3FSYA

Structure of tetrahydrodipicolinate n-succinyltransferase (rv1201c;dapd) in complex with succinyl-coa from mycobacterium tuberculosis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
307
structure length
304
Chain Sequence
b'VTGAAGIGLATLAADGSVLDTWFPAPELTESGTSATSRLAVSDVPVELAALIGRDDDRRTETIAVRTVIGSLDDVAADPYDAYLRLHLLSHRLVAPHGLNAGGLFGVLTNVVWTNHGPCAIDGFEAVRARLRRRGPVTVYGVDKFPRMVDYVVPTGVRIADADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEGRISAGVVVGDGSDVGGGASIMGTLSTHVISIGKRCLLGANSGLGISLGDDCVVEAGLYVTAGTRVTMPDSNSVKARELSGSSNLLFRRNSVSGAVEVLARDGQGIAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tetrahydrodipicolinate N-succinyltransferase
publication title The three-dimensional Structure of a mycobacterial DapD provides insights into DapD diversity and reveals unexpected particulars about the enzymatic mechanism.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 93
structure length 304
sequence length 307
chains with identical sequence B, C, D, E
ec nomenclature ec 2.3.1.117: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase.
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
A PF14789 THDPS_M Tetrahydrodipicolinate N-succinyltransferase middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3fsyA03
3.30.60.70 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Trimeric LpxA-like enzymes 3fsyA02
3.30.70.2010 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3fsyA01
2W0VA 2XATA 3EG4A 4MYOA 2FKOA 2I5KA 3BRKX 3D8VA 4EABA 1YP2A 3KWEA 2AQ9A 3TISA 1FXJA 3ST8A 3GVDA 1KQAA 4HURA 5E3RA 4M2BA 4N69A 3MQHA 3PMOA 2QKXA 3OW5A 1QREA 4E75A 2IUAA 3OU9A 4KNRA 4G87A 3VBLA 2IC7A 1QRMA 3TV0A 3KWCA 5U2KA 1HM8A 3TIOA 3I3XA 3FSYA 1MRLA 2GGOA 2VD4A 4KPXA 4N6AA 3TK8A 2V0IA 1SSTA 2GGQA 5E3PA 1XHDA 3VBPA 1YP4A 3BXYA 2V0HA 5E3QA 2OI7A 5L6SA 5DEMA 2TDTA 4G3PA 2WLFA 3NZ2A 3VBIA 1KRRA 4KPZA 5F42A 3CJ8A 4M9CA 3I3AA 3MC4A 4J09A 2OI5A 2WLEA 2IU9A 4N6BA 3FTTA 2WLGA 2VHEA 3BSWA 3Q1XA 4FCEA 4EAAA 4EQYA 3R3RA 1YP3A 4H7OA 5DEPA 3OTZA 4EA9A 1XATA 2JF2A 4N27A 2IU8A 4AC3A 2QIAA 1Z90A 4M98A 3IXCA 1KGQA 1SSMA 4IHGA 4R36A 2W0WA 3R2WA 3VNPA 3GOSA 1FWYA 3FSCA 3IGJA 4IHHA 2ICYA 4G3SA 3FSXA 3TWDA 3OTMA 3C8VA 1KK6A 3D98A 4HCQA 2OEGA 5ADXU 3R1WA 2ICXA 3BSSA 3R0SA 3FSBA 1SSQA 4KQLA 3OUPA 3VBJA 4M99A 1G97A 4R7PA 2RIJA 3R3IA 4KNXA 3R8YA 3SRTA 4EA7A 4MFGA 4HZDA 4IHFA 1TDTA 5ADXV 3T57A 4E79A 1THJA 3DJ4A 3TDTA 3FWWA 4EA8A 1OCXA 1KRUA 1MR9A 4K6RA 1QRGA 4E1KA 1QRFA 4AAWA 1S80A 3DHOA 1LXAA 2P2OA 3FS8A 4G3QA 3SPTA 3R5DA 4EGGA 1HV9A 3BFPA 3P47A 1V3WA 1MR7A 3R5AA 3EH0A 3ECTA 1KK4A 3FOQA 4M28A 4M2AA 1KRVA 2OI6A 3EEVA 3VBMA 4AA7A 2WLCA 3HJJA 4ISXA 1T3DA 3R5CA 2V0LA 3F1XA 4HZCA 1QRLA 3BSYA 1HM9A 3VBKA 4E6UA 3R5BA 5DG3A 1V67A 1KHRA 3V4EA 1KK5A 4R37A 1QQ0A 5AFUU 2OEFA 1HM0A 2V0JA 2NPOA 4J18A 4E6TA 4DCLA 2JF3A 3MQGA 2Q4JA 3JQYA 3KWDA 3DK5A 3GUEA 4MZUA 1G95A 2QIVX 3P1BA 5AFUV 2V0KA 3HSQA 5L6VA 3VBNA 1KGTA 1J2ZA 4HUSA 2WLDA
chains in the Genus database with same CATH superfamily
3RB3A 3EMTA 3RGIA 2DH8A 4GVLA 3ZZ0A 2CQPA 3K5LA 2IYGA 4JOUA 1YX2A 2E5JA 5E3PA 4B9MA 2YXLA 1ZAXA 4FCEA 1N34J 5HBMB 1R0AA 3LAKA 4M98A 4W4MA 1V1IA 4DV2F 2ZITA 3DGVA 2M5YA 3D98A 1S9EA 1NSPA 4C8LA 3QATA 3OTBA 3IRWP 3Q8PB 2W0TA 1UTAA 2ZBQA 3SPTA 3RW7A 3C6TA 4OJHA 2XMVA 1P9ZA 2MY8A 3VQTA 1RWPB 1PILA 4DL6A 5AXLA 2OO4A 1IQZA 2MKCA 4XIUA 1NRKA 1LR8A 4YDDB 4ES1A 1RWKB 1PJ7A 3PYEA 1CBKA 2C42A 4DQIA 4UUWA 1EX8A 3DK5A 1WG1A 1VMBA 5K9FA 4J9KA 3U7JA 2K7KA 3DKDA 5HLFB 4WZMA 3KLIB 1OY8A 4O0NA 5HI7A 4LF1A 4MIWA 5CYQA 4DXLA 4B9TA 4RJVA 2HRTA 4RKUC 1FI4A 4Y2MA 4KPCA 3EPGA 3HMJG 2ATCB 1JLAB 1HMVB 3UPFA 3PYFA 2QV6A 3KJQB 4C8NA 1SGQI 3TZWA 4USMA 4ZOSA 4KRWA 2FJXA 1DQAA 4NX9A 1RDRA 2GFFA 3SV3A 2NUUG 3MR7A 3MPWA 2HMIA 2FNFX 2DR7A 4HEA9 2IM2A 3N01A 3MTJA 3DGPA 4OYIA 2YKPA 2ZNZA 3R9LA 1YZ6A 1S0OA 4L75A 1WF0A 2ROEA 2I5JB 2XNQA 4I7FB 4DLGA 2F8HA 1RTDA 3U1NA 3GR1A 4N7TA 4DV1F 3OXFA 1IKWA 3T1YF 3CCRS 4WE1A 3J81Y 2V0JA 4WU2A 3SGBI 2RC4A 1JLEB 2MQ8A 2R7OA 1F3VA 2B8QA 1ZAVA 1ZA2B 3NGKA 3GILA 5J2MA 2KKHA 1GH8A 2IUAA 3DU5A 5DQHA 1X4GA 1T9UA 4ECSA 3SI8A 3DOLB 2IC7A 4TNOA 2HVEA 3NY0A 1R0BG 2I1RA 4NWBA 2YX7A 1HBNA 4LMZA 2AD9A 1RT3B 1YK9A 3PO5A 2IJFA 2O5DA 4EAAA 4MKBA 2DR6A 1RTZA 1SSMA 2BRKA 2QTWA 3X3UA 5D4PA 2RB7A 3ILLA 4DUTA 3NCRA 4C0HA 2M0GB 2N4CA 2PA3A 3LP1A 3MUTP 2DGWA 2SGFI 4ZLLA 2VKRA 2F3JA 2HHVA 5E7OB 3PNIA 3GV5B 1MR7A 2JDJA 4OI3A 4DV2J 4QR1A 1JLGB 4ILRA 3S8SA 1KOHA 3OSPA 2WLCA 3GMGA 4P7VA 2V0LA 2KFNA 3DLEB 3MUMP 1M5PC 4P71A 4ANEA 2DNKA 1WC4A 1KHRA 5F3ZA 3J81j 2MSTA 1RA7A 2XMWA 4IKAA 3K59A 2BE7D 4HT7A 2PC6A 1WD6A 2FYXA 1S79A 2BRLA 1OYDA 1D3WA 2VC0A 1PG5B 2BJ9A 4KB7A 3I0SA 1U2CA 4B3OA 4ZDNA 1O6XA 2WHOA 4JI5F 2C2ZB 2R8JA 3NGSA 1N0VC 4F3OA 2YKNA 1BQMA 1U25A 1SKUB 4ECTA 3CJ8A 5I3UB 3PKYA 4DQSA 1AZSB 4KO0B 1HYSB 3AH6A 4DL0C 1R8CA 3V5RA 3VNPA 2R2RA 3T1HF 1I94F 1Q8KA 2ZDOA 1Q95G 4IRCA 5LL6d 5H9EK 2ZZTA 2AZ1A 4QPXA 2H1YA 1NKBA 2NU4I 3RB6A 1Z2IA 4E1KA 2X52A 5FUVA 1S20A 2N3OA 4EUVA 3BQ2A 1SGYI 5CHCB 3EVWA 2E1MC 2CJBA 4ZP8A 1X0FA 3IG1A 5MAOA 3C14A 1AT1B 1S59A 3HD1A 2QL7B 2FJDB 4URQU 2B5JA 3PX0A 2PFDA 2EG1A 5HQLA 4G1QA 2FZKB 2CQ3A 4DV1J 1PKUA 1FJEB 1Q8BA 3T1YJ 2F40A 4OZNA 3QZ7A 2VODA 1TGSI 1BWEA 3HSJA 4J9OA 5THWA 1HNXF 3BN7A 4XPCA 3CJTA 3I5BA 3H40A 2UUBF 1WGTA 2YNGA 1NXIA 2L41A 1LW2A 3NCQA 4F67A 1PBAA 1KGQA 3MM8B 2JA1A 1XMQF 3CIZA 4NASA 1KMAA 4WZQA 4LFCJ 2CQDA 5D15A 4QJVA 4ECXA 1QM9A 4K50A 3KHRA 2UZAA 4CLTA 1AB8A 1JMTA 1WOOA 1QRFA 1RXOB 4OYAA 3HVRA 1ZM4A 1NB7A 1CULA 5KTQA 2QA2A 3IBCB 1HWLA 1WC3A 3JSYA 3NS6A 4PUOB 3MR2A 3EZUA 2P9CA 1Q4RA 1VQKS 1S1XA 3N28A 2DNGA 4N8OA 4KC5A 4KJIA 4MYOA 3CWJA 4FZVA 3BBBA 2CG8A 1N5YB 2AYEA 2HFZA 1MWQA 1WG4A 1UZDA 5CCMA 2BE2A 4Y0FA 1SBRA 1N6QB 2RAQA 2HIQA 1VQ8S 2OH2A 1NJWA 5KFBA 2P9GA 4OV6A 2WLFA 2LQ8A 2ZH2A 1GX6A 2QYGA 2XMTA 3H25A 2WLEA 2VHEA 3J80U 2GVZA 1Q78A 4C97A 4M5DA 4JI5J 3AB4B 5ETQA 1VCTA 3AOCA 2Q6CA 1RYSA 2CPXA 1TQLA 2F4FA 1QVGR 4I2PB 1OSCA 1ULKA 3LA0A 3T1HJ 3AAWB 4DNCA 1I94J 1W7WA 2EKNA 4X65F 2W24A 5KFEA 3SFGA 3TOBA 3H2VE 2XLKA 5A6WA 2JX2A 2NXNA 4MZUA 2ZH1A 1KQKA 3VBNA 1HNIB 2Y0MA 3TIOA 2ZBCA 4AL5A 2LMIA 4Y28C 5HROA 2DH9A 2A20A 4NRUA 4RWXA 4OYWA 3TK8A 5DG9A 2X1BA 1RBOB 2GJIA 3FRYA 4DR2F 2EVZA 1FJCA 1T11A 1SH3A 4I2QB 2HBQB 2FC9A 3UWTA 3CJRA 1S1VA 1YBTA 3DDIA 2EKYA 4QYRA 4UW2A 1HNXJ 1V1HA 4UUXA 3SQGA 3AXMA 2UUBJ 2V34A 4E79A 4J9LA 1REVB 3MEGB 1NPKA 1LXAA 4F4XA 1S9GB 1XMQJ 2EWHA 4KT0C 3CGIA 2B6AA 2LFVA 5EWFA 3KK3A 3VBKA 1IW4A 2FHKA 3GFYA 2DHHA 3RRHA 4CH1A 4Y2KA 4YB1P 3PDNA 4BS2A 2X1FA 1U8WA 4B3RF 2V94A 2PN6A 4X4PA 3NS5A 3W2WB 4Q0BB 2ZZMA 5IZHA 2V50A 3D6MB 5D4NA 2BM1A 4QZVB 5FD1A 1WNEA 4O3SA 3GQ8A 2V53A 1UWAA 1ELOA 3CO0P 5L1KA 2DHAA 4PXBA 2YX1A 1WDDA 4USHA 2V4RA 3WIUA 5EGYA 5LJ5Y 3C66A 4ZIWA 3CJKA 4LFBF 3VZIA 1FKPA 4CLLA 2MKKA 2HQGA 4GO5X 2IAJA 3DM2B 4Y65A 2VDHA 3L3CA 4TKTA 4LF6F 4L3KA 4MFGA 3HLUA 1U2RA 3HFZB 3U1LA 3BN4A 3DXSX 1IBLF 2MYFA 1TMJA 2W1BA 2AJQA 1VQYA 3IBWA 3P4UB 1OWXA 3TP2A 2CADA 3ENVA 3H59A 3GOXA 5DLFA 4BC7A 1LWEA 2JZMA 3VVUA 2YPZA 3KLHB 3T6BA 4X4TA 3V2UC 2UUAF 2VBZA 2ASYA 3S7RA 4ECWA 1X9MA 4NXNF 2MLXA 4KHRA 3MECA 2A1BA 2PIIA 4X65J 4WP4A 1WSRA 3OR2B 2WRMA 3DMJA 4HDGA 4GMKA 2F5GA 3WIVA 1SGEI 1F2HA 2VHGA 5ETNA 4RW9A 5F3TA 5A0YB 4EO6A 2B4VA 5AJ3J 4DV4F 2W2QP 1YTYA 1U1RA 2MZQA 1NUBA 2Q43A 4ZVGA 5EWGA 2DIVA 4TYAA 1S6QA 4EMDA 2A10A 4O0IA 4M5LA 4UZCA 3GOSA 4YHHF 4DR2J 4AE5A 4YR2A 1OPIA 3DCAA 2WVBA 4BLGA 4RNHA 4IOBA 3JQKA 1WGCA 1P6TA 2F9JA 3SQOP 5IT9Y 3FEYB 3TQ1A 4DV0F 3PW2A 2BYCA 3M2UB 4ZVPB 3M2VA 2BOPA 5AXNA 2VPZB 2O01C 4CYUA 3M4XA 3FZ2A 3I55S 1F3FA 2KZMA 4USKA 2OGUA 3VGVA 3D8VA 4P74A 2AX1A 4HL9A 4CLKA 1SV5B 2DHGA 2MLYA 4U7UK 1NSKL 1XC9A 3VAJA 4B3RJ 1U02A 5C25A 2KG0A 1IWGA 2XSJA 3PEHA 5H9FJ 3BO2A 2OFHX 5D78A 4EWTA 2D3OR 2UUCF 3IXCA 1VFJA 1B7YB 7FD1A 3HZEA 2V8PA 3M8WA 4DPXA 2PE8A 4TN2A 3BGFA 4YMEA 2QFIA 2HS4A 5ETKA 3BSSA 1KTQA 1XERA 3GE9A 4ZVOB 2IA0A 3CC2S 2EEYA 3N6MA 4F4KA 4EA8A 3BBFA 1QRGA 4H4OB 2O66A 5ETRA 5KFHA 4LFBJ 3CJSA 3ISZA 2GQQA 1X74A 2RQCA 4DQRA 3VQSA 2ARPF 1U6ZA 2PI5A 3LQVA 4C8ZA 3F1XA 1RTJA 1UA1A 2VH7A 2CZ9A 4E1PA 4K2JA 1B64A 3HVWA 1IBLJ 3EWGA 4RNFA 3KOAA 3RBDA 2E9RX 2V8GA 4ECYA 3D00A 3ZZUA 3TNVA 1UVGA 1X4EA 3DDNA 2X3TA 5K5MA 3LP0A 3OTEA 1LW0A 4UT4A 1VHIA 4MMOA 2MQOA 4KQZA 4IR9A 4KGMA 3P8BB 1YBUA 3A3OB 3MM5B 2DNYA 3E3XA 2ZOGA 2UUAJ 2OPPA 4NXNJ 1SGDI 3NGUA 1AW0A 4DMZA 3SZ2A 4DSKA 1S4EA 3IS9B 4RW8A 3KK2A 2M8HA 4CWBA 4KR0B 1JXEA 4DV4J 3QO9B 2QGFB 1JLQB 4Y2AA 2BX6A 2FJWA 2GAGC 3FJ2A 2XCPA 3OQ2A 4OI2A 3GV7B 2K06A 1NJYA 3EH0A 2CJYB 3QFWA 3ULHA 4FN5A 4KSEB 4GC6A 1FRKA 4YHHJ 1DTTB 5GADI 4DDFA 1GMVA 1WELA 3EGZA 2AU0A 3PG9A 4LFAF 5T7LB 1ZM9A 2VB6A 5KFWA 4CRJA 1X0PA 4IDKA 1TR0A 4DN0A 1KGTA 3HF5A 2CQ4A 1F2GA 2NPIA 4R0JA 2A6OA 2XZTB 1FD2A 1QE1B 4DR5F 4LIWA 2FJBB 2FUG9 5DAEA 3G82B 1HM8A 1T9VA 2QX0A 2GGOA 2WCXA 1WDTA 4DV7F 4ED7A 3DRSB 2YQ1A 2DTJA 2MKHA 4DSFA 1KEKA 4KIAA 1VBYA 2XI3A 2VPYB 3UCGA 4J9MA 3JYTB 3CCJS 5J8FA 2HSEB 1KHWA 4B17A 4LF9F 4R36A 3GP9A 3M6UA 4DUYF 2GV1A 3SRTA 1KLNA 2VG6B 1IBMF 3TVZA 2OKQA 2E73A 3OVBA 2V8VA 3AOAA 1SGNI 2BA9A 4K7QA 4OJ1A 3R3TA 1SH0A 3QT5A 2P5VA 3MMAA 4WFYA 5AFUU 1QAIA 3SSSA 2M7SA 1OQ3A 4I56A 5E3AA 4PR6A 3MDFA 3BKUA 1SJRA 2M3DA 2QQDA 4IOCQ 4NZ7A 4OHZA 1GEHA 2BKPA 4IH7A 4J90A 4JV1A 3ILIA 5B0DA 4PCQA 1F9EB 3M1VA 5IQ6A 3FBEA 5IT9U 4B3TF 3TO7A 3BH6B 2LQ9A 1YU6C 2Y1IA 4IG0A 2QIFA 4ILLA 3CSKA 1SC4B 3MEEA 4OZ3A 3ITHA 1DAXA 2LEAA 4NLDA 2PT0A 5D4OA 4NEYA 1DS3I 4CDIA 4K6RA 1IM6A 4BWJA 4ID8A 1PTQA 3K5PA 3POTA 3KYLA 3DLKA 3MM6A 2BV3A 2W9BB 2EXUA 1DZ5A 3ADAC 4CP5A 2KMPA 1G2EA 1K47A 4E6UA 1TAUA 3DOMB 4UOFA 1SIZA 1HM0A 4HYKA 4CIOA 3KWDA 4CZCA 3BR9A 1EKSA 1ZZNA 2CVEA 5AXKA 1BGXT 4HR2A 2NREA 2KJWA 4LFAJ 1RT7B 3W2VB 3I0RA 2XZWA 3TVKA 1HHQA 2DB1A 3UCUP 3MURP 1N0UA 1UETA 4FS1A 3UI3A 2XLJA 4DR5J 2PA8D 5FJ4A 1GTEA 3LPYA 4RW6A 3ZZRA 4KGXB 5KT5A 2VG7B 3M6VA 1RWNB 4DV7J 4ZN1A 2D9PA 2HEKA 1S5ZA 4OX8A 2VASA 3M8QB 4F3QA 2HGLA 3GWCA 4B9UA 4KNXA 3IRXA 4PG6A 2YPYA 5KFJA 1OCXA 1ACMB 3ETMA 4TU9A 5BYSA 2HFVA 4EGGA 2MMYA 1D0EA 3GZ7A 4YY3F 4LF9J 2JW6A 1FXRA 4LSNB 3AJ2A 1FRJA 2ZD1B 4DUYJ 1XBWA 3A8IA 1CT0I 1RT6B 1KK5A 2GHWA 1L3SA 1IBMJ 2HZAA 3IBFB 1TBRR 3G86A 1KQGB 4PAAA 1V3SA 2GKVA 3KDNA 4C2MA 5DO2A 4DV5F 3CXLA 2AGOA 4WKYA 4ZJQA 2Z56B 4ZVQB 3UW1A 1VJWA 3VBPA 3SBMA 1N4IA 5J2NB 2OI7A 1X5SA 3TO9A 4CM2A 2ZJQQ 2JC1A 2GKRI 3BREA 1Y1BA 4KPYA 4I6AA 4XDCA 4ZPWR 4OI4A 1RWMB 2ICYA 4F2RA 3GV8B 1C1CB 4ZIVA 1MU2A 2WONB 4L72B 3VAIA 2YWEA 5HMYA 4B3TJ 5D8HB 4I69A 2HNDA 4EK2A 5KAKA 3D2WA 4FYDA 2UXCF 1JWWA 4UY8T 3VAHA 1ULMA 2QMUB 3VGTA 3G2XA 4HTIA 4DBQA 1M5HA 1VQ5S 4DR3F 2BANB 4QW8A 3AD7C 2IC3B 4RUCA 1GXLA 5F0WA 3IO1A 3UVJB 3HHLD 1YJNS 3Q89A 2BDPA 1VQNS 1H74A 3TA0A 4NE9C 1CJVA 1UP1A 3MFIA 3DLGB 2KG1A 2KRRA 2NU2I 1KBFA 3EICA 1HQUA 3GU0A 3W9HA 1PSDA 2CVIA 2CXEA 1Z1ZA 1I1GA 2YQ3A 1Z4UA 2JRSA 4ELTA 4PQAA 2L7XA 1Y00A 4J37A 2F7VA 4X4VA 3ZTPA 4H4KA 1W25A 1OSDA 3FFIB 2ABYA 4CI0B 3H5YA 3RYLA 1TL1A 3JQJA 3OL0A 4OYZA 3FMBA 4F0HA 1UL3A 4BWMA 1VDHA 1FRXA 5CYJA 3CJ3A 2RU3A 2RHQB 1URNA 5ADXU 4OZLA 4CLYA 3ETOA 4K59A 2DXEA 1RWVB 4LF7F 2VOPA 3DLLQ 1I6JA 2SGDI 3QIDA 2N82B 3CCWA 3TUIC 3IWXA 5DETA 1CSJA 1V3ZA 2CFXA 2YKMB 2H65B 1SL1A 2YNFB 4ISXA 4I4BA 4MFBB 1BMOA 2HHXA 2HHHF 3N5FA 1E6YB 4JV2A 1EETA 4F0MA 2NU3I 1JJHA 1WHWA 2VPWB 5F9LA 1FRLA 4OHYA 2ZC4A 2BVZA 2ATLA 2PQ8A 1IUJA 2HIYA 3NBPA 4PWDA 1VQ9S 2P6TA 4NLUA 3FMWA 4OYMA 1KONA 5F8HA 2W9CA 1U1OA 3PMOA 4ANDA 1MSWD 3VAMA 4HGUA 3UN3A 2DKOB 4G87A 3Q8VA 1IKVB 2W2NP 2PD1A 2YWKA 5D6GA 3FZBA 1FNOA 2XWYA 3I3XA 3DGPB 3CD5A 2MEWA 2VD3A 2GJ2A 5IWAF 3QGPA 4HACB 3SEOA 2DO0A 1QLNA 3THPA 3GJQB 5EWEA 1NDPA 5BJRA 5B0CA 5D77A 3KLEA 1IKWB 4WE1B 1HBOA 3D66A 1HBUB 3LALA 1RAEB 2EFNA 2J5AA 3DRPA 3FBCA 1Y10A 3CE8A 5J2MB 4KHPF 3G8QA 4IFVB 1Q16B 1G3OA 1C4AA 3F41A 5GMEA 4R5PB 1B7FA 2E5IA 3R7BB 2KYZA 4GVBB 1FE4A 3QQCD 2R2SA 1HBNB 1SPBP 3OLAA 2P6SA 4DFMA 2A18A 1LWFA 1K7TA 4HDHA 3KDOA 3ZO7A 3HD2A 5IT4A 2K2PA 2AEMA 2HFNA 1S6OA 4OYPA 3CULA 5E3RA 1Y0HA 3NGDA 2XGQA 4QWCA 2BR0A 2FGCA 4DX5A 1EARA 4DR3J 4LRAA 3Q8QB 4KGKA 3LP1B 1KTVA 1U09A 5CZVA 1IQTA 4DFKA 3UCZP 4M5HA 5HMXA 3GCWP 3EJMA 1H3DA 4K2XA 1OYEA 4TYBA 1WUUA 2M2BA 2GGPB 2M8DB 1MJ9A 3NOCA 1ZH5A 3M2RA 2QQEA 3PV8A 2QFJA 1D9AA 4NZ0A 4QCLA 3SDEA 2VL1A 4C6AA 5C24A 4OMFG 1G97A 2H54B 2AJ4A 5L39A 3FWWA 3UFCX 1Q9BA 1NH8A 2POKA 4DPYA 3OL6A 3MMCA 5FDLB 4ZVUB 2MB0B 3V6DB 3CB4A 5KG1A 2AGQA 3FVYA 4K4SA 2YQ0A 4DSEA 2F9DA 2ADCA 3UGIA 4LF7J 4AL7A 4B3MF 1GQEA 5EN1A 5EX3A 4V1Ak 4BCAA 4MK8A 1RCOB 3C3LA 3ZZOA 3TISA 1PYOB 1J27A 2MQLA 3WC0A 1HPZA 4X84A 4A8KA 2HHHJ 3KWCA 3UNGC 1QAYA 1QDUB 2FGOA 2NQPA 1NAQA 3UD3P 3TEHB 5J1PA 4ZP6A 3DDKA 2V67A 2LCWA 4ZK7M 2UXDF 4J9NA 4EZ9A 2WB4A 3NCPA 2V4JB 3J7YU 3M9MB 4JI2F 2MGZB 5HVFA 2RSQA 1VQSA 4FPIA 1EHWA 4FVMA 1YG0A 1NCLA 5IWAJ 4NLSA 2ICXA 4KQLA 3AT1B 1XMOF 4F4YA 1BHNA 2CDRB 2Y0BB 1N56A 2UXBJ 4G1QB 4NLRA 1XX6A 2CPIA 4QIVA 2VFSA 3QIPB 2Z2LA 1SKWA 4B9VA 3ZZTA 2HHUA 1RISA 4OI1A 3MOZA 2L9WA 1HHTP 1RT1A 2JVRA 1F0XA 1KC8T 1CEZA 1TL5A 1J2ZA 1LW2B 1HARA 5BYRA 1IN0A 3L4BC 2CPJA 2EFOA 1TU0B 1VRTA 4OYBA 3OU9A 4ZVTB 5K14A 4IG3B 1TTHB 2XO7A 1U49A 1OO0B 5J1EA 4YS2A 3HVTB 2JNJA 4Y34A 2LYVA 2BKNA 2JEJA 3MCSA 2WGCA 3MAAA 4WIIA 2SGPI 2LEPA 1X4SA 4TLRA 4KPZA 2CWGA 2Q79A 3PX6A 2VUGA 1B3TA 2OTJS 3CEDA 1NKCA 3M32A 4WTOB 1CULB 2MZRA 1BQXA 1VJQA 2VG5B 3MOJB 1TKZB 1N33F 3HJVA 3M30A 1N52B 3MHYA 4JYAF 3FKBA 4OHXA 2GVIA 4M99A 5ETLA 4CCHA 4P73A 3HX9A 4NPOA 4ETZA 3PR5B 2HNYA 4R0EA 4JP8A 2EC2A 4EI2A 2KFYA 4AAWA 1YQHA 4RLEA 5BXIA 1XK8A 1WTBA 2CPFA 4C9DA 2Y9HA 1FKOB 1HEVA 4OVOA 2GQ2A 5KG7A 1SC6A 1SH2A 1HM9A 2Y1JA 1P9QC 2R7QA 3TAPA 1XEZA 2HNZA 4WP9A 3NXZA 4J9UE 2RDJA 4ZLNA 3EVOA 2QPOA 3P3DA 4B08A 2ZHOA 5FIIA 2HWTA 3H4DA 4ELUA 4B3MJ 4DL4A 1TIHA 2BJ8A 1CJKA 5LSLA 2OSQA 3NOGA 2MQQA 1XN9A 1T3OA 4EBCA 2MQNA 4MJKA 4G3PA 1UA0A 3VBIA 4M1KA 1HNWF 3I3AA 1HI0P 1U48A 2OD1A 3T5JA 4C48A 2GIVA 2GNKA 4J9QA 3O2IA 2JF2A 4P52A 3ZNJ1 3OTOJ 4CO5A 2NXJA 1O5JA 3OLBA 1C2PA 4UZBA 3B78A 2UXDJ 1MW7A 5A8WB 2OZUA 2RDIA 1HA1A 5E41A 1WKKA 1HKAA 2HK3A 4NLYA 2X51A 2F65A 3ZNUA 4JBCA 2DNOA 3LUYA 1HW9A 1KRVA 2LDYA 1FRHA 2Q3PA 3VR1A 1VYAA 4HZCA 1KBEA 2UUWA 2ODDA 2SGQI 4R37A 1HHSA 1NKEA 3RW6A 1UZHA 2C22A 5L8RC 1G95A 2MZTA 2KM8C 3OVOA 2WOMA 1C1BA 4LQ9A 4W98A 4DEZA 2IMOA 4RW4B 1TL3A 1OVOA 2W7AA 2FHJD 4Y00A 2WSFC 3P49B 4UOGA 1QRMA 3QLHB 4LR9A 2HQCA 2OEKA 4NYOA 1VIXA 2GGQA 5AE3A 2CZ4A 4C4WA 3V81A 3OXLA 3MM9A 3GQAA 5L1LA 1Z2ZA 2E7VA 4ERDA 1JLFA 4NCGA 1T9XA 4EQYA 3PJ9A 1S6PA 4U96A 4LF4F 2DPJA 3U1MA 2B8TA 1YBAA 3PRDA 3TO6A 3TAMB 1QAXA 3CD7A 2HKEA 1TVRB 3AOBA 3CJ4A 2QSWA 5ETSA 3ISND 4Y2CA 1VQ7S 3QWPA 4PKDB 1LFWA 4ZCMA 3AD8C 1Z2LA 2G1HA 1S77D 4ZJOA 4JI7F 3M9OB 2FLLA 4ZPAA 5J8CA 4L73A 2OPQB 2MSSA 4I1TA 3DN9A 1YHQS 1S1UB 2H4WB 1N33J 1WHYA 2OLWA 3N9UC 4JYAJ 4Z7CA 4Q2MA 1FF2A 1HWKA 3PR4A 4V19X 3C16A 1NHKL 3KY9A 3BJYA 2ZWOA 4WKRA 2FJVA 5HN0A 4RNMA 1FRIA 4C8YA 3GUEA 4WPAA 3V4IA 2YH1A 1ULNA 4MKYA 1RYRA 1FXJA 3NNHA 1M90T 4LSLB 1YI2S 3DYAA 2A3JA 2VBYA 4FF1A 3TA2A 1Y3KA 1BMQB 1UPPA 3BKFA 2CRLA 2CJQA 2WBMA 2ZH9A 1KS2A 3MCMA 2KDOA 2DK2A 1WTJA 3NMAA 3RAQA 3PW4A 1YJTA 2IU9A 3PCOB 2PI4A 2JLEA 1B0TA 5D3GB 4K4TA 1WC1A 3ONQA 4NLXA 1RWUA 4QWAA 2XMKA 2Z30B 1C0UB 1FK9B 2WB1D 4G3SA 3OFFA 3GQCA 1FERA 1VBZA 2CPEA 1VQMS 1SJ4P 3GJRB 1JKHA 5CZXA 1A9NB 1X31C 2M5XA 1HNWJ 1IKXB 3MCNA 5BR8F 2C2NA 3FS8A 3FCHA 1XR7A 3JTNA 3ZTQA 1VISA 2XB2D 1SGRI 3MAQA 1E6VB 4WYWA 2CQCA 2EI5A 2IPOB 3JTPA 3C19A 3GR0A 3NNAA 1HI8A 3FDSA 5LMNF 4DCLA 2ZHBA 5HQMA 1RCXB 5D0EA 1CS4B 1KNZA 3E59A 3KUHA 5J2PB 3M8YA 2DBBA 3SGQI 5HBMA 1M1KT 3OL8A 2LXUA 3JAMY 2HQDA 4PYAA 1JJ4A 3UR3C 3PEJA 1PC4A 1TK0A 4X4QA 1UAWA 4OLPA 3FC9A 2DGXA 5EDWA 4WK1A 1OMUA 2PMHA 3BGLA 3J7Z5 4OL8A 1Q5YA 1EQ0A 2WLGA 3PM9A 2N3LA 4QQBA 2VJUA 2KTQA 4C3LA 1NZ8A 4P72A 1M5KC 2Q1LA 1HD0A 1T7PA 4NLTA 1I3OB 2MZSA 1JIHA 3Q2TC 3UDLA 4LF4J 2FDNA 5HLFA 1QAJA 5EHHA 3QRPA 3KLIA 2KN4A 1Q79A 4DU8A 5F8LA 2HW3A 2E5LF 2GIFA 2ROPA 4AXJA 2R7XA 3SEKC 1CQNA 1U6FA 4OLOA 4JI7J 3T3FA 3K5MA 4LRFA 2GVDB 1JLAA 3S6EA 4PEOA 1TKXA 4QWDA 1Q53A 2LB7A 1TL7B 3MMBA 5C7PA 3QRQA 2H4YB 1X4BA 2JJ4D 1Y1CA 3ELHA 2FPHX 3MUVP 2R8HA 2AEJA 4CNYA 1D09B 2WZ1A 4WCEQ 4F50A 1RT5B 3HK2A 3BF4A 2DR5A 2KJVA 1K1QA 1HWIA 3OTZA 2I5JA 1FO1A 2NPFA 4I7FA 4A46A 1NK6A 3IAM9 4TY9A 2QA4G 4K4VA 4NLVA 2HHTA 2G0IA 1SQGA 1JXLA 3M6XA 2YNIB 1JLEA 1FDAA 4DU7A 2HHPA 1HIYA 2IIHA 2XQCA 4F3MA 3DOLA 3UNYA 3PYDA 2C3PA 1S0MA 1G1XA 3W8GA 4HT5A 1EJ7L 3BJIA 4DJBA 3CJ5A 5BR8J 3AB2B 3BQ0A 3P1BA 1RT3A 4C8OA 2LVWA 4MTPA 4UY85 2AQ9A 4X66F 1RAHB 4C11A 2QKXA 1OS5A 2RT3A 1UMJA 2XTJP 4O23A 3R1HA 4YQWA 3TV0A 3R5GA 1P27B 3D6FB 2MZ1A 1UFWA 4R8UB 1FJ7A 2UVUA 2R7UA 1LEOA 5FLXU 2R2TA 1VQ4S 2FB0A 3MD1A 3CCUS 3KWMA 3UQSA 4JI6F 2MHNA 1RAFB 2ZOMA 2DD8S 1H0HB 2J0XA 4DLEA 3D67A 3WX8A 4X64F 3DLEA 1KVJA 1Q1KA 2OJ3A 1IBKF 2DNNA 5GAGU 5JVGQ 4WFZA 1KN6A 3LAMA 4UXHA 4RO0A 3GPAA 5H9FK 2KMOA 4Y2IA 1OQ6A 4ITSA 3LGNA 4MH8A 1O8BA 5I42B 3OH3A 3A3PB 2XY5A 1X4DA 3GIJA 4IO1A 3TW0A 4AA7A 5FUYA 3IXQA 3WHIA 1FA0A 3PW7A 1UVFA 3BKTA 2KXFA 2VOOA 3MFHA 2JF3A 2R9LA 3Q83A 3W5YA 1S49A 3HSQA 4ER8A 5I3UA 4NLOA 3EEVA 3R5CA 2WLDA 3KLGB 4F25A 2ZVIA 3OFGA 3Q86A 1AZSA 4ZJLA 3MQHA 1K7VA 1XA6A 2V8HA 4KV8B 4U7UD 5B08A 2NZCA 4FP9A 3Q22A 4P2SA 1BQNB 4F4ZA 4KPXA 1GMWD 2VQEF 1SGPI 4I6WA 2ORWA 1FEHA 3NKYA 4USVA 2Z0GA 4RBTA 2PSZA 4CNZA 4JI0F 4ILMA 1PYSB 1SCJB 2LP4A 1CG2A 3B8HA 2V1CA 2HFOA 2JC0A 3FSIA 2DEJA 2EPIA 5EUHA 2MY7A 1L3KA 1VDDA 1PBUA 3CC4S 4CH7A 1S0VA 5JVHQ 2EW9A 1K8AT 1K0TA 2LXIA 1TDTA 1GXTA 1L5UA 1LR9A 1VOMA 2W01A 3QTLD 3D6HB 2ERRA 1U1LA 3BFPA 3I82A 2E44A 5FUWA 2ZWPA 5T41A 1T8EA 5LMUF 2B3TB 2ADBA 1M8NA 4DV6J 5KT7A 4MKVA 2G13A 2EBEA 3SYZA 1LWCB 2VA2A 3TANA 1R0CB 2KHCA 2QIVX 3HVAA 2K8GA 1VS3A 4IG0B 4EABA 4B6DA 4DPTA 1PJ5A 1T9YA 3DLBA 1RP5A 3BGRB 1M8BA 3ZTOA 2DNHA 4PQUB 3R1LA 3GIIA 3V6KA 4DSIA 2GO8A 1S97A 4PG8A 2YWWA 2XSFA 1KOOA 5E2QA 1LKZA 5DS7A 4JI3F 5AE1A 2XS7A 1VR6A 3BYPA 5CH7B 5EX0A 1T03B 2RUGA 4X66J 1WORA 2YTCA 1SJFA 5C2GA 3OV7A 2AF6A 1F5AA 1TBOA 2MXYA 3MWBA 5IM0A 3W65A 2HG4A 4A4JA 4DF8A 2DB6A 2DCLA 1FJGF 1QSYA 4IHHA 1TZ0A 3CCQS 3C8VA 4HCQA 3OUYB 5SZTA 4PUOA 2O1PA 2FC8A 2K1RB 3C46A 5AT1B 2KT5A 4JI6J 3H5UA 2ROGA 2KI2A 1U0HB 1H0ZA 1N5YA 2R7RA 2Y3YA 2FLOA 1K0VA 3KMSA 1PTRA 2DGUA 3TARA 1TFYA 4X64J 1Y8FA 2JZ5A 3IR5B 2RD5C 4D3GA 1IBKJ 3RR7A 1N6QA 4OI6A 2E5RA 1FDNA 1DJ0A 5F0UA 1C0TB 3AXKA 2BACA 3M05A 2MKYA 3TJ8A 1YJ9S 3FC3A 3BR8A 1RQ0A 4DF4A 3OW5A 3JXOA 1S1WB 2E9TA 2JL9A 5B09A 2YX4A 5U2KA 4Y6IA 3IRXB 2WVDA 4I6YA 4Z2XA 3PVXA 2XEXA 1WC6A 3SCIE 2FHJA 5E3QA 1HNVB 4X4OA 3GCXP 2LA4A 1P8GA 2R7WA 3HFVA 3JTOA 4HI1A 2KMQA 2H48B 1HNZF 2ASLA 5I3QA 1BWVA 2ZZNA 2X1GA 2C3YA 4ICLB 2Z57B 4M5NA 2VQEJ 4FYXB 5T14A 3GONA 5CYMB 1HBMB 3E01B 3Q24A 4J9PA 4JI0J 2N71A 3RAXA 1HNIA 3R5DA 1TAQA 2DISA 2XULA 2CNKB 3T9ZA 5DQIA 3FRZA 1IR2A 4O4GB 1Y5LB 2OPRB 3GSDA 5HJYA 1BD6A 3OJUA 4ZHRB 1KRPA 4YUDA 2J9DA 4X62F 3IFEA 3CPWR 1RTHB 1MROB 2F4VF 3KG0A 1H2UX 4ECUA 1UVIA 4I2QA 2XY6A 1SJQA 2FKOA 1H98A 5LMUJ 3BSAA 3QRRA 3I87A 2QN6B 1Y3JA 2HVZA 1HDLA 4ZCKA 2CQ1A 1YRUA 5A76A 2V69A 2RMLA 5L46A 2WBRA 4ENOA 2YKQA 4UTGA 2Q6BA 1UFKA 4ZVEA 1W26A 1FWLA 4PXCA 3CDWA 3PJWA 2I9SA 4O44B 3MEGA 1RKIA 4B9SA 4HTJA 1GK8A 4EYIB 1S9GA 1R8AA 4KHMA 1T0TV 4ZVRB 2RH3A 4MIAA 5KFQA 3IGJA 1N88A 4Q8EA 3I31A 4JI3J 1Z2FA 2OEGA 1S7HA 3KK1B 4NYPA 3MPUB 3NNCA 4R7PA 3H98A 4ZVSB 4YEAA 2U1AA 4O3NA 3S01A 1UVNA 3ZZPA 1SB6A 3W2WA 4Q0BA 2H51B 2AGPA 2P2CB 1FJGJ 2NS1B 3DI6B 1WEYA 4USIA 4IRDA 3UFFA 2BJ1A 1RHRB 1LNQA 1N5SA 4L3NA 3CNQP 1DQ9A 2H5IB 1P9YA 3CCSS 4M5IA 3J7YI 1N5TA 2OU2A 1FX2A 3PXGa 1TKTB 2XS5A 1R31A 2MDAA 2W0VA 2XRCA 1SIWB 3WX4A 1MMNA 5A2QY 5C5JA 2CPDA 4LRDA 3K2YA 3KG4A 2AJ0A 2W8KA 1GTHA 4FVCA 4ECVA 1YJUA 5L9NA 4HLBA 4HI2A 3T1AA 4PG7A 1ICEB 3FSYA 4X4RA 2RKIB 5KFMA 4CLFA 1H2VZ 4QWBA 2RQMA 4JI1F 3OVSA 1PO6A 4PWWA 3CTRA 2IM3A 4YFUA 2DRDA 4M5KA 3TWZA 2E1PA 1APSA 1EETB 2KB2A 4LBIA 4S0MA 1XJWB 2AZ3A 3R1WA 4DL7A 4W92B 1VI7A 3PO4A 2ZJPQ 1TL4A 5E3CA 1V9OA 5DGAA 3CJ2A 1SUQB 3QZ8A 2ZH5A 3KLHA 2RQ4A 4QIGA 2W9CB 1HNZJ 3I5CA 1VGYA 3R5AA 4YR0A 1U1MA 4EZ6A 2F1FA 2C2KB 3O5TB 4K5SA 1RWOB 2XMUA 1BC6A 2OI6A 1SC3B 3OR2A 5HP1A 1RB0A 1HQEA 2KVQE 5JUMA 4WFXA 3TVYA 1BUXA 5A0YA 4LF2A 2CWHA 3IM9A 4KKOB 5F8JA 4CO3A 2E5HA 1RHJB 2B9XA 1KP6A 3MPVA 4FXVA 3NS7B 2ZH4A 4ZP9A 1VC5A 2RNEA 3WQPA 3EG4A 5JMNA 1KSPA 3Q8SB 1EQMA 1UKUA 2APOA 2VFRA 3EX7B 2DT9A 4X62J 1AUDA 3HHNB 2F4VJ 3DHWC 3S1TA 3CMQA 1KLMB 2F63A 2XMAA 2JXDA 3D5MA 1FHTA 2X7IA 3QGHA 4XAKA 2GAHC 4A8QA 3M2UA 3FQLA 5KFCA 1S12A 3A12A 2HHSA 4FKDA 2J6UA 4PABA 4ETXA 3K8VA 1SSQA 3G87A 1NO8A 3R8YA 4FYWB 1TBNA 2CZVC 3QJJA 3LO3A 4TY8B 1MT1A 2B9EA 3ILOA 3MR6A 3SSRA 1SV5A 1DURA 1FEEA 4OYOA 3PIOQ 5A6PA 3ET6B 5CXTA 3MMJA 4A47A 3BSYA 3W62A 3WBZA 2OEFA 1S9FA 5K8MA 2UVVA 1P1LA 2BEFA 2B4OA 2FLPA 1FAQA 1WKXA 1KQAA 4NA3A 3LW5C 4A8OA 3DC2A 1CQMA 1ZAWA 5KT4A 2QG9B 3R7NB 2BKOA 1FNMA 2ASDA 3L95X 2WVEA 3J81U 5K8OA 4NL5A 1WF2A 4YDXA 5B0BA 4DFJA 4N76A 5ETTA 3KHGA 4H4OA 4LT6A 3W60A 2ZE2B 4DWIA 2NSBA 4C7QA 2YWGA 1YP3A 1RJJA 3FEZA 5L1JA 2W8LA 1NMEB 3OHBA 3NAIA 1AFIA 1KQSR 4PG5A 4C3MA 3DRXA 4X4SA 2CAJA 3SV4A 2D7SA 3I4PA 1YSJA 1UFLA 3OFHA 2AX0A 2N52A 4DCPB 1H2TZ 1I5OB 2CJSC 1R27B 2HS3A 3CMES 5E5NA 5KFAA 3P45B 1X5OA 3DFEA 1RADB 2L9NA 2B7CB 4RPFA 3JQYA 3K58A 2CWKA 3UN2A 2AIRB 5L6VA 4A8SA 4USTA 3ENAA 3D1OA 4ZMMA 2ACMA 3KWEA 4YB7A 4URGA 2KH9A 3IS9A 1U6BA 2HRYA 2JEGA 2HVIA 3QO9A 2IRYA 1JLQA 3D68A 2DNPA 2IBKA 2GA7A 2TDTA 1K7UA 4LRCA 2Y1LB 2ZH6A 5GAHU 3CDEA 4KH0B 1CJTB 1YDLA 2KM8B 5A8RA 2K3IA 1GMWA 3R3RA 1N54B 2LLZA 4FS2A 1XATA 1GMUA 3LGHA 2ZBPA 3FCWA 1DTTA 2BJ7A 1FVQA 2A2CA 2LECA 1RT1B 5T7LA 5DG7A 1CHOI 3NGTA 3HHDA 2IYIA 3T57A 2XYHB 1LR7A 2J9RA 1RTIA 3EDQB 3OL9A 1ZTTA 2B4PA 4M28A 4LR7A 4MKAA 3G82A 1R8PA 1F5CA 4A8WA 3RRKA 1UPMB 1YJRA 1FXDA 3DRSA 1HJAI 2NYHA 5A8KB 2R42A 3D28A 4IYQA 3UEJA 2JEFA 4RWWA 1HLWA 1FTCA 3C15B 1YGYA 3B6BA 3IN5A 3JYTA 3Q23A 1RABB 3MZIA 4NOHA 1RLCL 3O3LA 4WTYA 1R43A 1BY9A 1J5EF 4B9NA 2VG6A 4CTAB 4NI2A 4NA1A 2RF2B 3LANA 3VV2B 1MMDA 1Q7YT 3TZYA 3DOKA 5ETVA 2NXEA 4EA9A 5M2RA 4CT8A 1FKAF 1RAGB 1OJ4A 2V2KA 4USWA 3AJDA 1KK6A 3TEGA 2J7KA 2ZUAA 5LXYA 3OW2R 3VDUA 2P9EA 4ZKAA 1CJUB 3BDEA 2CNNB 4RW7A 3EDRB 2CQIA 1YIJS 1RHQB 4TQSA 2I8EA 4DR7F 1KR4A 4J9SA 2C1EB 4HKQA 3EGVA 5IC4B 2BABA 5KOWA 1YLXA 1B70B 2L8EA 2QE5A 2P6AC 2J7WA 3OR1A 4DX6A 3M7VA 4LIRA 2L9DA 1MJAA 4CO1A 4PPZA 1NHUA 4OZ0A 2EK6A 2C2RA 1NK4A 1LXNA 1FVSA 3CCTA 5KFXA 4NMXA 4CT9A 4DL5A 5D0RA 2FTRA 1PPFI 2FD2A 2W9BA 4YN3B 3G6YA 1W2IA 3UE2A 3OBIA 1GAOA 2ZFHA 3DOMA 1WOPA 2C2DA 7AT1B 1Y7PA 1NJXA 3B4VC 2XCAA 5KFZA 2VBWA 1RAAB 3OH2A 2P2OA 3MI7X 1YITS 4ED8A 3QJPA 1NDCA 3SMZA 3PACA 3DRRB 1HL6A 2QL9B 3BS9A 1VC6A 4LSZB 3E2IA 3SUCA 1RT7A 3W2VA 4QIEA 1XWLA 4C8MA 1FD8A 2EFVA 1N36F 1S6PB 3H0PA 4K4UA 1S1TB 2PMWA 4UXIA 1FARA 3L7UA 1YKWA 2FY8A 4P2FA 4BC9A 2VG7A 2CUYA 5IFMA 2ERWA 2GMLA 3M8QA 4ATNA 5J2QB 3GLJA 2UUTA 1TK8A 3T41A 3WDOA 2DVIA 2D3UA 4LSNA 3OH0A 3BSOA 1GNKA 2ZD1A 4KH1B 2GC8A 2BZ2A 2N1AB 3EUNA 3H5SA 2UV8A 1J5EJ 2V63A 2UZ3A 1RT6A 2LU2A 3VBJA 3LTOA 4WBFA 4ELVA 2DRAA 4LF6J 5G0RA 3KJVB 2R3VA 2W4CA 2Y8YA 2HQFA 4RU2A 3QAEA 1VLOA 2A0FB 4QIFA 4DQQA 4GO7X 1Q8LA 4WXWA 1CVJA 4OZ2A 2FVCA 5CD4A 2YBVA 4P7TA 2MKJA 3V4EA 2MKIA 3QMQA 4DSJA 5J2NA 5LXRA 3V4MA 3IGVA 3A13A 1G7CB 4CH0S 3EGNA 4OIXA 3GQ7A 3BSCA 3PRVA 3R2DJ 3E51A 2C3UA 3SFUA 4O3QA 4C8KA 1QUVA 4DR7J 1R6YA 5GAGI 1CT2I 1RT2B 2DNLA 2OIHA 2OTLS 3GIKA 1S72S 1C1CA 3PIPQ 2WONA 4OX6A 3TUPA 1S76D 2V0HA 3BO4A 1DLOB 5B7WA 3SCKE 3RBEA 1Y5NB 5DEPA 1FFWB 3GTYX 3IR6B 3R6GB 4OX7A 2E7XA 2MJNA 2J8AA 4DG1B 2G0CA 3FSXA 3F56A 4DQPA 1OMTA 4N77A 2BANA 4E2FB 4M5GA 3J7AN 2IC3A 6AT1B 1VQOS 4ZA1A 3UVJA 3LF0A 2R2UA 1TOTA 3M8SA 3MTKA 3DLGA 1WEXA 4DX8H 4DV0J 3JS9A 3BPSP 2YQPA 2MKSA 3TJQA 2QA1A 2DGOA 5DG3A 1TKDA 2OUGA 4QU7A 5ETOA 4ED3A 2BBEA 5HVHA 3FFIA 1RU1A 3ZFVA 3Q8RB 3HSGA 1Q82T 4N69A 1RZMA 4Q2LA 2QLBB 2RILA 3VBLA 5K20B 4ID5B 1QY7A 1TMMA 4JI8F 3R2CJ 4LF5F 5LSOA 2HWHA 4L76A 1N36J 5IQQA 1TUGB 4AMLA 4DFPA 3OTDA 3C6UB 3CCES 1SI9A 2BW2A 1S0NA 3IWNC 2D69A 1NPRA 3NWGA 4CQ1A 2UUCJ 1SXLA 2YKMA 1B0PA 2DRBA 2YNFA 4WP8A 2YNHA 2XYGB 2KL8A 5DDPC 1ITPA 5L38A 4MFBA 3KG1A 1E6YA 3IMQJ 1TKXB 3AHPA 2CPHA 4USUA 2LEBA 1T9TA 3RBZA 3MMBB 3CXCR 1KRUA 3DHOA 4XK8C 1T05B 4E0DA 1IY6A 1RT4B 3ECTA 1KK4A 3I56S 3VBMA 2HQ3A 4XPEA 3GIMA 3N6LA 1U0SA 1IKVA 3HKWA 3CD0A 1FWPA 2VIHA 1R6VA 1D8ZA 4QR0A 2B0UC 4KFBB 1TV6B 1W3SA 2NPOA 4HACA 2ZKTA 3H2UB 1ZYQA 2ZUGA 3KNAA 4TU8A 5AFUV 3VWSA 3J80Y 4ZVFA 4E75A 3DLJA 3HCXA 4UQTA 1U1NA 2QLWA 1VHFA 2VD4A 1HBUA 2ELIA 1JQGA 3KHHA 1DTQB 1IKYB 5L1IA 2E1CA 4ZCIA 4IFVA 3G8TA 2HGMA 1RBLA 2M4MA 2W0WA 4R5PA 4LFCF 3B54A 5KFOA 4QW9A 3TWDA 4ZPDA 4GVBA 4IRKA 2IDEA 3PKMA 1HFEL 1OPZA 3H5XA 2AKWB 2QT7A 3K89A 4HHHA 7FDRA 4MYUA 1HV9A 4C11B 5LM7E 1MWZA 1NUEA 3A8EA 4J9RA 4AL6A 1U7LA 3HH2C 2WVCA 2QZ8A 1SL2A 4OX9F 3KNGA 2X3DA 4AT1B 3GFZA 3J7ZT 2CWXA 1FNXH 3BV8A 1V67A 2J9EA 3NL0A 1MN7A 2J0QD 1KVIA 1D8YA 3NP5A 5LT5A 4J5OA 2ZH3A 2LU1A 3DNCA 3R5JB 1VQLS 2E1AA 1F9FA 2QQCA 1RHMB 5DDOC 2GGPA 5C42A 1TBQR 3I9V9 3QWUA 4H4MB 2IJNA 2HPUA 2OPSB 5KFIA 1P1TA 3EVMA 3LP2A 4JUZA 3DHXA 4GC7A 1M0SA 3HO1A 2K3KA 5HMZA 5FDLA 1BE4A 1XNQF 2ZDPA 2ILZA 2J76E 3V6DA 2XM3A 4WU3A 4FXWA 5ETMA 1SJ3P 4JI8J 2E29A 3FGVA 4LF5J 1Q8IA 3OTMA 3MEDB 2DNZA 2ENZA 4M94A 2G2ZA 2AYGA 1YJ7A 8ATCB 4P10A 3M8PB 1N5VA 3ZZYA 1EP4A 1LK5A 1RAJA 3CW2C 3DXBA 3W1YC 2CPZA 1P9GA 3RG6A 4EU0A 4OYXA 4G3IA 3LGMA 2V9KA 4OI0A 5KG0A 2SGEI 4ZVHA 2VU5A 2OMLA 4LF8F 4DHVA 2J6TA 3PX4A 5KFYA 5FUXA 4I67A 2E7WA 2G0JA 2V4JA 2ZM6F 4G6VB 4N41A 1NU4A 1T94A 2MGZA 3BPDA 3QSYB 3O44A 2ZOFA 1Q0NA 2GCFA 4FF2A 3DLHA 4K8RA 1UW4A 4LBPA 3OSNA 2R8GA 4P2MA 3PYGA 2KCXA 1YZ7A 2DYAA 5DJBA 3D1HA 2UVRA 1NBEB 2RQKA 2QMXA 3QIPA 4P6QA 1IJEB 2YY3A 2VV5A 1AFJA 2BUSA 1N4LA 4A48A 3MCOA 2CPYA 1SVDA 3KLFA 3UEYA 1URRA 3VZHA 5DRKA 2XWXA 4M95A 2U2FA 4DS4A 4NCBA 1JLBA 1N8RT 4F8RA 2CJXB 1R0AB 4M2AA 3HDSA 1T3DA 1S9EB 4IG3A 4U6PA 3HVTA 1GFWB 1PJUA 1RK8A 4W90B 2Z8QA 3B82A 4XO0A 2GQCA 2B9WA 3NG8A 5IM0B 4F04B 3P96A 3C6TB 1J5OA 4OX9J 2W2MP 1WACA 2M70A 4HURA 4JI4F 5KFUA 2VG5A 1TKZA 3UOEA 2I2YA 2IMWP 2DHXA 1Q86T 5L6SA 1CC7A 3ZTSA 1TK5A 2IM0A 5I4MA 3MC4A 1FKOA 1DRZA 2EG2A 5D4LA 3H8YA 5HAOA 4IOAQ 2HGNA 1X8DA 4IH6A 5CYQB 2GZOA 1EWWA 2VZ9A 1WWHA 1EAYC 2LEOA 3K7RA 5ADXV 1NDKA 1XNQJ 3AJ1A 1KD1T 3J7A1 3HM9A 4WP3A 4YY3J 1U1KA 4WFNQ 1D1UA 3I9ZA 3VGUA 1QTMA 4RNOA 2HMIB 5KFFA 4LVNP 2EBGA 1HWUA 2EFGA 1LXJA 4BBYA 4F0KA 3PRBA 2PMZD 3V6HA 2HZCA 1RWWB 1XR6A 4WIQA 1T95A 1RTDB 1U47A 4B02A 4DV5J 1OY9A 4LF8J 7WGAA 5F8NA 5AJ3F 2GHPA 5CABA 5A8WA 4C0BA 1X7VA 2QSFA 2W4PA 4Z37A 5DZ7A 2ZM6J 2KHDA 2ZVSA 4K5RA 3BSWA 3CD6S 1N5QA 2UV8G 1HR0F 5HJXA 1YRXA 3JSMA 3L09A 5KOXA 3V6JA 3NAHA 2FVRA 2NXCA 2PO4A 4IH5A 1JK9B 3W9IA 2CWFA 1CC8A 3U02A 3LWMA 2DY1A 5CCLA 2V2QA 4RW4A 3KLVA 2COLA 3TRGA 2AP6A 2UXCJ 4C98A 3QLHA 3TUJC 3B4MA 3F73A 3OD2A 2N7YA 5GMKa 2DNRA 4QIWD 1ZPWX 2G2YA 4OJ3A 1KVKA 3OVAA 2CQGA 1MG7A 3GJTB 2GIQA 3ICLA 2DGQA 1H38A 3TAMA 1TVRA 3GSIA 1WG5A 5F8GA 2D41A 3AQOA 2J9CA 4H4KC 8RUCA 2VRWB 3GFHA 4MYTA 4CLZA 2OPQA 2FHOB 4JI4J 4K0KF 1M1GA 3VDPA 1S1UA 3MM7A 2OMOA 1PGZA 3VF0B 3ENQA 3I0SB 5IV3A 2ZBRA 1F6TA 4B3OB 2QLXA 4XTTA 2DPIA 3M8ZA 3GYGA 1VC0A 3R7SB 3QGGA 2YKNB 1VRUA 1BQMB 3R97A 3D1QA 1V5IB 1NXUA 2OI2A 1IBCB 5B0GA 2OD4A 1GX5A 1DS2I 3F44A 4LSLA 4HHJA 1L0SA 2MPUA 3K5OA 3VE5A 4GI3C 4IFYA 5GAHI 4AQYF 4D3HA 1EZZB 3P5TL 1Q81T 4J18A 4K4ZA 5HSPA 4DZ6A 2IRXA 3BRKX 3UO0A 5KFNA 1ZPVA 5D3GA 3W9JA 3GG0A 3UR0A 5KFKA 3EXYA 1MN9A 2L3MA 1C0UA 1FK9A 3IG1B 2CDQA 3HHKA 3O1LA 3C14B 2GKTI 2V8DA 2FVPA 4C0OC 3RR8A 2F8EX 4NLQA 1PCAA 2B5JB 1IKXA 2CYYA 3TJAA 2EFQA 2MQMA 2GMJA 3M6WA 2LA6A 3BZQA 2HVHA 3FTTA 1DQ8A 1K44A 2QLJB 3H20A 4CO4A 2AJFE 5HP1B 4X4NA 1HQEB 4OZ5A 1HD1A 1E6VA 4HHUA 1U24A 1H73A 2JLGA 1X9WA 5IXUA 3NLCA 2MLZA 4ZITA 2WVFA 5G4DA 1MR9A 2PEHA 1CS4A 3E8OA 1VRQC 4F36A 3VALA 1HR0J 1V3WA 5J2PA 2M9KA 3CJ0A 4KHPJ 2YNGB 3TX0A 2W2PP 1ZTWA 2E5GA 3HJJA 1PAUB 3HULA 3MXHP 3H90A 2IHR1 2F3CI 3BYRA 2MJUA 3CC7S 1X4AA 3Q8UA 2DIPA 2CNOB 3OH1A 3UDCA 5B0EA 1TUSA 1HPTA 2QL5B 3BBCA 5U47A 1FTRA 1UHAA 4ANCA 3NRBA 2DH7A 2CQ2A 1UWBA 1YVFA 4EO8A 3CIMA 2V0IA 1SSTA 5HL7Q 5DLGA 1CE3A 2LDIA 1S1XB 1FXLA 3KJFB 2NCKL 4DR6F 3TAQA 4F4AA 1TFWA 3CCMS 2ZHAA 2CJ9A 4PG4A 5E0OA 2J7UA 3QGIA 2BE2B 4YB6A 1QJHA 1NK0A 2ORVA 3D0GE 2XG8A 4RR5A 3CMAS 2FZGB 2GVDA 3R6LB 2VICA 4K0KJ 1ZM2A 1TL7A 2GVZB 2KU7A 1J2VA 4FF4A 5DZ6A 4NMLA 3BH7B 2I38A 1M8CA 3RJMB 1NJIT 3QSIA 4M5DB 5L9XA 2QJ3A 1ZETA 2CG4A 5KFDA 4LQ3A 3BDPA 3KFWX 2Z2YB 2V5HG 1CGJI 2X1AA 2KO1A 4WF9Q 1RT5A 1F9HA 2RRAA 2E66A 2XLIA 5CA5A 3DRYA 2BE9B 1FDDA 1JLCA 1QSSA 4TVAB 1FRMA 1L3UA 3IWLA 4B9LA 2GW8A 1R79A 4AQYJ 3RB4A 4AXIA 1MRLA 4I0WA 2VFTA 2IFXA 3WZ0A 1OYVI 4FF3A 2YNIA 5F42A 4Z7YA 2KYXA 3KKFA 4H7OA 5D0HA 5HROB 4Q5VA 1XTZA 4SGBI 5KFGA 2HRUA 1QSLA 4JI2J 3DU6A 2C28A 1MMLA 3O6QA 3D54A 1XMOJ 3R3IA 3M8RA 4JB8B 1WOSA 1THJA 1SL0A 4U7CA 1DHMA 1N13A 4P9SA 2QRRA 2ACYA 1WHXA 1S1VB 4QYZJ 4RU9A 1GT8A 2IVMA 2EC0A 2XY7A 2W4DA 1NSAA 3GFXA 4KY3A 3RB0A 3GQ9A 4R8UA 1JX4A 2D1CA 2K7JA 2D9OA 3SQGB 5A8RB 3QT6A 5IT0A 4NCAA 4OV1A 4DN9A 2B6AB 1G4CA 2I6WA 4DCJB 2J8SA 1LV5A 3KK3B 5IOLA 2Z2MA 1XHDA 2LXFA 2V2VA 1X4HA 2M52A 5ETPA 4LR8A 1RTIB 1KRRA 2GS8A 4ALZA 3VVTA 2OI5A 5I42A 2V2ZA 4E8UA 4X4UA 3AQPA 2JEIA 2D74B 2RIJA 4RUAA 2NU0I 1KQFB 4M5JA 3LOUA 4GRSA 2ALZA 4DR6J 3CJKB 1U2FA 3OGZA 4MK7A 5LOQA 4LUBA 3TI0A 2JFDA 3OXGA 3D4JA 3KLGA 1FKPB 2A2DA 3D3BJ 4FNHA 1RKJA 4AD6A 2IAJB 3FBFA 4KV8A 1S7IA 3BGUA 2VQFF 3R5BA 1BQNA 4NI2B 2BOAA 3HHLA 4EBDA 2KZZA 2A6MA 1KDNA 4LRBA 5GMDA 2HWIA 3W3SA 2ROWA 3RUBL 3VAKA 2V0KA 3DOKB 4O4RA 1C4CA 2I5KA 2XI2A 4RL1A 1JXVA 2JWNA 2FVSA 1V5VA 2CQHA 2O67A 4WJBA 3T5HA 2RS8A 1R3NA 2NXUA 2RRBA 1RHKB 4YOEA 4NZ6A 5DEMA 1LWEB 4RW7B 4RZRA 2DY9A 2QQ0A 2OD6A 3T6JA 3OTCA 2OEJA 5HMWA 3BQ1A 4N27A 3MECB 4MAKA 1YWXA 4B3SF 3DMJB 4CLPA 5LSRA 3GYNA 5D0GA 2CJAA 2B8PA 3R0SA 4RW9B 3Q2SC 1LWCA 4ZLPA 3TA1A 3CJQA 4IHFA 4Q44A 4LREA 3OR1B 4U9RA 2AYBA 1AUSL 2HBRB 2HAFA 3QJLA 2FZCB 1XNRF 2KFZA 2XGPA 1XMBA 1QVFR 1F1BB 3BGRA 2W7PA 1S6QB 1DY3A 4PQUA 4XDDA 3K8WA 3NEKA 2J0SD 1QRLA 4J91A 4ZPCA 1D9FA 4I68A 1UEUA 3SSQA 4CO0A 5GAEU 4YB5A 2HLUA 1T03A 4TLQA 4AYBD 1LOUA 1V3RA 1BXNA 3KUGA 2OSRA 4PRFA 2AV5A 3M2VB 1SQEA 2FHMA 2ZEJA 2JFKA 1X5PA 2J0WA 2JSXA 3OUYA 5LJ3Y 4N8NA 2DCUB 2K1RA 4MK9A 4CYUB 1Z7KB 2XBPA 4L9MA 3AA9A 5JXSA 1U4BA 4OZJA 2BQ3A 2V9WA 1U0HA 1CPZA 4DPOA 4AC3A 4FNIA 2B9YA 2B56A 1WSVA 2KXNB 4ZPBA 2G4BA 3FSCA 1MWYA 3W8PA 1UEVA 3OUPA 1VK3A 2RU9A 2HLTA 4AFFA 2OEMA 5C25B 2RHSB 5J1NA 3DJ4A 1C0TA 3T5LA 1S80A 4PWUA 5DM7Q 3F0NA 1HMVA 2MHEA 2XSJB 2HS0A 3HFKA 1FYBA 3W61A 3LH2S 1S1WA 5K8NA 3BM7A 4YR3A 4ECZA 1QTNB 1VQPS 1Y9OA 3KXDA 2D3O1 2HK2A 4UQGA 5MLCV 1HNVA 3TYTA 1W4RA 2RVJA 2V6AA 5DM6Q 1U1QA 2E1RA 2YKOA 4L6V3 5KG4A 4IQXA 2NSCA 3HHLC 2VQFJ 4USJC 4ICLA 2C3MA 1F60B 1V6HA 3CF5Q 1RTJB 5G0RB 2JHEA 5CYMA 1HBMA 1IM4A 3E01A 2AWZA 2GJFA 4NLWA 4F02A 5H9EJ 2NZ4A 1S10A 2HZVA 5DG8A 3A1YG 1A6LA 4O4GA 1YRTA 4FKXA 1PYTA 1S6UA 3QT8A 2OPRA 2R8KA 1YJWS 2XMMA 3LP0B 3BEGB 4A24A 4DZDA 1LW0B 2EK1A 4ZHRA 1ZS6A 3FSBA 2DGVA 1RTHA 1MROA 4CO2A 1RFHA 1B4SA 1PAEX 3TDTA 3AFGA 5AE2A 2OPPB 5HATA 5JJBA 4B3SJ 3G4SS 4RW8B 3KK2B 1FE0A 3QAUA 2XZDB 4KE5A 8AT1B 1UJ6A 5CD4H 3OJSA 3A4TA 1B0VA 4NLPA 5LMNJ 3OH4A 1LQ9A 4O44A 1XNRJ 2I0XA 3TOQA 3CO9A 3GG1A 3HHEA 1Y5IB 4FKYA 2XS2A 2B4UA 2DKVA 5ADZA 2DR9A 2RJZA 3MAHA 2CQ0A 4ZP7A 1JLGA 4K4WA 2IDLA 2JH3A 1JB0C 3KK1A 2BQUA 2DR8A 3PHEA 1WJ9A 1SKSA 4G65A 1O51A 4RUHA 4IDKB 4J09A 4U8YA 1HWJA 3IC1A 3DI6A 2IU8A 5DDQC 4WXOA 2RE1A 4G1IA 2KRBA 4IHGA 4DL2A 3KMQA 3HSDA 2H9ZA 4N5SA 3L9ZA 2J6SA 4X2BA 4ED6A 2HYIB 4U67Q 5IV4A 1RSCA 1TKTA 1M5SA 3D7SB 1PIEA 1NZAA 2VFVA 4K4YA 3FCVA 3VHQA 3TQEA 1UJ4A 5H1SV 2Y0SD 4IQMA 3KJNB 4KO0A 3CDBA 1HYSA 4M63A 2E5LJ 1RWXB 1UVJA 2ZJRQ 4L74A 3D3CJ 2RKIA 1H6KX 5C2CA 1YTPA 3P5BP 4HUSA 2J9DE 3UD4P 2H5JB 3QNWB 2YNHB 2RDDA 3EXCX 1QREA 3MMAB 2CKWA 5IC6B 1XQIA 2L08A 3SCLE 3QYYA 3H42A 2ZNYA 4J9VA 4WFBQ 1SUQA 1R89A 2DGTA 2C2OB 5B0FA 4F2SA 3JAMU 2B51A 3FUYA 3TZXA 4C3KA 2GIRA 2FLNA 3N0VA 4MIBA 4A8YA 3FEXB 9RUBA 3VTIA 3GIRA 3G96A 3K57A 5DGBA 4KKOA 2HHWA 2F8MA 2DXDA 2YUUA 4ZS6A 3M1VB 3T5KA 2Z4PA 1QD1A 2C3OA 2UXBF 1AN1I 1LK7A 2BJ3A 5KT3A 1O0PA 1TUVA 9WGAA 3P47A 5CQGA 3SCJE 1WF1A 1AXQA 3FK4A 4F26A 3FOQA 4FXDA 4GKKF 4N47A 4V19J 1S57A 1RA6A 3MEEB 3ITHB 3MM8A 4F4WA 2B7BB 2V0NA 1KLMA 2HHQA 9ATCB 1R0RI 1U8SA 4OZ1A 4IUFA 2XATA 2V4QA 3POTB 1RBAA 3DLKB 3MM6B 4M5MA 3ST8A 4DV3F 4M2BA 3FQKA 5M2PA 3TO8A 5M2UA 1IR1A 4N6AA 3MR3A 2C2EA 2FJAB 2ILYA 2DHSA 3NZ2A 2JLFA 4KGVB 4M9CA 5KG5A 2BMBA 4TY8A 1K9MT 1JNZB 1L3TA 4ZPVR 2VJVA 4LVOP 1Y4ZB 3ET6A 1ZOTA 4K4XA 3I0RB 3K0JA 3EM1A 2VONA 1U5KA 2ZH8A 2H5EA 3TOAA 3OHAA 5C42B 1JJCB 4CLSA 4EEYA 4BDPA 2XNRA 2GHVC 5KFRA 2AHOB 5E33A 4DPWA 3H7HB 1SQFA 2KT3A 5B0AA 4RW6B 1N32F 2XC9A 1Y11A 4RBUA 2OAUA 1NLKL 3W5ZA 2VC1A 3RZAA 3LP2B 3AY0A 1R7IA 5KG2A 3HP6A 1WEZA 1S48A 4MT1A 4FBTA 1AROP 3MF5A 4E6TA 2FQQB 4UF4A 4LBHA 3G8SA 2ZE2A 2W2OP 2WW8A 2AT1B 1FDBA 3CCVS 4EGLA 1FX4A 2W7OA 4ES3A 1DBDA 3U27A 2IM1A 4DR4F 2OHDA 1RAIB 4KGZB 4I2PA 4BHQA 4DR1F 1I51B 3N6NA 5F8IA 1EP4B 1YP4A 1ZBTA 2JVOA 3PFOA 2MZJA 3CCZA 5HK4A 2XO6A 2HVDA 3UD5A 2V1CC 4DI6A 2IRUA 3OTOF 1Z90A 1W2BR 2CA9A 1TELA 1JJ2R 1FWYA 4PYDA 2UU9F 1B99A 3B4DA 3D0IE 1UJ5A 1H7XA 3W5XA 3CT9A 3BGOP 5KG6A 3NWRA 2IY5B 1D9DA 4O3PA 1X4CA 2DNQA 3W7BA 2IBOA 3PJXA 4H54A 4NRTA 4HVZA 3M9NB 3KTQA 5KG3A 1BUSA 1FESA 1MU2B 2DJWA 4ZLJA 1NK7A 2WW4A 2UVWA 2J87A 3MD3A 2VFUA 4QWEA 2HNDB 2W9AA 3EYZA 1CJTA 3PW5A 2IVFB 3I5AA 1REVA 1ZZFA 3GVDA 4GKKJ 3TJ9A 3N79A 1NK8A 4A8MP 1SC1B 4KNRA 4JV0A 3KLFB 1RAOA 1HQ2A 3LPEA 1UVMA 4WK3A 4F7VA 3I32A 3OPKA 1JLBB 4DV3J 1LFPA 4MPIA 1HW8A 3PZPA 4ZPTR 1CJVB 2EFPA 3IAS9 5F9NA 3A8KA 2LKZA 1HQUB 4NLGA 3MGJA 2SXLA 4ECRA 2BJEA 4UOCA 2VDIA 2ASJA 1IJFB 2RS2A 5SUHA 5A8KA 5I3PA 1J5OB 1WHVA 3PY8A 3IR7B 4ED1A 4ED4A 1TL1B 1OMSA 3C15A 4ZCLA 1NB2A 1XR5A 3BB5A 2LQJA 2WAQD 4QOTA 4I64A 3DM2A 2WVJA 3US5A 1KBRA 1QQ0A 1HI1A 4CTAA 1VBXA 3ZZZA 1ULRA 2AYMA 2RF2A 5CAAA 2HAIA 3OFEA 1N32J 1DARA 3AA8A 2CIMA 3A8JA 4YP3A 1NPPA 1DFDA 2OVOA 2AW0A 2DITA 1PC5A 5KFSA 4DS5A 1IY5A 1VIOA 2BW7A 1CJUA 1YJVA 2OELA 4IR1A 4NXMF 1NH7A 4A8FA 3RAMA 3NBPB 4DR4J 4PWDB 4O3RA 3C8YA 4EFAC 2DEIA 1NDLA 5F8MA 4DR1J 3EPIA 1WI8A 5HQ8A 1WKLA 2YH0A 3W63A 3TZZA 3Q0AA 4URSA 2FIUA 3ISNC 2XMJA 3VAFA 1RACB 4TXSA 2OP5A 4RUBA 1KFSA 2UU9J 3KLEB 4KYZA 3EZOA 2WSEC 2DIUA 1KHVA 1HBOB 3W66A 1MJBA 3D9BA 3L7PA 1FY7A 1FWKA 4AUKA 4PZVA 3DRPB 3OL7A 3JSMB 4QPTA 3HZGA 1F5BA 5KFLA 1T3NA 2PFFB 2LUYA 3TUZC 1NK5A 2HFUA 3AODA 3LWLA 2HQIA 1IWAA 3VGSA 4GKJF 4ED5A 1LWFB 3KHLA 2K9HA 2KT2A 3RRGA 4WYLA 4N6BA 1CLFA 4J7CA 1REGX 3DRRA 2N4DA 3K5NA 4FBUA 2BJDA 1IXKA 3VAGA 4P2XA 1TP7A 3Q8YA 1MLAA 5KFVA 1WC0A 6FD1A 4HZDA 3X1LB 3SIPB 3UDEA 2GO9A 5HO4A 4CM0A 2R7SA 3H4BA 4G3QA 2R7TA 3ILJA 2AEFA 3A3NB 1S1TA 1QUPA 3TR5A 2NU1I 5K8PA 4RX6A 3M2RB 3L7OA 3SDEB 3G6VA 1RGVA 2QA4S 1IVZA 5C24B 3UGDA 5J2QA 5FLXY 1RU2A 1T02A 4U95A 3MMCB 2RUSA 4EYHB 3MM7B 2BQRA 1PJ6A 1YP2A 2WCYA 2AMCB 5BYQA 1UUCA 3NMRA 1VRUB 2AJ1A 1ROFA 3PFEA 3QFHA 1UW9A 3KJVA 2N7CA 3HSZA 1U45A 2G9OA 4LJMA 4JI1J 3GJSB 2VBXA 3SXLA 2QMWA 4G1PA 2ZBIA 1HPZB 2QIAA 1X9SA 5JHWC 4IFYB 2YVSA 3R2WA 2GMHA 1TUWA 2XYPB 2Y8WA 1EB0A 2IA6A 5IS2A 3NGRA 1H7WA 3HI9A 3IGNA 1NK9A 1UVKA 4NXMJ 3I6PA 2ENNA 2B43A 3D0HE 2B0GA 2LQBA 1FT8A 1XBTA 1WI6A 3O8WA 1RHUB 3MM5A 1AYEA 1FFSB 4HH0A 2HBYB 4NYZA 1RT2A 3GB0A 5KFTA 3JQMA 1CSOI 4FDFA 3HXMA 1UVLA 3FBBA 1PCEA 3VCDA 4DX7A 1DLOA 1VBKA 3T19A 2Y1RI 5HVGA 1VQ6S 1FCAA 2V68A 2MQPA 3QPIA 4DG1A 3UN5A 2P8IA 3TX8A 4OHWA 3W64A 2QEXS 3QT7A 2ZH7A 2XHWA 2NLWA 2DNMA 3OT9A 5RUBA 5KT2A 3K17A 4DUZF 4O3OA 3RBXA 4ES2A 1RI7A 5A2QU 1CT4I 1VK8A 3ZXWA 1VRTB 2KXHA 5AXMA 1KWMA 3HT3A 1QE1A 3N5BA 5KFPA 3BO3A 5K14B 3G9CA 4GKJJ 5J1EB 1M1HA 4EA7A 2R7VA 3MAAB 3UGLA 1X5TA 1ZA1B 1MNEA 1XIQA 4RNNA 2QLFB 1A0OB 3N4WA 3M32B 3QAHA 1NJZA 1UWBB 3T9NA 3M30B 4Q8FA 3EE3A 4ID5A 4ZN3A 2DO4A 1RLDA 4FYYB 4KTQA 1WTFA 4IO9Q 2HNYB 3HJFA 4TU7A 2WTFA 2HFSA 3C6UA 3PW0A 1UCNA 3CVKA 4ED2A 5ITHA 2GX8A 1Q5VA 4QR2A 3WC2A 4OQJA 3CUNA 2NUHA 2PGCA 1EKRA 4Q43A 4DL3A 2WSCC 2WK4A 3BXYA 2HNZB 3HKZD 2QO3A 2CJKA 2OFGX 3CDUA 2E9ZA 3Q1XA 4JV5F 1T05A 4DCOB 1WKJA 1RT4A 3E2EA 3ZC4A 2G2OA 2IJRA 4PXDA 1GXUA 3EZ5A 2H3EB 4U8VA 5GAEI 1VLYA 4FYVB 5HANA 1AA1B 1S4FA 4FPRA 2VPXB 1M5OC 3JB9k 1FFGB 1CJKB 3IM8A 4KFBA 1TV6A 4A8XA 3IP0A 1BLUA 2BM0A 4CLUA 2FJEB 2FY1A 4N56A 1K1SA 3I96A 2D3ZA 1N48A 1JLCB 2QC3A 1KKHA 2DXFA 1ZM3A 2DGSA 2BUNA 2O3DA 4ECQA 4CLWA 4DV6F 4JCVE 4DPUA 4DSLA 3MEKA 2AJ2A 2BXJA 4RBVA 2W25A 2LQ5A 3GYXB 2Q66A 1H72C 4ED0A 1DTQA 2Q4JA 2FVQA 2QYCA 1NEEA 2HBZB 3H2LA 3C2PA 2G1DA 1IKYA 1RE1B 4E1RA 2YWFA 2MTLA 3P6YC 1OIAA 4QU6A 1N34F 3PHTA 2ALYB 4QBUA 2IVYA 2YWHA 2XHCA 5DDRC 4UXJA 4WFAQ 2KMRA 2JOQA 2JYYA 4Q45A 2WOMB 2PDAA 3JSRA 1C1BB 3FNNA 3MPYA 1X4FA 3CDAA 2HURA 2NR0A 1TL3B 1M5VC 1NNDA 3ENWA 5F41A 2C2MB 1NSQA 1OY6A 2Z2ZA 3BSNA 4M8LA 1NM2A 1NHVA 4DUZJ 2CQBA 2NYIA 2VF3A 3V81B 5KT6A 1TURA 3MM9B 2UVOA 5GVQA 3QBCA 3RTVA 3JSBA 1JLFB 3AD9C 4NCGB 2M88A 5DQGA 4PXEA 2CNLB 4H4MA 4UOHA 3G6XA 2Z58B 2OPSA 3CCLS 4R25A 4Q7AA 3MPDA 3PTWA 1S99A 2VKZG 3HPOA 3ZTRA 1T9WA 3MQGA 4OJGA 1G6BA 4NEZA 4E98A 1RUSA 3G6ES 3HT0A 2ZC3A 3THTA 3I4HX 2VA3A 1R8HA 4HH1A 1UEKA 2ZKUA 3KUEA 1JNRB 4DOZA 1WC5A 1U26A 3MEDA 3C16B 3RU0A 2R8IA 3R27A 1SKRA 2KVIA 5GADU 3M8PA 3V4IB 4NA2A 3THVA 6FDRA 1KFDA 4Y3CA 4TQRA 1R8BA 4P75A 2AQ4A 1EIYB 3DYAB 2N17A 2X3GA 3HHLB 1U1PA 3UDVA 2YKAA 3MR5A 1K73T 2RRNA 1SJ1A 4EBEA 4OHVA 4JV5J 3G71S 3IA0A 2UP1A 4PPDA 3EGWB 1L3VA 1LWXA 1IR0A 3D6TB 2PEBA 1X60A 4KBIA 4KAIA 2R4FA 4WWSA 4OFZA 1Q7LB 1A7GE 1JKHB 1CGII 4QYZK 2L48A
chains in the Genus database with same CATH topology
4PWDA 3RB3A 1VQ9S 2P6TA 2FLPA 2DH8A 4NLUA 3FMWA 4NCAA 1KONA 5F8HA 4OV1A 1KQAA 2W9CA 3ZZ0A 1U1OA 3PMOA 4NA3A 1MSWD 3LW5C 2CQPA 4DN9A 4A8OA 2B6AB 3DC2A 3VAMA 4G87A 3K5LA 1CQMA 2IYGA 5D6GA 1IKVB 2PD1A 2YWKA 4JOUA 1ZAWA 5KT4A 3FZBA 1FNOA 2XWYA 3KK3B 1LV5A 3I3XA 1FNMA 3CD5A 2ASDA 3L95X 2VD3A 2E5JA 2Z2MA 5E3PA 1XHDA 2LXFA 2GJ2A 5K8OA 5IWAF 4NL5A 1WF2A 3QGPA 3SEOA 4YDXA 4B9MA 1X4HA 2M52A 5B0BA 2DO0A 4DFJA 1RTIB 1KRRA 1QLNA 4N76A 3KHGA 4H4OA 4LT6A 3THPA 2ZE2B 4ALZA 2OI5A 1ZAXA 5EWEA 2NSBA 4DWIA 4FCEA 5BJRA 4C7QA 2YWGA 5B0CA 1YP3A 5HBMB 5I42A 1R0AA 1RJJA 5D77A 3FEZA 3LAKA 4M98A 3KLEA 1IKWB 5L1JA 2W8LA 4DV2F 4E8UA 4WE1B 2ZITA 4X4UA 1HBOA 2M5YA 3AQPA 3OHBA 3D98A 1S9EA 3NAIA 1AFIA 1KQSR 2JEIA 4PG5A 1HBUB 4C3MA 4C8LA 2D74B 3DRXA 2RIJA 3LALA 4RUAA 4X4SA 2EFNA 2J5AA 3OTBA 3SV4A 3DRPA 3IRWP 2D7SA 1KQFB 3I4PA 3LOUA 3Q8PB 2ALZA 3CE8A 3SPTA 5J2MB 3CJKB 1U2FA 1YSJA 3G8QA 3RW7A 4KHPF 4MK7A 3C6TA 4IFVB 1UFLA 4LUBA 4OJHA 1Q16B 2JFDA 2XMVA 3OFHA 2AX0A 2MY8A 3OXGA 3KLGA 1G3OA 1H2TZ 1R27B 3VQTA 2HS3A 1C4AA 1FKPB 1PILA 2A2DA 3F41A 4FNHA 4DL6A 1RKJA 5AXLA 2IAJB 4R5PB 3CMES 5E5NA 2OO4A 5KFAA 1B7FA 2E5IA 4KV8A 1IQZA 2MKCA 3BGUA 1NRKA 4XIUA 2KYZA 1X5OA 4YDDB 1FE4A 2VQFF 4ES1A 3R5BA 1BQNA 3DFEA 2R2SA 3HHLA 1HBNB 4EBDA 2C42A 2L9NA 4DQIA 2KZZA 3OLAA 2P6SA 4DFMA 2B7CB 4UUWA 2HWIA 2A18A 3JQYA 3W3SA 3DK5A 3K58A 1LWFA 1WG1A 3TI0A 4HDHA 3VAKA 1VMBA 5K9FA 5L6VA 2V0KA 3U7JA 5IT4A 3DOKB 4J9KA 2K2PA 4A8SA 2K7KA 3D1OA 1C4CA 4O4RA 4ZMMA 5HLFB 2I5KA 2XI2A 3KWEA 2HFNA 1S6OA 4YB7A 4WZMA 4URGA 2KH9A 3KLIB 3CULA 5E3RA 1Y0HA 2JWNA 3NGDA 2XGQA 2FVSA 3IS9A 4QWCA 4MIWA 5HI7A 2BR0A 5CYQA 2CQHA 2O67A 4WJBA 2FGCA 1U6BA 3T5HA 4B9TA 2HRYA 2JEGA 2RS8A 1R3NA 3Q8QB 4KGKA 3LP1B 4RKUC 2NXUA 1KTVA 2HVIA 1U09A 5CZVA 2RRBA 3QO9A 4Y2MA 1IQTA 2IRYA 1JLQA 2DNPA 2IBKA 4DFKA 3UCZP 2GA7A 4YOEA 4NZ6A 5DEMA 1LWEB 2TDTA 3EPGA 3HMJG 4RW7B 5HMXA 4RZRA 2ZH6A 1JLAB 1HMVB 5GAHU 1H3DA 3CDEA 3UPFA 4K2XA 2QV6A 4C8NA 2OD6A 3T6JA 3OTCA 2KM8B 4TYBA 5A8RA 2M2BA 2K3IA 3R3RA 2GGPB 4ZOSA 5HMWA 3BQ1A 1N54B 2M8DB 2LLZA 4KRWA 4FS2A 2FJXA 1XATA 1DQAA 4N27A 3MECB 4NX9A 1RDRA 4MAKA 1ZH5A 3M2RA 2GFFA 3SV3A 3PV8A 2QFJA 2NUUG 1YWXA 4B3SF 3DMJB 1DTTA 1D9AA 3MPWA 4NZ0A 5LSRA 2HMIA 4QCLA 1FVQA 3GYNA 3SDEA 2VL1A 2CJAA 2A2CA 2LECA 1RT1B 2DR7A 3R0SA 4RW9B 3Q2SC 5C24A 4OMFG 1LWCA 5T7LA 1G97A 4HEA9 5DG7A 2IM2A 3N01A 3TA1A 3HHDA 4ZLPA 2IYIA 2AJ4A 3MTJA 4IHFA 3DGPA 5L39A 2YKPA 3T57A 4Q44A 2ZNZA 3FWWA 3UFCX 1NH8A 2POKA 3OR1B 4U9RA 2AYBA 3OL6A 3MMCA 5FDLB 1S0OA 2MB0B 3QJLA 1RTIA 1XNRF 2KFZA 3V6DB 2XGPA 1XMBA 1QVFR 1WF0A 3BGRA 3CB4A 2W7PA 2ROEA 1S6QB 1ZTTA 2B4PA 2I5JB 2XNQA 3OL9A 4M28A 4I7FB 5KG1A 4DLGA 2F8HA 4XDDA 4PQUA 3K8WA 1RTDA 2AGQA 3U1NA 3GR1A 3FVYA 4K4SA 4DV1F 4MKAA 3OXFA 1R8PA 1F5CA 4DSEA 2F9DA 1QRLA 1IKWA 4A8WA 3T1YF 2ADCA 2J0SD 3RRKA 3CCRS 4AL7A 4WE1A 1YJRA 1GQEA 4B3MF 4ZPCA 1D9FA 4I68A 3J81Y 5EN1A 1FXDA 1UEUA 5EX3A 3SSQA 2V0JA 3DRSA 4CO0A 5GAEU 4YB5A 5A8KB 4WU2A 4BCAA 3D28A 2HLUA 4IYQA 4MK8A 1T03A 4TLQA 1JLEB 2R7OA 4AYBD 3C3LA 1LOUA 1V3RA 2JEFA 3ZZOA 4RWWA 1ZAVA 3NGKA 1FTCA 3GILA 3TISA 1YGYA 3IN5A 3JYTA 5J2MA 2KKHA 2MQLA 1GH8A 3WC0A 1HPZA 2OSRA 3Q23A 2IUAA 4X84A 4PRFA 3MZIA 2AV5A 3DU5A 4NOHA 5DQHA 1X4GA 4ECSA 3M2VB 4A8KA 3SI8A 1SQEA 2FHMA 3DOLB 2IC7A 4TNOA 2JFKA 3KWCA 1X5PA 2J0WA 3UNGC 1QAYA 2FGOA 2JSXA 3O3LA 3OUYA 4WTYA 5LJ3Y 1NAQA 2NQPA 4N8NA 1R43A 3UD3P 1BY9A 2DCUB 2I1RA 2K1RA 4MK9A 1J5EF 4B9NA 5J1PA 4NWBA 2VG6A 2YX7A 4ZP6A 4CTAB 3DDKA 2XBPA 1HBNA 3AA9A 2LCWA 4NA1A 5JXSA 4ZK7M 2UXDF 2RF2B 3LANA 4LMZA 2AD9A 1RT3B 4J9NA 4EZ9A 1MMDA 3PO5A 1Q7YT 2WB4A 1U4BA 2IJFA 4OZJA 2BQ3A 2V9WA 2O5DA 4EAAA 3NCPA 4MKBA 1CPZA 2V4JB 3J7YU 3DOKA 4DPOA 4EA9A 3M9MB 5M2RA 4AC3A 4FNIA 2B9YA 2B56A 4CT8A 1SSMA 2BRKA 4JI2F 2MGZB 1FKAF 2KXNB 3X3UA 5D4PA 4ZPBA 2G4BA 2V2KA 2RB7A 3FSCA 2RSQA 1VQSA 3NCRA 1KK6A 4FVMA 1YG0A 4C0HA 4NLSA 2ICXA 1MWYA 2J7KA 2M0GB 4KQLA 1UEVA 3OUPA 1XMOF 5LXYA 3OW2R 2N4CA 1VK3A 2PA3A 2P9EA 2HLTA 2RU9A