3FTGB

Crystal structure of h2db in complex with np366-n3a variant peptide from influenza
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
100
structure length
100
Chain Sequence
MIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protective efficacy of cross-reactive CD8+ T cells recognising mutant viral epitopes depends on peptide-MHC-I structural interactions and T cell activation threshold.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 13
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ftgB00
4CVZB 1AD0A 1NGWB 5IF0B 1ZA6B 4XAWH 4QXTA 1NGPH 3S34L 1WTGT 1YEDA 3IDUA 3CFKB 4HJJH 5CD3A 1PAMA 4ZTPL 3OAZK 3TIDA 5IFHH 5ADPL 2DQIL 2G60H 3AAZA 1RZ7H 4PP2A 4BZ2H 1FRGH 2R1WB 3OJMB 4EJ1C 3HC3H 1K4CB 2G5BA 1U58B 3MLZH 4I48A 4NNPL 4EN3D 3I02B 2YBRB 1MCOL 2VLRB 1DDHA 3LY6A 3O2DH 2NW3B 1JPTL 4M6AA 5ICYB 1P69B 2H8PB 1GPOH 3RGVC 1IGCL 4LSVH 1CU4H 4PG9A 4ZUVB 2AJYH 3PJSA 4P46C 5I8OL 3GJFH 4XWOD 1EUTA 2CXKA 4ZS7H 3TO4C 5I76A 1Z2KA 2V5MA 4GQ9L 1KLGB 2FX8H 4AMKL 2XKSA 5EUKB 1WBZB 3QFDB 3C9NA 4NQSB 4XTRD 1INQA 3DXAE 1GGBL 1JPSL 1MRFL 3QIUC 5DLML 1FORL 1ZKAA 1IAIL 1X9QA 5CBEB 5JA9A 5ID0A 2F54D 3BUTA 4L5FH 1KULA 5HGBA 3NCBB 2JJTC 4FG6D 2Y23A 3O6MH 4ZTOH 1N59B 4WWKA 2F53B 5DD6A 4TOYL 5I71C 4K3DL 3BP6A 1RULH 2XTJC 1F3RB 3IVKA 1Q9WB 4HIJB 4XI5C 2XWJA 2EXWC 3IJSA 2ORBH 3SDCB 1OB1A 4KUCF 5DHXB 5GJTL 2A0LC 4JKPH 2PTTA 3ZDZF 2BVOA 4O00A 1C7TA 3OHXB 3ARBD 3WLBB 1DQQA 3LD8C 2AK4B 3U4EB 1HYSD 3BJLA 3MLRH 1G6VK 1N3NA 3ME0A 1RU9H 3VXRA 2QADC 3BHBB 3AU1B 3ARSA 1A7NH 3MRPA 3K3QA 4UOJA 3L3IA 4FQQA 2VXSL 2EO1A 3RNKA 2O5ZL 4YBQC 3D0LB 1XAUA 1D6VH 5J56B 1I75A 4IRSC 5H35A 1WTLA 1I9JL 3MXVH 5I1DA 5TE7L 3ULUC 1FZJA 1P7QB 1EZVX 4FTVA 1VB9A 2G5BB 4O58H 2IC2A 1NGPL 3S34H 3SE3C 3MRNA 1NCAH 3MA9H 5B38B 3TPUB 1KJVB 1IBGH 4LSDA 4HFWA 1P6FA 4HWBL 2W0LA 2GY7B 5IP4A 3EOBB 2CLRA 2N1KA 3OKOB 4YHLH 3U46B 2X5PA 5JOPE 3X3FL 1JNLH 5I9QB 4M61A 1OSZA 1OPGH 4PJDE 4X80H 3VFUB 3NFSH 3VG9B 3VXRB 2YPVH 4A6YH 3GRWA 1NMBH 4I3SL 2BJMH 4GQPH 4OI9A 2QHLA 1HXMB 4YH6A 4NKMB 4PJ5E 4KJYB 3UTZA 3V6OE 4Q9RL 5FO9B 2DMCA 5ITBL 3OF6A 5BV7L 4TRPL 2IMMA 2DWDA 1NFDF 5FYKU 1PY4A 1UZ8A 4RAHA 2D7QA 4RFNC 4W6XB 2FHBA 3IDNB 4LRNL 2VAAB 3U79A 5AZ2H 5FYLL 3WV0A 3FB7A 4WW2B 4HX1A 4OFYD 3RX8A 4XNXL 1VFAA 3FQTA 4QY8B 2SEBA 5BO1H 3SO3C 1BQHG 5HYEA 5HHPA 1B0GA 2AJSH 5C0NC 5IJVB 2LU3A 4Q58C 2EH8L 3FB5A 1CGVA 3RGVB 5K9JH 2H2SC 3RWFB 2VJXA 1SYSA 3QDME 4OM1L 1GC1C 1F90L 1I8MA 4JCMA 1NLBH 5IWLA 4UBDD 1F6AA 2Y5EA 4XBEH 3MLSL 4CVXA 4UMGA 1DEEB 4NOFA 4IJ3C 5CJBA 1BX2A 5DHVB 5EC2A 2ZUVA 3TIEA 1XR8A 1UM4L 4FQCH 5IWLC 2APWA 4NFBA 2MSPA 5KAQF 3QPXH 4MLIA 3WE6B 2MPAL 1FAKT 1ODAA 1S7SA 4ZO7A 1F02I 2G75A 1AD9A 3MNZB 4WNQA 3V4PH 4LOUD 1DN2A 5DSCB 4FXKB 1CE6B 1EHLH 4HXAL 4MA8H 5LWYH 5LGKA 1RVFH 4Y4FD 1TVBA 4LSTL 3T65A 3T65B 2VDQH 2X1WL 1SJEA 4J6RH 5IFAH 3ZL4H 1EEZA 1OT1A 5B8CA 4KKLD 3CLFH 1NEZG 2Z92B 4S11A 5H8DA 3O2DA 3N85L 1ZA6A 4OCYH 5T1KA 3RZCD 1MAMH 5EOTA 5E00B 2VE6B 1P2CA 5E99L 1S7TB 2P8PA 3B6SB 3V52L 1Y0LA 3TBSA 1KENH 4HEME 5LXGL 4QOKB 1M6OA 5FDWB 1AQDB 1U92B 4FFWD 1SEQL 4Z0BL 5CEZE 2YD1A 3HG1A 1DQMH 4YHLL 5C0EA 1F90H 4XPHL 5FK9A 2XQYK 1GAFL 3CFIC 4LSRL 4L8BA 1DQQB 4LLQB 4RA0C 1NMBL 1MWAH 1T20B 4YHKH 4PY8J 1L7TH 3Q6FB 3LN9A 3NFSL 3UO1H 4H8WH 1P4LA 2VERN 3RVVD 5DMKB 3QFJB 3NVQA 1IZJA 2IQ9H 4CVWA 3F65A 1TJGL 3F58L 1ND0A 4TVSa 1KCRL 4LCUA 1A6TA 4AIXA 1MCCA 4AQ1B 3G5VA 3OKEA 4ETYA 3MACH 1CGUA 4KVCL 4LFHG 3B43A 3CSPA 2R2EA 4HKJB 5FKAB 3UCRA 1T0MB 4HCRL 4PGDB 4KV5F 4WHYG 4Y1AD 4M7JL 5C7XL 3PV6B 3ZHKA 2QSVA 3VXNA 2IF7A 3QA3B 4Z7WF 1RZJC 1GZQB 5SWSD 4ZUTB 3WMSA 1QFHA 4N9GB 1BQHA 3NPSC 3FL7A 1U8MA 3D2UB 1EJ6A 3MA9L 4RZCA 5E56A 5TE7H 3VFMA 3GKWL 3EOYG 2ADGA 3DRTA 3C6LB 4ENEC 1UXSA 5CGMA 3QDJD 2HA1A 1MCLA 4G6JL 2UWEF 3EO1B 1T1ZB 3GNML 4S0TD 3OG6B 4L1HA 3L3KA 1DEDA 4B0MM 2E9WA 4J3WA 5BS0E 2WBKA 5JXED 3O6FB 5DHYB 4ODSL 4ONFL 4OFDA 2RQ8A 4U3CA 1S9YA 2CDFA 1I8LA 2DQCH 5DJAA 6FABL 5KSVA 2E7BA 3MGTA 3NAAL 4L8SB 1YY9D 4RX4D 1CU4L 4H5SB 2VL5A 1PJ9A 5H37G 1QPPA 5CKAA 1XT5A 3G5YB 4RAVB 4WI3A 5HHMD 5T3XH 4LVHC 2YPVL 4N0UE 2J3SA 4M6OH 4HPYH 1L9NA 1QLRA 2BOBB 3KHQA 1YPZB 3INUH 1J0IA 4IBLT 5HY9B 3T3ME 3RU8L 3K1KC 4Y4HC 4YDJB 1AO7B 2VDRL 4LPVA 1NMAL 5E2TH 4OV5A 2AK1L 3GHBH 5F3BB 5AZEL 4OGYH 4GKOA 2W0FB 3BP7B 2VZOA 4Y8DC 1FG2B 1MFEH 1K3IA 2FZ3A 3RWJB 1ZEAH 1I8KB 3GIZL 1RULL 4O58L 5F71A 5JXAH 4JQVA 3G5XB 5EOCJ 5DJZB 4DW2L 2W59A 4NNPH 1ACYH 3GNMH 3ARXA 1IE5A 4U7KA 5H94A 5B38G 5DUBB 4PJBA 5D8JH 3QISA 1H0DA 4JFPB 1RK0A 1HH9B 5EU5A 1HHJA 1ULVA 4KK9C 5DD1H 3WNNA 1KELH 5HHPB 3PL6C 2BVTA 2ED9A 2A73A 3HI6L 3OAUL 4OGXL 4ZD3H 1MCRA 2D31B 1Q94A 2YPKB 3HFMH 1E28A 3MRIB 4ZNEE 3S36H 3VXRE 4OD1L 1J5OH 1A3LH 3OB8A 5EWIH 4WFHD 4LIQH 4Z7OE 1NUNB 2I5YL 1KN4L 3S37X 1EVUA 4O9HH 5D7LD 4LSSH 1U42A 5GRJL 3V4VL 4FFVD 1CN4A 2VIRB 3IU4H 5AWNH 2BVUA 4IDJL 4WEMB 1BZ9A 2DQJL 4JFXB 2IH3A 1CLOL 4UQ3B 4XCCL 1RUML 5I1CH 4X6DB 1JUFB 5J12B 4MCZA 5HGDA 1QR1A 2G75B 2I25N 4RFNB 2D03H 5B21A 3H9HB 3QUXC 5JW4N 3VI4F 1HSBB 4ONOA 4G6KH 4YHML 2DQTH 3H3KA 1U6AH 2J1KA 3ULVC 4QGTA 4DAGL 3ELAT 1G9NL 4WWKD 5DUPL 1QHOA 2WWMD 3HAEG 3VDAA 3HA0A 3TJEH 2FCBA 5MEOB 3QUYD 1DDHB 1S9XA 3DVNB 3UC0H 2JCCA 5DRXB 1KCSL 25C8H 2GJZB 4HFUL 4IHOA 1T89A 4QRQA 5CGYC 5L7XL 1JGDB 4QHMA 3VG0H 3MO1A 2O61A 2BRQA 1M05A 1T04B 5KZCD 2FIKA 1W72A 1AKJD 4MSWA 1INDH 2YPLB 4LLUB 3KPTA 1JFQH 5FGRA 2BNQD 2GSIB 4NN6C 5BZDB 1JV5B 4FQIH 4HXAH 4UAOB 3MODH 4QRPA 5IFJA 1CGSL 4RIRA 3FCTB 4XC1H 4ZODA 1QLEL 4YDLB 3FO9B 1LD9B 4B41A 1QVOA 3IU4L 4YIQA 3SGJC 3GSVB 1G6RH 4FFZH 2QEJA 3TZVB 5ISZB 1Z5LA 3BZ4A 3KPMB 4TSAH 2DICA 1DBJL 1GGCL 3B9KC 1JWUB 2NLJB 1JYNA 3UYRH 3ZYIA 1EXUB 1Q0XH 5EZIH 3T04D 3HG1B 1GJIA 3E6FA 3MLWL 3OXSB 5C0ND 1N7MH 1PEZA 4Z8FL 1F6LL 3CVHA 3WHXA 2X4OA 5L88L 3OR6B 4NQUA 1NLDH 1Z3GH 1RI8A 3QYCA 1N6VA 4LKCB 4KY1H 2QL1A 2AVGA 4OKDA 3V7AG 3BP6B 4K7PH 4R4FL 3SKOB 1YMHA 2EYRA 1BBJB 3LKPA 3HPLB 2V9RA 4G7YL 4ZSOB 1IAII 1M4KA 2DJ4A 5DURD 2WLYA 4QXUH 4RAUB 1T7ZA 2V7NB 2AJ3A 3ROOA 3MNVB 5JOFA 4WI9A 2VLKE 4U1IB 4AZ8A 4KVNL 3NOIA 3V5DB 3X3GH 4Z5RB 1KCLA 1IT9H 1IGIH 2GTZA 5IB1A 5FGBC 1E4XH 2P8MA 3DROB 2A6KB 1F58L 1LK2A 3SKJL 4PRIA 3MRHB 2OR9L 3KPLB 1A21A 4NKOA 1KYOK 4LPTA 1B4JH 2IQAA 4JFQA 4EEEA 4H25A 3TH3T 1EMTH 4MD4B 4QF1A 4PJEA 3LEVL 3ZE0E 1BZQK 3KNBB 3V2AR 1QR1B 4OCSL 5IHUH 1P5UA 1D5MA 5F7DA 3L3GA 4P2QA 5HDQL 5IG7B 3T09A 2AV1A 4QYOA 5T5FL 2DQCL 4M62L 4LPCA 4DTGL 1CFSB 5CZVL 1NC2A 1YJDL 3IRZA 1AJ7L 3LRHA 4POUB 4WV1C 3BSZL 5D1QC 3U0PA 4EI6B 2PTVA 2FIKB 3HNTL 1N4XL 2V5TA 3HAEH 1MIEL 5TE6H 1IEHA 4OQTL 1WK0A 1RSFA 1SVZA 4KTEL 3ZT5A 3TJHD 3K4AA 2PCPB 2DWDB 4R2GB 5TH2A 5CBEA 2WLZA 5CUSH 1I4FA 1MVUA 1YY9C 4PJ8B 1HSAB 5L0QC 1XF4A 3M17B 5C0AB 5EZOL 3CLEL 1XR9A 4KK6C 3QDGD 4Y7MA 2NYYC 1KB9K 1A6ZA 5TDPB 1OW0A 4JN2A 1HE7A 2VZ3A 5IMOA 3F7VA 2CDEB 3U9PL 3MZTA 1QFUH 2CLVA 4QRTB 3T4YA 3T4YB 3KPOA 1S5HA 3T77B 4K2UL 4P5MA 3C5ZA 1YC7A 1KN2L 3QH3B 4JDVA 5FDYA 3QQ9C 5E8EA 3QUYC 3C6LC 3EJYD 3OKNB 2R1XA 2OTPA 3QCVL 3V5KA 3G9VA 4NQXA 1Z9OA 2XA3A 2OLDA 3UZVB 1KLUA 1AC0A 1UB6B 3AROA 4IMLB 4LNVA 4X6FB 2N7AA 2GJJA 2RR3A 1F6FB 1F3JB 5D1ZD 3ESUF 3SCMA 4ZFZB 3WD5H 15C8H 2NCMA 4NPYA 4Q0XH 5F1IB 4NWTL 1J87A 3IKKA 4L8SC 5GS0D 3L7FA 3H9SB 1FE8H 3DGGA 4OQTH 1K8DA 2Y7QB 3B5GA 3HE7A 4K3EL 4G7YH 12E8H 1YUHA 4RFOL 2EECA 1U3YA 3P4NB 3WHE1 3DO7B 3PHOB 3D9AH 1R3HA 2F9BT 1OP9A 3CZFA 3OGCB 4G9FB 1C16B 3HZKA 2MHAB 4WUUB 2UVEA 4UB0H 2CH8A 1NGZB 2E27L 5E8DH 1C5BL 2ZUWA 4UT6H 3TPKA 1EH9A 2B0SH 4L3EA 4NQED 4X9IA 4P4KA 4PJCF 3SBWA 5CCKL 4EDXA 3I3BA 4TUOB 3Q3GB 3RQ3A 32C2B 3KPLA 4JM2D 4IEFB 3E2HB 3MLTA 4L9LA 5FYJD 2WWKT 4G8GD 4D2NA 1X7QA 4M5YH 1F11A 4GSDH 4XNUH 2EC9T 4MDIB 4X7SL 3JVGC 4YR6B 5IUSA 4TNVK 4YNYB 4XPFL 2DBJA 1TCMA 3ARBA 3QCTL 1P6AB 5DD6B 3JVGA 2FX8L 3EW3B 4H1LG 1RU9L 2MKLC 4LLMB 3GMNA 1BBJA 3LKPB 5ERWA 1HHJB 5MHSD 2FLBT 5FB8B 4OUUA 2HJKA 2VLKA 3I6GA 1GYAA 4BQ9A 2ZG1A 2EXYD 1UVQA 3BMVA 4LVNB 5H94B 2LQRA 4NQTA 3EJZC 3BZDA 5J7CC 1INQB 3CMGA 2I9TB 3RU8H 4P2OD 3S96B 3BE1L 3HE6D 5JR1H 3BKYH 1V8HA 4JG0H 1XIWC 4OZIB 3RWGB 3TO4D 4WU5A 4KRMB 5AZ2L 3NA4A 3GMRA 1YMME 1I1RA 3QWOB 4R96A 1SMOA 2P5EE 4LSQH 3BISA 1FVEB 4OTXH 3VFMB 5F89A 3RHWK 2F74B 4U6YA 4ZYKA 4PJXE 1U6AL 1OT2A 4XCEB 2MQ0A 1FH5L 1KPRA 1H3GA 1AXTH 4JM4L 1S7QB 4M8VA 4QOKE 4XXDA 4F9LC 2NQCA 3ES6A 4GXUM 4MMXC 1I1FB 1EEZB 1J12A 5C09D 3VA2C 3Q6GH 2DI8A 2IJ0C 3EO0A 3DSNA 5EBWA 4EI5D 4M1GL 5T5NF 4Z18A 2YXMA 2OX5A 1E4XI 2J8UA 5E6YA 1RUPL 1NGQL 4OCWL 1CXHA 5F6HI 4O2CB 1RK1B 3UJTL 5EU6A 2HT2C 1FVDA 4HPOL 4POZC 4G42B 3HB3D 5EWIL 3GJEB 1ZA3B 5BRZE 5FEBA 4GG6B 2NY4B 2DLFL 4HXBH 2IADA 4M7ZB 4G8IB 5J13C 5DHVA 4Y5VC 5C07D 2XN9B 1BD2B 3D85D 4OZIE 1W8OA 5I66B 1D6EA 3JV0A 3WIHA 4HZLB 2X05A 5HI3D 2CQVA 1G0XA 3QJHB 1T6WA 1WCBA 3TYFB 4HS3A 1L6XA 1JZ2A 3BD4A 4JO3L 3BPCB 5HYSA 4ZTPH 3G6JA 5SWZE 1T1XA 4LU5L 2X4NA 4AM0A 5D93C 4PGDA 1J8KA 1HOCB 5F9JB 3S4SA 4QHUB 1FC1A 3OSKA 3BGMA 4OKVB 2BY1A 3TC9A 1I9EA 4AG4L 4FZEL 2Z8SA 1QG3A 5JDJA 3FB7B 4WW2A 1SEBA 3GRWH 3L3DB 5I15L 2FEDC 4HIXH 3KPQA 3THML 4H26B 4ZYKB 3SDCC 2VITB 5GGSB 3FHQA 4RQQA 4G6FB 3MUJA 1KB9J 1IC7H 2D4DA 2Q7NA 1KCUL 5GIRA 4NKMA 4HLJA 4JZOB 3GHEH 3QXWA 2APVA 4JFHE 3QR2A 2W07A 3QIWA 1FBIL 1VERA 5DJ6B 1XCQA 3GDBA 1M7DA 1JJUA 3SKMB 1A7RL 2EDLA 5KVDL 2WIMA 2FBOJ 1XMWA 3ULUF 1CCZA 2X4RB 4U05A 4TULH 2DDQH 4JG0L 3CX5J 3PL6D 1YN7B 4M43H 1AO7E 1PD6A 4TPRH 1CTNA 4KWUA 4N8VB 5D2NA 4G8FA 2JIXD 3J7HA 1PY9A 2PKDA 1P1ZA 4YAQB 3VCLB 1MLBB 5CCKH 1NAKH 4KK8D 2R4RL 1D5IH 4LSUH 2C7UB 2DYPB 1NLBL 1JVKA 4LOUC 1MNUH 3QI9D 1LP9B 1FFRA 1X3DA 4LPUA 3EUUA 4WO4D 1OTUC 1CLCA 1FYTA 3GK8H 1I85C 3BKML 1YYLL 4K3EH 1GXEA 4S2SA 3QNZA 5HI5D 3W39B 1XIWB 1QP1A 4P2QB 4DKAA 1QYGL 4JANB 2X4SB 3BYTA 3CPLB 3VXPA 3MV8A 1N3NB 2HKHH 4PJEB 3P40A 3T8XB 5B22A 1KUMA 2ESVB 3MRKA 1WFOA 1NL0H 1A4KB 3NCEB 4LPXA 1EA9C 3GJEA 3NZ8A 3SY0B 5AUMB 4KKAC 4PUBL 2HVJA 5HGHA 1DZBA 3GHBL 1U93B 2R8SH 5DMGD 3UTTD 5C0GA 4PJAF 2Z92A 1NUDA 3GKZA 3RVTC 4PGBB 1B6DA 2E7CA 3TPUA 1HHIB 3QRFM 3GI9H 4JZJC 5T33H 3LEXB 4GSDL 3ZT7A 4BQ6A 1X4YA 4OZHA 3FOMB 4D9RD 4N8CL 4QHLB 3KDMB 3MREB 3GI8L 1Q1JH 4I0PA 1I8IA 3P3YA 1MIML 1MFDL 5F88A 3OKNA 4BK5A 1H15A 4XH2B 1A7PH 1P4BH 4HMDA 4JM2F 4XPHH 5TQ2L 4UBDC 4JQIH 1MCWW 1EV2E 3A6BL 3VXME 4F15C 3PE9A 1QQDA 1W0WB 3UTTE 2VKXA 4M3KB 1TENA 5I2IA 4HK3N 5F97E 5SWZA 1X6NA 4PRAB 12E8L 1R5VB 4RFOH 1X5HA 4I5BB 3RL1B 3D48R 1FE8L 5I1AA 1D9KB 4RAUA 3ROOB 4BKLA 4Y4FA 3MYJB 3VW3H 4J3OC 3KR3L 2H9GB 3EO9L 5F44A 2VDKH 3TYGL 3BKCH 4Q9QL 4QGYA 1R3LA 3QQNA 2DDQL 5BRZD 3VXNB 1MCJA 4A6YA 1K9TA 1FGVL 1K2DB 1GOHA 1M71A 4FP8L 1G7HB 2OSLA 5FIEA 1RZKL 2R8SL 1AR2A 2OM5A 3HE6C 3DMMC 5CBAB 3IFPB 5T1DL 4IM8A 4L4VB 1MCKA 3MFGB 3IF1B 1HYSC 4UTAL 5I1DB 4RBPK 1R3IL 3EZJB 3U36A 4NGHL 4X6DF 4HV8B 2PW1A 2AJVL 4EUPA 3WFDL 4F7PB 3UP1A 4M7LL 4CNIA 5FYJL 3ILQC 1A2YA 3DVFA 4R4BB 4PY7B 4HG4J 2EDDA 1NANH 2ORBL 4ODHH 6CGTA 3THMH 2O5XL 4P4KB 2IFFL 3SPVB 3X13A 4O2EB 1V7NH 4AG4H 1S7SB 2X4SA 3CPLA 4JANA 1BLNA 4CJ1A 1C16A 3UZEA 3EDKA 2Y1VA 1VFMA 3OKLB 1FYTB 2BSTA 3AREB 5DC0A 3V0VA 2XG5A 1BF8A 5T1KB 5IVXB 1VGKA 4M1DH 1BVKA 4XCFL 5F7EL 5IW1B 2DM4A 3GSNL 1JN6A 4JKKA 5AWNL 1K4CA 3QEGH 5INCA 2VLJE 3ARFA 3VFRB 1JGDA 2ARWA 4N5EC 2Y25A 4YXLL 4L3EE 3SDDC 2YUZA 2CKBB 3TT1L 2GT9A 4KI5C 2IFGA 5DO2D 4OCNC 3LN5B 1KF9B 3QDJA 5JO5A 2B4CH 3KS0H 1OSPL 3HUJA 2IALA 2GIYA 1UT9A 1GGCH 4JFEE 1ZVSA 3BX7C 1EBPA 3UJJL 1UACL 5D9SB 2UV3A 4JRYD 5GS0C 2XY2A 5ELIA 4I4WA 3IDNA 4P2RD 5SWZB 2AK4E 5D7IF 5D7KD 5KSBF 2IPTH 4MNQD 3FFDB 1XCQB 5JHLL 2FHFA 4CMMA 3JV6A 1EAJA 4ODUA 1EAPB 1ZHNB 4CADB 2H1PL 2ARJA 3PDDA 4RMUA 2PXYA 1I9RH 2FR4B 3TT3L 4NZDA 2FO4A 4OF5A 1CGWA 2CK0H 1I1AB 3VXPB 5IESL 2NX5A 1S7RA 4J1UA 2P5ED 1AXSA 2YD4A 5DMYA 3I50H 1VKXA 1CWVA 3OAUH 4QRRD 4DN4L 1P7HL 4BSJA 3SBWC 4FQ2L 4ORGA 4HKBB 4PB9L 5F7HA 4MXQD 4YDKL 4V2CB 2EC8A 1T7YA 1ITBB 4L5FL 2JLLA 4ZUWB 4ZO9A 3QEQA 3U1SL 2XPGB 3NIGE 3MODL 4YDIH 3D3VE 2RFXA 4O4YH 4DKDC 5KVDH 4RNRA 4QHMB 2R29H 4F58H 3IFOA 4JR9H 4NCDA 2FO1A 1IBGL 2R0KL 2D03L 4JM4H 2V9QA 3GMPA 4UILH 4NO5B 2F54B 1VACA 1ZHKB 3UAJD 2X9YA 1J0KA 5F70A 1BPVA 1KCSH 3Q0HA 1OSZB 3L5HA 1QFPA 1UWGL 5EU4B 2ZSWA 4MCYB 5D1XC 3FMGH 2DM3A 4AMKH 4PRDB 3RVXC 1VADA 1CLYH 5C0JA 4LRIC 3MJ9A 2D2OA 1AO7A 3SDCD 1MUJB 4K7PX 1UB5B 5GS2H 1QFWM 3VA6A 2YXFA 4WWID 2F58L 1IGCH 2PYEB 4LSVL 4PJIB 1OGAB 3DMMD 1KB5B 2Z4QA 4P2QE 4YFLF 4ZS7L 3ISWA 3SN6N 4GRLA 3VXSB 1ZANL 1RPQA 4NUJA 1JHTA 3ORJA 2FBJH 5DR5L 5D6CB 4U6XB 1Q38A 2AK1H 2Z35A 4PJXF 4QHKJ 4OKVA 1FL6B 3V0WL 4OFKA 4ZAKD 1I3GL 1IGTB 3VFWB 3ULVL 1HH6A 2J2ZA 2IPUK 4GW4A 4HUXA 4X7TA 5C0RH 1ND0B 1CI5A 1ZSDB 3MUY1 3T0ED 4P4KC 5JPNA 4HJJL 1X5FA 4UILL 2VLJD 2ID5A 4JGMA 5DUBA 3FFCE 2BNUB 1IJ9A 3BI9X 4WV1B 4HT1L 2BERA 3MLRL 1MI5B 1MI5A 3BUYA 3BUYB 5DTFA 3HC4H 4PRHB 3CFDA 5CP7A 4AYFA 5MEPA 5MENB 4EQ2A 4OCLC 3UROR 5KVGL 2HLAB 2Z8VC 1W0WA 3L1OH 1A9EB 1BEYH 5T1LA 2WUCL 3ROLB 4MJIA 4KQ4H 4PYGA 1IFHH 4ODVL 4R26H 1RJZB 2WMPA 4G42A 5I8KH 3MRLB 5GS1B 3I50L 5BZWB 1JF6A 3RY6A 4XCFH 1NGYB 5DI8A 5F7EH 2VB5A 5SV4A 2B8OT 2H2PD 4YDKH 4KK5D 2HLFD 2GCYB 3LKNA 3ET9F 3S37L 4Q74A 1OARL 1FJ1A 4XPAH 3LB6D 5B8CB 3IDYC 3FT4B 3VFSB 4XCCH 4RDQF 1EJOH 1AQKL 1TVBB 1LO4H 2N4IA 4PRPD 5IHLB 4IOSD 1IL1A 4H5SA 1URLA 3ARGD 1RD6A 4CGTA 4YBHA 4AENB 1MCPL 3R0NA 4P2RA 1VCAA 2EDQA 5LXGH 2G2RB 2GW5A 5ICZA 2E6QA 4WFHE 2ZPKH 3V52H 1VADB 3ZKQD 4Y1AA 3HZKB 3NCYS 1OW0C 4K2UH 5CZXC 1YA5A 3MV11 3O11B 4MCYA 5HYQA 3MV8B 1LO3L 3DBXB 4O02H 3MRCA 1NAMB 5KVEL 4OZHF 3A6BH 5CEYA 5HYJA 1GPOL 5EOTB 3K74B 5CZVH 1U58A 4D9QE 3CSGA 4LSPH 5T5FH 5EZJB 3VWJC 1WICA 3T0DA 4F7CA 4Z76B 4DZ8B 4M7KH 2OMBA 1FPTH 2RCSH 3PDOB 2ZUUA 4E41E 1UVQB 4WRLA 1V7MH 2IQ9L 3VD5A 2O5YL 1U8KA 4H20H 1E6OH 4PRBA 3I6KA 3MACL 5D1QA 3WNMA 1II4E 1XGTB 5E94A 5D72L 1IKNC 1JNHA 3BQUD 4IOIB 1KPUA 1BD2E 3GO1H 4LRNH 1CGTA 4J4PC 1C5BH 4UT6L 3BIAX 1FGNL 5KSAA 1JIBA 4LSQL 1WISA 2X09A 4UQ2B 1NMAH 5CILL 5T1MB 4B7LA 4AY0A 1N5YH 5LGJA 5IM7A 2I07A 1OGAE 4KTDL 1ZVHA 3WXVH 4D0CB 3REVB 1UWEH 3FO1A 4IJ3B 3M8OH 5GGQH 1FLTX 2BX5A 2VR4A 4X4ZA 4X6BA 5KVFH 1OTTD 2DKUA 2F8XC 3SDDB 1RZGA 3SKNB 2JCCE 1FV1A 3UJJH 5CGTA 3RZCB 5KTEH 4ZNEA 4XBGB 4H88L 2Z93A 1MFAH 5GGRY 1EIBA 2AJXH 4OLVL 4KJQC 1KLFA 2CK0L 5CEZD 1JL8A 3MROB 5EBWB 1H3UA 2YR3A 5E00A 3CUPB 2VZ1A 1Q72H 2DAVA 2C26A 5D1QB 1SY6L 2WK2A 1X7QB 2C3VB 2APXA 3MPCA 2C4FT 3BW9A 1ZVYA 3KJ4C 3LSOB 5J1AB 4YFEA 1QRKA 1KTLB 1A0QH 3CLFL 4XX1G 5IG7A 1PSKL 3IFLL 4FTVB 4N5UA 5DRWB 1JNNH 5FGCB 4K8RC 1DUYA 3DXAA 4LSTH 5DQJB 4RMRA 1FLRL 1G9NC 1TITA 5KSUA 2GJ6E 1S5HB 5C0BE 4L1DA 4PGCB 2WV3A 4E41D 3VFUA 3V0VB 1H8OA 1DANT 4YUEH 3JTTB 4NKOB 2AKRA 5CSGA 5BRZA 1UCTA 3SO3B 3U4AA 3QO1A 5TDPA 1C5DB 3B2UD 4HUNB 4UIKL 3KWWA 5L9DH 4M6ML 3D2UD 4R7NA 1MVUB 3V95A 4PPTA 1ZE3C 3TJEL 3LZFL 4JM2C 1S3KL 3RP1A 3DURA 1PVHA 4MDJB 2EDXA 3NTCL 3GMQA 4Q6YA 3CVIH 1OB1B 4X98A 5I6XC 3IT8D 1BBDH 4ETQA 5HHOB 1T5WB 1G1CA 4Y5YB 2GYSA 5BS0A 1YC8A 5DJ0A 4ZS6D 4LKCA 3FQUA 1HQRB 1A6TB 5ICXB 5E8EB 3L3IB 4GKZB 4DCQA 2DMBA 4XCNA 3RWIB 3MV7E 1EPFA 4IRJD 4IIQA 3LEYL 4Y4KB 4WW2C 1A3RH 3HE7D 3ULVH 1XCTA 3S35X 5IMOB 1HI6B 1I7UA 5I0DA 4OT1L 1U8PA 3DRQA 5A3IC 4MNQE 3ZL4L 4E0RB 1IAMA 3MBXH 2PXYB 1BMGA 1LK3H 4QHNB 5FGSA 4MJ5B 1AQKH 1ZSDA 2X4PB 1QUNA 3ULSA 2E9BA 2GAZB 2EDEA 4D9LH 5HYJD 4WY7H 3LQZA 3DPBA 4P57B 5EZIL 2KH2B 5HYFA 4HS8H 2APFA 3ZT6A 5GQBA 4LVHB 1DUZA 1CICB 4ZSOA 2AEWA 7CGTA 1LVEA 2AXGB 3KPSB 3WDJA 3MRFA 2ICES 1K5NB 4OZFH 1I7ZB 3IDGA 25C8L 3SGKA 3GMNB 1RJYA 5AAWA 4JFZH 3RUGB 1NC4D 1M05B 2H26B 1UYWH 5DEGA 3D25B 1SY6H 4NO2A 4XMPH 1K6QL 4ZFFB 1UH4A 3REWB 3SDAA 3GSUA 3K80A 1JMZA 3MYZA 5TFSH 3S36X 3K81A 3WKMH 3B9EA 4WNQB 4G8GE 2IPKA 5C3TA 2IAND 5GPRA 5EO0B 4M93C 1ZAGA 4WHDA 2V5RA 1OTSC 1W2KT 1BM3L 1UENA 1G6RL 2XG4A 5J3HC 2D7PA 3T0EE 1V3LA 4LLDB 5FKPB 3KYOB 4F9LA 1T0NB 5FCUL 5CJ5A 1LO4L 1NGZA 3FTGA 4FQJH 2Z31C 2ZUYA 5D7LB 4GJTB 3VGDA 2DQTL 4YE4H 5FO8B 5TF1L 3FO0L 4TNWK 1QSED 3RWCA 4OFYA 3T4AB 2YA1A 5KVEH 5IB3A 5KG9B 1U8HA 5IKCA 2VR9A 1NGXB 5BXFA 5KOVC 2H32A 5LAXB 2ZUSA 3C09B 5FUOL 4WJ5B 2BDNH 1UEMA 2M1KA 5IB2B 1JWMB 4DVBA 2ITCA 1YN6B 3FQTB 3IF1A 4TSCH 3DVGB 3RAJL 4K7PL 4R4FH 4U6TA 4Y5YA 5F6HJ 3EOAA 3KJ4B 3MLYL 2R23A 4GQ9H 3WFEH 1B4RA 3P0GB 3KYAA 3QUMB 2AXGA 2B2XL 4HULB 4ZD3L 2PO6C 2EYTA 4UV7L 43C9A 3PP4L 4ZOAA 4LMQI 1QRNB 4F9PC 4Z7VB 4OD1H 5IT2L 3ARUA 4NM4L 1UH2A 2CRYA 5KZCB 3MBXL 1AKJB 1PBYA 4HWNA 2G5RA 2YPLD 1TQCB 5C70A 3TVMA 2C1OB 35C8L 3BEVA 4GRLD 1P9MC 1EEUA 2UZIH 3E0GA 4Z95L 4YQXL 3L9RA 5J4MA 4K7PY 1DSFL 1JF5A 2PUQT 3HC0B 1BVLB 1UA6L 4AL8H 2BK8A 4LRIA 3KDMA 3MREA 1MJ8L 5GHWL 4XWOC 2EDOA 3REWA 3N9GL 3IXTA 3SDAB 3BT2L 3KPQB 5IVNA 5FECB 1N6QH 2BOCB 1R24A 4BH8B 4J3TA 3QNXB 3GSXA 2CPCA 1LO5B 3BIKA 2VLJA 2P48B 2YHGA 3FRPG 4NKIL 5I74B 3HG1D 1O5DT 4GAYB 4XMPL 4X98B 2YPLE 1KXQE 1R5IA 5KSVB 4MXVF 4XGZB 3RDTA 3DGCR 4GRWH 4YGAB 5FYKD 1P4IL 1MCHA 2BVEA 1QRNE 2V2XB 1XGPB 1KJMB 4O2EA 3WIIL 4YHZL 3NACH 3W11C 1RURL 4CBPA 1XGQB 4OLUH 1QEWB 2R56H 3AS3A 3W0WA 1RZKH 3QZWB 5EZOH 3L3JA 4WI8A 3HI5L 4BSWA 2BVYA 1YMMB 2X2YA 5DVOA 1JNJA 3MA7B 5IFJB 1FQ9C 2VDML 3MJ7B 1UGNA 1NFDE 5DJ0B 2VLMD 5T1MA 3D39A 3HNVH 2R2BA 4XP9L 4AH2B 3RTQB 1J18A 5KW9L 3WJLC 4MSWB 1T7XA 2JJWA 1DVFA 4WCYH 2MOVA 1MCSA 5DMGC 2CMRH 1WEJH 5BQ7B 5JMRA 4U1HB 3DSFL 1OAQL 1DCLA 3MLSH 5D2NB 1JGUH 4BSVA 3DURB 3QDMD 2ENYA 4Y8AA 5MEOA 4M62H 4G8EA 1TETL 1CTOA 4F8TA 4PRPE 4LP5A 3V9FA 2A9MH 5HHQA 4JY5L 4GMSH 5J1SC 1KG0B 5JQ6L 4HZAA 4DZ8A 3B2UC 5DJZA 3MLXL 4FQLL 4RWYH 4PRAA 2MJWA 1YZZA 3LEYH 5E9DB 4KQ3H 3V4PL 2DIAA 4WV1A 2V17L 4GT7A 5F8QC 4JCLA 4L4TD 2PW2A 3BKJL 3QIBC 3SDDA 3H42H 5DHYA 2WW8A 2WUBL 2IH3B 2Z31D 1H3TA 1I1CA 3DIFA 4D3CL 1ZHLB 5ABDE 2M26A 1J1PL 3EYSL 3L3KB 1E4XL 3IXAA 5DC4B 2BY0A 3TT1H 3BDBA 4OIIH 3EYVB 2P8PB 3B6SA 1DUYB 3B5HA 4UI2A 2NX5E 4YUEL 5KS9B 4OFIA 1YEKH 2IH1A 1FZOA 3VFOA 4OZHB 3QRGH 4FP8H 3VXMD 3DRTB 5EO9A 5IBLC 2P5WE 4MS8D 3NCMA 3TVMC 3HE6A 4HK0B 1G9MH 4KI1A 1DQML 4LLYA 4H8WC 3CFKA 4QHUA 4G43A 2IBZY 1OAUL 1OWRM 4MDJA 5J0BA 5IK3B 4X83A 4XBPB 3S9DB 1NLDL 1Z3GL 3DARA 4LSRH 4OZGF 3MUHL 5AG8A 3JWDH 3QEHB 3WS6C 1R3JA 3MLTB 3CVIL 2IFFH 1SM3H 3T8XA 5CEXB 3OKKA 5SX5K 1Y6NR 3Q3GA 1IARB 2V2WB 5FHBL 2ILLA 5F1KC 4MA8L 5LWYL 4Z7WA 1NFIA 2UZYB 3JTTA 3DBXA 5C6TL 1JPGB 4LLQA 5HHVL 5I1JL 5CAYB 4LDEB 4N9GA 1CBVH 2GSGB 3H9SD 4PJAB 1RUAH 2ICWA 1MY7A 5IIEA 3NN8B 5E94B 3TZVC 1E6JL 5CSZB 5BOPA 4NZTH 1MHPH 5C0CB 1NEZA 1HIML 1IGTA 2COQA 1LK3L 4NN5B 3GSNA 4M93B 4WHYH 4X5LA 2Y07H 3SE9L 4WUUD 3SDXB 2MMXA 3RVXD 3VRIB 4HKBA 4U6XA 3JUZA 4P9HH 5JW4M 3KPPA 3KPPB 4NQEB 3IXTB 4FXGA 3UTPD 2NTFB 3H0TB 1T2QH 1MHCA 4TUJA 5AYUH 5DXWA 2IAMA 3G6DL 4UDTA 4OLYH 2VLME 3R4DA 2XQYG 3SKMA 1L7TL 4LDLB 1RJZA 3R1GL 4XBEL 4OJFH 1UWXH 3EDEA 4KDVA 4PJXB 1FV1B 2IBZX 2OTUA 2OTUB 1FPTL 2RCSL 4MNHA 5EU3A 4GMSL 1F3DJ 3V6ZA 2FDBP 1I7TA 1M1SA 1CFVH 4XWGH 4DEPC 3U0WH 1ADQL 5T3XD 4EIGB 2JF1A 3RKPA 3BKJH 3DMMA 3MLPA 4YHZH 4CN6A 4ZPVB 3O3DB 5HHME 1DQJA 4FQPA 1G9MC 1KTDA 4ODXA 2AI0H 2CD0A 3W9DA 3T2NL 4KC3B 4DVRH 5C0IB 2OR9H 1G7PA 3OZ9H 3QI9C 3AUVA 5J3HD 2LTQB 4NOBA 3VFSA 2VSDA 2X7LB 2NNAB 3GSNB 4PJ8C 2D9CA 4KMQA 4ELKA 3ECBA 4NHCL 4P2OB 3RIAK 1Y18B 1Y6KR 1WBXA 3NABH 4Q9BA 4M9PA 3JWOC 4Q2ZA 2WBWB 4PJFE 3RA7L 5ACLA 5GRZA 4M8QB 4CMHB 4CVUA 2BRRH 1OLLA 2F19H 1KIPA 1GH7A 3WNPA 2GSGA 3HRPA 4MNQA 2BOBA 4RMWA 2XA8L 3QDMA 1XZ0A 1YEJL 4XTRC 1U8HB 5IKCB 5AD0B 5K9QI 2VAAA 2W9DH 4HJGA 3V79C 4QYOB 2AV1B 2LU7A 1QSFD 1GGIL 4ELME 1UM4H 4HK3J 4UNTA 3X13B 5J6HB 1JRHL 3TFKC 4W68A 5B3JE 4P2YA 3OTTA 4NO0A 5FKPA 2YD2A 1Q72L 1ZXQA 3X17A 2YEZA 4MD0B 2AK4A 3U4EA 3QJFA 2EKSB 2ADIA 3T2PA 4UV4H 4X5WA 2PTUA 2Y7QA 2PO6B 3WXWH 3SJVD 3WUWA 4MA3A 5D6CA 2Y9RT 1RURH 3ZYZA 1BJ1H 1U3HC 5ILTH 1FL6A 1NMCC 3LHPL 5DJDB 4JO3H 3GSRB 4YQXH 2XN9D 1OWWA 4YHNB 4IS6A 4C56E 1OVZA 3V5KB 4G6KL 4YHMH 5FUZL 2VRAA 1C08A 4PRID 3D0LA 4P48A 3TNMB 5EIVA 4Z77B 1MJ8H 1FH5H 3FT3A 4XVSH 1WZMA 3MRPB 2D9QB 1A9BA 4HHAA 3ARDD 4TTDC 3X14B 5KJRL 1C8PA 2JJUA 2VH5H 3TH2T 3KPOB 4U3XA 4ONFH 4M7ZC 5J13B 4I8DA 3UC0L 4PJ9B 1OAYH 1U8OB 1ZHKA 3OKOA 4H20L 4K71B 5D2NE 3FO2B 3ZDYE 3KPRE 3IFOB 3N1MC 3DX8B 3T0AA 1AI1L 3GBML 4JY5H 4M6OL 3QB7C 3W5NA 3E6HB 3F7RA 2IAMC 1T22A 4K23L 5E8OA 3D18A 3S37H 1EUUA 4LBEB 2EIEA 4NHUA 3OJVC 5D7IA 1DLFL 5DJDA 5H2BB 1W72H 4MNGB 1FZJB 1HHIA 1P7QA 4EI6A 3LQAL 3Q1SL 1U8JA 1AGEB 2VDRH 1X5ZA 3H9ZA 4QT5B 3ARDA 4JFEB 3BPOB 1MCPH 4OB5H 3QHTC 2GK0B 4UU9A 2PYEA 2LVEA 3PL6B 3BO8A 2CK2A 1QD0A 5HGBB 1TZIA 3CNKA 1S7XB 2OZ4A 4QRSA 4N0CC 3IDXL 3MJ8B 1KJMA 1FNHA 4MHHG 4S1SL 1EAPA 2P7TB 3EYFB 4H1LA 2HN7B 4JFFE 3KYOA 4YXKL 1YECH 4JQXC 1WAAF 1FFNA 1KGCE 4K9EL 5L7XH 4FQXA 2WQ8A 5K9OB 1F13A 2CLRB 2Y5TA 1NKOA 4CMMB 3BGFB 4ERSL 4WI2A 5C0DB 3MSPA 4M5ZL 4EN3B 2Y36H 1L7IL 2VLRD 3A67L 3QI9B 3L6FB 4KHTL 4TN9A 4ORZC 1I8MB 4JGUA 4WO4B 4LIQL 2IALB 3HUJB 1KTLA 1EBAA 3KXFE 3STBA 3EAKA 2VXTH 4HBCL 2H26A 5B39B 4HF5L 3S35L 1EDQA 1PQZA 2VSCA 4HEPG 2NY4C 2P43B 1S8DB 5BMFL 1G7PB 2QQNL 4NQXB 1AR1D 3DXAD 4QY8A 1U95B 3QBTB 4YDVB 5JNYB 5I1CL 1E28B 3MRIA 5GGRA 3ZLQC 1YEDB 2DQJH 3BQUC 1FZKA 2GJ6B 5C0BB 2DN7A 4G6JH 1DBKL 1DLHB 3MRGB 4CVZA 4MS8C 3X12B 3TGXA 5CGYD 5IMLB 3PWUB 2F53E 5F7UA 5EC1A 2CDGA 4ACPA 1X6LA 5FO7B 3W2DL 1WT5A 1NJ9B 3ZTNL 1YYMH 1A7BA 4XVJL 4BQ8A 2H8PA 1B90A 4DJMA 5EA0H 1A47A 1SM3L 2BVPB 1K6QH 4CNIB 4H26A 2NY5H 1KELL 3M1BB 2J5LB 2NXYC 5D7JB 4ONGL 4PY7A 4JG1L 2ADFL 5LVEA 3EOBA 3WFEL 3P11L 4P2CG 4R4NC 1RZ8A 4FFWC 4KK5C 2AK4D 2AEPL 1YN6A 4HFWB 1C7SA 3O3AA 3QEGL 4PGEA 1T04A 1XGTA 3WKNA 5HVFB 1ZV5A 4H0HB 3GI9L 3DTXA 5T33L 5ECJE 3SDXE 5E24E 4X99A 2Q76A 4IHOB 4DEPB 4QCIB 1FG9C 2BRRL 4UTAH 4GOSA 3QJHA 5CILH 1MCFA 3N50A 2Y07L 5F7YC 4JFDE 2VL5B 5D93B 4NQSA 1FZOB 5LBSL 3TN0A 5I66A 5HJ3A 1DQTA 3RGHA 1KENL 4KKBD 3TA3A 3CZJA 3LPFA 4OLWH 4GBXB 4ODWB 4PJ7F 4EUPH 3HZMB 2EDTA 2MWCA 1ZGLM 1G7LB 4OLYL 4ZOBA 2HFTA 1CZ8L 1S7XA 4YBLB 4FHBD 4I3RL 5GIRB 5L88H 1OP3K 5C3LD 3C6LA 3OHXA 1GSMA 2VITA 5GGSA 1LEKB 3NIDE 1D5BB 3IDMB 5GSVA 3C5ZC 4OCXH 4QHLA 2R2HA 4K8RL 3JV4B 1YMHB 2EYRB 3T0EC 1DL7H 3ZKMC 2DJUA 1EHLL 1MF2L 1UQSB 4DVRL 4NUGH 1UEYA 1RUAL 5DVKA 3IFLH 3VW3L 1WWAX 3ARED 3MXVL 1QFUL 3RDTD 3QWOA 4R96B 4S1RH 2Z93B 1IQDA 1EO7A 3M8OL 4WI5A 1HINL 3DLQR 1TVHB 3C09C 2MQ3A 3DUSB 2CUIA 4EDWH 2F19L 3DX6B 2R69H 5IQ7H 5JORB 5I1AB 1RHHA 1C5DA 3KS0J 3G04A 1AGDA 3QEUA 3QEUB 1CFTB 4I0KA 4QXGL 4N8CH 1SJHA 3LEVH 3O8XB 3CDCA 3OPZH 5FCSH 2R0WL 4JAMB 1LEGA 2I27N 5IQ9A 2DLEA 2IBGA 4WO4C 5ERWB 3RGVD 4LLAA 1CZ8H 4H8WL 5F6IB 4UDTB 4NCC1 4X8JB 5SWZD 4YHKL 4M5ZH 1BIHA 4HKZB 3VXSE 1AE6H 2MKWA 2FHCA 3T2OA 3CK0H 4Q2ZB 2HTKD 4HMEA 4JG1H 3GMMA 3C87A 2I24N 3O6KL 1ZLUK 1SBSL 3MOAH 3HI1A 4KHXL 4KROD 3X11A 1FAIL 2VDKL 4APQD 1RJLA 1CFQB 1I1AD 2D7TH 3MJ9H 4PYHA 4AQOA 2E7MA 3IJHA 3MGTB 3E3QE 4QRRB 1B0WA 4NP4L 4U1LB 2EDFA 2ADIB 2EYSB 5LBSH 2V2XA 2BVQB 1Q0YL 2VDNL 5L2KA 3Q1SH 1J1XL 5J6HA 1N26A 4R0LB 3IRPX 1TFHA 5MENE 2EKJA 2J8UF 2EEDA 2OQJB 1UKQA 1NDGA 5BVPH 3C8DA 2I9TA 3I2CL 4IRSA 1F4YH 5E1AB 3IDXH 4O02L 5GHWH 1CICC 4QOKD 2DLTA 2ZCHH 2FWOB 1FSKB 3FONB 1SYVB 3CMOL 1NGQH 2XT1B 4NNXB 4WI6A 4LHQB 2QR0B 4FQLH 3P73B 2IMNA 1DE4A 2HT3D 3K4ZA 2FJHA 1A7OL 3JXAA 2K3TA 2NY5L 3WFCH 4OCXL 3NIFE 3JZ7A 3MNWB 1OARH 3ULUL 4NO3B 1FBIH 2FATL 2PETA 2G9HA 3HPJB 1W72L 4PS4L 3EYSH 5C8JB 5IT2H 5KS9A 4JR9L 4X6DE 4GXVL 5MENA 4LLVB 1RQ5A 3DMMB 4OLUL 2Q8BH 3MMEB 3KPRA 4JHBA 5EOCL 1JRHI 5JOPD 4YHPB 1UA6H 4AL8L 5K9KB 5D2LE 1L0XA 4TNVF 2NW2A 4ALAL 4KI5D 5ESQB 1UCBH 3BH9A 3VFPA 1G9ML 2VXUH 3OXRB 4Z95H 2B1AL 4GO6B 1J1OL 1MEXH 2NX5D 4ZAKB 2X4UA 1RMFH 3OGCA 4LQFH 4C54A 1FO0L 1OD7A 5I15H 3S5LA 4QLRA 5K59E 1AXTL 4WFGE 4OI8A 2VDLH 2XWBA 3H7BA 2OI9B 3T0EB 4HT1H 1MAKA 3HI6H 2VLJB 1E4KA 4XP4H 2CKBA 1SJEB 4JVWA 2DIJA 3PF2A 5BXFB 2CXGA 4KQ3L 3L1OL 4PRHD 1U8IB 4JJ5B 1KBGH 3F12B 4K07A 5MEND 3VH8G 2P4AB 2D0GA 4AM0B 3RX5A 2H6PA 1A64A 3U48A 3PDGA 4AK1A 5JQ6H 4XMLL 3UDWA 3L3GB 1NDMA 1UB5A 5L0QB 5HGGS 1EEQA 4HWZB 4PB9H 1KN4H 3UEZA 5IW1A 3QHZL 2HFGH 1ZGLP 1RFDL 3MRDA 5GRVK 2GUOA 2QQNH 1WFTA 2BSRB 2ERJB 1H5BB 4HMCA 1VFOA 2XZAH 4M6NH 4YXHH 1RHFA 1B0RA 4FRWA 3WO4B 3G5ZA 4HBQA 4K7FA 1E4WH 4X6CF 2KBGA 1AO7D 5ESVA 1KXTB 5F7MC 4DKEH 3HMXL 4U1IA 1J9CT 3HC3L 5HDLA 1TMCB 4PRPB 4HUWB 1S78C 1PFCA 3RGVA 5IGXH 5DK0A 1FRGL 1P84K 3ARGB 3VGAC 2X40A 1R0AL 4M48L 2HTKC 4QRRE 2AXFB 3EYUH 1ONQB 1B0GB 4U1SA 1LEIA 1Q9WA 4PRNA 1T6VN 4FS0A 1EO5A 2NZ9C 1UM6H 4DFIA 5IMMB 3IDYB 4F7TB 4KI5E 3RBSA 4MQTB 4O5LH 3QUZB 3BN9C 4RRPG 2E5EA 4NNXA 3O6LH 4HIIB 5FECA 3S4SG 5I74C 2Y6SC 4NZUH 4HPYL 4WGVB 5L8JB 2EH7L 1E27A 3INUL 2ATPA 5E4EC 3WXWL 5SX4H 3F7YA 4PS4H 1R3HB 2C1OA 2QSCH 4HAFA 1LHZA 1ERNA 4WUUA 3D5OF 4P9HC 3BZEA 4ZQKA 5HGAA 5LCVL 3S97C 2E8YA 2P24B 4RISH 1E6JH 3MC0A 3SJVA 2GUOB 2XIDA 2EDHA 4JRXA 3PGCB 1UFUA 4R90L 2DQHL 4OLEA 2FX9L 5I1LA 4NFDA 1IAOB 5B38A 4HS8L 1IILE 4EZMA 1EO8L 2W9LA 2LABA 4UIKH 3NH7H 2Z9TA 2ZNWA 4IRZH 2X1QA 2DQUL 1FNGB 2LFGA 6FABH 4HWUA 4JO1L 5JPMA 2JCCB 1KOAA 1UM5L 4PGBA 1PEWA 4EI5C 2QKIB 2ITCB 2IG2H 4KHXH 4JRYE 4ZXBC 5DD1L 3FT2A 3OMZA 4KAQL 1ZLWK 1X5XA 3BEWB 3QQ9D 1OCWH 1TCRB 4XC3L 1FFOA 3ZE2F 4ISVB 2I26N 1WZLA 1XH3B 3D3VA 3W0WB 2JK5B 3KR3H 1IKFL 3TYGH 4Q9QH 2VZVA 4LASH 3M17A 4PD4K 5C0AA 4CN4A 1XGUA 3BVNA 3BVNB 2W92A 3FQNB 2P8LA 2AERT 3MCG1 2ZSVA 2KQMA 4L8DB 5CSBA 5GRXG 1UC6A 5HHVH 4AJ0A 4W4OA 1R5WA 4MYWB 2EIBA 5IROA 4OF6A 1MRCL 4GLRH 5JORA 2BNQB 2V9TA 5BW7C 4N0RA 5K93A 2NY0C 1WZKA 4ZPTA 4X9GA 3DHMA 4Y4KA 5L6YL 2VDNH 3MXWL 4KUCD 3WJJC 1IVLA 4GFTB 4JHAH 4M6MH 5ISZE 1FFPA 2BC4B 2BC4A 1BFSA 1HZHH 1ZLSL 4BZ1H 2IPTL 5JHLH 1A1MA 2YD3A 4YWGH 3N1PC 4PRIE 1JGEA 3SDYH 1UJ3A 4TVPL 4U4BA 2P5WA 4Y16D 4R0LC 1A3QA 3MLXH 4WFGD 1DVFC 4JRXB 1VENA 1C12B 5EIIB 1MRDL 2VC2H 4K8RH 1H5BC 1KV3A 3FO2A 3BEVB 3QDJE 4OF0A 4OZGB 4DGIH 3V7MA 2UY7A 1G7JA 2GQHA 1FSKC 2DL9A 1MCDA 3D9AL 4OT1H 4FQXB 4PB0L 5K9OA 1AHWC 2WINA 1J11A 2D7MA 2HWZH 4S1RL 3BKCL 4PG9B 4ZUVA 3PABB 3PJSB 1T66D 2JB5H 4FFZL 3FT2B 1BQLL 2BHUA 3CC5B 3FB8B 4AEHH 4TPRL 2IBBA 4PREA 1LO0L 4IRJB 2ZJSL 4UIMA 1IQWL 3S98A 5KSBA 4YIQB 3VRLE 1O7SA 1FNGA 4X9FA 4L3ED 4NQEA 3FOMA 4P5TB 1JGLL 5K9JL 3EDDA 4QRPB 3LEXA 5DEFA 4OCSH 5IHUL 1D5IL 2QJDA 4LSUL 3S4SB 1IM9B 1YPZE 4ODTH 1UZ6F 4PGJA 4LPWA 4U1SB 3T0EA 2FEDD 2HFFA 4EOWH 5CEYB 2BJML 5HYJB 1KEGL 2Y6SD 5CMAA 5IB3B 5KG9A 4HS3B 2VISB 3VD9A 2IAMD 4X80L 1W8NA 1CICD 1RZIA 4FN0A 3KPSD 4P0DA 4HQQL 4OZFG 1OCWL 4XC3H 3P11H 3UTQB 3MYJA 1NC4B 3MOBL 1AC6A 4X6BB 1X5IA 3GB7B 5IEHA 3H3PH 2XKUA 1BF2A 1B2WL 3CFDB 4LVOC 3WLBA 3OR7A 5BMFH 1JZ8A 1HI6A 1I7UB 5DK2A 4DZBA 4NZRH 2I07B 3ZSTA 1MHEA 1LP9A 4LF3B 4N1CA 1XF3B 3LDBB 4PJHF 5E5RB 4P49A 5DF0A 1IQDB 3PGFL 4MQ7A 5GGQL 1DP0A 2LTQC 4UQ3A 3GSUB 3IDIB 4X7TB 4NO3A 4F7TA 1HKLH 1M7IB 4M03A 3EJZD 3QDGB 1GHFL 3KPSE 2FJHB 4PJGA 5L6YH 2FD6L 3SGDH 1S8DA 1UQSA 3P0YH 1DE4B 2VLLB 4X7FC 2ICEA 4LIQE 3WFHA 3DVNA 1CT8B 4Z7UE 1YYML 1BHGA 3H9SE 3KPSA 4YXKH 3W82A 3BZFA 1MCIA 3W2DH 5F7FA 5KBNC 3CFEB 1PG7W 5EA0L 3HZYB 1HN1A 3G5YA 4RAVA 4NRZB 4YWGL 2R1YB 5E8PB 4PJIA 3P30H 4NQCB 3CCHA 4XCYA 2X4PA 4WDIA 2OK0H 1TTGA 1RZJL 3ARDC 2YUWA 5EU3B 3SY0A 5C71A 1NQBA 5I1IH 2YEZB 3STLB 2Y4SA 3VRLF 5DR5H 5GGTA 5A2JH 4KVNH 2VAJA 5D2LF 1A5FH 1I8IB 4NN6B 3G5XA 1X4XA 1Y6MR 5EBLA 3EO1A 4LHUD 3I02A 4B50A 4JY6B 3IJHB 4J23A 2FZ3B 3CAFA 1HWHB 3L3DA 4Y4KC 1FL3B 3DHJA 1DQDL 4PJFA 1QRND 4QT5A 4ZMAT 3D1MC 4FQJL 3LAFA 1KIQA 2B1AH 4YDIL 4JZJB 4P23D 5E6IB 4N0YL 4MX7A 4JB9H 2AGJL 2XZZA 2UZIL 3KLSA 4P4RB 5E2WL 4POYA 3NPZB 43CAA 1DVFB 4Q6IA 4OQTA 5E1HB 1UWGH 3P9LB 4E42B 5B3JF 5AUMA 4BFEA 3LKSB 5H37H 4JM2B 4N0FA 1VA9A 1ZT7B 3NAAH 1ZHBB 3CFJB 5LGHH 3MV01 4FNLH 4NQCE 4P59L 2EIZA 4XP5H 3SDAD 5SWQB 5GZOD 1I9RL 2P5WD 2Q3AA 4I3SH 4Y16A 3PWPE 1CXIA 4KQ4L 5BJTA 2YKLH 1WAAE 1WWWX 4KDTC 4FQXC 4NZUL 1D9KC 3DV6B 1K8IB 2LV4A 2ARJQ 1VEMA 5J11C 1FNLA 3SE3A 1XF2A 5DWUL 4OFVA 2CDGB 4OGAD 4MNHB 3LQAC 4MQXC 1ZHNA 4PP1D 4NM4H 2VNCA 4GRMB 3GGWB 4MWFA 4FQ2H 4C59B 3AGVA 3MQIA 4NWUH 3HAEA 2X41A 3P2TA 3NACL 3P0VL 1MFEL 3VE0B 2W9EH 1RUMH 3BXNB 4G8FB 3HE6B 2AW2A 3GIVA 3QQ3A 3ALWA 5D1XD 3TO4A 1A7QH 3LKOB 4DW2H 1HDMA 5E95B 3H3BC 2DQHH 4ZG1A 5IFHL 4UINH 1T89C 1K85A 1I1AA 4G80B 1F4HA 4PBVC 1HCVA 1JK8A 2JELH 3VGEA 1NANI 4ZSOE 4LCWA 3Q48A 2VH5L 5DJXA 2DS4A 2X6MA 5D71H 1OAYL 2CIIA 4OF7A 4JAMA 4OGXH 5C0DA 3QEQD 3BYYA 3GJFB 3KG5A 5AYQA 4F33B 2BSTB 2YD9A 5DUMH 4NO0B 2ZSWB 1E0OB 2HLFC 5TFSL 3AREC 3GBMH 4U1KB 4EI5B 4R97C 3FN9A 2A6DB 1MQ8A 1QHPA 2O26U 4HUVB 3GBNL 4EN3C 1KJ2L 3EYFA 4H1LB 1T5XB 1KNOB 4PJ8A 4XP6L 2V2WA 3UTQA 5DVMA 1JI2A 1KCVH 4YBQD 4Y5XC 4KZDH 3I85A 1ZHBA 3BMWA 5A1AA 2JJTA 2NY2B 3FAXA 1QBAA 1KPUB 3HN3A 4X99B 3PV7A 2Q76B 1DBMH 2VDOH 3K7UA 5E9DD 3TVMD 1X5LA 3VXQA 5IBLD 2DQEH 2Q8BL 5C07B 1BD2D 4MX7B 4WFFE 1J8HD 3B9KA 3PWNB 4GG8A 1IZKA 4BFIB 1N5AB 2H32B 5JIKA 2EDYA 1AHWB 4WTZG 1S9VA 3QXTA 5DD3H 5FF6B 3O3BA 2JB6A 4TNWF 1IQWH 2P1YA 3WEXB 5B4MD 3JUYA 3ARQA 5GS1C 2V2TB 4FFYH 4XCEA 2CRIA 5ESAA 3Q6GL 1A1OB 3VXMB 3RAJH 2Q1EA 2UUDH 4U6VH 5F7NC 4MA7H 2NZIA 3C08L 3CIQA 5IVZB 4KMTH 4P5TC 1I7TB 3DUHA 5IBTH 5IESH 5FHBH 4MAUH 2FEEI 1BECA 4JO2H 3FFDA 1EK3A 5FYLD 4NQEE 3VFTA 3WFCL 2MTPA 2F58H 5E9DA 3IJSB 4HGMA 3L7FB 2OZ4H 3LIZL 2J5LC 4RFEA 3FT3B 5FM5M 1FZKB 3L5XH 3WN5B 1I1YA 3EO0B 3FOLB 5FGCE 3AVEA 5T3ZE 5KSAC 1ZT1B 3BZFB 3MV9D 1U95A 4X6CB 5JNYA 3ES6B 5HHXL 2YSSB 1K2DA 5AG9A 3UPAA 1EGJA 4NZRL 3VI4E 1FAIH 4NUGL 5KSBB 4LCYA 4M4PA 2H3NA 2RJMA 1BVLA 3QQ4B 4DUWA 5T3ZH 3VWJB 4YGVB 3FRUB 3L5WA 3UAJC 2E7LA 1MY5A 2FYYA 4UIMB 2BFVL 3KXFD 1RZKC 3E2HC 3SDAC 5FUZH 1VKXB 3H6JA 1JGLH 1MJ7L 1MEXL 1XF1A 3HS0B 4J7RA 1A7PL 1P4BL 3UBXI 4DUVA 5IQ7L 3WSQH 2OTWB 3MA7A 4U1NB 5GRYA 5JDSA 4JN2B 1KIUA 3U7AA 4JZNB 2QLVB 2ADJA 1JTPA 2B7DT 5HJ3B 3UTPE 2EIZB 1CVRA 3UBXB 2NXZD 3MJ8A 1Z5LB 5ISZA 1KEGH 1VESA 3I84A 3VFGL 4Z7QF 3FB5B 4PJHB 5IVXF 2PCPA 5DO2C 4HUXB 3QWRD 1A1NA 3W39A 3BO8B 1SYSB 1F3DH 3VWKC 5EIIA 1NCWL 3OL2A 4YNYA 1N0XL 3AAZB 3W9EB 4L9DA 1N5AA 4WEBH 3VXUD 1R6VA 2R4SL 4IMKA 1MHPL 3ZO0A 4KJPD 5I1JH 1AP2B 5ACZB 3ULVD 4I18B 4O2FA 1UZ8B 4TYUA 5A2FA 4TSAL 1MCBA 2AI0L 1CBVL 4U3HA 1FL5B 3LDBC 2Z91A 3KPRD 5INCB 3UTZB 1OP5K 2XQBL 4D0BB 1XEDA 4WFED 3VFVB 2AABL 4W70A 3UTTB 4Q9CA 2Q7YB 4B5EA 4LVEA 3RBGA 3LKRA 2VN7A 1D5ZA 1CK0L 3BGAA 3QO0B 3P0YL 4P23C 4JFYB 2P8LB 1S3KH 4CADA 4PJ9A 3P4NA 4KKNA 4CL7A 4WFFD 1M7DB 2QHRH 3G08A 5C07E 3X12A 4KUZL 3O2WH 1MIMH 3PQYE 5L9DL 4ZS6C 3AMKA 2HVKB 1T80A 3SPVA 2DYPA 2M2DA 5I8KL 3HNTH 3GMPB 1H3PH 1IEBA 4NM8L 3CFCH 5HHQB 2Q8AH 1QYGH 5KS9E 2KQNA 2E9IA 4ZFZA 4C58B 1I8LC 1NCDH 2H3NB 4AEEA 2F5AH 4ZFGL 1HDMB 4TRPH 4I48B 2ZCLH 1CS6A 3PWPA 1CR9H 2XWJB 4GH7B 5B8CC 3WDHA 4XNMA 2E6JA 1A7RH 4RMTA 4PP2B 5FUCC 1OLZA 2X10A 5DQDH 3PHSA 3QT2A 1KGCD 4NDMA 4FMFA 3N1FC 5HYSG 4PUBH 4MJ4A 4X4ME 2IANE 4GW1A 2FJFA 5ANME 1ZT4B 2PO6D 5F93C 3E6HA 3BN3B 5IBUB 3SJVB 1BAFL 2A6JA 3VGAB 3BRFA 3BZEB 3WFDH 4GAGL 4QO1A 3UBXA 3MV9E 3AU1A 5TQ0L 3KYMB 1MJ7H 1ORSB 5C9KA 3F6IA 5D1ZA 1JWUA 1LDSA 5F7DB 3TEUA 4GXUN 5EPMB 1CXEA 3FFCA 3GM0A 2CRZA 3KVQA 1H3VA 5CWSB 4YHOH 3OKKB 5KSAB 2GK0A 4UU9B 3RWEA 4PRIB 3WNOA 5CMAB 1TZHA 3TM6A 3OWEA 4UT7L 3QAZB 4KTEH 2DKMA 3RL2B 3KLAA 1U3HD 3KYNB 5ICYA 4X8XA 1YEIH 4KMTL 5HD8C 3P9LA 5TDNB 5CZKA 1S9WA 2PXYC 2WAHA 5TGBB 1I7RA 1RY7B 5D70L 3UTSD 2R4SH 1EZVY 5JW5B 1VEPA 4XB8A 3LPWA 1FGNH 3WJJA 4R8WL 3SKOA 5F9DC 2VDOL 1A02N 3VGHA 2DBLH 4F57H 2IH1B 3HCVB 2EH8H 4TOYH 5J6GB 1JPFA 2FX7L 4YZFE 5TF1H 1A6WL 4XXCA 1LO2H 4LEXL 1EMTL 2DQEL 3L5IA 5E2WH 3LV3B 4QTIL 3N06B 4P2OC 3NIDF 4K71C 5C0AE 2GFBB 5J1TC 4X0KA 4RISL 3MCLH 4JJHA 5I18L 4P3WA 3WS6A 2FJGA 4HWBH 1LNUA 3MNVA 3ZZ1A 3RZCC 5J89A 2BP3A 2NW2B 3MUGA 3ESVF 1JGUL 4ZNCD 3F7QA 4PY8I 4PJIF 4WFEE 4LLVA 4UUJB 1CE1L 1UM6L 4Y2DD 4U1JB 5D7SH 2FSEA 2J7LA 4IRZL 4JPWL 4MNQB 2A2QT 3GSWA 2C7UA 4XXDB 4L3CB 1F5WA 2EE2A 4M8QA 1LDPL 3SCMC 2DM7A 3HG1E 2F74A 2FGWH 1WT5C 4PR5A 4PLKD 5EUOA 3SO5A 4AEFA 1HXYA 1W0VB 3NCCB 4HKXB 1BM3H 1DLFH 5IIEB 1WBYB 5KN5B 3CDYA 3PQYA 2MCPL 4NJ9H 3BH9B 4L3AA 4LCCC 4KDWA 3BQUA 3WN5C 1NCAL 3VD7A 2ERJC 3T3PF 4BA8A 4TUOA 4PJEE 1XGYL 2A6DA 4UDUB 1V5JA 4F58L 1QVOB 3D3VB 3HMXH 4OB5L 5TQ0H 3WO4C 1XGPA 4D94A 4G6AC 3IS1X 1GGUA 3CZFB 1XZ0B 2GJ6D 3GRWL 2N7BA 3FMGL 3MRDB 4XNUL 5C0BD 5DFVD 4A2MA 4JPVL 3PWNA 3CJJA 5DQJA 1HHHB 3UO1L 4CW1A 1GZPA 4Q6IB 3TBYA 1IGYA 1RIVL 5JPMB 3P73A 5DA4A 4XNQA 1NAMH 3ZTJH 4UT9H 3FRPA 1OAZH 3WD5L 3VRIA 1YEHH 1X5JA 2FLRT 1U3JA 4HBCH 4Y5YC 3MOBH 4XMLH 3PQYD 4N8VA 3PDOA 3UBXG 5E2VH 4JQXA 1KJ2A 1NEZB 2DTMH 4D9RE 3W5MA 2QR0A 1F2QA 2VWEE 1KNOA 4LCIH 5D7JD 3LKQA 5ILTL 2X4RA 4PJAA 2W60A 1QSFE 3PIQA 3U1SH 3GUTA 5EBMB 4IRSB 4F57L 1HSBA 3ARVA 4Z7NF 3VXSD 4JY4B 1CLZH 4XVTH 4WY7L 3WNKA 1XF2B 3QNZB 1EEYA 1C5CH 5GGTL 5K9KA 1RIUL 1ROWA 3C6SA 3IU3A 3REVA 5BVJB 3EHBC 3V5HB 3MLUH 4MQSB 1SEQH 3LKOA 4M5YL 4JDTH 1JF1A 4HH9B 4RNRB 2DLGA 4LFHD 3G6DH 1U8LB 2DRUA 3FFCD 4ZUUA 1YEGH 1YNLH 3PP3K 5GISH 2RHEA 4X4YB 4G43B 1J5OL 1VFAB 3O2VL 4Q97A 4FOMA 1U8QB 2XKNB 3O2WL 4L4VE 4XX1E 2EDBA 1JYVA 3CXDL 5JHDE 4MDIA 3GSWB 4HPOH 5IQ9B 4AIZB 2B2XH 3BGFC 1B2WH 4FABH 1CD1B 1G0YR 2AJUL 3AC0A 1MRDH 2ICCA 2VC2L 1OTSD 2VXQL 2D0FA 3O8XA 5EBGA 3IDJB 1YQ2A 4RGOH 3RVWC 1W0YT 3BE1H 4NKDA 4U1GC 5F96L 3OB0K 4KRLB 2JB5L 4CU7A 2ZSVB 2AAVA 1FFQA 5CZXD 5D2NC 4LHUG 2EYSA 4E42A 4BQBA 3MXWH 4HWZA 4NBZB 3RDTB 3LS5H 1LILA 4XPBH 4PJCB 5GRUH 2H6PB 1CGXA 5E6ZA 4DKFL 5HVHB 4LCWE 5E8NB 1N8ZA 1KJ2B 1YNTB 5CJOH 4PLJC 1PZ5B 2JJSA 3HZYA 1BZ7A 4EBQL 4NZJA 1WGOA 2R0WH 3NA9H 3CDFA 3ILPB 1GZQA 3O8XD 4ESKA 2Q8AL 3L3OA 5TPWL 1S9WB 1WUNT 2WANA 4CDGC 3HC0A 4MXWH 4I2XE 1OAKL 5E5MB 1TXKA 3IETB 4WUKL 1QR4A 3JWOH 1QSZA 4NN7B 1T7VA 3E3QC 2YRPA 3QNYB 2GTWB 2LAGB 2ZCLL 5D7KE 3T3MF 2FH8A 3OR7B 4HCRH 4N1HB 2HLAA 1F4WH 3DROA 1MHEB 1BLNB 1S5IH 4G8IA 4URTB 1U36A 3RKDD 1YPZF 4PRHA 2WUBH 1UXSB 5TJWK 3TWCL 1BAFH 2OMNA 3BQUB 2F54A 2ZZUT 3GKWH 3B2VL 5KW9H 2EICA 1RK1A 5TH2B 3QUMA 2DWEB 3AM8C 3DTXB 1YUHB 5M95B 3C60B 3I2CH 1BFVH 1NSNL 2N56A 2VLLA 3MRGA 1UG9A 1NBYA 4QCIA 2VDPH 4PR5B 4GKNA 4HC1L 3CX2A 5HI5C 1FP5A 3MBEC 5CBAA 4WW1B 4BH8A 4PJEF 3KJ6H 4QNPF 3VG0L 1G84A 4FTVE 2F53A 2FSEB 5L2JA 3I6LD 1WIOA 4NFCA 3DUUB 5TE4H 5ALBL 3QAZC 4OZFA 4Z76A 1OQXA 5D7JA 5F72S 3S7GA 4X6EB 3K8KA 4WO4A 3WFZA 4EUPG 3O9WD 3ARZA 1D6VL 4XP6H 4Z7QE 5DK3A 1QLEH 3QO1B 3W0WE 3V4UL 3QUXD 4LLDA 3PNWB 3F8UB 3WL9A 4MB4A 4LK4A 3AS0A 1MCWM 1JNNL 5KSBE 5GGRB 1DFBL 5D9SA 4F7EB 3IETA 4FTVD 4N90E 5T3ZD 4LPYA 4YC2C 4PJIE 4RX4A 2WIIB 5FYJH 2CMRL 3U7YH 4DKEL 4GRWE 2EC9U 3L95A 4E41B 2Z91B 3K8MA 2XN9E 3B3IB 1A7QL 1F3JA 1JNLL 1AJ7H 1J0ZA 1XGYH 3ULVF 1KJ3H 5TGBA 2DLHA 2XPGA 4YBLC 3D85A 1ACZA 3S5LG 4OLVH 2A9ML 5E8NA 1MFDH 5C0GB 1BWWA 4KJWC 1MNUL 2RB8A 3MNZA 3EFDH 5GS1A 3L3HB 3O45A 1WC7B 1BREA 1JCKA 4DK3A 1TZHB 4FQHA 4U1GB 1AXSB 2BNQA 1G6RA 4KGJA 3ULSB 2GAZA 4E5XB 4M4RA 2BVPA 1VSCA 3RZCA 4ZPTB 3RWDA 5DWUH 5HTSA 4CVXB 5I17A 4FQIL 1A7NL 5D96C 1BFTA 5BS0D 5GS0L 3K2UH 3B9KD 43C9B 4MJ6B 1OL0A 1CGSH 2D4FA 2VR5A 3C2SA 4K3HA 4XZUB 4ODUB 3TN0C 4HKXA 4GUPB 5HI3C 3P0VH 1DBJH 1U8JB 2JE8A 4OZ4B 3J8F7 3V8CA 2EDJA 5C0FB 3RUGE 1JZ4A 2HJLB 3CVHH 2ZCKL 4LAJH 4FQ1L 3DYPA 4TVPE 5CLWA 5EN2B 3AY4C 2GHWB 5I1GL 2PXYD 4HUMB 2VXUL 5F7LB 4XHQA 4NKQB 4OIBA 4YAQA 2NY6C 4XVUC 3JTSA 3MRRA 5FOBB 5CJOL 5HY9A 4DGVH 1F00I 3SGDI 4UINL 1RIUH 5I1LB 5D7IB 3TN0D 2X9XA 3HNSH 3MV7A 4ERSH 1ZLWH 3LRGA 4R7NB 3VU2A 3EYUL 1FC2D 4JRYA 4P59H 4WU7A 1RIVH 5F1NB 3OJDB 3PGCA 5DUML 3ZE1E 4QWWD 1KC5H 3Q2CA 3VD3A 2XTJD 3M45A 1ES0B 1CDUA 5DZOA 5E2UL 4Y5VB 1QA9A 4YHIB 5DJYB 3RIFF 1GGBH 1FFNB 1EXUA 3O11A 4KZDL 3BEWA 1UADC 2MNUA 3WUWG 4MD0A 2KPNA 3TA3B 4CU6A 3ZDXE 1D3CA 2HFEB 1I4FB 1A4JA 4EKXA 1IC4L 1Z0MA 4OSUL 3LKQB 3QUYA 1DQDH 4G8GA 5C9JA 3ARWA 4KRPB 1UKTA 3FO9A 2IANB 4HIIA 4NN5C 3EOTL 4YXHL 3TH4T 3DETD 3HPLA 5CP3A 5I19L 2DKSA 1AP2A 4CRPA 1R3KA 1HHGA 2BXYA 1E4JA 3LRSA 3KXFA 5MERA 3P4OA 2BHZA 1J10A 4PTUB 5GJTH 3GZKA 4UNUA 3RNKB 1G7HA 2OSLB 1QSEB 3S3SA 4ZFOA 4PRNB 3WUWB 4OLZH 4PLOB 4WENB 1ZMYA 1FCGA 4MJIB 3RDTC 3GFUA 5DDHB 2YKLL 4TSCL 4K7FB 1LEGB 1YECL 4XP4L 2L7UA 4MJ6A 2FR4A 4I0CC 4DN4H 3WBDA 2YRLA 2X1XR 2IADB 4R97B 3WKML 3BDYL 3BD3A 2B4CC 4UV4L 2OTWA 3SE4A 1U0QA 5KANI 2YK1H 4IOFC 4OI7A 1AGBA 3K2UL 5JR1L 4YX2L 5FK9B 5FHAL 5I16B 1CG9B 4HIJA 1I3GH 4HJGB 1QKZL 3CH1A 3PWVA 4PV9B 2P49B 1I3UA 3LMJH 4NNYB 3BPLC 4P3DB 4PFEA 1TJHL 5DMJB 3EYOA 3QQ4A 5J1AA 1Z6JT 2FIRT 2YBRA 2NNAA 3SOBL 3RWHB 1FN4B 1FNSH 2YWYA 5MI0B 3H2WA 2X89A 3F12A 1YEJH 1FO0H 4D9LL 2XY1A 5GSRB 3MX0A 3RVUD 1VPOL 1EERB 4GRLB 5FYLE 4OD3L 3VXSA 4BM7A 5ITFB 1PZ5A 4ZPVA 2YOCA 2XFXB 5EU6D 5CD5D 2EZ0D 3C6SB 3IU3B 5E1AA 3QCTH 2A73B 3EKCA 2C5DC 1B0RB 3C9NB 4XHJD 1NFDA 3I9GL 1NDGB 2XWBB 3H7BB 1CXFA 3BP4A 4KU1A 2Y5TB 1H3PL 3MRCB 4NM8H 2EKSA 1H0DB 1SMAA 3L5JA 4TVPD 1NUGA 3WS3A 4GLRI 4PRDA 1KC5L 3EJJX 5I6XB 4HXBL 3DV6A 5BOZG 1DL7L 2E8ZA 4QOKA 1FO0A 1VFBA 2HH0L 2OP4H 1GIGL 3FO1B 4L4JA 1QBLH 4M7JH 2ZOLB 5IEKA 3PP4H 4Y16B 4TUJB 1MHCB 5DQDL 4M1CC 3H3PL 4JRXD 4NN7C 4UQ2A 5HYJE 1N2RA 4LGSB 2YD8A 3CFJA 1NMCB 3FQXA 3QXAB 5SV3A 5F9OH 2Z8WC 2BXZA 4LAQL 3MFFA 1YEEH 2NY6B 1TPXB 5F9WC 3GM8A 4LEXH 3IJYA 3IJYB 4FQXD 4U1MB 1BFOA 1HHKB 2CIKA 4G5ZH 3EBAA 2D31A 1NGYA 5DI8B 2OL3L 3SGJA 1QLRB 3SJVE 4XVSL 4P9HL 5GRUL 3MV7D 5JUEH 1WVZA 2FB4L 4OCRL 4K3GA 4J4PD 2ICWB 2QSQA 2R15A 1DBBH 3VFOB 4QNPE 4K94C 4L3EB 2NR6D 1EX0A 2F8OA 5MEPB 4P23A 4QRPD 5I1EL 5FYKL 5DJ8B 5DRNB 4KKLC 3P30L 1IM9D 3UTSA 3V6ZB 1REIA 1Z9LA 3OAYH 3TA3C 1CF8L 3DUSA 2QADD 1A9BB 4HHAB 3X14A 1JZ3A 4S0SD 1TQBC 3VXUA 1W0VA 1TZGH 2PNDA 1SBSH 5DJXB 1DLHA 2JJVA 1S7WA 3QEHA 5E5MA 2IAMB 1P7KB 3O81A 5CIPH 3V7AE 2VXVL 4OGZA 4LCYB 5IK3A 4NDMB 1FNFA 5GS0H 1IC1A 4KGLA 1MELA 3AY4A 4HLZH 4JPIA 1T1YB 3GMMB 4PJGE 5E6IA 4L4TA 4NRXB 3RWHA 5EB9A 2HJFB 3FJTA 3G6AA 2Z31B 1KB5A 2ZUQC 3BPOC 1A8JH 3LS4L 4ODTL 1KXVC 4R90H 4YC2B 1KB5H 1T1XB 4W81A 2Y06L 3O41A 5CD5C 4DN3L 2J8OA 4KTYA 1VHPA 1CXKA 4MMZC 5BVPL 2X44D 1VFBB 1A4JB 2QQLL 3RHWF 5TF0A 3WS3B 3SDYL 5DT1L 1A1OA 3QG6B 4Y2DA 4JHZA 3HZVB 1Q9OB 3VDCA 4BQCA 1OHQA 1IC7L 3O3BB 3R0MA 2KUTA 2R0ZL 2EDKA 4JM2A 3HRZB 3VRJA 1AGFB 2NY3D 3BPLB 4NQCD 4BSVB 2BSSB 4WTZA 4ZDHA 2FL5A 4PV8B 2VOTA 4YR6A 1U8QA 2XKNA 2SEBB 2CO7B 4NYLA 2UYLA 2YS4A 1JHTB 2PYFA 3G6AB 3DJ9A 4P3DA 1F4XH 5IV2A 3MFFB 1KPVA 4ORGB 4X9BA 1Q9LB 3PWJB 1OD9A 4LHUB 1PG7H 1KTDB 2CSPA 5AEAA 4V1DE 4HCRA 1PW3A 3MRQA 1D5BA 3SEPA 5C0CD 4PJCE 4C83A 1LNUB 3A6OA 1LQSR 4JZNA 2XOTA 4WTXA 2C3GA 3JBG7 1FZMA 1J7VR 2OCFD 1JHKH 4U0RC 2QTEA 2P8MB 3O2VH 2AJXL 3CCHB 4Y16C 4GW1B 2VWEC 4M1CD 1Y0LB 4I4WB 2OP4L 2DL2A 2LU4A 4OD2B 1ZGLB 1A0QL 4NSKB 3LH2L 2Q3ZA 4F2MA 4RGOL 2P5WB 1S7VB 3MRMB 4YFDB 3PWPB 5F9WB 3LOWA 4P5KA 3QNXA 1GOFA 2XZQH 2OJEB 1KT2A 3BN9D 3GSQB 1KFAH 2NXZC 5L8LB 4B7IA 1CDHA 4LVOB 4OIIL 4YPGB 3NCJH 3L6FA 1F4AA 3OV6A 1HWGB 2YWZA 4OBRA 5FYKE 1WCBB 3LN4B 2BNRE 4QRTA 2AXHA 4HWEH 1CL7H 4GG6E 2W1NA 3B9VA 3SOBH 5L2KE 3TF7C 3TIEB 4JDTL 2P46B 2H41A 3NFPB 5D1XB 4X9HA 2A1WL 2JELL 5FM4A 3QIWC 2XI9A 1NC2D 1BIIA 5FA3A 5FO7A 2VMFA 4JO2L 1C12A 1UM5H 5ITBH 5D7SL 4O5LL 5DC9B 1QSFB 4N1EA 4P4RA 1UJ3B 3QIUD 1T21B 5FOJA 2PW1B 2UWEA 5GGVH 1NL0L 1NAML 3IVKB 3OBAA 2OBGA 3QEQB 5IB2A 5A3ID 1C1EL 2ESVE 1A6UH 4NO0D 4LSSL 3I75A 1QKZH 5GRJH 3DVGA 1OQOA 5JA8B 1PKOA 5BV7B 1CFSA 3SCMB 1KCVL 3FQXB 3QXAA 4LLWA 4YX2H 1M71B 3HMXA 1Q8MA 4NQDD 3M1BA 1T7WA 1UB6A 2DI7A 3RUGA 1SBBA 2A9NL 1MH5B 2BY2A 2HRPH 2VQ1A 2Z0BA 4IRJA 3JSSA 3W9DB 1UACH 3O9WA 5EFIA 4XRCA 1V3JA 4KJYA 2IQAB 5B39G 4M6NL 4Z9KB 1NCUA 1ZLVK 1UH3A 2AEQL 2RGSA 3TVMB 5HD8D 1HQ4B 2APBA 3UJIH 1UJTA 3PNWA 5LQBH 4I77L 3WIHH 4QTHA 4QTHB 5K33A 1J8HB 4XPGL 1FZMB 4D0DB 4JN1H 5F6IC 4QRUB 2HN7A 4YGVA 4Y5XA 1HEZA 3CFEA 4LCWB 4NKIH 3PG2A 4OZFB 1QOKA 5DEGB 3ARDB 4JFEA 4FA8A 5IJVA 5I30H 2EDNA 4F2MB 4YO0B 4K23H 1ADQH 2Y72A 1RIHL 5F21B 4RRPA 4PJ9D 1QO3B 3U30C 4JFFA 2GI7A 1A6AA 4WW1A 4HWBA 3FZUD 3S3JA 3BGMB 3T1FA 1AI1H 3P4MA 1CR9L 2E27H 1OY3B 4HD9A 4OF3A 4H0IA 1JWMA 5J11B 5E8OB 1K5NA 3LMJL 1V3KA 1GL4B 1AGBB 4Z0XB 4F7EA 5H2BA 4O4YL 4LMQE 4V1DA 2HVJB 2VZUA 2IANA 5GRVL 1F8TL 2X42A 3VJ6B 1MAML 3QJFB 3BHBA 3LQAH 1R3IH 1M7XA 5DHVH 1U91A 5EORH 3RVWD 2R0LL 1U8NA 3MBED 3GMLA 3GMLB 4JFHD 4U0RB 3N1GC 4X7CC 4BFGA 1NFIB 2HRLA 1D6EB 1MWAB 4S1SH 3FO0H 3DOSA 4LQFL 4KI5F 4HC1H 2V2TA 4XPFH 4JFED 4DCQB 1MHHB 2PF6A 3PHQA 3CFBB 1BFVL 1NSNH 1NKRA 1S9VB 5IGXL 1BVZA 1KJ3L 4I2XB 3TNMA 3LKSA 3I3DA 2VUYA 1HKFA 2O5XH 3KXFB 5MERB 4JRXE 2ZNXA 5INDB 2RIKA 1UYWL 2BNRB 3QUZA 1A6VH 43CAB 3AB0B 3FRUA 4EVNA 2V7NA 5JOFB 4NPYB 4M3JA 3IFPA 4N68A 4L29A 3GSRA 1AH1A 3WDIA 3MGOA 1FYTE 1JP5A 1T22B 2NXZB 5DQ9B 1PYWB 1TQBB 3IAGC 2VLRE 2HFGL 4X6CA 4GKSA 3CC5A 3JWOL 4BKLB 4PBWD 1I1YB 3OGOE 4YDLC 1A22B 5DFVC 1RJCA 3FB6B 1F42A 4UOW1 3SE4C 5HGAB 4Y5VA 4YHIA 4U2ZA 3VXUB 2R9HC 5BW7A 4GUPA 4HG4K 3LS4H 4QKXB 3O4LD 3QIWB 3QEQE 1BJ8A 4FQ1H 4PRHE 4A2LA 3U7YL 4JY4A 3LPGA 4LCCA 3DXAB 4M7LH 4AT6B 3SDXF 1OSPH 2ATPB 5E70A 5DYOA 5C08D 3R06A 1ADQA 2VDLL 4ENED 3KPRB 3VH8B 3T2QA 1GGTA 2NW3A 3OKMA 4ODSH 3JTSB 3MRRB 5FOBA 2VDPL 2X9WA 3JWDL 3C5SA 2H1PH 3D69A 1GC1L 4KK6D 4TVPH 2LVCA 5F9JA 3KAAA 2MPAH 4ELMA 4NWTH 1YEFH 3GSO