3FTGB

Crystal structure of h2db in complex with np366-n3a variant peptide from influenza
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
100
structure length
100
Chain Sequence
b'MIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Protective efficacy of cross-reactive CD8+ T cells recognising mutant viral epitopes depends on peptide-MHC-I structural interactions and T cell activation threshold.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 13
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ftgB00
5GGTL 3V8OA 3ULUC 2VUOA 1DQMH 3OXSA 4U1HA 5EOQL 2VB5A 3T0BA 2ZJSL 4WUUA 4XNZC 4R0LB 5GIRB 3UTQA 1G0YR 3ZYIA 1D5XA 2GI7A 3CDCA 4JM2A 1DBKH 3QYCA 1GIGH 5LGHL 1MF2L 3SN6N 4IJ3B 5DJAA 4P99A 3ZE1E 2IJ0C 3RA7L 3T4AA 3AAZB 4I2XB 3BPOC 1NCWL 4FFYH 3OB0K 1ONQB 2Q3AA 4OGAC 2DQEH 4N9GB 1WT5A 4FQIH 4JQXA 1QEWA 5A40E 3OG4B 5D1ZA 4FQCL 4JPWH 4YO0B 4ZS7L 2R8SL 4ZS6C 4PG9B 1QG3A 1NGQL 2UZIH 3QDHA 2AJYH 3GI9H 1RZFH 5KSAA 2IBZY 1VPOH 2FGZA 4Z7UB 4P23D 1JN6B 5CEZH 2KDGA 4KI5E 4U1IB 1S7XA 1NPUA 1NGPL 1JCKA 3MRBA 3MV01 4R2GB 1EHXA 1K85A 2E7LA 4J3OC 4Q6YA 5HYJA 1C16A 2GEEA 2Z93B 1HH9A 1R6VA 4HPYH 5B38B 1R0AL 5EFIA 4C56A 3RVVC 4PJHA 3GSNB 2YK1H 5IHLB 3GB7B 3O6MH 1MQ8A 2HMIC 4L29A 1FZKA 4JHZA 1TJGH 5LBSH 4O02H 3K80A 5EO9A 1TVDA 2Z8WC 4P4RB 3T65B 5L6YL 3MOBL 4RA0C 4XT1C 5B8CB 3UZQA 3BPNC 1ZLUK 1U41A 1IEHA 2H2SC 4LOUD 1RJLA 1OB1A 4PRBA 2NY6D 2Z31D 4M6OL 1AD0A 4OUUA 4X6BB 5JHDA 1K6QH 2WINA 4L5FL 2IWGA 4GRWE 4X7FC 3P9LB 4G3YL 3BGFB 3FN0L 2FJGB 1IC4L 4UQ2B 4PLOB 4X5WA 3DX7B 4E5XB 2ZCHL 5DRWA 1YEIL 2XZQH 4LCIL 2LV4A 3VG9B 1VCAA 4WFHD 4Z8FH 1UKSA 4JJHA 3BE1L 4MNHA 1BAFH 1A3LL 3RIAK 1QP1A 3MMEA 5BS0E 1J11A 4YHKH 4LU5H 5EOTA 1CE1L 4JFEB 4C55A 4KUZL 3TWCL 3SBWA 2WLYA 3IGAA 5D1QD 3U0PA 3VXOA 3T0EA 5I1HL 5JOPD 1P4IL 2WBJB 4KPHL 4MXVF 1W0WA 1ZOXA 2NY5H 4U7KA 5C0IA 1B0GA 4D94A 1HQ4A 4G9DB 4ALAH 1P1ZB 5C0RL 4PJ9B 4P4KC 1ZVSB 2YXMA 4LCUA 4HH9B 4MQXD 3WS3A 1NFIB 3HUJB 1QKZL 3MV7A 4LEOB 4NC0B 3PJSA 3DSFL 3MA7B 5ALBL 4O00A 1ZLSH 4EJ1C 2A6DA 2X09A 4H26A 1T6WA 1HN1A 1FYTE 2VDML 5HDBF 2OJEA 1ND0A 1CK0L 2XY1A 2VQ1A 5CS7A 3ZL4H 1A1NA 3LD8B 4TPRH 4PRPD 3WIIH 5IMKB 3HAEH 4M7LH 3PWNA 3X17A 5IB1B 4J4PD 1OF2A 3CVIH 3EOYG 1NDMA 4K7PY 2VL5A 3WE6A 1MJ7L 4HWUA 1NCBH 2IH1A 3RL2A 1T21A 1RUQH 2BY0A 5IHBA 3UDWA 1AH1A 4U1HB 3OXSB 5TE6L 2D31A 4NQCA 1EUUA 3KPOA 2DF3A 2CRIA 4WUUB 3UTQB 3KPRE 4OF5A 2BY1A 1D5XB 2Z4QA 3CFCH 4JM2B 2Y25A 4WFEE 2I9LA 1YEJL 5DJAB 2VR9A 2CLZA 5C0CE 1YECL 2JJSA 3GMLA 4LDEB 3T4AB 1VFBB 1MJUL 5GJSH 3IKCA 1YNKH 3OKEA 5DLMH 3BKYL 4AL8H 5IB3B 3BDXA 2VITA 1OHQA 3ZKMC 4WHCA 3S96A 3NCMA 1MQKL 3AB0C 2JJTC 1QEWB 5D1ZB 4Z7VF 3O6LL 1F6AA 3DUHA 1GC1H 3W9DA 5KSAB 4OBSA 3BEVA 3LZFL 3W5NA 5IBLC 4X9GA 1KJMA 1OGAA 2H2PC 1S7XB 1INDH 4N5ED 3MRBB 1FE8L 4PLJD 4CGTA 2CDFA 3VD7A 4M61A 1FORH 1CL7H 3BPCA 4UBDD 2A83A 1EV2E 2WWKO 4FXKA 4ERSH 5HYJB 5IJKC 1C16B 3BUYA 1HH9B 1A6UH 4C56B 1WGOA 4MYWB 2PXYA 2HFFA 4PJHB 5BXFA 4IRSC 1N0XH 5HTSA 4L29B 1FZKB 3EZJB 1FZMA 3BN3B 4QHNA 5EO9B 2QQQA 5FHBL 1X44A 1G9NC 2R4RH 1YQVH 3S98A 1M05A 2BRQA 4OKVA 4LSUL 2H8PA 4M7JL 1OB1B 4PRBB 1U8LA 4NQUA 3BX7C 1X5IA 2AXGB 1AD0B 4OUUB 2XTLA 5JHDB 2Q8BL 1XH3A 2WINB 2P5WA 3V6BR 4XPTL 1J8HE 4FQPA 5D9SA 3ULSA 1U2CA 5ADPH 4G5ZH 2AI0L 3EYQC 5HHPA 5K9JH 1WZLA 2XTJB 4K7PL 1A7NH 4X5WB 2RAMA 1RZKC 2PETA 3OXRA 5GGQH 3HS0A 3V95A 5I1EH 3PQYA 1UM4H 1RZGB 1DQLL 5DRWB 3K2UL 2X9WA 2NY3C 3WO3B 4MNHB 3UJIH 3LH2H 3MMEB 1UC6A 4S2SA 2M8XA 5F1IA 4BQ6A 2HRPL 4JVWA 5BMFH 5EOTB 5IM7A 5DR5L 1G7LA 3U0PB 3IGAB 3FT4A 2R2HA 3VXOB 3EJZC 4PG2A 3T0EB 3BYYA 4F80A 1W0WB 3VI4F 2EDHA 5ISZA 2YN3A 1OLLA 5C0IB 1RULL 1HQ4B 1AXTH 2B5IC 3CD4A 3EYOA 4TQEH 1OM3H 5B38G 7FABH 1UCBL 1U58A 5FOBA 3QIUD 4LCUB 3WS3B 1FRGL 5TDNA 3VXMD 3MV7B 4MJ2A 5C08A 43C9A 1N7MH 3PJSB 3I2CH 3ZKQD 5FDWA 3MLWH 5MEPB 5ANMA 3P0YH 4O2CB 2A6DB 3TT1H 4EQ2A 4H26B 3KLHD 3WFHA 1V3JA 2ZUTA 2OJEB 1ND0B 2VQ1B 1A1NB 3VWKA 3PWNB 5B22A 4LCCC 3EYFA 1OF2B 5KVEL 1NDMB 4HIXL 2VL5B 5SWSE 3WE6B 4LSTL 1CLYL 2IH1B 1GSMA 3RL2B 5HVHB 3GI8L 1AKJA 1T21B 3WJLC 3PP3K 1A5FL 3VMNA 2D31B 4NQCB 3KPOB 2FX9L 2Z4QB 4RISL 4QRTA 5B3NA 2I9LB 4GRLC 2D3VA 4FQXC 4TVPE 3QZWB 4EN3D 4JG1H 2CLZB 4XPGL 4OI7A 1A6VH 2IAND 3GMLB 3QQ3A 4I0PA 1F4XH 1KLFA 5FA4A 3IKCB 3OKEB 5C7XL 2VITB 3FRUA 4FZEH 1HNGA 3OZ9H 3NTCL 3S96B 5GS0C 5HI3D 3PWJA 1UEYA 4XPFL 3DRQB 2UYLA 1F6AB 3QXTA 3AMLA 3W9DB 4TTGA 2DQGL 4QOKA 3BEVB 1ZTXH 3N1GC 4PP1C 1YY9D 2JIXA 2APXA 3L3OA 3BN9C 1BZQK 5FUOH 1KJMB 1OGAB 5GRVL 2BFVL 2AERT 4GJTB 2CDFB 4URTB 4FP8H 3TJEL 4M61B 1IAKA 1PG7W 2ESVA 1QR4A 3BPCB 1B4JL 2A83B 3ARBA 1KPRB 4FXKB 3BUYB 4MXVE 2EEAA 4FZ8L 2PXYB 2HFFB 5BXFB 3RX7A 3H7BA 2JJVA 1FZMB 5HPOA 4QHNB 3U4AA 4JDZA 5E7FA 4YPJA 3K1KC 1M05B 2YRPA 5GGRA 3FQWA 4OKVB 3NCJH 4OI9A 4UV7L 5A2LH 2LABA 4KVNL 2H8PB 2CIKA 1NBVL 1WICA 2BNQA 2VZTA 3SE8L 4NO2A 4NNPL 1MCJA 3OF6D 1ED3A 1U8LB 2DQHL 1IKFL 5IUSA 2R23A 1G7PA 1X5KA 4JFOA 1XH3B 5HYQA 4IRJC 2P5WB 5A3ID 5HDBE 5D9SB 3ULSB 3V4VH 3QXDA 3O45A 5F1KC 5HHPB 3UX9B 4I18C 4HMDA 1MJJB 1P4BL 4YH6A 2RBLA 3OXRB 3HS0B 2AJXH 3PQYB 2Z91B 5E08L 1IAOA 1KCLA 3WDJA 5F7FA 4RGNE 4PBXA 1CGSH 5F1IB 3CSGA 3L3KA 2NW3A 1RURL 5IM7B 4FXGA 2NYYC 1ZVHA 3DWTA 1CD8A 1U42A 1VERA 4GFTB 5EBLA 5ETUA 4KRPC 1E4XH 1G7LB 1VDGA 1EH9A 3FT4B 2R2HB 5E7BA 1RVFL 4IIQA 3PABA 3VXQB 2L7JA 5C09E 4BQ8A 4LDOB 5ISZB 3VJ6A 4DGIH 2XXCB 2MKLC 5CIPH 3IFNL 3EYOB 2Q1EA 1Q38A 3VXSA 1U8NA 1U58B 5FOBB 5JQ6H 4XTRC 5TDNB 4J3UA 3VXPA 1KN4H 5C08B 43C9B 4Y5XB 5FDWB 4YXKH 4QWWC 5ANMB 2DM2A 5GRJL 2A74A 3RWDA 2YC1A 4JO4L 1S9WA 4YDVA 3VWKB 3Q1SH 3TA3A 3VXUE 4NDMA 3EYFB 1UT9A 4UNTA 3O2DH 4J6RH 4QRPA 2EXYD 2AK1H 2HFGH 1S5IL 3M8OL 3PWPA 4FFVD 3L5HA 2VXVL 3LPWA 3O4LD 4YX2H 1DP0A 1AKJB 3MLTA 4FG6C 4F7PA 5KVGL 1RIHL 5GGVL 2IMNA 5F9OL 3S35L 4QRTB 2AEPL 4GW1A 1OAYL 3SGDI 1EVUA 3ROOA 5EU6D 5D5MA 4JKPH 2GJ6E 2H9GA 4YDKL 5H35A 1V7ML 3HZYA 4OIIL 1P4LA 4CVWA 4AEEA 3KLDA 4TSBL 5GRYA 3RUGF 3GBNH 1YN7A 3P30H 3QQ3B 4I0PB 2YA1A 1UZ8B 4MMZC 1J5OH 1DLHA 2B2XL 3FRUB 3PWJB 1OQXA 3AVEA 1BIHA 4LP5A 2VDKH 3GHBH 2UYLB 5E1HB 3CLEL 5FHAH 4MB3A 4EDWL 4QOKB 4QLRA 4XNYL 1I8KA 3GK8L 3HI6H 2JIXB 3DUUA 3L3OB 3MYZA 2QSCL 5EZIH 4M48L 5KAQG 1F5WA 2WBWB 1TJHL 4M9OA 1JUFA 1IAKB 2ESVB 2VDRH 3DRTA 4X4ME 4JFED 2QL1A 3ARBB 1CLOH 4L8DA 4S0TD 5DVMA 2W9DL 3LEXA 4AEIL 4WIQA 5IT2H 2X4RA 4GG8A 3VI4E 5DK2A 4QT5A 5J1TC 3H7BB 1TDQA 2AEQL 4NC1C 5HPMA 4XGZA 3RY5A 1QSVA 1UWEL 4JDZB 1NFDF 4Y4FA 2AK4A 3RKPA 4Q6IC 3H9HA 3FQWB 5GGRB 1AGEA 4OZGA 4K8RC 1T7ZA 3PGCA 4PJ9D 2BNQB 4NO2B 4MQTB 5DVLA 4TOYL 2AJSH 2YKLL 4MAYC 3LKQA 3MC0A 2R23B 1G7PB 4YBQC 4JFOB 5HYQB 3KYNA 3C8HA 3QXDB 3O45B 4MNQA 4OCNC 4Q9CA 5D7IA 3SQOL 4WO4C 3VFGH 4OLYH 3SCMC 3QZWG 1KULA 1YNLL 2PO6A 4PGDA 2QQLH 1IAOB 2YZ8A 3DXAA 5JA9A 4GKOA 3BMVA 3QWQB 4HXAL 1QSEA 2FB4L 1ZMYA 5DI8A 4YXHH 4HUVA 3L3KB 3UTSE 3MLYL 2NW3B 2QHRH 4FXGB 4BH7A 5HSFA 4WUUD 4LVNB 5EBLB 2A1WH 3GBLA 3TEUA 5ETUB 4JM2D 3VFUA 4W6XB 2PYEE 5CMAA 5E9DD 1MVUA 3PABB 1DLFH 4UIKL 2LAGB 3EHBD 3VJ6B 1K3ZA 3X3FH 1MIML 3GMNB 4UTAH 1L9NA 4ORZC 1FL3A 3RJQB 2ED8A 4DTGH 5JMRA 3VXSB 1ZA3A 5JIIA 5AYQA 1U8NB 3IFLL 1J1XL 5DJCA 4P9HC 5D1ZD 2CIIA 4G6JL 4HKJA 4JRYA 5GHWH 5H2BA 5C3LD 3VXPB 1CICD 1XR8A 3G5YA 5FB8A 5KSAD 1MCBA 4AIOA 2F5AL 3P0GB 1A7OH 2A74B 3RWDB 2CXGA 2YC1B 4HZAA 3UC0H 4DZ8A 4R8WL 3EKCA 1S9WB 3WNNA 4YDVB 2QSTA 5FO8A 4K23L 3RU8H 2COQA 3TA3B 4NDMB 3MUZ1 1UXWA 4QRPB 4YGVA 4Y5YA 1IT9L 2IBGA 5DHVA 3HNTL 3PWPB 1IILE 4YUEH 1URLA 5SX4I 4PIRF 3MLTB 4F7PB 2VMFA 2VQTA 4LSVL 1FP5A 1I3VA 5DJ2A 2QQNH 5ADOL 5DUMH 5IK3A 5T5FL 4LCWA 3S34L 4FQ1L 1P7KA 3O2WH 2XWJA 4GW1B 4JFXA 3QDMD 3ROOB 3RWFA 5D5MB 5H35B 2H9GB 4MD4A 3ZSSA 3WIHA 1S9YA 1P4LB 5E2JA 1FNHA 1YN7B 3BJLA 4Y4KC 3W0WE 3O11A 4FQLL 5JHDD 4NCC1 4JFFB 1VFUA 4KVCL 1BREA 1FLTX 3I50H 4YHLL 3E0GA 2J6EL 3K8KA 3DVFA 1G6VK 4OB5H 2ZPKL 5C0ND 3ZSTA 5JUEL 4HLZG 5I1IH 4XWGH 5D1XA 4E9LA 2VZOA 5I1JL 3QXAA 5DUBB 5B4MC 3S4SA 4PGCA 1IAIH 1I8KB 5CKGA 4BFEA 3DUUB 1BQUA 2FZ3A 3GZKA 3V2AR 5FUZH 2AGJH 9CGTA 5HVFB 1JUFB 2BVUA 2X4QB 3ILPA 1P84J 1AO7E 3DRTB 5FYJH 4L8DB 3LEXB 2F19H 1IFHL 3DV6A 2HA1A 2X4RB 3DHMA 4GG8B 5HJ3B 5DK2B 4QT5B 3MXWL 3T0ED 4FS0A 1JPST 1T7WA 2WM0A 4KWUA 4X7SH 4XGZB 3N50A 2D4FA 5HPMB 3I84A 4Y4FB 3GKZA 2AK4B 3H9HB 1DQDL 1YMMA 1AGEB 3BFOA 2IGFH 5T1DL 3NFSH 4OZGB 4HUMB 3H7LA 4WEBL 1OCWL 3PGCB 4F7TA 1IGML 3IETA 1IJ9A 4TRPL 5INDA 3LKQB 4NM4L 5IESH 1R3IL 4NPYA 4PLKD 3U4EA 3KYNB 2BNRE 4TN9A 1KFAH 1T66C 5DD6A 5D7IB 4OJFL 1K8DA 2OLDA 4OD1H 3TO2A 3K0WA 2DQTL 4BK5A 4F3FA 1KB5L 3SGKA 3QG7H 2PO6B 3MSPA 2P47B 3WDHA 4PGDB 2I60L 4G8EA 1DN2A 2Y72A 3DXAB 5D7LE 3KYMA 3GM0A 5DYOA 3P4OA 4AQ1B 1ZLVK 2VXUL 4Q9RH 5DI8B 4HUVB 1PSKH 4P59L 1KTLA 4BH7B 3MJ8A 4L3EE 1I1AA 1QSFE 4WENB 2EH8H 1JPTH 4OLVL 1U8JA 3VFUB 1AGDA 1B6UA 5CMAB 3B2UD 3RUGE 2OR9H 1MVUB 5CCKH 2XNAA 5ITBH 4OF8A 5L2JA 2CKBH 5FEBA 4LRNL 1U8HA 1IQWH 1LP9A 1FL3B 4P2QE 3CXDH 2ITCA 5HBBA 1YYMH 5SWZE 1ZA3B 2OR7A 3K4ZA 2AJZA 5DJCB 1WSST 2CIIB 5D72H 5H2BB 4JRYB 4NHUA 3DARA 1XR8B 4LVOC 1RV6X 1KPUA 3G5YB 5FB8B 1OP3H 3MTRA 2DJUA 4DZ8B 5ESVA 4K94C 5FO8B 4Z95H 1UJ3A 3BI9X 3HB3C 1UXWB 4K3JL 4Y5YB 4G42A 1OW0C 5DHVB 2DM4A 5EU3A 5L9DL 2EIDA 2PXYD 5LXGL 3F5WB 1NFDE 5DJ2B 5C07A 3NH7H 1H3GA 3ULVD 5IK3B 1FNSL 1VACA 4LSPL 4LCWB 1F11A 1P7KB 2XWJB 4JFXB 3BT2H 3RWFB 5IQ9A 4ODWA 2NX5D 4MD4B 2R1WA 1S9YB 3Q5YA 4ODTH 1J1OH 3O11B 2P5WD 1PG7H 2KBGA 1LE5A 1Z9MA 3BEWA 1E4JA 2R9HD 4WU5A 5LJYH 4N90E 5D1XB 4G9FE 2FH8A 3QXAB 5LCVL 3S4SB 1YPZF 3GBML 3I6GA 2ZSWA 4FG6D 4PGCB 3L5JA 1T80A 2BVQA 2FZ3B 1INEL 1TJIH 5AD0A 3HMWH 1JI1A 3ILPB 3TVMD 4LLQA 1IAMA 3NA4A 4LSSH 5TFSH 3IU3A 4H1LH 4M7KH 1NBQA 5DEGA 4GQPH 3DV6B 2X1XR 4MAUH 3HMXA 3ARVA 4QRUA 2OTUA 2PTTA 3GFUA 3NFNA 1J7VR 1JBJA 3V5HA 5DQ9A 4F15C 2WAHA 5E2WH 5ISZD 3BMWA 3JUYA 2WUCL 1RUKL 1QVOA 1YMMB 3RDTC 1F42A 3U30B 2W0PA 3V6OA 4V2CB 1RMFH 4RWHA 3LQMA 4F7TB 3IETB 1EO8H 4TUKL 5INDB 3JWOC 3GSNL 5C0GA 1XF4A 2KL6A 4PLNC 4NPYB 4PJIA 5GRXG 3U4EB 3TYGL 3L3IA 5DD6B 1D5IH 1K8DB 5E70A 3TO2B 2QR0A 4OQTL 4AJ0A 4F3FB 3SKMA 4QTIL 3QAZC 1NUNB 2PW1A 5FECA 4G8EB 1Q8MA 3KGRA 2KZ1B 3HRPA 2XYCA 3KYMB 5HHOE 1N6UA 5DYOB 3P4OB 4L4VE 4P49A 5HYSB 1MFDL 1KTLB 3H6JA 3MJ8B 1I1AB 1A6AA 2X89A 2W0KA 4AMKH 3O3BA 1U8JB 3LN5A 1P9MC 1AGDB 12E8L 3QRFM 5MENA 2F54A 1BJ8A 4X6EA 1EPFA 5TH2A 4UTBH 1U8HB 4I0PD 1LP9B 3CH1A 4NC2B 4WI3A 2ITCB 2R0ZH 3SGEI 2VKXA 2ADIA 2JJUA 4KKAD 2AJZB 3IVKB 4MJ6A 1KEML 4NHUB 3KDMA 1KPUB 1GYAA 4ORGA 3MXVL 4CNIA 4QOKD 5CJ5A 1ADQH 3WJJA 4LASL 1YUHA 1IGIH 1S5HA 5E94A 5ESVB 1KCVL 1UJ3B 2Q87A 3FFCA 3OKKA 4LSQL 4C58B 35C8H 4OLZL 3ARBD 2HJFA 4G42B 4ZNEE 5EU3B 3QPQD 1C12A 3BP6A 3UPRA 5D2NA 2V17H 1T7YA 1OP5K 5C07B 3A6CH 4LKCA 1VACB 3HNSL 5JLZA 1F11B 4OD3H 4QXUL 4UT9L 3WUWA 2R69H 2UVFA 5CD5C 1E6JH 1PJ9A 5IQ9B 4ODWB 1FGVL 1IKNA 2R1WB 1FYHB 3GSWA 4M02A 1LWRA 3HG1A 3RWIA 4UT7H 1JZ2A 3QHFL 2YWYA 4XWOD 3V52L 1BVKA 1AFVH 2EYRA 1CGTA 4J3VA 5LVEA 4CUCA 1LE5B 5C0FA 5D8JL 3BEWB 1IGTA 2ZUSA 4WU5B 3S5LA 3RZCC 4X5LA 2N56A 4I1NB 1NANI 4GH7B 4PB9L 1YEFH 1OSPL 1F2QA 3OB0H 1CT8A 4I3SL 3I6GB 2ZSWB 2XFXA 5GSVB 4HJ0C 1RIUH 2BVQB 4XP5L 4MJIA 4N0RA 3VA2C 5AD0B 5DJ8A 3IDNA 3ARDD 1FN4A 4LLQB 5BO1L 1DBAH 3ECBA 3RAJL 4MVBC 3MR9A 3IU3B 3G6AA 4V1DD 1NCDL 3HAEG 4QRUB 2OTUB 2PTTB 3NFNB 43CAA 2OTPA 4JHAL 3V5HB 3S7GA 5DQ9B 1GAFL 1XGYL 4J3WA 2YWZA 1QVOB 5FGCE 1GH7A 4D9LL 2W0FA 4J1UA 4JY4A 3VXSD 5F7EL 5DD0L 4F8QA 5D2LA 5C0GB 3EIFA 1E4WH 3EDFA 4PJIB 4WFHE 3U9PL 3L3IB 1ZLUH 5ID0A 3SGJA 5SWQA 4DKEL 5GZND 2QR0B 4D0CA 1WWCA 2OCFD 3SKMB 3TA3D 2VDOH 3MCG1 5FECB 1LO0L 2BOCA 25C8H 2P8PB 5EUOF 4QRPD 2NZ9C 5FO9A 5JOPE 3PWPD 4KY1L 1RU9H 4GXUM 2A6JA 3IDJA 5HYIA 5DC0A 1ZT4A 2K7PA 4XMKH 1A6AB 3E8UL 1CD1B 3S4SG 3O3BB 3LN5B 3O9WA 5DGRA 4G7YH 5MENB 4BZ2L 2F54B 3WKMH 2P42B 4X6EB 3AROA 1PQZA 4N0CD 4M7ZC 3VGGA 5TH2B 1DBBL 3Q48A 4PJ8D 4JFFD 2QBWA 3CH1B 3IU4L 5MEQA 2ADIB 4PS4L 4PRPE 5CBAA 2QQKH 3V6FB 2EZ0C 1YPZE 3DMMC 1HZHH 4MJ6B 2DQJL 3WFBH 1CDBA 5CEZD 3HZVB 1AHWC 4D0DA 4ORGB 3TM6A 4U7MA 3CX2A 2O93L 2IFFH 3QI9A 5E94B 1YUHB 1S5HB 4KQ4L 3FOLA 2DDQH 3QCVL 4KGLA 4RFOH 2UY6A 3V7AG 1VFMA 3HKFA 3FFCB 3OKKB 3W81A 5JA8B 1KC5H 4UT6L 2HJFB 2EO1A 5FGRA 1JFQL 1C12B 1X4YA 3BP6B 1DANU 5D2NB 1DSFH 3B9AA 3UPRB 1H3WM 1MRFL 4LKCB 4Y4FD 5JLZB 1J0KA 3WUWB 2YPVH 4F57L 1AGCA 3MLRL 5I1GH 3HC4L 5E03A 3HN3A 1QBLL 4UINL 3GSWB 1V7NL 4KTEH 5I75C 3HG1B 5EG6C 3RWIB 5CAYB 3GJFK 5AYUH 1BQLL 1BVKB 2EYRB 3TT3H 3V5KA 3ZHKA 5C0FB 3VRIA 4I5BA 1IGTB 4Z7UF 2EDTA 4M1GH 3S5LB 3A0OA 4ZPTA 2BSRA 3QIBC 2E9JA 1CT8B 3WNKA 4RFNB 4P5TA 1TPXC 4ONGH 4S1QH 4U3XA 3EW3B 4HZLA 4R2GC 1M7XA 2QJDA 4MJIB 5DJ8B 3QNXA 3O41A 1KB9J 1OAXL 1T83C 4BUHA 1FN4B 1MFNA 3ECBB 5EWIL 3MR9B 3G6AB 4C59B 5HXMA 3ARQA 4TULH 1FNAA 43CAB 4M5ZH 1BFTA 2J88L 4K9EC 5B8CC 3BUTA 5BZDA 1KCKA 4N8VA 5MP6H 2X4UA 4C4KT 2W0FB 4POYA 2GJJA 4J1UB 4JY4B 4XP9L 4QXWA 3QUYA 3X3GL 5D2LB 4C54A 1F8TL 5T33H 5C6TH 5FYKU 5E99H 3ULVL 1BIIA 5I30H 1BBJB 1G9MH 3KAAA 2XN9A 4XNXL 5TF1H 4X4XA 5ID0B 5SWQB 1FC2D 5FKPB 5TGBA 4H20H 4D0CB 5DHXB 4QYOA 5DDHA 1D3CA 3QPXL 4P3DA 2GTWA 4NQVA 3BOVA 3EFDH 3RZWA 1NGYB 3AU1A 1NCAH 4KZDL 1O7SA 5FO9B 2L0DA 3O3AA 5FUCC 3WFDL 2R0LL 2ORBL 3D6GA 2AXHA 2A6JB 3IDJB 2AW2A 4DEPC 1ZT4B 2IBZX 5LQBH 4BFIA 4Y5VC 3HC3H 4OGXH 1N6QL 4KROB 3O9WB 2FX7H 2CKBA 3EYVA 3OV6A 2YD6A 2WBJC 4ODHH 3VXME 1PQZB 4NZUH 1A7RL 5I1CH 3C9NA 3HUJF 4HUWA 3K74B 5JW3L 2BVYA 4HD9A 4PRNA 3DROA 4MA1C 5MEQB 5BS0A 3QUZD 4HIIA 3UAJC 5CBAB 3UTZA 1E6OH 1HHGA 5EBGA 3CXHJ 1E28A 5D1XD 1Y6KR 5M95B 4HF5L 4D0DB 4WV1C 3QI9B 4APQC 5I15H 3FOLB 5I74B 1V8HA 2EXWC 2J5LB 5GGRY 4HIJB 1U92A 2VIRA 4JM2F 3FB5A 3BKCH 3UJJH 2IANE 5EO1A 4FNLL 3HZKA 3F8UB 3TN0A 1L7IL 3WO4B 5K59F 3BESR 2UZYB 3AUVA 3F7YA 5DHYA 1MPAH 4XMLL 4BQCA 1YEHH 3R1GL 4OF3A 3P4MA 3P11H 4RMUA 3PP3H 1QRKA 2N4IA 1JZ7A 3B4NA 1FVDA 2F8VA 1OTTC 1WT5C 3VRIB 4I5BB 5EZOH 4R97C 2JLLA 1HYSC 5EUOE 4ZPTB 2BSRB 1T0MA 5F6HJ 4ZUUB 5JTWA 1O7VA 4P5TB 2DQUH 1F4AA 5E4EB 1N5AA 4HZLB 5AZEH 3FOMA 1JTPA 3A6BH 3SDDD 3TO4A 1SEQL 3O41B 5CD5D 1VKXA 2DI7A 1LK2A 1I1AD 4Z7WA 5JW5A 3HRZA 1S7RA 1AC0A 2VZVA 4ZSOE 1WZ1H 1EERB 4HCRL 4OZ4A 4HUXA 1ZA6A 3F58L 4K7PX 1QACA 2YUWA 4CJ1A 5BZDB 4OF6A 4N8VB 2W9EH 3PUCA 5CJQH 5D93B 2X4UB 1DBML 5DJDB 4JVPA 4GT7A 3QUYB 5HHVL 2ARJA 4XB7A 2A2QT 1CLZL 3BDYL 2FWOA 1BIIB 2A38A 2VLJA 3S88H 2XN9B 3IDXL 2XTJC 4X4XB 3S3PA 5CD3A 1M4KA 5JW4R 3U0WH 2ENSA 5TGBB 4JRWA 4LK4A 3UTTA 1KN2H 4JQIL 4QYOB 5DDHB 4X98A 4GXVH 1OAKH 2GTWB 4O9HL 3MRRA 4NQVB 1IBGL 1OPGL 3AY4C 2P7TA 1HILA 1MJ8L 1TITA 3AU1B 3B2VL 3O3AB 4Y16A 4BQBA 2X4TA 5C07D 2AJUL 1J8HA 4GRWB 3WYRA 4BFIB 3B3IA 1R3KA 3JTTA 2X44D 4R90L 2CKBB 3EYVB 3WD5H 3MCKA 2FO1A 3DGCR 5J3HC 3C9NB 4HG4K 2V7NA 3QHZH 3FTGA 4HUWB 1G7IA 4PRNB 4KTDL 3DROB 2AS5M 5BS0B 4HIIB 5TPWH 5JZ7C 3DX9A 3UTZB 1HHGB 5E2VL 1ADQA 1E28B 5H8DA 1ZANL 3IXAB 3VD4A 2B39A 2NMSA 3O4LE 4MNGA 4XHJD 2DLFH 2UV3A 3ARED 4ZTOL 4L8CA 1A7BA 5L7XH 2XZAH 4X83A 4ZXBD 3IJYA 3BSZL 1RFDH 2CMRH 1HINL 2X10A 4LLWB 1U92B 2HKHH 5EU6E 3RI5F 2VIRB 3AGVA 1VSCA 4YE4L 2I5YH 3OTTA 2XRAL 3FB5B 5F9WB 1QLRA 3C08H 2BOBA 2FNBA 1YY8A 3ZKND 1D6VL 3D25A 4RA3A 5EO1B 3TN0B 3HZKB 4JPVH 2B4CL 3RVUC 3F7YB 5JPMA 5DHYB 3FRPA 3P4MB 3RTQA 4OLWH 2YMXH 2F8XC 3UZEA 1DQML 4KKCD 1NJ9A 1I75A 4Y4HA 1DBKL 1H15A 3WEXA 1HYRC 4YFLI 4DCQA 3BRGC 5KZCB 2F58H 5MI0C 1FVDB 1GIGL 5KS9F 1JE6A 4HKBA 4HWBA 4MWFA 2B0SH 4JFEE 4JG0H 4FFYL 4F9PA 1A7QH 2DQEL 4FQIL 3BW9A 4O2EA 1N5AB 4JPWL 3FOMB 1UA6H 2HJKB 1SYSA 3B9EA 3IFOB 4H1LB 2UZIL 3M45A 3PV6A 3TO4B 2AJYL 3GI9L 3N9GH 1RZFL 4UUJA 3ULVF 1VPOL 1VKXB 1LK2B 2DJSA 5GPRA 4J3SA 3VFTA 4Z7WB 5JW5B 5CEZL 3HRZB 1S7RB 2OMBA 3MX0A 3O3EA 5CHNA 3C6LA 4UAOC 5MEND 2FRGP 5DRXA 4OZ4B 4WCYH 3KYOA 4HUXB 4F9LA 5I18H 4MB5A 5D6CA 4OCWH 2GUOA 4HPYL 4W81A 1CDGA 1UM6H 3EBAA 2YK1L 3O6ML 1TJGL 2X42A 4O02L 5LBSL 2ARJB 1WWAX 1I8LC 4BFGA 2FWOB 4JANB 2VLJB 1G1CA 2YD4A 3BZ4A 5CD3B 5DVOA 3FAWA 5DK3A 1TVHA 3UTTB 1IMHC 5BJTA 4ZTPH 1I9JH 4HGMA 1K6QL 3IAPA 1UYWH 4X98B 4WUUE 3MRRB 4XC3H 2OZ4H 1FL6A 1TQBC 4TUJA 4DN3H 2P7TB 1HILB 1G0XA 2NLJA 1U2HA 5SV3A 1F4YH 1TZHA 5E9DE 4JZOA 1JV5A 5K59E 3LKRA 4Y16B 3PWUA 3SDCA 1HI6A 2XZQL 5L8JB 5T5NF 2D4DA 4Z8FL 3GSUA 4TSAH 1R3KB 5C9KA 3JTTB 1BAFL 4J7RA 4PG2C 1BFOA 4YHKL 5J89A 4LU5L 3ESUF 3MCKB 2IEPA 1IGCH 4XP6H 4KMQA 2XQYG 3DV4A 3SGDH 2V7NB 3FTGB 5C0BA 5EBMA 3QR2A 2YUZA 3MJGX 2BXZA 2WBKA 2NY5L 4X7TA 2YD3A 3DX9B 4ZMAT 3PWLB 1HWGB 5DFTA 4ALAL 4YLQT 4ZFOA 1XEDA 4HIEA 4MNGB 3P9MA 2VWEC 4AZ8A 4L8CB 3S35X 3VWKC 1PEWA 5C09A 1Q9LA 1FCCA 3IJYB 4LRIA 1SYVA 5F7DA 3D87B 1ZLSL 2NXYB 3QDME 4LQ1A 1TFHA 2HT4C 3G5VA 4YFEA 3ZL4L 4TPRL 3WIIL 5HVWA 4PJ7A 4M7LL 1QLRB 2HN7A 2BOBB 2NCMA 4YFLF 3CVIL 3D25B 3IYLW 5JHDE 3VH8A 4XPHH 1I9IH 5JPMB 4U6VH 1NCBL 4WWKD 1SJEA 3LS4H 3RTQB 5TE4H 1RUQL 5E5UB 4UNVA 1NJ9B 3MRGA 3VXUA 3OJMB 3CFCL 2OI9C 3LCYA 4Y4HB 3WEXB 1H15B 2C3GA 3BGMA 4M1CD 4DCQB 4FOMA 1KYOJ 1MCIA 3SOBH 4HKBB 5E56A 4MWFB 1N6VA 4CJ0A 1DVFD 4JVUA 4LSRH 4UILH 5GJSL 1YNKL 2P8MA 5DLML 4AL8L 1FSKB 5GS1A 5KVDH 4R4ND 3BW9B 3REVA 3T0EE 4O2EB 3TV3H 1SYSB 1GC1L 3PV6B 3C2SA 3CLFH 4UUJB 1YZZA 5ABDE 3MA9H 5FYKH 3U36A 3VFTB 1T1WB 3C87A 3O3EB 3GMQA 3JSSA 4XCCH 1INDL 3C6LB 1CR9H 3O9WD 5CHNB 3VWJA 2X7LA 5DRXB 1FJ1A 1FORL 2A0LD 1CL7L 2A9MH 4M93B 3KYOB 3NACH 5D6CB 4OM1H 1VHPA 2GUOB 4ERSL 1HSBA 1A6UL 3ZKXB 2EEBA 1X6LA 5C0EB 3S36H 1U3ZA 3MBEA 1N0XL 4W70A 3QUKA 4NSKA 2R4RL 3N1MC 1U93A 1YQVL 3ARFA 4X4MA 2EH7H 2FIKA 3BZ4B 2EDXA 4GOSA 3SDAA 5F70A 1BMGA 1TVHB 3QI9D 5BJTB 1BFSA 5DVKA 1QUNA 3CAFA 3IDYB 5E6YA 5GGTA 5ADPL 4G5ZL 1FL6B 4TUJB 5K9JL 5I71B 2NLJB 1TZHB 1A7NL 2CD0A 4NKOA 4X9HA 1IE5A 4JZOB 1JV5B 5GGQL 5I1EL 3RNKA 5A43C 4O51A 1UM4L 3LKRB 1BQHG 3PWUB 1HI6B 1JHTA 5JW4M 3GSUB 4RMQA 4WI4A 3UJIL 5SX4H 1YNTA 3LH2L 5DJYA 4IIQC 2VUYA 1ULVA 4E42B 4IOFD 1BFOB 1YDPA 5BMFL 1RUPH 3NOIA 3KXFA 2FX8H 3HC0A 4H1LG 3DV4B 3L5XH 5KS9E 5C0BB 3B5HA 2ITDA 5EBMB 3OAYK 1RUMH 5HI5C 5E5RB 1GGYA 2CSPA 4HS6A 1Z3GH 2LU7A 1IGFH 3VMOA 4X7TB 3B8YA 4KDTA 4KKLD 1AXTL 4TQEL 1OM3L 4ZFOB 2PYEA 7FABL 1A14H 4HIEB 4P5TD 4YWGH 4KJWC 4RQQA 3P9MB 4JY6B 4N8PA 4OIAA 1GZQA 1TCRA 5C09B 5FYJD 3ULVE 1Q9LB 2DRUA 1N7ML 1SYVB 3I2CL 3DTXA 5F7DB 3MLWL 1NEZA 5J56B 1JGVH 3P0YL 1OSZA 3IRPX 3TT1L 1E4KC 2NX5E 5C1MB 1G7JA 3W2DH 3G5VB 4GBXC 5F7LB 4PJ7B 2HN7B 3QDJD 2LVCA 2X1OA 3VGAB 5D5MF 4GLRI 5E6IA 5DSCA 2P5WE 3VH8B 3O4OB 2ZKHH 4MA3A 3VG0H 3W39A 1SJEB 2VXQH 1HHHA 5CINH 3MUJA 1GGIH 3MGOA 3JZ7A 1RZ8A 3MRGB 4C4KO 3QUYD 3T8XA 3VXUB 2EECA 4X4YA 5DMIH 3BGMB 2XN9D 4WJ5A 3WLWD 4JG1L 1T4KA 2HTLD 1A6VL 2JTDA 4Z7QF 2Z0BA 1F4XL 1MFCH 2P8MB 4FZEL 5TDPA 3OZ9L 5GS1B 4QY8A 3REVB 4ZFZA 3BPLC 2FEDC 3NCFB 5DD1H 1CCZA 5ISZE 4OM0H 3DYMA 1EGJH 1ZTXL 3U36B 2VYRE 4OV6F 5M7QA 2QSVA 5FUOL 3GMQB 1LEGA 4GAJH 1CDHA 1YN6A 4F33A 4JE4B 3VWJB 4FP8L 2X6MA 2X7LB 1FJ1B 4OZGF 3Q5TA 4UOW1 2Z8SA 1X5HA 4OZFG 4I8DA 1HSBB 5ANME 2HWZH 3C5ZA 5CP7A 3W11D 3MBEB 1D9KA 5D7IF 2JB5H 1BJ1H 3QUKB 4NSKB 2HH0H 1CQYA 2A9NH 1U93B 3ARFB 5AUMA 4GKNA 3NCJL 2FIKB 4NQDA 3SDAB 3QEQD 3S37H 3MLVH 3NGBB 3STBA 2P8LA 3V4VL 1XIWA 3WN5A 3QNZA 1RZJH 1F4WH 4NKOB 4PV8B 4Z7NF 3LHPH 2AJXL 3RNKB 4O51B 4F37F 2IMMA 3CDYA 3RVTD 3TBYA 2XICA 1VFOA 3TN0D 3R4DA 2BNRA 1JHTB 1D6EA 4TSCH 1YNTB 2R1XA 1GZPA 5DJYB 4PPTA 4WWID 4OTXH 4CDGC 1CGSL 3QO1A 4DVBA 1YDPB 5DQJA 3KXFB 3HC0B 4MXQD 1KUMA 4IM8A 2HLFC 1E4XL 3GIVA 2ITDB 3SQBA 4QOKE 5D7LA 3BKJH 4ONFH 5KZCD 4XVTH 4KHTH 4HS6B 3VXTA 3VDAA 5DMGC 4DGIL 2LTQB 3T0DA 1IL1A 4L3EA 2OYPA 4JB9H 3REWA 2FH6A 4HGKC 3LRSA 2JCCF 3RUGA 5JQ6L 4HBQA 1L9MA 4PBWD 4CMHB 5F7KC 3BXNA 1GZQB 4GW5A 1A2YA 1TCRB 3FQXA 1KN4L 1KCRH 3ROLA 3TO4D 3DTXB 2OK0H 4YXKL 1NEZB 2YD1A 1OSZB 4Y5YC 4P2QA 3V0AC 4DZBB 5SWZA 1NC4D 4JPIB 1G7JB 1KXQE 2NY2B 1T0PB 3HR5A 4HJJH 3MUY1 3Q1SL 3H8NA 1LEKA 5E6IB 5DSCB 2DMBA 3O2DL 4J6RL 2AK1L 2HFGL 5EU7C 4XAKD 3W39B 4YX2L 3SO3B 1A6WH 1R3LA 1J0YA 1HHHB 4U7SA 3D85A 5F3HA 4Y88A 3MGOB 1RZ8B 1M71A 3T8XB 5E8EA 1X3DA 3RVXC 4JKPL 4U1GB 2VLJD 4L9DA 4WJ5B 2DBJA 1NFDA 2WQRA 3GBNL 1T4KB 1CD0A 3UTTD 3P30L 4GQ9H 3O81A 1II4E 1NGZA 5DD5H 1ZV5A 4N0UA 1CDYA 4PBVC 5BV7C 4M6AA 4V1DE 4C57C 1J5OL 1H3UA 1HEZA 4NNXA 4I4WA 4QY8B 4ZFZB 3O6FC 2VDKL 5HGHB 3GHBL 3E6FA 5FHAL 2H26A 4Y16D 5TDOA 2ZWLT 2DAVA 5D96B 2F15A 3HI6L 5E1AA 3QIWA 3TNNA 1LEGB 3VXSE 1YN6B 4NCDA 4F33B 3ULUH 3OL2A 5EZIL 5DJXB 3OAUH 5ESQA 4N0FA 4XMPH 4WTZA 2VDRL 3PGFH 2WLZA 1CLOL 3U30C 1IVLA 5SV4A 3C5ZB 5CP7B 4KRMB 5IT2L 3QUXC 5IFHH 2FLBT 1D9KB 3M17B 2NY0B 1EFXA 1QFUH 1JP5A 2NY4B 1ORQA 5AUMB 4GKNB 4QRPE 3VH8G 4PJ5A 2XZCH 3EJJX 3PWPE 1QPXA 4GMTH 3QXUA 4NQDB 1KTRL 2AJSL 4JKLA 3SGKC 4WI5A 4O2FA 3GSOA 4J3TA 1EIBA 1WZMA 4NO0A 2AAVA 2WWMC 1XIWB 2N1KA 2NXYD 5CJOH 4PJFA 1JMXA 3ARRA 3QNZB 3VFGL 4OLYL 4XC1H 5D5ME 2D7NA 1I9RH 4NOBA 3E6HA 4NN7B 4NO3A 3AFLA 3BQUC 2V9TA 1SJXA 2BJMH 3TBYB 5AG8A 2QQLL 4JFFE 2BNRB 2VAJA 5KTEH 1D6EB 3A67H 4IS6A 1MSPA 5BW7C 2R1XB 3E3QC 3RTQD 1BHGA 1LP9F 4YXHL 3QO1B 4DVBB 3SPVB 3TLRA 4CBPA 4M62H 3ES6A 5E8PA 2OL3H 2ZG1A 5CEZE 2A1WL 4LP4A 3GIVB 3KR3H 2E9WA 3HTLX 4NCC2 3TYFA 4Z7QE 1DLFL 4I77H 5E8DH 5J4MA 3MACH 2E8YA 4L4VA 5CKAA 3VGHA 3ARTA 3VXTB 1C5BL 3X3FL 5LG1A 5GZOC 3J8F7 5FOJA 1IL1B 4XCFH 3G5ZA 4L3EB 3REWB 4UTAL 4GSDH 3HE7D 1C08A 4JRXA 2ICEA 3LRSB 4DTGL 5KOVC 3RUGB 2E7MA 2YR3A 2X4SA 3VFRA 5DF0A 1AP2B 3BXNB 3O8XA 2G60H 3OJ2C 1A9EB 2PF6A 1A2YB 1RHFA 4NP4H 5GHWL 3FQXB 1UJ3C 3ROLB 5C70A 1L0XA 2E9BA 1CBVH 1A7OL 4P2QB 1SQ2N 3UC0L 5DEFB 1X7QA 5SWZB 2X40A 3VRLE 3OKMA 2FBOJ 3HR5B 3T0VA 3VFVA 3RU8L 3T1WA 5FFLA 3KPTA 4MSWA 3FHQA 3IT8D 2GITB 2P4AB 1PDKA 1FHGA 5CJXA 5JOFA 2ICWJ 4YUEL 5D7IE 5I6XB 1R3LB 3P4NA 3VXRD 3DVGA 4OCSH 3D85B 2QQNL 1LO4H 5DUML 4KZEH 5KOMC 3WBDA 2EIZA 5E8EB 3JWDC 3O2WL 2RFXA 4KU1A 2FEEL 3FQUA 4DFHA 1MHEA 3P9WB 1L0YA 5H94A 5GGUA 5HYFA 1WC7A 5DFVC 1NGZB 5DC4B 5DO2C 3V7MA 1A6TA 3GSVA 3I50L 2A77H 4HUKB 3DNKA 4JN1H 4N0UB 4GBXD 4Z7NE 4NWTH 3DX6A 4OB5L 1HEZB 4KJQD 4NNXB 4I4WB 1CD9B 1ZK9A 5I1IL 4XWGL 4WRLA 3E6FB 3J7HA 2H26B 4HKXA 5TDOB 4NGHH 1JNLH 1IAIL 4P23A 5E1AB 5D6DC 3QIWB 1XGTA 4ZD3H 5FUZL 2AGJL 4X80H 4N0FB 5EOCH 1PFCA 4XCNA 4H8WC 5FYJL 4YHNA 4QO1A 5TF0A 1Z6JT 1ZAGA 2F19L 1ZHNA 2HFEA 1AR2A 4PUBH 5F1SA 5C0BD 1TTUA 3IDGA 4PJIF 4IDLA 2CGRH 2FIRT 3D3VA 2EDYA 2UUDK 5JHLH 2I9TA 4YC2B 2R0WH 4X7SL 2MCG1 1EFXB 3MPCA 1A3RH 1ORQB 2JCCE 5HD8C 2IGFL 4PJ5B 3NFSL 1DTUA 3TBWA 3OB8A 3U9UA 2YBRA 4Q97A 3BD3A 4BZYA 4O2FB 3GSOB 1G6RH 3FO9A 1MREH 5IESL 1Y18A 1KFAL 1W8OA 2X1QA 1CZ8H 5IROA 3C8KA 4OD1L 5J7CC 4PJFB 5JNYA 4XXCA 5KSBF 4HEPG 3E6HB 2P24B 4NO3B 3QG7L 4HKZA 3TF7C 1H3TA 3QCUH 5IW6A 1ZGLM 3LOWA 5IVXF 3PNWA 1P53A 4IRZH 4IS6B 4ZUWA 3UBXA 5A16A 4U6HA 1N64H 4Q9RL 3ORJA 2X4NA 3WFCH 1G9EA 1PSKL 3PDDA 4ZAKA 2FYYA 3ES6B 2DM3A 2R56H 1G9NH 2WK2A 5E8PB 2EH8L 1JPTL 4JFYA 3UPAA 4XB8A 4ZODA 2K1MA 5CZXC 2OR9L 3TYFB 1JGEA 1PGRB 5CCKL 3X14A 4L4VB 5ITBL 3C2AH 5EA0H 2CKBL 5JIKA 1JTOA 3G5ZB 2CXKA 1LO2H 3HPLA 1IQWL 1C08B 4JRXB 3CXDL 2ICEB 1YYML 4P2RD 2X4SB 1RZKH 3VFRB 3L5WA 4CU6A 4M3KB 3VGEA 3O8XB 4KJYA 5D72L 3GEWB 3ARUA 2FLRT 3HI1A 3EDKA 3UROR 5EIVA 5HHNA 2XIDA 4HK3J 1X7QB 2OR8A 4OFKA 4PRPA 3OKMB 4Z95L 1YPZA 3V7AE 1NKRA 4WHYH 1CDJA 4MSWB 5F8RC 4AENA 4N1EA 5JOFB 1KEGH 4WUKH 2K9UA 3P4NB 3U82B 3DVGB 4AIZA 4FQQA 3NH7L 2XG4A 2XKUA 4NRYA 2FEEI 4V2BA 5F93C 2EIZB 2YOCA 4Y2OA 1KCSH 3UP1A 2RFXB 3BT2L 3LQZA 5HDOA 1NLBH 3FQUB 4ODTL 4YR6A 1MHEB 2Q86B 1J1OL 2APBA 5H94B 5GGUB 2BRRH 3BWAB 1WC7B 1IC1A 4GAGH 1PG7L 1A6TB 3GSVB 4DK3A 4NRZA 3WNLA 2PYFA 4I9WD 5FYLH 1EGJA 2H6PB 4LNVA 2H41A 4HKXB 4NN6B 4PR5A 4F7EA 2E6QA 1PX3A 4P23B 4ZOEA 4PRAA 3VFOA 1LP9E 3DI3B 1JMZA 4UB0H 4CN4A 4OT1H 4LLVA 1XGTB 3MV8A 1KIQA 5CGYC 1TJIL 4HS3A 3HMWL 4PTUA 1ZGLP 4XCNB 3KXFD 4LSSL 5TFSL 5D2LF 4YHNB 4M7KL 1NLDH 1ZHNB 2HFEB 4MAUL 2EDQA 3IDGB 1BF2A 3D3VB 4LCYA 3D5OF 2I9TB 1OT1A 1EJ6A 5E2WL 1VEMA 4OV5A 2YRZA 3O6FD 3SGJC 5GS0H 5IW3A 1RMFL 3TBWB 3U9UB 3V8CA 5IEKA 1A1MA 4GS7C 1EO8L 2NY6B 2YBRB 3E1F1 4CW1A 2BVEA 3FO9B 3GSRA 5C07E 1OTUD 1Y18B 2AVGA 2FJHA 3DX8A 3G04A 1D5IL 4XI5D 5HI4D 3C8KB 1OTSD 1HWHB 5JNYB 3GNMH 5JR1H 3QNYA 3VA6A 2NY2D 5KG9A 4NBXB 4HKZB 3IAQA 1KLGA 1UVQB 2F5BH 5JPNA 1R24A 5KSUA 2FHBA 3PNWB 4KROC 4ZUWB 4CN1A 3UBXB 5A16B 2AABH 4NKIH 4U6HB 4BQ9A 2X4NB 4YK4C 4HS8H 3IDIA 4XNMA 4ZAKB 2FYYB 2BMKA 2QADB 3FZUD 4JFYB 4AMKL 3TFKC 5B39G 4KTYA 3ILQC 2WP3O 1JGEB 1KF9B 1UQSA 3X14B 2IQ9H 3PG2A 1NCUA 4NUJA 2ZCKH 3OMZA 1S7TA 5KN5A 1PD6A 4UTBL 4W6WB 4U1LB 4P9ML 4LNRA 4AEFA 3EO1A 2R0ZL 5EULV 1LDPH 3QIUA 2NY1C 4X0KA 4DQOH 1MCDA 5I74C 3BGAA 1EJOH 1AR1C 3L5WB 4LVHB 4KJYB 2X9XA 3HI1B 3T3MF 1NCNA 1FVCA 2BK8A 2NXZB 1ADQL 2AXJA 2XQYK 2CRMA 5HHNB 1IGIL 3BAEH 3V6OE 3QXVA 1DBJH 4PRPB 4DAGH 4DUWA 1YPZB 4I0KA 1CU4H 4PJIE 35C8L 5DQDH 5T1KB 4AENB 4D3CH 3RBGA 2MOVA 4OCXH 3UEZA 3C5ZD 4I48A 3U46A 2V17L 4AIZB 2PCPA 4FQQB 3C60D 1HKFA 3LN4A 3A6CL 1P6FA 4PRDA 4OD3L 2NY4D 2R69L 1KB5A 1E6JL 1WWWX 3WS6A 3LQZB 2E9IA 5F7UA 4NQDD 4YR6B 1V05A 5FV1L 2EC9U 3GMPA 1LMKA 5E5MA 2XG5A 4UT7L 2LE9A 4K7FA 4XVUC 5KSBE 5C9JA 1AFVL 4I3RH 1U3HA 4NKMA 4NRZB 1XIWD 2PYFB 3CDGA 4EI6A 1NMCC 2ZNWA 1SY6H 5MENE 5A1AA 5IVXE 3M07A 1YEFL 1YJDC 3MRNA 4PR5B 4F7EB 2XA3A 2QLVB 3LSOA 3MJ9H 4PRAB 3VFOB 2UWEF 4FFWC 1T2QH 1RIUL 3DUSA 4LLVB 3DSNA 4P2YA 3ARSA 3MV8B 1MJUH 1KIQB 4RWYH 4B7LA 4HS3B 4PTUB 2DQDH 4CN6A 5CLTA 1DBAL 4HV8A 2RQ8A 1CFQA 2BY2A 1MFAH 1KELH 3F6IA 4KI5C 4ZG1A 2C26A 2SEBA 2W92A 4LCYB 5DFVD 2XPGA 4NT6A 1KJ3H 5D71H 2KUTA 7CGTA 1NMAH 4HQQH 1XF2B 4HLZH 1A9BA 4WHTA 4OV5B 1EZVX 4KAQH 1Q72H 4X6CE 5IEKB 5AWNH 1A1MB 4U6XA 3OF6A 2P44B 4CW1B 5D2NE 5C0DA 3GSRB 1E4WL 1UWGH 1SVCP 3WLBA 2FJHB 5FO7B 2VSDA 3DX8B 1KTKE 4ZOAA 5CEXA 2Q6WA 5DT1H 3UYPA 1Q9OA 4GRWF 4ONHA 2HT3D 3QNYB 3NCBB 5I9QB 2J8UA 4YAQA 5JXED 1S8DA 5KG9B 2VDOL 1KLGB 5JPNB 2F9BT 1MAMH 2RCSH 1WIOA 2DI9A 3MGTA 25C8L 1R24B 5KSUB 2VLMD 1U9KA 1RQ5A 1RU9L 3ZYJA 4JEGB 3PL6C 3F12A 1DL7H 3D85D 3FFDA 3IDIB 4XNMB 3GUTA 2NR6C 4XMKL 4OF0A 2BMKB 2W07A 4G7YL 3RIFK 4K8RH 1W0YT 1FIEA 4K3HA 2C1PA 5F1NB 3EDEA 3WKML 4BSWA 3UYRH 3HPJA 5DZLA 1CDUA 3ARWA 4NUJB 1P7HL 5KN5B 3EOAA 4OLXH 3MO1A 4MS8C 4LNRB 2MTPA 3EO1B 1E27A 1TNNA 3QIUB 4X0KB 1MFEH 3ARGC 4TTDC 2QQKL 4HHAA 1DEEA 1HZHL 1FV1A 3WFBL 1QO3A 4HDIA 3WHE1 3MGAA 1FVCB 1XMWA 2IFFL 1JN6A 5BVJA 3BIBX 3H3BC 3QWOA 4PB0H 4W4OC 1FGNH 2BVTA 4ZFOL 2DDQL 5D2LE 4RFOL 4DGVH 5K9KA 1KC5L 1ROWA 4Q7DA 3RIFF 5B38A 3O4LA 1E0OB 2EC8A 4I48B 3U46B 1DSFL 2XOTA 2PCPB 3LN4B 2EDLA 4PRDB 4OQTA 2KQNA 2YPVL 2FL5A 1KB5B 5EU6A 2IF7A 4PJ5D 5I1GL 4YHYB 4IMKC 3GJFA 3UBXG 2MWCA 2DIJA 4P9HH 3H0TA 4KTEL 3GMPB 4LPUA 1GVIA 5E5MB 5AYUL 4K7FB 4LIQH 1J0JA 5C9JB 4PGBA 1MWAH 3IRZA 3TT3L 1U3HB 4NKMB 4JO1H 3CDGB 4EI6B 1ZVYA 5LWYH 4Z7WF 4M1GL 4JY5H 3MRNB 4Z78A 4LPVA 4W68A 3LSOB 4Y89A 4XCEA 4ONGL 4S1QL 5IJVA 1QLEH 2H1PH 2B7DT 4XNZB 5K93A 4P46C 4JO2H 3NPSB 5DURB 1JZ4A 1EEQA 3CCHA 3TBSA 1T1XA 2X4PA 3T2QA 4HV8B 1CFQB 4TULL 3NAAH 1A64A 2SEBB 3BPOB 2HVJA 3BZFA 4M5ZL 2XPGB 4NT6B 5FXCH 2E6PA 2JJTA 4WHTB 4CVXB 1UXSA 2XWTB 5F1OB 5MP6L 4JRXD 1G6RA 3RKDD 4BZ1H 4U6XB 3VFNA 1EXUA 3T3ME 1F6LL 5T33L 2FHCA 5C6TL 3F7QA 5C0DB 5E99L 2ILLA 1HH6A 3WLBB 2DL2A 5I30L 1G9ML 5TF1L 1W72H 2EEDA 3QFJA 2O5XH 5CEXB 2Q6WB 1Q9OB 2A73A 4H20L 5A2JH 1F3DJ 4ONHB 2J8UB 5FK9A 1T3FA 1MRDH 5IJKA 1S8DB 3DYPA 4XBEH 1YYLH 3EFDL 3MGTB 4PRID 1NCAL 1TZGH 2OL3B 1EX0A 2DYPB 1TZIA 2Q8AH 4BFBD 3F12B 3FFDB 3PIQA 3GUTB 5LQBL 3DJ9A 3HC3L 1VEOA 4OGXL 2CDGA 4G6AC 4PD4J 2ZCLH 5E9DA 2FX7L 2XA8H 4WTXA 2C1PB 4ODHL 4HUNB 4BSWB 1CFVH 5FYJE 3HPJB 1NCCH 4NZUL 1GRWA 5TJWK 5I1CL 3EOAB 4OZIE 1VFBA 3QWRA 4YHMH 3KJ6H 3MO1B 4RCAA 5IB3A 1MCSA 3OAYH 1JHKH 1E27B 2CUIA 3PHOA 4PV9A 5E4IA 3QDJE 5ACZA 1E6OL 4HHAB 4KJPD 1DEEB 1CICA 5FYKD 4ZFGH 1MAJA 1FV1B 1QO3B 2UWEE 4HDIB 2MSPA 3G6JA 4TUOA 1WZKA 1ORSA 4UU9A 2RHEA 5BVJB 3QWOB 1D7FA 5I15L 2WNGA 5ACMA 1ZLWH 4NWUH 4PYGA 4KK5D 4RGMB 5L0QC 2BHYA 5BRZA 3SE3C 5K9KB 5I8EA 3ME0A 1OAZH 2XN9E 3O4LB 1UZ6F 3BKCL 1MCNA 3D3VD 4NBYB 3UJJL 1ACYH 5CEYA 3ALXA 3GIZH 4Y4HC 2NY7H 1MPAL 1JZ6A 3QQ9D 3QDMA 1YEHL 2FL5B 5EU6B 3MUGA 3P11L 3U0TA 3WCYA 1FPTH 3GJFB 3H0TB 2AXGA 3MQIA 4P57A 1ITCA 2OJZH 4F9PC 4EUPG 4PGBB 3MLXH 2DLHA 4QHUA 1DE4A 4KKNA 5EZOL 1UH4A 3DECA 4K94H 4OFVA 1DFBH 5FKAA 1RZGA 3L6FA 4Z78B 1FC1A 5IJVB 4XCEB 2DQUL 3B9KC 4HAGA 1MCPH 3C6LC 5AZEL 3QA3A 4X6DA 4B5EA 3A6BL 5D7JC 4YHPA 3CCHB 2D0GA 3TBSB 1T1XB 4ZAKD 2X4PB 4FQXA 3ZMRA 5ERWA 3MBXH 2QADD 4YHIA 5F6IB 4LHUG 2V9RA 3QEQE 1WZ1L 4OBRA 2HVJB 3BZFB 2DKSA 3JV5A 5T3ZH 3AB0B 5IFAL 1UXSB 2W9EL 5CJQL 4N1HB 3QEUA 1G6RB 5IBTH 1BD2B 3LDBB 3LQAC 3VFNB 1EXUB 1VA9A 3IDYC 3OGCA 4S0SD 2ED9A 1MFBH 5K9QG 1HH6B 5MEPA 3S88L 4O2CA 3RIAF 5C6PB 3QFJB 1KIUA 3U0WL 2NXZD 2A73B 4CU8A 2BSTA 1KN2L 5FK9B 1T3FB 1D5MA 4GXVL 1OAKL 3SDCC 4M43H 4KMLB 5T1KD 3QQNA 3LPGA 4GW4A 4XPBH 4EZMA 2PW2A 3LAFA 1TZIB 4GLRH 3R8BB 4EI5D 3HR6A 2OQJA 4NJ9H 3PIQB 4J12A 2ZUUA 2CDGB 5E9DB 3WD5L 4IRJA 4D9QD 4RGNC 1P7QA 3QZWA 4BSJA 3TZVD 3JWOH 4I18A 4Y8AA 2VTFA 3QHZL 4NUGH 2ZSVA 3RWEA 4Z77A 1U95A 3EDJA 1T7XA 4Z7WE 4KKBD 3PHOB 4PV9B 3KWWA 3DRQA 5TPWL 3U7WH 5ACZB 1EA9C 1CDIA 1AXIB 2NY3B 1CICB 4PJ7F 5KS9A 3WXWH 4XAKE 3G6JB 4MD5A 3PL6D 4TUOB 2JB6A 1ORSB 4UU9B 2DLFL 5DWUH 1OD7A 1Q1JH 5KSVA 5L7XL 2XZAL 3D9AH 3MV8D 5T1LA 1V3KA 1W8NA 4XPAH 1GOGA 5BRZB 1RFDL 2CMRL 5I8EB 2VE6A 3KPSA 1KPRA 1J10A 2HKHL 4WEUD 2VLJE 1ZHKA 2I5YL 3C08L 3UTTE 2B5IB 4MCZA 1SBSH 5I66A 1N4XH 3NBNA 4JPVL 5CEYB 3FO1A 3VD3A 3QDMB 4RGOH 3TJHC 3O2VH 3MUGB 4OLWL 2EDNA 2NX5A 2YMXL 2DKUA 1HCFX 1X5LA 3LIZH 2GSIA 3U0TB 5KJRH 3CX5J 4Y2DC 1GGTA 3WFZA 5FYJU 4P57B 3DVIA 1SY6A 1RHHA 2F58L 5DJ0A 3T3PF 4QHUB 1CXFA 1F58H 1MJJA 1DE4B 1CXLA 5CUSH 2B0SL 5CGTA 3C8DA 4A6YH 4B50A 3JV4A 2ZG2A 4HWZA 5FKAB 4JG0L 4M5YH 2Z91A 3L6FB 4NZTH 1A7QL 1QOKA 2DB8A 3ZE0F 3NIFE 3QA3B 1UA6L 4NIKB 4X6DB 3VWJC 3DVNA 3N9GL 3TVMA 3GJEA 4YHPB 3BKMH 4YBHA 4OSUH 4WI8A 4FQXB 3CZJA 5ERWB 2FSEA 4YHIB 4EEEA 5KBNC 3D18A 5ALCH 3U48A 4MNGE 3MBEC 2CK2A 4MB4A 3VXQA 4WCYL 1BGXH 5I18L 4OCWL 2ENYA 3RVWD 3ARFC 5EORH 2Y7QA 4UDUA 3RWJA 3LB6C 1UM6L 3QEUB 3SDAC 1FZJA 3P73A 2YA2A 3P3YA 2FGWH 4KH2A 2ADGA 3OGCB 4YPGA 4Y5XA 4X4ZA 4F7CA 4LHUD 1FIGH 4E0RB 2L4OA 2BSTB 4Y1AB 4ZTPL 1I9JL 3T2NH 1D5MB 2HP4A 1UYWL 4OLEA 3TH4T 4XC3L 2OZ4L 1UZ6E 4DN3L 3OKNA 2OXHA 4EIZC 3G08A 1F4YL 1Q9WA 4O5LH 4GW4B 2ARWA 4GKZA 2PW2B 4Q6IA 4MX7A 1NSNH 1QNZH 3FHAA 2OQJB 3RBSA 2FHFA 4TSAL 3D39D 3H3PH 1WQVT 4IRJB 1P7QB 2IALA 1IGCL 2LTQC 4I0CC 4I18B 4XP6L 4WO4A 5DMJB 5MHSD 5IB2A 1KNOA 2FATH 2ZSVB 3RWEB 4Z77B 1UZ8A 3SCMA 1N26A 4ZO7A 1I8IA 1U95B 3MYJA 1A22B 1U3HD 3KWWB 4MCYA 4NQSA 3S3SA 4JREB 5CZVH 4G8FA 5KW9H 3DETC 5KS9B 5GQBA 1W0VB 3ULUD 3KS0H 4HCRA 2ZUYA 4MD5B 2JB6B 1RPQA 2HTKC 3VXRE 4JO3H 2AV7B 4Q74A 5KSVB 3I6KA 5DURD 5T1LB 5E6IC 5J6HA 1IQDA 5HHXH 2VE6B 3KPSB 4ETYA 5IBUG 2DMCA 3SO3C 1ZHKB 2E7BA 2YD5A 2AXFA 3L3HA 1ETZA 5HVGB 1QRNA 4MCZB 1X4XA 5I66B 4NM8H 4OGAD 4XPHL 1I9IL 3FO1B 4U6VL 1LNUA 1BVLA 3LS4L 4U1GC 1J8KA 2NX5B 4ZS6D 5TE4L 2GSIB 3HE6C 5GGVY 2OTWA 2MQ3A 3TGXA 1FQ9C 4S1DC 4B7IA 1RHHB 5DJ0B 3SOBL 4ZPVA 5GRUH 3BZDA 1KBGH 3D0VA 1KV3A 4LSRL 3JV4B 4HWZB 4NFBA 4UILL 3TBTA 3D69A 3RVVD 5D96C 4G6MH 3V9FA 5C0BE 5KVDL 4ZUTA 2HMID 3TV3L 3QRGL 2ZZUT 2DYPD 1CI5A 1AQKH 1L7TH 3DVNB 5EU4B 5SWSD 5F7WC 3CLFL 4JDTH 3TVMB 3GJEB 3ARDA 4X8XA 1QHOA 2Y06H 1I9EA 3MA9L 5FYKL 5JMOC 2O61A 4PRHA 4V1DA 4H0HB 2FSEB 2H2SD 3NA9H 5DTFA 3D18B 4XCCL 5TE7H 1CR9L 2YHGA 2FDBP 2E3VA 4HPOH 1D9KC 1Z9LA 2A9ML 4WHYG 2NY0C 3NACL 4OM1L 4EBQH 3GMNA 2Y7QB 4P3WA 1PLGH 4UDUB 5DD3H 3RWJB 5DZNA 5C2UB 3S36L 4RDQF 2UUDH 2D03H 1AD9A 1FZJB 4PJ7E 1W72A 2DBLH 3P73B 3FMGH 2ADGB 4YPGB 2EH7L 3DO3A 4F7CB 1VEPA 3CPLB 4QRRD 3IDUA 1FFPA 5F7YC 3WN5C 1I8MA 1UB6A 5CZKA 4NN7C 5I8OH 3LKSA 1T89C 1EEUA 3WXVH 5E00A 5HHMB 2WW8A 1JYWA 3OKNB 3G08B 1Q9WB 4GKZB 3GHEH 4Q6IB 4MX7B 4DK6A 4K9EH 1PY4A 4K07A 4P4KD 4P2RE 3W9EA 3C5JA 4MAYB 2VLKA 2DOCA 1TTGA 3D1MC 3OKOB 4YDIH 1RUPL 1UACH 2IALB 2FX8L 1ZE3C 2VN4A 3T3PE 1CGWA 3L5XL 4WO4B 4PJ8A 1PKOA 4JFFA 5IB2B 1KNOB 4LQFH 2CLVA 2MPAH 1RUML 4MQ7B 3SCMB 1I8IB 2ADFH 3MYJB 5HY9A 1J86A 1Z3GL 3GDBA 4MCYB 1IGFL 4NQSB 4OLUH 2CH8A 4G8FB 1Q0XH 5DUBA 1MCOH 3ZE0E 4ENEC 4HBCH 1V3MA 4LMQI 4LGPB 1A14L 3ZT6A 1K4DA 4YWGL 1AGFA 3BP4A 1I1RA 3I6KB 5J6HB 4LPTA 2X4QA 1IQDB 1JGVL 4P5MA 1MH5A 2GKIA 3IXTA 5I0ZA 3W2DL 2AXFB 5HJ3A 1N8ZA 3L3HB 1ETZB 3RQ3A 1QRNB 1U8QA 5HDLA 1HHKA 5B21A 3ZKMD 4KK6C 2ZKHL 5H37G 4KK9C 4BUGA 3VG0L 1LNUB 1BVLB 2VXQL 4I9WE 5CINL 1R3JA 1S9VA 1GGIL 1BD2D 1CLCA 4XP4H 2OTWB 1NAKH 3K4DA 4D8PA 5DMIL 1F13A 5IBLD 4ODSH 2AJVH 2H2PD 1CG9A 3H9SB 4P2OC 3CK0H 3QFJD 3CMOH 4ZPVB 1ZHLA 5I8KH 3D0VB 4POUB 3KXFE 5DUPH 1TQCC 1MFCL 3D69B 3TBTB 2DD8H 4ZOBA 4IRSD 1U3JA 5F8QC 4ZUTB 5ILTH 5I1LA 5INCA 2A6KA 5JOEA 5DD1L 4OM0L 3EYUH 3ETBF 4DKDC 3ARDB 1EGJL 2O61B 3N85H 4PRHB 4V1DB 3ZDXE 1NGWA 3LEVH 3U4BH 5DTFB 4GAJL 1NMBH 2J3SA 4U2ZA 4YC2C 2GTZA 3T04D 4ESKA 3EYQD 4B53A 1OWRM 5K33A 2NPLX 3QWRD 2HWZL 4WY7H 5C0AA 1YEKH 2GIYA 5JIHA 2XKSA 3RY6C 2JB5L 1AD9B 4DN4H 2HH0L 4PJFF 1W72B 1EK3A 1M6OA 1WCQA 2A9NL 2NY3D 4P3CH 1MY5A 1FFPB 1LVEA 3HAEA 1I8MB 1UB6B 3S37L 4JZNA 4QHKJ 1CVSC 3MLVL 2LQRA 3FQNB 4LPCA 3LKSB 2OBGA 3ALPA 5E00B 2LFGA 4FTVD 2JCCA 5BRZD 2EDWA 3EJZD 3G5XA 2VAAB 1RZJL 1F4WL 3FAXA 5T1MA 3LHPL 3F5WA 1FFQA 3T77A 3RDTA 4TSCL 3GGWA 3UBXI 3W9EB 2DLIA 3C5JB 3E2HC 2D0FA 2Q76A 2VLKB 4OTXL 1KG0A 4GXUN 1UADC 2HG5A 4ZO6A 4PJ8B 1LILA 2YPKA 2CLVB 3G6DH 3BKJL 4ONFL 4XVTL 1QQDA 5FYLD 3QUZA 5HY9B 4KHTL 1T6VN 3O8XC 2PR4H 4POZC 2C4FU 4JB9L 1MUJA 1A02N 1LDSA 2BY3A 4OKDA 1GHFH 1K4DB 3ZE2F 1AGFB 2O26U 3BP4B 2DS4A 1IGYA 3AXLA 4WI2A 1KCRL 1K5NA 1P9MA 1JGDB 2OK0L 5I76A 4GRLD 1JK8A 3EJYC 4P5MB 1F90H 4ELMA 4FQXD 4UDTA 1MH5B 3IXTB 3CFJA 3UTSD 3QDAA 1N8ZB 4NQDE 4HJJL 4JAMA 1U8QB 5EIIA 4QHMA 1P5VA 1HHKB 1KB9K 3I9GH 4HXBH 2PN5A 1XGRA 3LEYH 5GS0D 5CSGA 1A6WL 4NN5C 2Y5TA 1R3JB 1S9VB 3C5SA 4LVOB 4UNUA 2VLRD 1RIVH 3MRDA 4Y7MA 4D8PB 4PP1D 2P5ED 3BN9D 1CG9B 1RZ7H 5CSBA 1ZWIA 4X99A 4JLRA 1ZHLB 4Y1AD 2QV2A 2DKMA 3I85A 4GQ9L 5DD5L 1A47A 2X9YA 3VFSB 5AAMA 5I1LB 4NZDA 2RGSA 5INCB 2EDRA 5MEOA 3SDDA 2A6KB 4Z0XA 2APTA 3ZZ1A 4XNUH 1T03H 1KLUA 3MV9D 1NGWB 3HA0A 3ULUL 3RGVC 4G7VH 3OAUL 4IRJD 2ADJA 3TIDA 1P7QD 4XMPL 2GTZB 1M1SA 3PGFL 5D7SH 2H3NA 1HHIA 5C0AB 3N1FC 1JRHH 4LOUC 4OI8A 5IFHL 4HUUB 2NY6C 5C92A 3L7FA 2Z31C 2DJ4A 4XRCA 3IVKA 1M6OB 1QFUL 3MOQA 2MQ0A 2VLME 4RX4A 3KHQA 2XZCL 4S1RH 3HAEB 4GMTL 4JZNB 1ZT7A 2NYYD 1NBYA 3CXHK 4R4FH 4KHXH 3CU7A 5HYSG 1WBYA 3CVHH 4KRPD 5T1LD 2JCCB 1BBDH 1YEEH 4LLDA 5CJOL 3KPSD 3GSQB 3G5XB 3ARYA 4PJAA 1JI2A 4XC1L 4F15B 3BDBA 3ESVF 3H2WA 1I9RL 3FO2A 5BCAA 5T1MB 4WFFD 5HDQH 2K7QA 5ENWA 3T77B 3RDTB 4EQ3A 2BJML 2VDLH 4JGJA 1ZT1A 5KTEL 4N0UE 5D1QC 3GGWB 3A67L 2Z8RA 1S7WA 3NMEA 4BYHA 3FQTA 2Q76B 1RI8A 4XTRD 5I73C 1KG0B 4XBPA 1K2DA 4M62L 2HG5B 4QWWD 2OL3L 4MGXA 3KR3L 2YPKB 4LFHG 4PGZA 3T0AA 2P48B 1QQDB 1T5WA 3QUZB 4I77L 4MQXC 5E8DL 3MACL 1UKQA 4M7LT 5E8NA 3O6KH 3EFFB 4KDVA 3B5TA 3G9AB 4JQVC 4XCFL 5E0QA 4GSDL 5E8OA 1MUJB 4CRPA 2BDNL 3CU1A 4H0GA 3VGFA 3I02A 4NQEB 3K2MC 2VERN 3AREA 5IB4B 1Q0YH 5GSVA 1HKLH 1M7DA 2G60L 4ZXBA 4NP4L 4J4PC 1IGYB 3AXLB 5CBEB 1K5NB 2EIBA 5FGBA 4OFYA 5I76B 3TPUA 1IARB 4ZQKA 4IMLA 1JK8B 1CBVL 4ELMB 4UDTB 4HEME 4PJ5E 2ZOLA 3CFJB 3EUUA 3FB6A 5CFHA 1P6AB 4JAMB 4KUCD 2CDEB 1EHAA 5EIIB 4QHMB 1RJCA 5FA3A 1XGRB 1QFPA 2VKWA 2XZZA 5L2KD 3DMMA 4PJFE 1TXKA 3IKKA 2Y5TB 5K9QI 3QEHA 3C5SB 4G6KH 4OCSL 1LO4L 1AHWA 1FNEA 4KZEL 4NKQB 3MRDB 1RUAH 2VOTA 1A8JH 3R0NA 1KENH 3WDIA 4LLAA 5E2UH 4A6YB 1ZWIB 2R29H 4X99B 4JLRB 2EC9T 5HGBA 3BD5A 2A77L 4JN1L 5HHMD 2P8PA 4NWTL 2G75A 3L3JA 4N5EC 4WNQA 3MRQA 4PLJC 3SJVA 4KK6D 3SDDB 5MEOB 1PVHA 1K9TA 4Z0XB 4UBDC 5KVFH 4OCLC 4NGHL 1JNLL 1KLUB 5KSBA 4K8RD 3MLZH 1CD1A 4JRXE 4MAYD 4ZD3L 5TQ0H 5KVMC 3NZ8A 4WEMB 4X7DC 4LMQE 4X80L 5CIPA 4YBQD 4E41D 2ADJB 3MRHA 5EOCL 3TIDB 5IVXA 3X11A 5J1AA 2N7BA 3CFIC 4WO4D 2H3NB 1HHIB 4PUBL 1GPOH 3QDGD 3SCMD 2CGRL 3C6SA 3QIBA 5JHLL 1NAMH 3L7FB 3CUPA 2R0WL 3V6FA 1VADA 4XRCB 4JFHD 1A3RL 1EEYA 4PRIE 3ZYOA 3HZVA 3ZE2E 5F21B 2LU4A 1MCQA 3X12A 1ZT7B 1T1ZA 5I9QC 3O2DA 3HI5H 1NBYB 1FG2A 1G6RL 2V5SA 1MREL 1WISA 3TESA 1WBYB 2H45A 1B2WH 3GMRA 3MLSH 1CZ8L 4YEEA 4LLDB 1CFBA 1FH5H 3MOAH 3UTPD 4PJAB 5BOPA 4OZFH 4X6CA 3FO2B 3MNWA 5ENWB 1QRND 3QCUL 3HLAA 2I24N 1ZT1B 4NFDA 2DTMH 3OPZH 4IRZL 1S7WB 3P2TA 2Z35A 3FQTB 5J11C 1S7QA 1N64L 3WFCL 4XBPB 5FYKE 3LV3A 4N0YH 4PJXA 1K2DB 2R56L 1G9NL 3RPKA 4FA8A 4OCRH 3H9SD 5C3TA 1T5WB 2O5ZH 3INUH 1VGEH 3QIUC 2NW2A 3TIEA 3C2AL 4U6YA 5EA0L 5E8NB 2FCBA 1J9CT 1IC7H 4MA8H 1LO2L 5E8OB 1LE9A 2VZ3A 3KLHC 3I02B 2VR4A 3AREB 1RZKL 1M7DB 3D3VE 4Y5VA 2E5EA 4ZXBB 5DJZA 3EO0A 1EVTC 4AK1A 3TPUB 4ZQKB 4IMLB 4PRHD 4O4YH 2ZOLB 3FB6B 1O5DT 1MAKA 4Y4KD 1CIDA 2EE3A 3KHOA 1EAJA 3THMH 1JPFA 1FVEA 5FA3B 4UOW0 4WWKA 2O5YH 2IAMC 1KEGL 1ZKAA 4WUKL 3DMMB 4EN3C 3QEHB 3SDYH 1AHWB 4QEGA 1FNEB 3ZHLA 1Y6NR 5B4MD 1A0QH 4WV1A 5GS2H 4U1KA 1KCSL 4APQA 4U2YA 15C8L 1G7QA 1BBJA 1OD9A 2EKSA 3CJJA 1GL4B 1NLBL 5FKPA 3BISA 2XV6B 3UPCA 1A3QA 5HGBB 1DVFA 2BRRL 4GAGL 4F58H 3T0WA 1YY9C 1NGYA 2G75B 1P2CA 2YSSA 1H3XA 3L3JB 4WNQB 1WEJH 5FM5M 3MRQB 3NPSC 5FYLL 4K55A 3SJVB 2QTEA 2ERJC 2CR6A 4UV4H 1IC5H 4HC1H 4RFEA 5KSBB 4F2MA 4UB0L 2JELH 4OT1L 3CSYA 5I75B 1JPSH 2VLKD 4L8SC 1JHLH 3NZ8B 5CIPB 3T2OA 3MRHB 5IVXB 1OAQH 4G43A 1T66D 3X11B 5J1AB 2VABA 1NLDL 2E7HA 1DR9A 4JPKH 4X6FA 3OX8A 3ZDZE 3C6SB 1D5BA 3QIBB 1YMHA 3CUPB 1VADB 1J0IA 3FN3A 4XH2A 2H32H 3S3JA 3TH3T 4IDJH 4KK8C 4KFZC 3RRQA 1TPXB 5A3IC 2J8UF 1EEYB 1QZ1A 5GS0L 1C1EH 3X12B 1NQBA 1T1ZB 5LAXA 1FG2B 4EOWH 4HWEH 3GMRB 4HH8A 5T3XH 2VR5A 3RGVD 4LGRB 4HIJA 3GNML 5JR1L 4D9QE 4X6CB 3JBG7 3MNWB 4K71B 3FB8A 2F5BL 3BWUC 4R0LC 3HLAB 2Z35B 1S7QB 2AABL 4NKIL 4IJ3C 4HS8L 3LV3B 4PJXB 3TPKA 2V5TA 2EKJA 3NIDF 2RB8A 4OCYH 1XGPA 2IQ9L 1C5CH 2HVKA 2NW2B 3HB3D 3MV8E 3TIEB 1JF5A 3AY4A 4U6YB 2ZCKL 3TP4A 4AH2A 1KYOK 1LE9B 4ZUUA 4G6FB 1WVZA 4G8GD 3LKNA 1S9XA 1LDPL 4DQOL 4DEPB 1EJOL 5CP3H 2YUVA 2Y9RT 4Y5VB 2W91A 4Z7OE 5IW1A 4RGMC 1A1OA 3B9DA 1U8OA 5DJZB 3EO0B 2EXYC 4OZIA 1B3JA 4FFVC 4ODVH 4XX1G 1Z2KA 4LHJB 3BAEL 3SHSA 1DBJL 4KXZI 4XBGA 4R26H 4DAGL 5FCUH 1XF1A 3QDJA 5T3ZD 2IPKA 1MEXH 1CU4L 1BX2A 1KCUH 2VRAA 1JPFB 4MA1B 2UWEA 4PY8J 1FVEB 5DQDL 4D3CL 5FDYA 4OCXL 4WWKB 4RAVA 2JE8A 5C0AD 5DJDA 1EHLH 4HT1H 4ONOA 3JVGC 2ZUVA 5L88H 1MHCA 2YD2A 4WV1B 4U1KB 4APQB 3LMJH 3OWEA 1G7QB 1QBAA 4MZ3A 3BGFC 4W6YB 2EKSB 2EE9A 1U8KA 1R5VA 4TNVK 1NUFA 4XVJL 1I85C 1DVFB 2ZUXA 3KYAA 3VG9C 1TETH 4NQXA 4I3RL 5DHVH 5DMYA 1CFSA 2YSSB 1P2CB 2CPCA 1SY6L 1YEGH 3OAZH 4LLYA 1I7RA 3MREA 3RDTD 1UM5H 1REIA 4RFEB 4DGYH 3MJ9L 4PREA 4OAWA 5F6IC 4F2MB 1MCLA 3CSYB 1T2QL 3WIHH 3BH8A 4RWYL 1EEZA 2BHZA 4M1DH 4WW2A 2DQDL 4G43B 4M03A 2VABB 1MFAL 3L95A 2C3HA 1CGXA 1KELL 2QHLA 4R97B 4TNVF 3OX8B 4PJ9C 4X6FB 3AC0A 1D5BB 3LDBC 4Z18A 1KJ3L 1YMHB 5D71L 3KJ4B 5E2TH 1NMAL 4XH2B 4HQQL 5EC1A 3ZDYF 2IG2H 5BV7H 4KAQL 3IXAA 1Q72L 1QLFA 4NQED 3QEQA 3CVHA 5AWNL 1ERNA 5D7KD 3LD8C 4YIQA 4KMTH 4ZOCA 5LAXB 5FM8A 5IF0A 5EFIB 3B43A 3U7YH 1UWGL 1OAUH 3D39E 4HWNA 4YDLB 4LLWA 5DT1L 4R4BA 3PDGA 1WBXA 3EOTH 4UOJA 1U36A 3FB8B 4Q58C 5IKCA 1Q9KA 4LLMA 5MHSE 1MAML 2RCSL 1RJLB 1F6FB 2K3TA 4JM2C 4XVSH 2J4WH 1I8LA 1EZVY 1QBMH 1MNUH 3EHBC 1DL7L 3CFDA 4TYUA 5JW4N 2C5DC 5K9OA 3ULUE 3NIGE 1AXSA 2DWEA 4K8RL 4YHZH 1VFAA 1MCFA 1A4JA 4JQXC 1XGPB 2HVKB 3G6JF 3UYRL 5D1ZC 1BQHA 1CQKA 1CICC 3L7EA 1S7SA 1H5BA 1HIMH 4OLXL 2W59A 4AH2B 5KSAC 2PNDA 3MRFA 3LKNB 1N2RA 1RJZA 1S9XB 3B6SA 3OQ3B 4DKFH 1K4CA 1MFEL 1UGNA 2HJKA 5IW1B 3IFOA 4H1LA 1A1OB 1U8OB 2D9QB 4JFDD 4PJCA 1UWXK 5JW4Q 3GO1H 2E7LC 1SMOA 4OZIB 3K8LA 1U0QA 5GS3A 1NC4A 4PB0L 4H88H 1FGNL 2ZOKA 3CFBA 4XBGB 3RL1A 1B0GB 1ODAA 3QDJB 2IPKB 4DGVL 1NEUA 4U3CA 3EO9H 1BX2B 3ABZA 4Z5RA 2UWEB 1JJUA 3MJ7A 4RAVB 3RZCD 4LSDA 4X9FA 2J8UE 4QTHA 4J23A 2BXYA 2GJZA 1MHCB 4DW2H 5CILH 5I1KH 2W60A 4JANA 4HJ0D 4RX4D 1A6ZA 2Z9TA 5C0NC 1V3LA 1Q94A 1U8KB 1R5VB 3OKYA 3QULA 2X70A 4P9HL 3MUHL 4MVBD 4X6DF 5IHUH 4LIQL 1O0VA 1MWAL 1QFWM 4NQXB 4JO1L 1CFSB 1UFUA 3JWNC 4LLYB 5LWYL 1I7RB 3SY0A 2D7PA 4GO6B 3MREB 4JY5L 2IAMD 1B9ZA 3QXWA 3GMMA 2GYSA 2PUQT 4PREB 4OAWB 1KIRA 3SBWC 2QKIA 1QLEL 2H1PL 3T0EC 1PYWA 3BH8B 4JO2L 3EAKA 1EEZB 4JJ5A 4WW2B 5MI0B 4WFGD 1EAPA 5KAQF 3NIDE 4IOIA 3JWDH 4QRRE 5DRZA 2BCKA 5J06A 1NAMA 3L95B 2R2EA 4ZDHA 3NAAL 1WF5A 4KQ3H 1U8IA 4PLKC 5EC1B 3L9RA 4RMRA 2NZ9D 3PWLA 5C2BH 3KVQA 3MLUH 1QLFB 4NHCH 2D7TH 4BZ1L 3QEQB 3CVHB 1IEBA 4X7CC 4EKXA 5L8KB 4YIQB 5IF0B 4YXLH 4OZFA 1QR1A 1CF8H 1G84A 4UAOB 1W72L 4OFYD 2O5XL 4K3DH 5FCSH 1EO5A 2W38A 3HMXH 4WW1A 5HVHC 4R4BB 1WBXB 1MRDL 4ZFFA 2DQCH 3UDWC 3TH2T 5IKCB 4XBEL 1PAMA 1Q9KB 3P4LA 4H8WH 4LLMB 1YYLL 2WIMA 1AIFA 2YRLA 3B2UC 1CS6A 1LQSR 1UEMA 1TZGL 1XF5A 2EZ0D 1I1FA 2BSED 3DMMD 4KK8D 2Q8AL 4L4TA 2BVOA 5A2KH 3CFDB 2JJSC 4ZNCD 5K9OB 3VD9A 3HHRB 2ZCLL 2XA8L 1AXSB 2DWEB 1LO5A 2WUBH 1VFAB 1A4JB 4AG4H 1CFVL 4JREC 1TQBB 1NCCL 1BQHB 3A6OA 3L7EB 2GQHA 1S7SB 1H5BB 3HE7A 4YHML 1SVZA 3KJ6L 4S2SB 1JHKL 3MRFB 3DHJA 1N2RB 1PKQE 1RJZB 3B6SB 4YHOH 2DLGA 1K4CB 4M6NH 2AKRA 1MHPH 4ZFGL 3SJVD 3P0VH 2HAZA