3FT7A

Crystal structure of an extremely stable dimeric protein from sulfolobus islandicus
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
45
structure length
45
Chain Sequence
LNGIKLGVYIPQEWHDRLMEIAKEKNLTLSDVCRLAIKEYLDNHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Stability Analysis of an Extremely Stable Dimeric DNA Binding Protein from Sulfolobus islandicus
pubmed doi rcsb
source organism Sulfolobus islandicus
molecule tags Dna binding protein
molecule keywords Uncharacterized protein ORF56
total genus 13
structure length 45
sequence length 45
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3ft7A00
1B01A 3LGHA 1BDTA 4FXEA 1ARQA 2K9IA 2CA9A 2RBFA 2BJ9A 3FT7A 3VW4A 2BA3A 2H1OE 2HZAA 2K5JA 4D8JA 3H87C 2CPGA 2WVBA 2K1OA 2K6LA 3QOQA 2BNZA 2BSQE 1BAZA 2JXHA 1ARRA 1P94A 2AY0A 2BJ3A 2K29A 1IRQA 2WVCA 3OD2A 4HV0A 1PARA 2BNWA 4ME7E 1QTGA 2JXGA 2GPEA 2KELA 2CADA 1EA4A 2WVDA 2BJ1A 2BJ7A 1Q5VA 2JXIA 2CAXA 3GXQA 2HZVA 1NLAA 2WVFA 3VEAA 2WVEA 1MYKA 3VEBA 1BDVA 1X93A 2BJ8A 3FMTA 1U9PA 1MNTA 1MYLA 1B28A 2CAJA
chains in the Genus database with same CATH superfamily
4FXEA 1SH0A 2CA9A 3SFGA 2RBFA 1Q16A 4LQ3A 3H5YA 3H5XA 2CPGA 2WVBA 2KOEA 1P94A 1U9PA 3IR7A 2WK4A 2UUWA 4ME7E 2JXGA 3UR0A 2CADA 4QPXA 2BJ1A 2KKEA 2B43A 3GXQA 2CAXA 3VEAA 1BDVA 1MYLA 1B01A 3LGHA 1BDTA 1ARQA 4LRVA 4LQ9A 3FT7A 2BA3A 2AN7A 2K1OA 2K6LA 3UPFA 3QOQA 2BSQE 2K29A 2BJ3A 3LJPA 2WVCA 3NO7A 2UUTA 1PARA 4HV0A 1QTGA 1SH3A 2JXIA 2HZVA 2WVFA 3NAHA 3BSNA 3NNEA 1MNTA 1B28A 2K9IA 3VW4A 2BJ9A 2HZAA 2K5JA 4D8JA 1OHNA 1SIWA 2BNZA 1BAZA 3SFUA 3OD2A 3BSOA 3G5OA 3UQSA 1EA4A 2WVDA 2BJ7A 2A2BA 1NLAA 4MJWA 1X93A 2BJ8A 2JBVA 2CKWA 3FMTA 1OG7A 3NAIA 4O4RA 2H1OE 3H87C 1SH2A 2JXHA 1ARRA 2AY0A 1IRQA 2BNWA 2GPEA 2KELA 4NRTA 4NRUA 1Q5VA 2ADLA 2Q2KA 2WVEA 1MYKA 3VEBA 2H3AA 3QIDA 4AAIA 2CAJA
chains in the Genus database with same CATH topology
1B01A 3LGHA 1BDTA 4FXEA 1ARQA 2K9IA 2CA9A 2RBFA 2BJ9A 3FT7A 3VW4A 2BA3A 2H1OE 2HZAA 2K5JA 4D8JA 3H87C 2CPGA 2WVBA 2K1OA 2K6LA 3QOQA 2BNZA 2BSQE 1BAZA 2JXHA 1ARRA 1P94A 2AY0A 2BJ3A 2K29A 1IRQA 2WVCA 3OD2A 4HV0A 1PARA 2BNWA 4ME7E 1QTGA 2JXGA 2GPEA 2KELA 2CADA 1EA4A 2WVDA 2BJ1A 2BJ7A 1Q5VA 2JXIA 2CAXA 3GXQA 2HZVA 1NLAA 2WVFA 3VEAA 2WVEA 1MYKA 3VEBA 1BDVA 1X93A 2BJ8A 3FMTA 1U9PA 1MNTA 1MYLA 1B28A 2CAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B01 A;  3LGH A;  1BDT A;  4FXE A;  1ARQ A;  2K9I A;  2CA9 A;  2RBF A;  2BJ9 A;  3FT7 A;  3VW4 A;  2BA3 A;  2H1O E;  2HZA A;  2K5J A;  4D8J A;  3H87 C;  2CPG A;  2WVB A;  2K1O A;  2K6L A;  3QOQ A;  2BNZ A;  2BSQ E;  1BAZ A;  2JXH A;  1ARR A;  1P94 A;  2AY0 A;  2BJ3 A;  2K29 A;  1IRQ A;  2WVC A;  3OD2 A;  4HV0 A;  1PAR A;  2BNW A;  4ME7 E;  1QTG A;  2JXG A;  2GPE A;  2KEL A;  2CAD A;  1EA4 A;  2WVD A;  2BJ1 A;  2BJ7 A;  1Q5V A;  2JXI A;  2CAX A;  3GXQ A;  2HZV A;  1NLA A;  2WVF A;  3VEA A;  2WVE A;  1MYK A;  3VEB A;  1BDV A;  1X93 A;  2BJ8 A;  3FMT A;  1U9P A;  1MNT A;  1MYL A;  1B28 A;  2CAJ A; 
#chains in the Genus database with same CATH topology
 4FXE A;  1SH0 A;  2CA9 A;  3SFG A;  2RBF A;  1Q16 A;  4LQ3 A;  3H5Y A;  3H5X A;  2CPG A;  2WVB A;  2KOE A;  1P94 A;  1U9P A;  3IR7 A;  2WK4 A;  2UUW A;  4ME7 E;  2JXG A;  3UR0 A;  2CAD A;  4QPX A;  2BJ1 A;  2KKE A;  2B43 A;  3GXQ A;  2CAX A;  3VEA A;  1BDV A;  1MYL A;  1B01 A;  3LGH A;  1BDT A;  1ARQ A;  4LRV A;  4LQ9 A;  3FT7 A;  2BA3 A;  2AN7 A;  2K1O A;  2K6L A;  3UPF A;  3QOQ A;  2BSQ E;  2K29 A;  2BJ3 A;  3LJP A;  2WVC A;  3NO7 A;  2UUT A;  1PAR A;  4HV0 A;  1QTG A;  1SH3 A;  2JXI A;  2HZV A;  2WVF A;  3NAH A;  3BSN A;  3NNE A;  1MNT A;  1B28 A;  2K9I A;  3VW4 A;  2BJ9 A;  2HZA A;  2K5J A;  4D8J A;  1OHN A;  1SIW A;  2BNZ A;  1BAZ A;  3SFU A;  3OD2 A;  3BSO A;  3G5O A;  3UQS A;  1EA4 A;  2WVD A;  2BJ7 A;  2A2B A;  1NLA A;  4MJW A;  1X93 A;  2BJ8 A;  2JBV A;  2CKW A;  3FMT A;  1OG7 A;  3NAI A;  4O4R A;  2H1O E;  3H87 C;  1SH2 A;  2JXH A;  1ARR A;  2AY0 A;  1IRQ A;  2BNW A;  2GPE A;  2KEL A;  4NRT A;  4NRU A;  1Q5V A;  2ADL A;  2Q2K A;  2WVE A;  1MYK A;  3VEB A;  2H3A A;  3QID A;  4AAI A;  2CAJ A; 
#chains in the Genus database with same CATH homology
 1B01 A;  3LGH A;  1BDT A;  4FXE A;  1ARQ A;  2K9I A;  2CA9 A;  2RBF A;  2BJ9 A;  3FT7 A;  3VW4 A;  2BA3 A;  2H1O E;  2HZA A;  2K5J A;  4D8J A;  3H87 C;  2CPG A;  2WVB A;  2K1O A;  2K6L A;  3QOQ A;  2BNZ A;  2BSQ E;  1BAZ A;  2JXH A;  1ARR A;  1P94 A;  2AY0 A;  2BJ3 A;  2K29 A;  1IRQ A;  2WVC A;  3OD2 A;  4HV0 A;  1PAR A;  2BNW A;  4ME7 E;  1QTG A;  2JXG A;  2GPE A;  2KEL A;  2CAD A;  1EA4 A;  2WVD A;  2BJ1 A;  2BJ7 A;  1Q5V A;  2JXI A;  2CAX A;  3GXQ A;  2HZV A;  1NLA A;  2WVF A;  3VEA A;  2WVE A;  1MYK A;  3VEB A;  1BDV A;  1X93 A;  2BJ8 A;  3FMT A;  1U9P A;  1MNT A;  1MYL A;  1B28 A;  2CAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...