3FT7A

Crystal structure of an extremely stable dimeric protein from sulfolobus islandicus
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
45
structure length
45
Chain Sequence
LNGIKLGVYIPQEWHDRLMEIAKEKNLTLSDVCRLAIKEYLDNHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Stability Analysis of an Extremely Stable Dimeric DNA Binding Protein from Sulfolobus islandicus
pubmed doi rcsb
source organism Sulfolobus islandicus
molecule tags Dna binding protein
molecule keywords Uncharacterized protein ORF56
total genus 13
structure length 45
sequence length 45
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3ft7A00
1MYLA 2WVDA 1MYKA 1NLAA 3FMTA 3VW4A 2BNZA 1ARQA 2WVEA 2CADA 3VEBA 2RBFA 2BJ3A 1P94A 2BA3A 1QTGA 2JXGA 2K5JA 4HV0A 3VEAA 3QOQA 3GXQA 1ARRA 2CAJA 2K1OA 1PARA 2CAXA 4FXEA 2AY0A 1X93A 2HZAA 2WVCA 2BJ7A 3LGHA 1BDVA 2CA9A 2K6LA 3H87C 1BDTA 2WVBA 1Q5VA 2BJ8A 4ME7E 2H1OE 1B28A 2JXIA 2BJ9A 2CPGA 2WVFA 1EA4A 2KELA 3OD2A 1IRQA 1U9PA 2BJ1A 2JXHA 2BNWA 2BSQE 2GPEA 1BAZA 4D8JA 2K9IA 1MNTA 1B01A 3FT7A 2HZVA 2K29A
chains in the Genus database with same CATH superfamily
1MYKA 2BNZA 4AAIA 3IR7A 4LQ3A 2RBFA 3BSOA 4QPXA 2JXGA 1OG7A 1ARRA 1PARA 2CAXA 2HZAA 2BJ7A 2WK4A 2K6LA 1BDTA 2WVBA 3SFUA 1SH0A 2WVFA 2GPEA 1BAZA 4LRVA 3NAIA 3FT7A 1SIWA 2K29A 3NO7A 2AN7A 2WVDA 3FMTA 1ARQA 1SH3A 3VEBA 2BJ3A 1P94A 2BA3A 3UQSA 3GXQA 4FXEA 2CA9A 2CKWA 2BJ8A 2JBVA 4ME7E 1B28A 4MJWA 2JXIA 2JXHA 2BNWA 4D8JA 1Q16A 3NNEA 2KOEA 1NLAA 3H5XA 2WVEA 3UPFA 3H5YA 1QTGA 2CAJA 2K1OA 3LJPA 2KKEA 3QIDA 2B43A 2A2BA 1BDVA 1OHNA 3H87C 3NAHA 2H1OE 2BJ9A 2CPGA 4NRTA 2KELA 1IRQA 2BSQE 2H3AA 1B01A 1MYLA 3VW4A 2UUWA 2CADA 3UR0A 2K5JA 3VEAA 2UUTA 3G5OA 4HV0A 2ADLA 3QOQA 2AY0A 1X93A 2WVCA 3LGHA 1SH2A 1Q5VA 3SFGA 4NRUA 1EA4A 3OD2A 1U9PA 2BJ1A 4LQ9A 2Q2KA 3BSNA 2K9IA 1MNTA 2HZVA 4O4RA
chains in the Genus database with same CATH topology
1MYLA 2WVDA 1MYKA 1NLAA 3FMTA 3VW4A 2BNZA 1ARQA 2WVEA 2CADA 3VEBA 2RBFA 2BJ3A 1P94A 2BA3A 1QTGA 2JXGA 2K5JA 4HV0A 3VEAA 3QOQA 3GXQA 1ARRA 2CAJA 2K1OA 1PARA 2CAXA 4FXEA 2AY0A 1X93A 2HZAA 2WVCA 2BJ7A 3LGHA 1BDVA 2CA9A 2K6LA 3H87C 1BDTA 2WVBA 1Q5VA 2BJ8A 4ME7E 2H1OE 1B28A 2JXIA 2BJ9A 2CPGA 2WVFA 1EA4A 2KELA 3OD2A 1IRQA 1U9PA 2BJ1A 2JXHA 2BNWA 2BSQE 2GPEA 1BAZA 4D8JA 2K9IA 1MNTA 1B01A 3FT7A 2HZVA 2K29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MYL A;  2WVD A;  1MYK A;  1NLA A;  3FMT A;  3VW4 A;  2BNZ A;  1ARQ A;  2WVE A;  2CAD A;  3VEB A;  2RBF A;  2BJ3 A;  1P94 A;  2BA3 A;  1QTG A;  2JXG A;  2K5J A;  4HV0 A;  3VEA A;  3QOQ A;  3GXQ A;  1ARR A;  2CAJ A;  2K1O A;  1PAR A;  2CAX A;  4FXE A;  2AY0 A;  1X93 A;  2HZA A;  2WVC A;  2BJ7 A;  3LGH A;  1BDV A;  2CA9 A;  2K6L A;  3H87 C;  1BDT A;  2WVB A;  1Q5V A;  2BJ8 A;  4ME7 E;  2H1O E;  1B28 A;  2JXI A;  2BJ9 A;  2CPG A;  2WVF A;  1EA4 A;  2KEL A;  3OD2 A;  1IRQ A;  1U9P A;  2BJ1 A;  2JXH A;  2BNW A;  2BSQ E;  2GPE A;  1BAZ A;  4D8J A;  2K9I A;  1MNT A;  1B01 A;  3FT7 A;  2HZV A;  2K29 A; 
#chains in the Genus database with same CATH topology
 1MYK A;  2BNZ A;  4AAI A;  3IR7 A;  4LQ3 A;  2RBF A;  3BSO A;  4QPX A;  2JXG A;  1OG7 A;  1ARR A;  1PAR A;  2CAX A;  2HZA A;  2BJ7 A;  2WK4 A;  2K6L A;  1BDT A;  2WVB A;  3SFU A;  1SH0 A;  2WVF A;  2GPE A;  1BAZ A;  4LRV A;  3NAI A;  3FT7 A;  1SIW A;  2K29 A;  3NO7 A;  2AN7 A;  2WVD A;  3FMT A;  1ARQ A;  1SH3 A;  3VEB A;  2BJ3 A;  1P94 A;  2BA3 A;  3UQS A;  3GXQ A;  4FXE A;  2CA9 A;  2CKW A;  2BJ8 A;  2JBV A;  4ME7 E;  1B28 A;  4MJW A;  2JXI A;  2JXH A;  2BNW A;  4D8J A;  1Q16 A;  3NNE A;  2KOE A;  1NLA A;  3H5X A;  2WVE A;  3UPF A;  3H5Y A;  1QTG A;  2CAJ A;  2K1O A;  3LJP A;  2KKE A;  3QID A;  2B43 A;  2A2B A;  1BDV A;  1OHN A;  3H87 C;  3NAH A;  2H1O E;  2BJ9 A;  2CPG A;  4NRT A;  2KEL A;  1IRQ A;  2BSQ E;  2H3A A;  1B01 A;  1MYL A;  3VW4 A;  2UUW A;  2CAD A;  3UR0 A;  2K5J A;  3VEA A;  2UUT A;  3G5O A;  4HV0 A;  2ADL A;  3QOQ A;  2AY0 A;  1X93 A;  2WVC A;  3LGH A;  1SH2 A;  1Q5V A;  3SFG A;  4NRU A;  1EA4 A;  3OD2 A;  1U9P A;  2BJ1 A;  4LQ9 A;  2Q2K A;  3BSN A;  2K9I A;  1MNT A;  2HZV A;  4O4R A; 
#chains in the Genus database with same CATH homology
 1MYL A;  2WVD A;  1MYK A;  1NLA A;  3FMT A;  3VW4 A;  2BNZ A;  1ARQ A;  2WVE A;  2CAD A;  3VEB A;  2RBF A;  2BJ3 A;  1P94 A;  2BA3 A;  1QTG A;  2JXG A;  2K5J A;  4HV0 A;  3VEA A;  3QOQ A;  3GXQ A;  1ARR A;  2CAJ A;  2K1O A;  1PAR A;  2CAX A;  4FXE A;  2AY0 A;  1X93 A;  2HZA A;  2WVC A;  2BJ7 A;  3LGH A;  1BDV A;  2CA9 A;  2K6L A;  3H87 C;  1BDT A;  2WVB A;  1Q5V A;  2BJ8 A;  4ME7 E;  2H1O E;  1B28 A;  2JXI A;  2BJ9 A;  2CPG A;  2WVF A;  1EA4 A;  2KEL A;  3OD2 A;  1IRQ A;  1U9P A;  2BJ1 A;  2JXH A;  2BNW A;  2BSQ E;  2GPE A;  1BAZ A;  4D8J A;  2K9I A;  1MNT A;  1B01 A;  3FT7 A;  2HZV A;  2K29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...