B0EA 5DM6Q 3Q8VA 1DZ5A 2MB0B 5GVQA 1SL0A 4FBTA 2CPHA 2QIFA 3HT3A 4OX9F 4YDXA 2HQDA 2J9CA 1BXNA 3VZHA 2HFSA 1FVSA 4W98A 3HVTB 5FLXY 3CVKA 4XDDA 2P9EA 1OQ6A 1NB7A 2QA4G 4HH1A 3CCWA 1BQNB 2M88A 4TY8B 3MR6A 4A8SA 2KFZA 5A8KA 2C2OB 3CPWR 4DS4A 2FVQA 1PC4A 5CYQA 2BJ3A 4B3RF 3ONQA 3KWCA 2DR8A 3CD6S 3A3PB 3NS6A 3OTCA 4LT6A 5U47A 5L46A 1KHWA 3GJQB 1E6VB 1FDNA 3HZGA 2DNRA 4QZVB 3J81j 2VJVA 1I94F 5CCLA 2LQJA 1S59A 3P8BB 4IFVB 1N13A 4JP8A 4OZ2A 4RW9A 1SUQA 3TZZA 3HHKA 4DV6J 2D3O1 4IHHA 1IKXB 2J5AA 1THJA 3M8PA 3TISA 1RT3B 1R0CB 3F1XA 4B9SA 3NGSA 4AD6A 1UVMA 1WI6A 2HVDA 3NGUA 4K0KF 1TTHB 4ZVQB 2BJDA 2PFDA 3K8WA 5KFFA 4OX9J 4DV2F 1VQLS 2EBGA 4JI2F 2CPDA 1FF2A 2KT3A 2HQFA 4NL5A 1S97A 1JLQB 5IT9Y 2YKOA 4OZ1A 5E3RA 3UWTA 3H25A 3T5KA 2WVDA 2DNOA 2R2SA 2QN6B 4V19X 3KG4A 5J2MB 3KHLA 3T6BA 5F8NA 1RTJB 2ZVSA 1MR9A 2AW0A 4AAWA 4LSNB 3QAUA 4UOGA 2JW6A 4ANDA 4RX6A 3W2VB 3SCLE 4P74A 3J7A1 3GUEA 4LF7F 3LUYA 4X65J 4ELTA 2HHQA 1N0VC 3I9V9 2YNFB 4M1KA 4R25A 1JLEB 1CJVA 3V6DA 1Y3KA 3D0GE 1IJEB 1WDDA 2Y8YA 1ACMB 2DH7A 3H90A 3LAKA 1UJ6A 1SV5B 1U0HB 2B5JB 4HH0A 4KT0C 4CO4A 3HXMA 4IR9A 1JKHA 1PJ7A 2LDYA 2WVEA 1IQTA 1UTAA 1KQAA 2W4PA 1C0TA 4RNMA 1RGVA 3CW2C 2HAIA 5F3TA 4ZHRB 1HNWJ 4DV0F 3TARA 1KK4A 4A8XA 1NEEA 4EA8A 1HBMA 5HP1A 3C3LA 4C8YA 3T1YF 2W2OP 1EP4B 2KVQE 4F50A 5I3QA 3MCSA 4M5KA 4OX7A 5KFVA 4YMEA 2C3OA 2DB6A 2J6SA 4HDHA 5D0HA 2AU0A 2HBZB 2H5EA 2VASA 1IKVB 1LW0B 1SIWB 5A8RB 4LREA 1JMTA 1ZOTA 4C2MA 1ULRA 3QGHA 3DU5A 4DR4J 3DLGB 1Y5LB 2ALZA 4QCLA 5BYQA 5DEPA 1HBOB 1OYEA 1VRUA 3ZZRA 3VGSA 1L3UA 2HHSA 4DCPB 4DUYF 1LR9A 1Z2LA 3D1HA 1M1GA 2JNJA 2NU1I 4TY8A 4Y65A 1UA0A 4IOBA 1Y7PA 3OHBA 2IUAA 4KC5A 3IGJA 2ZFHA 3BBFA 2V4JB 3GFZA 2DIVA 5ETPA 1F2GA 1QAJA 2VV5A 3LP1B 3PJWA 4RZRA 2WGCA 2EFQA 3I55S 1Q1KA 1L3SA 1UEVA 4DCOB 2RIJA 2R7UA 1TV6A 4E2FB 5ADXU 2ZEJA 1FARA 1DS2I 2B9YA 1RDRA 2F9JA 1SI9A 3ICLA 3N0VA 4M99A 3LQVA 9WGAA 1SUQB 4DU7A 2EKNA 2GAGC 4P7VA 4GMKA 1ZA2B 2VBXA 3CO9A 4MH8A 3MPWA 1T9XA 4ED7A 2L9NA 2MJUA 3IGNA 2FLNA 1HD1A 1Z4UA 2E5IA 3QSYB 3ZFVA 3X1LB 2OAUA 2DR7A 1ZPWX 2EFOA 5B09A 1RHKB 3KLGB 2OPRB 2ZZTA 1VJQA 4WYLA 4ZA1A 1CVJA 3NNCA 3SSRA 2ARPF 1TELA 2QA1A 3NGRA 3PHEA 2JDJA 1JLQA 3BSCA 2ORWA 4YB5A 3QAEA 5K14A 1TUVA 1R8BA 4HACB 1I1GA 4DR3J 2VPWB 4DSLA 1RK8A 3OL0A 3DOMB 4Q2MA 5F8JA 3HSZA 3GIJA 3UNYA 2FJVA 3GE9A 3UDEA 2HRTA 1RTJA 2LU1A 1WGTA 2WB4A 2Y1LB 4DZ6A 4IKAA 2FLOA 4HTJA 3FEYB 4Z2XA 2BUNA 1JK9B 2VH7A 3DFEA 5A6PA 5SUHA 1H7WA 4PRFA 2XS2A 2AJ2A 1HKAA 4PUOB 1F3VA 3SCIE 1K0TA 4MZUA 3M2UA 1VC0A 1EARA 4OQJA 1PBAA 5KFIA 1IR1A 2JLFA 2B4PA 2CQGA 1X0PA 4ES3A 5DDRC 1HWLA 2HLUA 2LU2A 4AA7A 2M2BA 3Q2TC 2J6UA 2BACA 3OTMA 2VQFJ 1U4BA 1B4SA 2E1AA 2EEYA 2M9KA 3PEHA 4LR9A 4RW6B 3FCVA 4RNHA 4L6V3 2X1AA 3G8TA 2H5IB 4O44B 3PX0A 2N52A 3OH4A 1MROA 5LXYA 3Q8QB 4F02A 4M98A 5HLFA 4M2AA 1WWHA 3MGJA 3D0HE 3UN2A 1FRHA 2BXJA 1Z7KB 4OMFG 4PG4A 3W5YA 4OJ1A 2GKTI 2ROGA 4J9UE 3WZ0A 4C6AA 1N4LA 3SFGA 1S9EA 1K7TA 3WX8A 5HROA 7FDRA 4H54A 3KLEB 1R6VA 3EPIA 4FS1A 2XO7A 1RADB 5B0GA 2UZ3A 4E98A 4JI6J 2ACMA 4N47A 3BN4A 1Y0HA 1KBFA 1FXRA 2KRRA 2QKXA 2V8DA 3BH7B 5ETKA 4ZCMA 4O4GA 3E59A 1RU2A 2NYHA 2W9BB 4KJIA 2HVIA 3CJTA 3SQGB 4TU8A 5C42B 4CLSA 1P1TA 2CRLA 4JI4J 4WPAA 2XZWA 3ILLA 2EWHA 4E1PA 4KGVB 3ZZ0A 4AFFA 2BV3A 2IPOB 3C8YA 3DOLA 3I87A 1BHNA 5C42A 2XCPA 2UVRA 1UP1A 3RB6A 1TV6B 2XY5A 1VQOS 1MRLA 2GIVA 2IM3A 3GWCA 3TJQA 3J81Y 3KWMA 1ZM3A 3MMAB 1VBYA 2WOMA 1CULB 2KZZA 1SC6A 2DCLA 3DCAA 4UXIA 3QIPB 4LUBA 4PPDA 5F41A 3VVUA 4D3GA 3PNIA 4Q7AA 4DOZA 2UUAJ 3TDTA 1R0RI 3OTEA 3PJ9A 2OP5A 3HSGA 2XMVA 5HO4A 1QJHA 4JI6F 2QL7B 4PYAA 4DV5J 4NLPA 2OELA 3H2VE 4PPZA 1G1XA 3M6VA 3G82B 4ZVTB 1KVJA 2OEJA 4RW4A 1FRKA 1C4AA 3G6XA 5H9EJ 2NLWA 1LXJA 3W63A 1YP3A 2PA8D 3OR1B 4PG5A 1FRJA 2VFRA 4NXMJ 1WUUA 1M8NA 3BQ1A 3K0JA 5KT6A 2X7IA 4EU0A 1NDCA 2CAJA 3M32B 2UV8G 5EGYA 5F0WA 4C8NA 1YVFA 2N3OA 3MF5A 2CPEA 3T5HA 2I5JA 2J6TA 2R7VA 1N56A 2YH0A 1LXAA 1C2PA 2IRYA 4LSLB 3P47A 4BWMA 2MHNA 1CGJI 4CYUA 5F3ZA 3RB3A 2UXDJ 1RTIA 3MOZA 3PR5B 1TL7A 2W9AA 3Q83A 1RTZA 4AT1B 5KFMA 2UUCJ 4HUSA 1FRIA 2Z57B 1RT7B 1G6BA 1NUEA 1RAGB 1E6YA 5KOWA 1FJ7A 3RAMA 2F4VJ 4PQAA 1RWWB 2WVBA 1YZ7A 2JSXA 3JB9k 4QYZK 4WXOA 1X4SA 1Y11A 4KPCA 1JXLA 3ST8A 1U47A 1NNDA 2EFGA 4LVOP 2FC9A 3V2UC 1FWYA 2VKRA 1Q82T 3PFEA 4U7CA 1UW9A 1SXLA 3UFFA 4WF9Q 3W1YC 4DPOA 1FVQA 4X65F 3KLFA 1IM6A 3PZPA 1S1XA 3LH2S 2F9DA 2C3YA 2O67A 3VWSA 3GONA 2UUTA 3M2VA 5T7LB 3AD8C 4MMOA 1FFGB 2AIRB 2YXLA 2B9XA 1MU2B 4H4KA 4LRBA 5D6GA 4YHHJ 1YK9A 2L7XA 1X4EA 3JQKA 5HMWA 3UEYA 1DY3A 3M1VB 2BW7A 3R1WA 2DY9A 3OH1A 1PIEA 3HZEA 4FZVA 3SQGA 3TK8A 2Z4PA 3W9IA 1TK0A 2HHVA 2E66A 3W2VA 1RHJB 1AXQA 3M30A 4NRTA 3J7YU 4DV2J 4JV2A 3RGIA 4KPYA 4MFBA 3DOLB 2QIVX 1HPZA 1PBUA 2IJRA 1J27A 1FFSB 4ZIWA 3QFWA 2PMZD 4DUTA 2X52A 4O4RA 4OZJA 4TVAB 2XCAA 3RBXA 2OFHX 1EIYB 2BJ7A 3LAMA 5KG5A 1ZTTA 3MMAA 4G1IA 5D3GA 3TI0A 1CEZA 2WCYA 1IBMJ 2IIHA 1VJWA 2N4CA 3N4WA 1CJUB 2HEKA 4F67A 3KHHA 3BO4A 2C2RA 2V9WA 1VLYA 3PIPQ 4DV1J 1T94A 4QWBA 5DDQC 2CA9A 2XC9A 3UDCA 4FKXA 1YQHA 2ALYB 1SJ3P 2PI4A 3GQ9A 2VG5A 5C25B 1JWWA 4ZPBA 1N88A 3BJIA 2F40A 4IH7A 5HP1B 3BSAA 4R7PA 2K1RA 1H98A 2C3MA 2ZD1B 3D67A 3EVOA 2IDEA 1P9GA 1UFWA 3G82A 5EN1A 3BYRA 2QT7A 1O8BA 3I0SA 2CYYA 5FDLB 4DI6A 1AFJA 1IKVA 1CJTB 1LW0A 2OPPB 5DG9A 2DNPA 3GV5B 1UVGA 3KUGA 2V0HA 2ZH8A 5L39A 4DL6A 1TUWA 1IBLF 4J9SA 1RFHA 3MM9B 4QPXA 3MMJA 1D9FA 2CVEA 1WJ9A 3TAQA 1HBOA 3D4JA 5KFGA 4K6RA 2OZUA 1AFIA 1ZETA 4PXCA 1KRVA 3HM9A 4B3TF 4OI6A 5ETQA 1IBKF 1AZSB 1Q8IA 4ZP9A 3OHAA 3NL0A 2AGQA 4OI3A 2V4JA 2VA3A 4JI5J 1WF1A 2P8IA 4B3RJ 2DHGA 3LP1A 4KRWA 4X4PA 3U27A 2NSBA 1TMMA 3A8KA 2H54B 4M2BA 3C6UB 4K50A 1TBQR 4OYBA 3IM8A 1NSAA 1YJRA 3ZZOA 5KG0A 5IM0B 1U49A 2FTRA 1LWFA 3TX8A 5B0CA 3A13A 1V9OA 2XI2A 4NLRA 2CNLB 2G1DA 4GC7A 3L7PA 2HHPA 4ZN1A 1FKPB 3CULA 4N7TA 3DLHA 1XIQA 3IRWP 2FJDB 1DRZA 5DDOC 3EZ5A 5T14A 1HFEL 2YQ0A 1R0AB 4DWIA 3O8WA 1JLFB 1HQEB 3QT5A 4LFCJ 3CCSS 2CQ1A 3MD3A 3MCMA 3BEGB 1WF2A 4ZVPB 3KLGA 4F4KA 4J7CA 2D69A 4IRKA 3HJFA 1JLAA 2AJFE 2DJWA 3CJ4A 4K59A 4DV7F 1CQMA 2LXUA 2R4FA 2ZKUA 4HYKA 2AYBA 2V0LA 2PEHA 4CTAA 3KJVB 1AA1B 2BEFA 4U7UK 2V1CA 2CPJA 4TNOA 2IVFB 1VR6A 4ZPWR 2VBWA 3JTOA 4DBQA 1REVB 1UZDA 2BYCA 4EBEA 2OEMA 2WW8A 4X4RA 2DR6A 1KK5A 2CUYA 3MHYA 1MW7A 4DR1F 2CG4A 3PEJA 2WHOA 2XNRA 1SPBP 2AEFA 2JRSA 5J8CA 2AKWB 2Q6BA 3HSJA 2ODDA 3BKUA 4MFBB 4J90A 4R8UB 1VI7A 1M5OC 4KHMA 4DUZJ 3GLJA 3I3XA 4OX6A 1ULKA 1OMTA 1UAWA 3GG1A 2GVDB 4KKOB 2KXFA 4YB1P 5D3GB 3C19A 3V4EA 2JC1A 3D6MB 5IFMA 2V68A 3MOJB 1VDHA 3UO0A 4WU2A 3BSNA 5FUXA 1RT2B 1XWLA 1ZZNA 2E1CA 5KAKA 1Z2ZA 4DSKA 3R9LA 2QLBB 4RPFA 4FF4A 1RWVB 4PG6A 5HLFB 3IG1B 4LF6F 2QG9B 5CH7B 1U8SA 4U8YA 3ZZPA 3MWBA 1SGRI 3W5XA 2ZD1A 3IWNC 4AE5A 3PW4A 1MWYA 4CDIA 5EX0A 4OZ0A 1VQ5S 4EABA 2BJ9A 4H7OA 1HWIA 4LRAA 2B4VA 5FD1A 1NRKA 4I2QB 5HROB 3VBJA 1FO1A 3FEZA 4KSEB 5E3PA 1Q7YT 3C6TA 2I2YA 5JXSA 2VDHA 3ISZA 1CPZA 5K8OA 3EPGA 2K06A 4ZVOB 4NI2A 1ZH5A 2M0GB 1TL3B 3DJ4A 4NLTA 2R42A 1RYSA 3R3IA 1BD6A 2GFFA 1JLGA 3AJ2A 2FY8A 3DC2A 5THWA 3TVYA 1QRFA 1TKZA 2MQMA 3R7SB 2B8TA 3VGUA 2GVIA 1H0ZA 4C48A 3I0RA 2VQEF 4DV4F 1AN1I 3SYZA 2HYIB 3ETMA 3TV0A 1QY7A 1QUVA 2EFNA 4GO5X 5G0RB 1VQSA 4DMZA 4KNXA 4HDGA 4L72B 1J5EF 3BGUA 4YR2A 2UXBJ 3D0IE 2QQCA 3NNHA 1JJCB 1NZ8A 2A6MA 2BJEA 1P6TA 4DLEA 1OMSA 3GPAA 4C4WA 1LWFB 1UJ4A 3C8VA 2YWGA 4EZ6A 4NLGA 3D00A 1FDDA 2KVIA 1JLBB 1TKTB 1S5ZA 2HFVA 3BYPA 2ZH7A 3KK3A 1D09B 1WTJA 1Y1BA 2L3MA 3QPIA 2CPYA 1ROFA 4DL0C 4ED4A 5M2UA 3EGNA 1PPFI 5J8FA 1UWBB 2LA4A 5ETOA 1RE1B 2D7SA 2CPXA 3I82A 3BKFA 4B9UA 1BC6A 4DR1J 4U6PA 1K8AT 2JJ4D 2ZKTA 3MM6A 1OO0B 4KY3A 3E2IA 4DQSA 2V6AA 2P6TA 5KFDA 2XB2D 2MKHA 4HVZA 5HVHA 2XTJP 3KJVA 4CM0A 1QVGR 3EX7B 1D1UA 3OL7A 5D77A 4TYBA 2AQ4A 3G6YA 4DL4A 1K7VA 5LL6d 2YQ3A 4X4QA 2XWYA 3LA0A 3SEOA 3MXHP 1WC4A 1DLOB 2GCFA 1KONA 3F73A 1IY6A 1TKDA 4DUZF 3KTQA 3Q24A 3UCGA 5MLCV 1OY6A 2AX1A 2FZGB 1BQMA 5CD4A 2H51B 3HHDA 2CPZA 2DPJA 4LSLA 5L8RC 4LF6J 1RLDA 4L9MA 3TOBA 3BR9A 4HLBA 4WP8A 4BLGA 4LF9J 4KKOA 2NU2I 1RI7A 1RCOB 2PD1A 3QWPA 3CT9A 1YJWS 5E3AA 1RT7A 1FNMA 4FYXB 2V53A 1NK8A 2WRMA 1TUGB 2D3UA 3V81A 3RAQA 3OGZA 1FK9B 3NS5A 1RT2A 3EZUA 4OYPA 4C0OC 1UFKA 1TDTA 1IM4A 3VTIA 4DL3A 2BANA 1SVDA 1VK3A 3EXYA 5CYMA 1FKAF 1CS4B 1HNVA 1S7IA 3UEJA 2J9EA 2NYIA 2B9WA 2GMHA 3HCXA 5A0YA 4CO3A 4DHVA 3CDEA 3NOCA 1IJFB 4KV8B 4DF4A 2AD9A 3KLFB 4B3MF 1S1XB 2WLDA 4CH0S 1HR0F 1IWAA 2DNYA 2V34A 3L9ZA 3M6XA 2VBZA 4OHXA 3QTLD 2JYYA 1WHWA 2ENNA 1TAQA 5D15A 4KPXA 4J9PA 2EPIA 2YKPA 3N6LA 2AT1B 3JAMY 3CXCR 4ZPTR 2BE7D 4B08A 3DI6B 1S20A 2FVPA 3TA1A 4EA9A 2HRUA 5IOLA 3HP6A 2UUAF 1X74A 1U1MA 3HK2A 2ABYA 2B56A 3P5BP 1YJ9S 5F8LA 1T8EA 2ZWOA 3I96A 3DRPB 3M9NB 5AT1B 3UFCX 1YI2S 4FNHA 2L8EA 4QR2A 1HHQA 3DLJA 1FJGJ 2F8MA 1HQ2A 3DOKA 3QT7A 1KRUA 3I32A 4DCJB 1TK8A 1VQ6S 1RKJA 4DR2F 4IRCA 3H59A 3R97A 2XGPA 1SSMA 2KMRA 2NXCA 5D78A 3GIIA 4WFXA 1D8YA 4DR5F 3KK3B 3P3DA 2KXNB 5AJ3F 1HI0P 1G7CB 4LFAJ 2VC0A 4Q5VA 3TQ1A 3MQGA 1UWBA 4ER8A 4I7FB 5I3UA 4LJMA 4DSIA 3EDRB 2PT0A 5ETNA 5BYSA 3VAJA 3IXQA 2DH8A 3G86A 1P9QC 5HQ8A 3MM6B 4JUZA 1LWCA 4ZMMA 5DQGA 1F60B 4YQWA 2YPZA 3KLVA 2ZH3A 3V4IA 2RQMA 3D68A 3CJ5A 3K5LA 1HW9A 2J7UA 2AYGA 2E5RA 5J2PB 4M95A 4CIOA 2KYXA 2NQPA 3QBCA 1FXJA 4FKDA 1NM2A 3ET6B 2YKNB 4EBDA 4H4MB 4DFKA 3MM9A 4ID5B 1JJ2R 4UF4A 4IHGA 2JOQA 2RRBA 2NPFA 3TW0A 3AA9A 1NKEA 3R6GB 1RUSA 1N5QA 2JH3A 1FYBA 3UD4P 3FBCA 2U1AA 2G0IA 4IDKB 4OX8A 2LMIA 3FC3A 1AZSA 1Y5IB 1MG7A 2CWKA 2QC3A 3BBBA 2DEJA 3CJRA 3FVYA 3FMBA 3QLHB 1XA6A 3P45B 4OI2A 2AJ0A 5DQIA 2V63A 5CQGA 4B3SJ 1CG2A 1RQ0A 3CSKA 1N32J 2QSWA 2JEGA 5KG1A 2B6AB 3E51A 3CMAS 3QATA 2BW2A 5GAEI 3EM1A 2MQOA 4B6DA 5IQ6A 4PXEA 3FQLA 1S7HA 5HJXA 4ED0A 3R2DJ 1N33J 1HYSA 4PKDB 2C28A 3FFIB 1PCAA 4WKRA 3CNQP 4DF8A 1U1KA 1FKPA 1Q5YA 1RP5A 2GQQA 5KG3A 5HSPA 2DNQA 1YDLA 3HLUA 3T57A 4FYDA 5DJBA 1CSJA 3JTPA 2ZVIA 1VQ8S 1B7FA 1BLUA 1HQEA 2H4WB 4C3KA 1KR4A 4EEYA 2IJNA 1X0FA 1FNOA 1H73A 3N28A 3I9ZA 3D1OA 3EJMA 3PDNA 3FBFA 4HHJA 2FIUA 4USMA 1RT5A 5M2PA 3HPOA 3GILA 1ZAXA 1N34F 1OVOA 1IN0A 4WTOB 3J80U 2H5JB 4ED3A 2K3IA 5J1NA 2IHR1 3HI9A 5MAOA 3LF0A 1B7YB 1D8ZA 4HGUA 1KEKA 3MC4A 2ZJQQ 1T03A 4BC7A 2VOPA 3DMJB 1REVA 2FJBB 2Q3PA 3GR0A 1YP2A 3LWMA 3GZ7A 1FA0A 3D66A 1M1KT 4MKVA 3ULHA 4R5PB 8AT1B 3DRPA 3W65A 3GP9A 3D2WA 3G96A 4ED6A 3OL9A 1RISA 1YX2A 2GQCA 3GG0A 3M05A 3VR1A 4CNYA 3FWWA 1JJHA 4EO8A 1WELA 2DEIA 3CCES 3CCVS 3MD1A 1V3ZA 4ZVEA 3KLHA 4B9NA 2BQUA 1ZM2A 4HZDA 1QVFR 2MZTA 4RWXA 3OJSA 1HL6A 7WGAA 1X4AA 4DL2A 1A6LA 2XMJA 3F41A 4OI4A 2CIMA 3AQOA 1SGYI 2YKMA 4LF7J 3M2RB 3KWEA 1RAIB 2KRBA 2OUGA 3SEKC 1X4BA 3L3CA 2ZH9A 5LSLA 3HVWA 4ERDA 4NLQA 2E1MC 4RNNA 2H3EB 2I6WA 4GRSA 1C0UB 4JI1J 1GQEA 2QLFB 3W8GA 2VPYB 2OGUA 1SKRA 1FI4A 2ZC3A 3IBCB 3VAFA 1OPIA 4NCBA 4QR0A 9ATCB 3MUVP 1W26A 2W4CA 3AD7C 3NCQA 3LP2B 5D0EA 3TEHB 4LFCF 4HT7A 3ZTQA 1RLCL 4P75A 4HI1A 2EFPA 4LBHA 4JV0A 4YEAA 5KFBA 3OTZA 2KM8C 3A3OB 3SGQI 2BM1A 1T0TV 2X3GA 1ULNA 3K89A 4FNIA 2ZE2B 4BCAA 4CT8A 3DLLQ 1JLGB 3EXCX 3AOCA 3TJ9A 1CJKB 1ZZFA 2F8EX 4Q45A 2XO6A 4J9QA 1OQ3A 3KXDA 4W4MA 1NB2A 3T19A 3CUNA 3TUPA 1S48A 1LW2B 2XY7A 3MZIA 4YP3A 2Q66A 4OHVA 1D9AA 4RR5A 3W5ZA 1HR0J 4K4WA 2PMWA 3MFHA 3BRKX 3K58A 4X62F 4R37A 1HBNB 4M5DB 1XHDA 2U2FA 1I94J 1RTDA 1VIOA 4N76A 2ILYA 5ETSA 1XNRF 3J7AN 3GMGA 3IO1A 1NMEB 1IBMF 1C1CB 2EC0A 2CDRB 1GAOA 2PMHA 4CT9A 3CCLS 4NX9A 2HNZB 4M5JA 2HIQA 4KQLA 2IM1A 2QX0A 4TN2A 4TKTA 1V1IA 3UR3C 4X4VA 2ENZA 3A8JA 3HFKA 1K7UA 2KL8A 3GSIA 5GAEU 2NXJA 3BDPA 1EQMA 4FXVA 4IFYA 2LEPA 3R1HA 2WVFA 4P2XA 1KC8T 3OH2A 1EKSA 5C7PA 1PJ6A 2XULA 3FSXA 3DKDA 1XATA 4WE1A 1S76D 1RWPB 2IC3B 2QE5A 3IRXB 1SQFA 1HIYA 3WBZA 4DEZA 1ZTWA 1YRUA 1KMAA 1NO8A 2HZCA 1RAAB 1PTQA 2K8GA 3CE8A 2CQIA 5ADZA 5CAAA 2KB2A 1RWUA 3D5MA 4ITSA 4P2FA 2V8PA 4PWWA 1SJRA 3PR4A 2KHDA 3HVRA 3FBEA 5DQHA 4E0DA 2V5HG 1S77D 4KB7A 4DSFA 4EYIB 2CJAA 2H65B 1XMQJ 1KLMB 1NAQA 2AGPA 2IY5B 1KVKA 2CNNB 3ENAA 2IA6A 2FHOB 1TFYA 1X7VA 1U6FA 2DXFA 4DX5A 3CCQS 2QMXA 1KD1T 5KT7A 4DV4J 2O66A 3LGMA 5KFXA 1K44A 1SGQI 4G3SA 1FX4A 3NWGA 2E7XA 3EGWB 1S10A 5J2QA 3ISNC 3MDFA 3QGPA 2OI7A 3BSSA 2C3UA 4NE9C 3MURP 5LMNJ 3PW7A 2VF3A 4AXJA 3RRHA 3OUYB 2YQ1A 3G9CA 3AFGA 4CQ1A 5BYRA 3D6HB 1SGNI 1EQ0A 2VFVA 3N9UC 1KN6A 1Y10A 3CCMS 3OU9A 3FGVA 1T9UA 1C1BB 1LK7A 5EX3A 2DO4A 2WSCC 2M5XA 3SPTA 1JIHA 4Y2AA 2ZH4A 3BO2A 2HWIA 4DZDA 3RRGA 3M9MB 1RT1A 1VQKS 2B4OA 2B3TB 1F9FA 5GMEA 2VD3A 4ZIVA 2GHWA 4ECWA 1AT1B 4YB6A 5KT2A 4AQYJ 1YJVA 3ENVA 4F36A 2DHSA 1M1HA 3ILOA 4OZNA 2ADCA 1Y1CA 3HD1A 3HKWA 1B64A 3MAAB 3D3CJ 3CC7S 3MI7X 4ETZA 1W2BR 3DNCA 4O3PA 2W2NP 2JWNA 1TU0B 5J2NB 1U1QA 5LMNF 1Y3JA 5SZTA 1URNA 1U1NA 1UHAA 2A1BA 3PTWA 2A2DA 1S6QA 3QO9A 5D4NA 4DPYA 2KKHA 3K57A 2FLPA 4ILMA 2LEAA 4NXMF 5GAHU 2ZOFA 2QGFB 3HHLA 1DQ9A 5G4DA 2UXDF 1S1VA 2OD1A 2L08A 3CJKB 3TJAA 4C9DA 4P72A 4URSA 2OTLS 2YH1A 2GQ2A 4DSJA 1P27B 2LCWA 3TIOA 3RW7A 1XC9A 4KYZA 2WCXA 4NPOA 1HWJA 3W8PA 4DR7J 5DDPC 3CXLA 3OVOA 3FUYA 2HNDB 4NLSA 4OYIA 1OY9A 2NXNA 4IFYB 4U96A 1XR5A 2GA7A 2HFNA 1KGQA 3AJDA 2VBYA 4EGGA 3Q2SC 2QO3A 4DUYJ 3V4IB 2HBQB 3VAMA 2IC7A 1YP4A 3PHTA 4QIEA 5KFLA 2WSFC 2OFGX 4L74A 1JLEA 4WE1B 4QW8A 1TUSA 3SV3A 4HTIA 3H40A 2YKNA 3W3SA 1RWNB 1HEVA 2FJAB 4ID5A 2VU5A 2XMUA 4QPTA 4DN9A 5IXUA 2ZM6J 3Q23A 3EGZA 2XGQA 3GCWP 1FKOB 4ZKAA 1XEZA 2ILZA 1HNZF 3W62A 1BQXA 2CWGA 1KK6A 4FKYA 3R5CA 3SSQA 3W66A 1GMVA 3OR2A 3NAHA 2HQGA 3IWXA 1IUJA 1K1SA 3TP2A 3VBMA 1NUBA 3Q8RB 3DN9A 2JXDA 3MR7A 2NXUA 2ZJRQ 4M5MA 4JI4F 2Z58B 2XHCA 3GQAA 1S4EA 3HFVA 1LNQA 1QAIA 3MEDA 4UY85 1SIZA 4JYAJ 5DG7A 4EGLA 1TKXB 2I1RA 5J2QB 1H38A 4CLFA 1O0PA 3TZYA 1YTPA 3E3XA 5GAGU 2K7KA 1RAEB 2MKYA 3X3UA 5IT4A 4DL7A 3OTBA 4Q0BA 1H2UX 3AJ1A 2IJFA 2NPOA 3I4HX 2HLTA 2ZUAA 4KAIA 3MAHA 2KHCA 2YWHA 4DR5J 4DSEA 4H4KC 3R1LA 1YIJS 2KH9A 3UD5A 3FK4A 1RXOB 4LR8A 3RG6A 3CO0P 1C1BA 1RAHB 2MZJA 2W8KA 3POTA 5LMUJ 1JJ4A 2HMIA 2IU8A 1RT5B 1RSCA 4EO6A 5HL7Q 1TL5A 3DM2B 1YBTA 2ZJPQ 4DV6F 1UA1A 1HHSA 3GR1A 1AYEA 2XWXA 4QOTA 1QUPA 3UOEA 1B0VA 4G65A 3BSWA 3T1HJ 2ELIA 2MQPA 4ECUA 2ZH1A 1WORA 2RT3A 1A9NB 3C16A 4YDDB 3TO8A 1NDKA 4OHZA 1WHVA 4Q8EA 2BZ2A 3THPA 3MUTP 3KLIB 3P5TL 3Q22A 2OSRA 1M0SA 3P4UB 2FZCB 2B0GA 3NWRA 4RJVA 4E6UA 4MJKA 3R7BB 1OS5A 2IYIA 4USUA 3W2WB 2UXCF 4MKBA 3VV2B 3E01A 3JSYA 3HH2C 1IKWA 2L48A 1L3VA 1NHUA 2B8PA 1X4CA 4URGA 3AOAA 3DDIA 4J9KA 2CNOB 4CZCA 1RA6A 3QRQA 2BUSA 4XIUA 1RT6B 2DR9A 1M8CA 2XRCA 2BX6A 5DEMA 1L3KA 2HGLA 5B0FA 3D54A 3UE2A 5HQLA 1S1WA 3RTVA 3M2RA 2V2VA 2RAQA 1YJNS 3DOMA 4OI1A 5C2CA 4GI3C 2HBRB 1KS2A 1Q78A 4K2JA 4DG1A 3UCUP 1LFWA 1VBXA 4WFAQ 4QIWD 2A3JA 3R5GA 5D0RA 1VQMS 1TMJA 1T11A 2NUUG 1VGYA 2Z2YB 4BDPA 1T3OA 1UJ5A 3M2UB 3RUBL 3TAMB 3OFEA 4ZK7M 3S8SA 4L3KA 1VISA 2B9EA 3JSMB 1V3RA 2W0VA 1SH0A 2AP6A 3MQHA 4I4BA 4OZLA 1R8HA 2EK1A 4PYDA 1WC0A 2P2CB 4S0MA 1WNEA 4HCQA 1QRMA 1SC1B 2WONA 2IYGA 2Q4JA 3PW0A 3SRTA 3BZQA 2J87A 3HHEA 5EHHA 3MR2A 1CJKA 2NREA 3W61A 2F7VA 4P2SA 3BPDA 1VK8A 2RF2B 3NXZA 3OVBA 2R8HA 4DFPA 2FKOA 1RJJA 1R43A 4RUBA 3BO3A 2CQ3A 4ID8A 3UD3P 2VICA 3DDNA 2OEFA 1GT8A 3ECTA 2JEJA 2OH2A 1TAUA 3SFUA 1CC7A 3BKTA 2YNIB 3KLEA 4DQRA 2HVZA 1UCNA 3M8QA 5HVFA 2R2UA 3A8IA 3FC9A 4Q0BB 4YFUA 2BKPA 1NU4A 2RNEA 2DH9A 4WFZA 4F4YA 1GFWB 3AY0A 3O44A 1Q86T 1G97A 3BGOP 2LXFA 1PILA 1OYVI 2VFTA 2IRXA 3BFPA 2V50A 5LJ5Y 3OVAA 2HMIB 2ORVA 4K4XA 1IKYB 3PW2A 4A48A 3GV7B 3SCKE 2XMWA 2YX1A 2XLJA 5KFYA 1MWQA 4F3MA 2QPOA 4ECRA 2IA0A 1NK6A 2XS7A 3E8OA 1R79A 4ZP7A 2JZMA 1A0OB 1S9GA 2EG1A 2RKIB 3D3BJ 3IRXA 3S6EA 3TRGA 1OCXA 1G2EA 2RRAA 2LDIA 4GC6A 2DD8S 4AL6A 2C2EA 1U1OA 2R8GA 1FHTA 1LR8A 3CCJS 4JI2J 3PACA 3CCRS 1VQ7S 3QIPA 4X64F 1UVIA 1S6UA 4IOAQ 1KKHA 4RW7B 2YWWA 2OHDA 3G4SS 4NLOA 1UKUA 2CVIA 4ZJQA 2VOOA 1LXNA 4FN5A 3KYLA 2LECA 3E01B 2HPUA 4XDCA 1UEUA 1VC6A 1VRTB 2V94A 2F4FA 1HBUB 4WXWA 3DGVA 5CCMA 2BE2A 2FGOA 2MLYA 1RCXB 4P2MA 3H42A 1AROP 1BUSA 3IS9B 1CT4I 4F26A 2UXBF 1WOOA 1VOMA 4LF4J 2JA1A 1UEKA 2E9RX 2MGZB 2MKJA 3I5CA 1WC5A 3QIDA 1YRXA 4C97A 3GU0A 3IXCA 1PAUB 1WG1A 2O3DA 4GKJJ 5HMZA 4K4SA 3OL8A 3KJQB 3HJVA 3QGIA 2RDJA 1IR0A 3QAHA 4TYAA 1N5YA 1EJ7L 2UU9F 4DNCA 2QYCA 3U7JA 4CYUB 3JYTA 4MPIA 1ZBTA 4NEZA 1RT1B 5JHWC 1Y5NB 2AJQA 2FVRA 1PKUA 1TVRB 4QWDA 1M5VC 2ZDPA 3AODA 1OWXA 2HQCA 2OPSB 4OYWA 2DIPA 1SC4B 3UNGC 5LJ3Y 6FDRA 2RF2A 1XX6A 2BVZA 2RRNA 4C0BA 1QTNB 2DGSA 5K5MA 2QQ0A 3CMES 1KRRA 2FZKB 4N56A 1NXIA 2OMOA 4ETXA 2WLCA 2HVEA 3SSSA 3FSIA 1HWKA 4JV5J 1Q9BA 2E5LF 1APSA 1KLNA 2A18A 3DRYA 4ENOA 2P6SA 5CZXA 4I56A 2RH3A 5F8HA 4O3SA 4O3OA 2QMWA 3FZ2A 4MYUA 4ECQA 2RD5C 4R36A 3DRRB 2XZDB 1T02A 1QDUB 5C5JA 2QSFA 2QV6A 4N8OA 2MZRA 1PG5B 5B0AA 5H1SV 2ZHBA 1AB8A 2DPIA 3D7SB 2Z2LA 2XSJA 3LTOA 4UZCA 2VONA 4AL5A 1D9DA 3SQOP 2V4RA 2EXUA 1S1TA 1VQNS 1DTTA 2RQKA 3DHXA 1J5OB 4NA2A 2VA2A 2YBVA 1CC8A 2VHEA 1QAXA 3T1AA 3DLKB 4ED5A 3MMCB 2D3ZA 1X5TA 1T3NA 2UVWA 2ZBRA 3A1YG 3KK1B 3Q86A 1RACB 1RAJA 3JS9A 3M6WA 4PZVA 3W9JA 3MCOA 2DTJA 5F0UA 1K1QA 2B7CB 3N01A 3B4MA 4C3MA 4ECZA 4KO0A 4ZP8A 3MMBB 3BGRA 3N6MA 3ZC4A 4L76A 4WBFA 2MQQA 1MJ9A 2WZ1A 2NUHA 1ZPVA 4WCEQ 1IBKJ 2I5KA 3K17A 4O23A 3ZTRA 4RW7A 4QU7A 2NZ4A 4DR3F 2ZHAA 3UPFA 4B3OB 1BMQB 3NLCA 1S0MA 2HGMA 2HS3A 5CYJA 3PKYA 2RU3A 1U48A 2HURA 2E44A 1MR7A 4J18A 4RW8A 4N77A 2R8IA 1PJUA 1OJ4A 1Q81T 1B99A 5GMKa 3GIRA 2N7YA 2UZAA 2W24A 5D4LA 4E75A 3SMZA 3C66A 4QYRA 4YY3J 5FDLA 2XYHB 2C1EB 2GKVA 1GEHA 2DK2A 1HNZJ 3RR8A 4FF3A 2HS4A 2XBPA 4U9RA 3VAIA 2QLXA 1U26A 2XMAA 4DFMA 1BWEA 2K9HA 2CJYB 1VQYA 4XK8C 5KT3A 4N27A 3MUMP 1UVJA 3UN3A 3L7UA 3CJ0A 3POTB 3BM7A 5A8KB 2BQRA 3EVWA 4LF8F 2OD6A 4X4NA 1WDTA 3TZWA 2WLEA 1P1LA 4ZLLA 2GHPA 1N33F 2WAQD 4OHYA 1PYTA 3H5UA 1PJ5A 2MEWA 1WKKA 1TVRA 3QWUA 4UTGA 5K9FA 2NPIA 5IM0A 5BR8F 4A8QA 3VALA 4FBUA 3I31A 4QW9A 4ZLJA 1BQNA 1OY8A 2V2QA 4IFVA 2PN6A 2DXEA 5E7OB 3UGIA 5KFZA 2DNLA 4C0HA 5AE2A 2ASYA 4CLWA 3VNPA 2HAFA 1DS3I 3ZNUA 4OL8A 2HZAA 1L0SA 1H2VZ 4FF2A 1KWMA 2GJIA 2SXLA 3M8PB 5K8NA 3K59A 1QRGA 2HZVA 3H4DA 3IR7B 1NK5A 3LOUA 4PG7A 1SB6A 4LBIA 4PG8A 1FAQA 5HMXA 4JI1F 4IQXA 3NS7B 1KBRA 2RU9A 2COLA 2YWFA 1CT0I 3R7NB 4OLOA 3PG9A 2W0TA 1Z1ZA 1W2IA 1IKXA 1DURA 1VBKA 2BM0A 1GXTA 2EKYA 2JHEA 1S1UB 2JVRA 3HULA 3K5PA 3R6LB 3THTA 4CTAB 1NKBA 2JEIA 4WWSA 1KSPA 3L4BC 3GQ7A 1HPTA 2EW9A 1SL1A 3AHPA 2SGQI 4USKA 2AYEA 1FWKA 1J2ZA 2MZQA 4OFZA 3HSDA 2Q6CA 1WEXA
chains in the Genus database with same CATH topology
1R3NA 4G87A 4PWUA 2DGTA 2G4BA 3AB4B 2PC6A 3MMCA 5IQQA 4LMZA 3A8EA 4LFAF 2YNFA 3MAQA 1X4DA 1HQUA 1OPZA 3JSMA 5J2MA 3VBNA 3FRZA 2R9LA 5DM7Q 5B0DA 5E3CA 5K8MA 2F8HA 1TL4A 4TQSA 3DGPA 3OQ2A 4G1QB 3SCJE 3G71S 4KTQA 2GV1A 4DR6F 2RQ4A 2JF3A 3O2IA 1LK5A 3FSCA 3R5AA 4B3OA 5E3QA 1C0TB 2XHWA 5T41A 1F5AA 2M4MA 3F44A 3RZAA 3DLEB 4X4TA 2VODA 1M5PC 2V0JA 4G3QA 5AXMA 3J7ZT 3VAHA 3MTJA 4NZ6A 1JLCB 3IFEA 4IO9Q 3QJPA 4LQ9A 3GQCA 2CKWA 4Q44A 1NJIT 3M8QB 3UQSA 4RLEA 4QCLA 5B08A 1DQAA 1Q8LA 2MKKA 1GX5A 2RILA 2GX8A 4DDFA 2RDJA 4DLEA 1URRA 3OXFA 2UXDF 3DRSB 3I5BA 2RS8A 3HJJA 1JNRB 1EP4A 5ADXV 3L09A 3UW1A 3CCTA 2UUAF 1HMVB 2HW3A 1N5VA 1HW8A 2IVMA 4C3LA 1FJCA 2R7XA 1DARA 2LQ5A 1IKYA 3TR5A 3I0RB 5E2QA 1QRLA 2NS1B 3WX4A 4DV3F 3TUIC 4EFAC 2ZH5A 1NK4A 2FVSA 1YWXA 1XMQF 2HGNA 3HDSA 1NH8A 5HMYA 3MPVA 2RKIA 5DG3A 3DYAB 4F3QA 2E9TA 1Y00A 4QIFA 4A47A 1N36F 2DCUB 1JLBA 1TKTA 3WC2A 1XNQF 3LGNA 1V6HA 3C2PA 4G3PA 3WC0A 4V19J 4H4OA 5L6VA 1VRTA 5A6WA 3SZ2A 1RTHA 3CTRA 2IU9A 1YSJA 3KHGA 5K14B 2MPUA 1XN9A 1S6OA 2KZMA 3F56A 3IS9A 4QYZJ 2RDIA 4RUCA 3CEDA 2R7WA 2FDNA 4J9OA 1FD2A 2IM2A 1FXLA 4NYZA 2MQNA 3B4DA 3US5A 2ZOGA 1GH8A 2V0KA 1X5PA 4MK7A 5A2QY 2R7TA 1H0HB 2DRAA 2ZZMA 3LP0A 1VFJA 1BQMB 4RBVA 4I1TA 6FD1A 1FT8A 5KFAA 5B0BA 4EQYA 3PW5A 1FCAA 4NZ7A 2Y1IA 4BS2A 2KT2A 3GFHA 3OXGA 3LWLA 4C8ZA 1YITS 2G0CA 2N3LA 4PUOA 2M5YA 4MK8A 1PGZA 4O44A 1X5SA 3TA2A 5CYMB 4UUXA 4HZCA 2GHVC 1N32F 3CC2S 2G13A 3R27A 1PC5A 2P5VA 1S9FA 2YTCA 2VUGA 2YWEA 4LF5F 5M2RA 3R8YA 1KTVA 3AAWB 4JOUA 4AE5A 1EETA 2MSTA 3I4PA 4ZPDA 2D9PA 3VF0B 3GFXA 2JX2A 1MROB 4RKUC 2D41A 3M9OB 4M28A 4EBCA 3PM9A 5KG6A 2DGXA 5GAGI 2P9CA 3C46A 5CA5A 3IA0A 4KPZA 4KE5A 4O4GB 4AXIA 4IOCQ 4PR6A 1HMVA 5J1EA 3NP5A 2OPQA 1DTTB 1J5OA 1N52B 3PV8A 3OFHA 3FTTA 5B7WA 1N8RT 4WFYA 2KN4A 3NCPA 2KU7A 3D28A 4ED1A 2GNKA 3SDEB 2OEGA 2CJQA 3KK1A 5LMUF 3THVA 3VBPA 3GSDA 3B8HA 1S0VA 2GIRA 4I6WA 4J9NA 3CDBA 2BA9A 3PX6A 5AXLA 3BGRB 4P6QA 4N41A 2C3PA 2XSFA 2X1BA 3KMSA 4H4OB 3QGGA 4GO7X 2JEFA 2B51A 2HFZA 3W7BA 4YR0A 4ICLB 1XBWA 4RW8B 3IGVA 4JI8F 2J7WA 3PY8A 4ECSA 1RTHB 2CZVC 5DGBA 2F4VF 1S99A 2MKIA 2GW8A 1DBDA 2JLEA 5K8PA 3GIMA 2ICXA 4JV5F 4C11B 2XG8A 1Q4RA 2FHMA 1K73T 3NGDA 1QE1A 5C24A 4F4ZA 3M8SA 1VS3A 2AYMA 1HI8A 1NJWA 2E5GA 5KFRA 4RW4B 2AF6A 3SV4A 1O51A 2I5JB 4ZCKA 2ASLA 4IO1A 2ZH6A 2RVJA 3QLHA 4Y00A 4NLUA 3QZ7A 1VBZA 4B9LA 2HWTA 4TU7A 1RTIB 2ZITA 1S0OA 2LVWA 4K4YA 2B6AA 3EEVA 1J2VA 3CD7A 4IG3A 1XK8A 1ZAVA 4C8OA 3P49B 2P9GA 4C8MA 2CQ4A 2UVVA 4KHPF 4TXSA 2C2DA 5AFUU 2XMMA 3I6PA 5CXTA 1KOOA 1WACA 4J9LA 3LO3A 3MEEB 3FSBA 2WLFA 4QR1A 3FNNA 2KFYA 2R7OA 1BY9A 3CIMA 3BF4A 1H7XA 1B0PA 3M2VB 4G3IA 3GOSA 5U2KA 5EWGA 4TU9A 1S1UA 5IWAF 2Z0GA 2DNMA 1QSYA 2BQ3A 2GC8A 2MY8A 3BREA 1V67A 2OSQA 3M1VA 4A46A 1QTMA 1T03B 2HVHA 1YGYA 1HV9A 3DMJA 3T3FA 1WHXA 2KJVA 4IH6A 2D74B 3M30B 4DN0A 3AQPA 5T7LA 2CZ4A 1S80A 4BBYA 3JQYA 2GGPA 2I8EA 1KHRA 4HT5A 4MYOA 3HHNB 1HQUB 1H6KX 4JYAF 4RBUA 3HHLD 5DG8A 3NAIA 2NSCA 1HHTP 4G1QA 3BQ2A 4Y3CA 1VQ9S 2QEXS 2B4UA 2GIQA 3AH6A 4KIAA 2HHTA 1HPZB 5I4MA 4DQPA 1G3OA 3OW5A 1SSTA 2I0XA 2D1CA 4ILRA 2J0SD 3D1QA 3BSOA 4F3OA 3IAM9 2Q1LA 1TQLA 2K1RB 2YVSA 4N5SA 1HWUA 1N0UA 1X4FA 4FXDA 2W25A 4LF4F 2HHWA 4X4SA 3P1BA 2M8DB 5DLGA 4Y2IA 1JB0C 1MMDA 1UL3A 1FNXH 1SH2A 2CFXA 3T5LA 4ZVFA 3DRSA 4WKYA 2DNKA 3BJYA 2QLWA 1N6QB 2XLKA 4PQUA 1FESA 2L9WA 3I0SB 1S49A 1CQNA 3PRDA 2OPPA 4ATNA 2N4DA 4HEA9 2IFXA 1GXLA 1MMLA 2J76E 2MSSA 4CNZA 3C6UA 4LQ3A 2UP1A 1R6YA 4ED2A 2V9KA 1R7IA 2CPIA 3U1NA 4F4XA 2MZ1A 2JFDA 2K2PA 3DYAA 2KO1A 2YKQA 3CCZA 3O1LA 3R5DA 2KYZA 1IXKA 3RRKA 3TUJC 4YUDA 4Q8FA 3LALA 1C1CA 5CYQB 1M5KC 3KK2B 1U24A 3G8QA 2VG6A 3MEEA 4K5SA 1E6VA 4NYPA 5KOXA 4NLDA 3CJ3A 1XMOF 4NLYA 4ZPAA 3GYNA 1WF0A 4OJ3A 4E6TA 1Y9OA 3CJ2A 3VBKA 3VAKA 2CJBA 4B3SF 3K8VA 4DS5A 3KNAA 2CQDA 2DBBA 4FPRA 2V0NA 1RT3A 1U09A 4JBCA 2FHJA 3CF5Q 1R0AA 3MTKA 3OPKA 3NZ2A 1JLFA 3M4XA 1OSCA 3NRBA 4KBIA 1WI8A 2JZ5A 2VC1A 2XEXA 1YJUA 1JLAB 4FVCA 3N5FA 1DTQB 2Y1RI 2AWZA 3LP0