3FTNA

Q165e/s254k double mutant chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-295 of t. brockii adh by c. beijerinckii adh
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
352
structure length
352
Chain Sequence
b'MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAELADIEMGSSVVVIGIGAVGLMGIAGAKLRGAGRIIGVGSRPICVEAAKFYGATDILNYKNGHIVDQVMKLTNGKGVDRVIMAGGGSETLSQAVKMVKPGGIISNINYHGSGDALLIPRVEWGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLVTHVFRGFDNIEKAFMLMKDKPKDLIKPVVILA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADP-dependent alcohol dehydrogenase
publication title Biochemical and structural properties of chimeras constructed by exchange of cofactor-binding domains in alcohol dehydrogenases from thermophilic and mesophilic microorganisms.
pubmed doi rcsb
source organism Thermoanaerobacter brockii
molecule tags Oxidoreductase
total genus 116
structure length 352
sequence length 352
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.80: Isopropanol dehydrogenase (NADP(+)).
pdb deposition date 2009-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ftnA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3ftnA01
4AJIA 3ICCA 4BVAA 5JCJD 2IZZA 4BKOA 1NHWA 3FN4A 4YRDA 2RHCA 3SVTA 3W8DA 1V35A 3TL3A 3V1TC 1O9BA 4LRTB 2I99A 5DCUA 4M55A 4Q3DA 1PTJA 3ZV4A 3JD4A 3RC1A 4RDIA 4UULA 3OIGA 3UCFA 3ZGYA 1YBAA 3LLVA 4IDBA 3U4DA 4OJNA 5KJFA 1KVTA 3UN1A 3JTMA 3JQ7A 1UAYA 3BTVA 4J6FA 3WGYA 4CM6A 2JHFA 2XAAA 4CM3A 2WMDA 2WD7A 5CDGA 3JQ9C 3F1LA 1PQUA 1XKQA 4FN4A 4MOWA 1QLJA 4Z9YA 1LDNA 5B1YA 4I9UA 4ID9A 1Z7BA 4R1NA 3PPIA 4PLYA 5CHEA 4I1IA 5AQ1A 2Y93A 1KYQA 3ONDA 3ROPA 2YHIA 3PIIA 4AICA 1OC4A 1HDXA 3QV1A 4W7IA 3WXBA 2ZKLA 3D1LA 3INTA 3K2BA 3AFMA 4QQRA 3WNVA 2HAEA 1MG5A 5A04A 5JAZA 1EK5A 3FBGA 3Q1LA 4QTZA 2G0TA 4YJGA 2ZTLA 3BHMA 1LA2A 3RUAA 3IAHA 4YT4A 1A27A 3CPSA 1PJ4A 1GV0A 1T2EA 3ASUA 1NQAO 3L6DA 3P7MA 2Q45A 3DAGA 3U49A 3VC7A 4E31A 4K6CA 3FNGA 3QE3A 4PLGA 1YH3A 5TT0A 4DA9A 6ADHA 1D4FA 2VWQA 4YWJA 3A1NA 3AOEC 1TA4A 3AUSA 3RFTA 3HE3A 1R15A 1R4NA 2PR2A 4BO7A 3ICPA 1HLPA 2PKRA 5U9CA 2J5KA 4UUPA 5AXAA 4AJPA 5DCYA 4JJIA 3H9UA 2VTEA 2WM3A 3I52A 4MKXA 3W6UA 3WGOA 1YKFA 1JLLA 2NTJA 3ENNA 1UAGA 3F4BA 3IL2A 2QZ9A 4O6VA 1MV8A 4BV8A 4J2HA 3TZKA 3ZV5A 1IYZA 1SPXA 2B37A 4GLLA 3AFNA 4PRKA 3JQ8B 2JCVA 4Z0TA 1N8KA 3JD1A 4EJ0A 3VZSA 1QV6A 3MJTA 2GZ1A 4QUKA 2G1UA 1YJ8A 1LLUA 2BI7A 4ONEA 2VOEA 1CERA 1B0AA 2B5WA 5DF1A 1JKFA 4KUEA 1ZIDA 4RDHA 4CM8A 3JQAD 1EUCA 4XA8A 1KY4A 2DM6A 1SNYA 4K26A 4GQAA 3DBHA 2HKIA 4L0QA 3EYWA 3H8VA 4GMFA 2OBNA 4CLHA 4DIFA 4XEHA 3NTOA 1KEUA 1M75A 2Q3EA 3KYCB 1QXSA 1DFIA 3SLGA 5JNLA 1DHTA 3VTFA 4A26A 1I24A 1GCUA 3KRTA 3RUFA 3ASVA 2EEZA 4CM9A 3IUSA 4INAA 2RIRA 1N2SA 1E6WA 2RCYA 2X4GA 4YAEA 2Y1EA 4PLWA 2V7PA 4PG7A 5G0UA 2BRUA 2O3TA 2OL4A 2EJWA 4YA6A 1YGYA 5B4VA 3GZNA 5EIOA 1R12A 1E77A 3ON5A 3EZLA 5ENDA 1D1TA 1YBVA 4IGEA 4BGUA 1EEHA 3IJRA 1FDWA 4YJHA 4GX5A 5GZ1A 3LYLA 3WGHA 4W9NC 1QV7A 2A94A 2F1KA 4BS9A 2ZTMA 4E21A 5IJZA 2IZ0A 3NDRA 2HLPA 1EQUA 1ZSYA 3OSUA 1ZK1A 2YZ7A 3LC1O 3WMWA 4DIOA 4PLHA 3G1TA 2WSBA 5EQFA 4GMGA 4H3VA 2OXIA 3V8BA 5KJEA 2IEBA 2BMAA 3KLPX 1RPNA 3U0BA 2BHLA 1P31A 4TROA 3WX0A 2Q1UA 5JO9A 4P22A 4CQLB 3GEGA 5KJ6A 3LZ6A 4YDRA 4CMIB 1RM0A 4ALKA 1R0LA 5JC8A 1DJQA 1R0KA 4WK6A 3QWHA 4ND4A 3GEMA 1Z75A 2HCTA 4DRYA 3BTOA 3JQ6A 4ND2A 1HYGA 2EWMA 1ISMA 3WJ7A 1I30A 1KEWA 1SOVA 2FSVA 3F4LA 1QG6A 1NNUA 1XEAA 4J49A 3F9IA 3GOHA 4FBGA 3U5TA 4D0SA 2QRJA 5A9SB 2HMSA 4UREA 4AFNA 4IBOA 2VOJA 1Z74A 4O59O 4MDHA 1DFHA 4XQ9A 5ILGA 1H6DA 1I33A 1C1DA 1GFSA 3HDHA 3QLJA 1DFGA 4NJOA 2NU8A 1E0DA 3WICA 4BO2A 1GQQA 4IUYA 1G0NA 2C54A 4J4HA 4IDEA 4BGIA 3DMTC 3PQFA 5KIAA 3IKTA 1BG6A 1ZBQA 3LSYA 4U8GA 1Z6ZA 3ST7A 3DTYA 4PG5A 3Q9NA 2P5UA 4W99A 3ORFA 4EW6A 4S3MA 3STHA 3DZFA 3F47A 2ZYDA 2FZWA 3M1AA 1NQOA 4B8ZA 1UP4A 4DC1A 4R1UA 4NBWA 2GPTA 4IIVA 3TNLA 2P68A 4BKPA 1QP8A 4WPGA 4F6CA 1ORRA 4F6LA 2PD4A 1K5HA 4JNKA 4MIOA 3AUTA 4IZIA 4GAEA 4ZGWA 4GGPA 1DBVO 5G4KB 4PZCA 5JPIA 2O3UA 4KTTE 1I3NA 3MJ4A 4CM5A 4E5NA 4CQMD 1DLIA 5HRUA 3QVOA 1V9LA 3BMOB 2IE0A 3TN7A 1NVMB 5MDHA 2IODA 4BQRA 4J4TA 2O7SA 4PLCA 5L40A 2QYTA 3GR6A 4MP3A 3WS7A 5C7LO 2VT3A 3LLSA 2Q4EA 4MPDA 5COAA 3CIFA 3BZUA 3I83A 4R9RA 4E12A 4GKBA 1YL6A 2X0NA 3FCOA 3GQVA 2QZZA 3PDUA 5L7TA 2B4RO 3MTJA 4I9NA 5CPBA 4QFDA 4D79A 2PZJA 1R6DA 3HNPA 4JP2A 4XJTA 5A05A 4AJ4A 3ENKA 4N54A 2NQTA 3NAQA 1JKIA 3VZRA 1JVSA 4URFA 2FR0A 5EQDA 5F1KA 4D3DA 1Y8QB 5HS4A 3ZW9A 1YB1A 3PWKA 2GSDA 3RC2A 3ZU4A 1WP4A 1EFLA 4B7CA 3AU9A 4J1QA 3C7CB 3WYEA 3P2OA 4W82A 2Q49A 3TZCA 4Z0HO 1C14A 1V3UA 1A71A 3GAFA 4GWGA 2PWZA 2Y0DA 1SC6A 1GUFA 3HUDA 5DULA 1FDUA 5L51A 2VT2A 2CD9A 1ZXBA 2C29D 4BNHA 1G6KA 3ADOA 3G3EA 4R69A 1HT0A 4GVLA 4B4UA 3Q2IA 4IY1A 4A10A 2VHWA 3I1JA 2PY6A 2DFVA 4M49A 4YB8A 3AI1A 2VTDA 5BNTA 1WNTA 4N5MA 3CTMA 4CLOB 2I3GA 3KYDB 1XSEA 3PFFA 3PWZA 2O3SA 3V2GA 5A4DA 1LTHR 1XELA 3RBZA 2NU9A 1H2HA 1W4ZA 1PGNA 5CG2A 7ADHA 1AHHA 1MA0A 1VE9A 3MOIA 4Q3EA 3NKLA 3WWZA 1HF3A 3BHIA 1HZZA 3ZZNA 2D1YA 3VPHA 2NQ8A 5LDGA 4CM4B 2BELA 1BWSA 4J7XA 5BT9A 3AY3A 4KZPA 1JA9A 1ID1A 4FD3A 1PR3A 1O0SA 3AY6A 4OOFA 3H5NA 4UUNA 3ITKA 5JDCA 4RL6A 1LQUA 3VPSA 2AE2A 1T2CA 3PJGA 1P1JA 5AXDA 1ISJA 1H2BA 3GPIA 1BW9B 3OEYA 2V6BA 1W0CA 4RZHA 1Q7CA 3TPCA 4ZJUA 4E5KA 4NBRA 1NR7A 3W6ZA 4Q3BA 3DAPA 3AUAA 1B2LA 4IXWA 2Z1NA 1PJ2A 3OA2A 3L6OO 1LDMA 4BGVA 2WD8A 2HMVA 5CDSA 1E7MA 1DHRA 1U5AA 4I08A 2WE7A 4YAJA 4NMHA 5L7YA 1Q0HA 2HMWA 4IJUA 4ZICA 1SEPA 3D7LA 5LCXA 1DRWA 2C82A 5FFFA 1NBOA 3L77A 3VOSA 4CPDA 1ULSA 1YO6A 2YV3A 4L9RA 4OGWA 4J91A 1FDSA 4WLNA 4WE3A 3EVNA 4N5LA 5JMWA 3FWNA 1YS4A 1ZSNA 1YB5A 1I2CA 4CMEA 1GEEA 4IINA 2JFFA 2JCXA 1S6YA 2CMDA 1CETA 1ISHA 4TSKA 5TSDA 3QP9A 3D5QA 1GD1O 4PZEA 3L6EA 4UVEA 3X2EA 5FWNA 2AW5A 2CVQA 3GVIA 4WKGA 1Y1PA 1X7DA 1NXQA 3GPDG 2DPGA 3JQ8A 3WIDA 2D5CA 2GDZA 3N74A 2FRDA 4PFJA 5G0WA 3EGOA 3HHPA 3RAJA 3PJEA 5JYDA 1LRKA 2A4KA 5L53A 5C7IO 2YV1A 3R3JA 3H3JA 1BSVA 2ZTUA 3W4KA 5B4TA 2NU6A 3I9NA 4ZD6A 5A02A 1FXSA 1JQBA 3AI2A 3INGA 2OBYA 1NPTO 4MIEA 5BSFA 4EYEA 1PL8A 3VPXA 1QYDA 4YT5A 2VQ3A 3L0DA 3HJAA 1X15A 2VCYA 4CM9D 3ANNA 3JQFC 2Y1OA 3B70A 3JQGB 2O4UX 2Q1TA 5GZ3A 2D4AA 1F12A 4E2WA 3INRA 3K5PA 1ZK0A 4KQXA 4PLZA 1MGOA 2O7QA 4HV4A 3R1IA 3S2FA 3QWBA 3AK4A 4JCOA 4JROA 3KYCA 3KYBA 5ER9A 3RSHA 4TVOA 2I65A 4I8XA 1X13A 1VJTA 2VWPA 1M6HA 2VYND 1ZJZA 4GSLA 3R3SA 3RJ9A 3PFWO 1HZJA 2GCGA 2WE8A 2X6TA 2BD0A 3QWAA 3CXRA 3BMQA 5AXCA 5I8WA 1ENOA 3OMLA 1C0IA 1ARZA 4M87A 4U6SA 3JYQA 4BKUA 3UCXA 4LMPA 2AEFA 1KVRA 3PHJA 3A06A 4CR8A 3KUXA 4A7PA 1XR3A 4D44A 2G76A 3GMDA 5I9NA 2I67A 2BFMA 4CMBA 1DRUA 1VPDA 5B37A 2O2YA 4FB5A 2PGJA 4J3FA 4BO0A 2IXAA 4U7WA 4B4WA 3QA9A 4KWHA 2WDZA 4NNJA 1PJTA 2Q2QA 5KVVA 4CQLA 1PQPA 1UXIA 3BA1A 3AM5A 1UZMA 4CMIA 1KC1A 3B1KA 4YTEA 5JAIA 1IUKA 2VZ0A 4PGFA 4YQYA 4EGFA 3QSGA 3PZRA 5C5IA 1T4DA 3F46A 1JN0A 4HWKA 5EN4A 1ZXLA 4XYLA 3KSZO 1ZK2A 3I9OA 4WNCA 2ZK7A 3IP3A 2DU8A 1D3AA 4FFLA 3I4CA 4IQ0A 2DBRA 1PZHA 3FBTA 5L95A 5FF9A 2JCYA 3UAGA 5A9SA 4RPLA 1XLTA 3IP1A 3H5RA 3GVXA 1XGKA 3I9JA 3OQ6A 4OXNA 3PHGA 2O3RA 4HP8A 2C5AA 5KWEA 2C59A 3HB4X 3FNEA 3OIDA 3OJLA 1SO8A 4FIZA 4XIJA 3VH1A 1E1NA 3C24A 4BIIA 4Y6RA 1ISFA 1Q1NA 4RVHA 1U7HA 2PNFA 1UZNA 4J0FA 2EF1A 2B36A 3LF2A 4ZQBA 3UXYA 2B4QA 2GASA 4GKVA 2VWGA 2YFHA 2J5RA 1K3TA 3O26A 4RPJA 1Y8RB 2Y0CA 1HDZA 1EE2A 4NBVA 4XRGA 4R9SA 1U2GA 4ZQHA 3TRIA 1MXFA 5THQA 1MC4A 2IYOA 3RBXA 3WG9A 1F06A 4ZHSA 2FOIA 4L74A 4FFRA 1BHSA 1QORA 4LVCA 4IDFA 2DBVO 3DWFA 1CYDA 2GN4A 4BV9A 3KO8A 1E3IA 1T24A 5G4KA 4DVJA 1LSJA 2Q2WA 1XHLA 4NFHA 5T5QA 2GF2A 1GTMA 4TZKA 4BKQA 4CV3A 2JHGA 3PLRA 1ISIA 1J0XO 4JXKA 3VVCA 4IS3A 3AM4A 3EZYA 3GNSA 5DZSA 2PH5A 3GNQA 2I9PA 5LC1A 3BMOA 4BKRA 1LLDA 2DBZA 3KB6A 3RU9A 3MZ0A 4CR6A 1QRRA 3CH6A 3PI7A 4BNKA 5EPOA 3W4JA 4DIBA 1YBMA 1I32A 2NACA 4EEXA 2OOSA 3I23A 1WWKA 2W2KB 3LC2O 4HNGA 4OL9A 2IRWA 1P45A 1CF2O 4OKNA 3GAZA 2C0CA 3ROKA 5IAAA 4BO1A 5T8KC 3ANLA 2JKVA 5A9RA 4U5QA 2V6FA 1IHXA 1Y8QA 2BFAA 1B8UA 4L4SA 5JFOA 3Q2KA 5CFZA 1PJQA 3K8ZA 4K6FA 3NT2A 3JD3A 1JVBA 4AJEA 2ZJ0A 1MLDA 2YHUA 3IMFA 1NWCA 3JYNA 2UDPA 3B6ZA 4IGFA 4ZRNA 3V5NA 4BNVA 3TF5A 1GQYA 4M1QA 1IZ9A 4WLOA 1O5IA 4XX0A 5TJHA 1EK6A 4YAIA 4CL3A 2PFGA 2X8LA 1EFKA 1Z82A 5DN9A 1UXGA 1ENYA 1O89A 3GGPA 1P77A 4BOYA 3AOEA 2DBQA 3NDIA 4NPCA 4WLVA 3CMCO 4XYMA 4FPXA 2J3IA 3F3SA 2FR8A 4LGVA 2Z5LA 4WCFC 2AXQA 1XA0A 1WDMA 4YYZA 2JAHA 3OF2A 4G65A 4OAQA 5F1OA 4CLOA 3MJCA 1XDWA 3KYDA 1MX3A 3PYXA 3OP4A 4LSMA 2R6JA 1HYEA 2HUNA 4DYDA 3JSAA 1W73A 2E37A 4CMKA 3VKVA 1N92A 5L9AA 1U9JA 3MTGA 2HJRA 4M89A 1CWUA 3QVXA 2D59A 2TMDA 4I5GA 4BNNA 4HNHA 2BGKA 1HE3A 1PX0A 3DBRB 1WLYA 2X22A 1AUPA 4KDFA 1PS0A 4CM4A 5L4LA 1DC3A 2J8ZA 3RUHA 2EERA 4BNXA 2CVOA 1VC2A 3O38A 3W1VA 1HLDA 4OMUA 3EAGA 3WWYA 3FTPA 1PU2A 1UR5A 1V3VA 3VZPA 3CEAA 4OXYA 3VKUA 1O95A 1GUZA 1I5RA 2AE1A 4DPLA 2GLXA 5F5NA 3QVSA 2CF5A 4DXHA 5IDXA 1PJBA 5KTKA 1I3KA 1BW9A 3F5SA 3WBBA 2EKPA 1LDBA 3OIFA 3D3EA 4MVJM 2AQHA 1NAIA 3QJ5A 1L1FA 1F8FA 1DLJA 4PZDA 3FNHA 3MCVA 1ENPA 1GAEO 1MXHA 5B12A 2D8AA 1PGJA 1SZJG 4I5DA 3C85A 1FDVA 1N1EA 4GPD1 4ALJA 1ZEMA 1VRWA 2AEMA 3GGOA 5EMHA 3JQEA 5F5LA 4E2YA 3TFOA 4RQTA 4ZQEA 1P1IA 4PLVA 3ZU2A 2D2IA 3BTSA 5FI5A 3CINA 3BMCB 5LDHA 1JAXA 4W9NA 1TI7A 4R1TA 2RAFA 3OA0A 1O6ZA 1T1SA 3HZZA 2FPGA 4AG3A 1YL5A 2VUTA 4MP8A 2PKQP 3ZHZA 2QW8A 4B4OA 2P4QA 3GA0A 3GFGA 4YACA 3EDMA 4KDEA 5IDWA 1AE1A 4J9VA 2PZKA 2CVZA 4KP7A 4QT0A 3ZV6A 2GN9A 4CV2A 3GF4A 3OICA 1UDCA 5CP8A 1VSUA 3VTZA 4D46A 1DAPA 5JXWA 1TVEA 2ZCUA 2BKAA 1ZMTA 1E1KA 4TRJA 3WQRA 5A1TA 1GZ4A 2ZYAA 3G1UA 3NT4A 1MFZA 1HDYA 3RUIA 3QW2A 3DOJA 3W4IA 2PK3A 4U0JA 1ADFA 4OM8A 2NV6A 5DOVA 2YUTA 3A4VA 4QEDA 3DC2A 1CQJA 2R00A 4PG6A 3GT0A 4Z3DA 5IDQA 4HBGA 1MP0A 4ROSA 1TB4A 1DOHA 3TWOA 2NVUB 4YRAA 1I01A 1A4UA 4E6PA 2Q99A 3RI3A 3WLEA 3H9GA 1ZK3A 2D3TA 1KS9A 3JQGA 2E6UX 3DR3A 3C8MA 1KVQA 1LC0A 2XPCA 4CR7A 3ANMA 3K92A 1UDAA 2FWMX 1C0PA 2ZIZA 3FNFA 4NR0A 1X14A 1LLCA 2ZB8A 4XQGA 1KY5A 2OFPA 2WWRA 1A9YA 3WOHA 2O23A 3FSRA 4WASA 4L8VA 3RUDA 4BNMA 3DMTA 1FF9A 1NPDA 2X58A 2VYNA 3DHNA 3HDQA 1KVUA 4D0RA 1NAHA 4ALMA 4WEQA 2G17A 2AG8A 2XXBA 5BR7A 2YFQA 1KC3A 4CV1A 1GYQA 2CDCA 4TZTA 1AXGA 1TT7A 1F8GA 5A03A 1M2WA 1OAAA 3UH1A 5AXBA 3TL2A 2GO1A 1X1EA 1IE3A 1GEGA 1OFGA 2I3AA 1EMDA 1KIFA 5EERA 1H93A 1YDWA 4M86A 4XD2A 3DO5A 2UVDA 4UVIA 4XGNA 2AQKA 4BNJA 1OI7A 3UGKA 4CMGA 4ND5A 1DO8A 1K6XA 4AVYA 4MINA 1Y5MA 3K31A 4P4NA 4WLUA 5I9LA 2ZATA 5K6AA 1PGQA 4KMSA 2V65A 4WOJA 3PTZA 5BSEA 3NRCA 4J7UA 2VHZA 1PR9A 1UXHA 2BI8A 1YONA 1XU9A 3I5MA 3KBOA 2DTDA 1EDOA 3NJ4A 5TX7A 1VJ0A 3HFGA 4TVBA 2X9VA 5L7WA 5TF4A 3GVCA 2UUPA 3P5SA 2C07A 4NHEA 2Q1SA 3DB2A 3DZGA 3ZDFA 3GDFA 4F46A 1QYXA 1UJMA 3ZWAA 4E3ZA 3JQCA 2A92A 5KNLA 1OBFO 4J43A 4BNZA 3A9WA 2EHDA 3HG7A 3VH2A 5I7EA 1U3VA 3UFXA 3DBVO 3ZNQA 1N7HA 1EVJA 4XDZA 5L45A 3L9XA 4KWIA 3KSUA 4IJVA 4FW8A 4J2OA 3HB5X 4BL5A 4HFNA 4RPKA 1H6AA 5G2OA 3DHEA 2I76A 2C5EA 1U7TA 1DIHA 1JKJA 1Q7BA 4EEZA 5TLSA 2OMEA 5COQA 3LC7O 5FYDA 3L4SO 4BNTA 1ADBA 4DQVA 2GUGA 1Y8RA 1YDEA 4QO7A 4WCFB 3RD5A 3T4XA 2UAGA 4MO2A 1B8PA 4BO9A 4E0BA 3B1FA 4Y9DA 1Y7TA 3B1JA 5I7FA 4RVUA 3UUWA 3RCBA 1V3TA 1A9ZA 1M66A 3RJ5A 1T25A 3ZU5A 3EY4A 1RM5A 1XU7A 3I4FA 1MFPA 4Y67A 3E1KA 1R0SA 1MG0A 2EV9A 3L9WA 4EBFA 1LDEA 1GZ6A 2B35A 1PGOA 4A73A 1W6UA 3E8XA 1GPDG 3COSA 4RCVA 1WPQA 4OKIA 3PXXA 1Y5RA 3RASA 1BXGA 3O8QB 2HU2A 5IDYA 4ND1A 2W2KA 3C3XA 1PL6A 3GVHA 1E1MA 1ZO8A 2NVBA 2HRBA 3ROMA 3GDGA 3CSDA 4QX6A 1SEVA 2W98A 3EK2A 4GLOA 4J16A 4LK3A 1AN9A 1LNQA 4P38A 1E3JA 3RIHA 1ENZA 2E4AA 2P9CA 4F45A 2X7HA 3FF4A 1N1GA 3GLQA 4ZU3A 4CLDA 3WFIA 2JD0A 3VPGA 3KXDA 4EZBA 1ZK4A 3E48A 1BTOA 4JBGA 4UVDA 2NUAA 1WZIA 4BHTA 4DQUA 2FN7A 4DWVA 3C7AA 3JYOA 1TT5B 3NTRA 3FPCA 1IZ0A 1I2BA 1QKIA 3DEYX 2QRKA 3K96A 3HWRA 1JTVA 1N9GB 1ZVMA 4BNWA 4DL9A 1I10A 1M76A 1FMCA 3IS3A 4QO8A 3KV3O 3KTDA 2OO5A 1PWXA 5U4QA 1TXGA 1K6IA 2HQ1A 3R6DA 2YJZA 1KEPA 3NDJA 1ADGA 3UKOA 4DYVA 4HX5A 1KVSA 1RJWA 2JJYA 1LJ8A 4D45A 3H65A 2PZMA 1ZCJA 3DBLB 1NR1A 4XYBA 2H6EA 3DXFA 1WMBA 2YQ4A 5ADHA 1JWBB 4G5HA 1YWGO 3ZWPA 5IXSA 3E9QA 4D41A 5ITVA 1WXDA 2GZ3A 4RVGA 3L4BC 1P1KA 4FSHA 4GX2A 5H81A 5JAQA 3KHUA 1YQDA 2I66A 3GVPA 4NK4A 3KETA 4CODB 3CUKA 1GDHA 2PLAA 1NTOA 4AJOA 2HK8A 4WUVA 4E2ZA 4DQXA 3DBRA 1NWHA 1Q7GA 3DONA 4FJ2A 3ZU3A 2ZB7A 5DNAA 3PRJA 3WSWA 3BXXA 2JL1A 4CMCA 1NX6A 4DLLA 3PHHA 3S2IA 1I3MA 2VYVA 3AI3A 4R16A 2WTBA 3QY9A 5HS6A 2O4CA 3IC5A 5L4SA 1JWAB 2HK7A 2YDYA 3HQ4O 5H82A 4D7AA 5KOIA 2AQIA 3VZQA 3ZWOA 2DAPA 1U1IA 1LQTA 1UZLA 4YVFA 3TOZA 1I2ZA 4XQCA 4PVCA 2OGUA 3JYPA 4KUGA 3SLKA 1B3RA 2HDHA 3RC9A 1HKUA 1XQ1A 2QX7A 3D64A 3FPLA 1HRDA 1HDOA 4K9DA 4R54A 4AJ2A 1DIBA 5JDIA 2J5QA 4GWKA 1D7OA 2WYWA 2PKQO 5F21A 4Z9FA 5B4UA 3GEDA 5J23A 3D4NA 3IKVA 3I9MA 1NP3A 4UEOA 4XZ3A 3WJAA 4DC0A 2Y1FA 1ML3A 3DFUA 4J1TA 1EVIA 2FMUA 4HY3A 3H5AA 4RF2A 1R16A 4P4GA 2I5PO 5GZ6A 4DUPA 4GH5A 3TJRA 1IOLA 1DDOA 3BMCA 1BVRA 4IDGA 3ETGA 3FRJA 4RF3A 5IG2A 5HTOA 3FTNA 2FSSA 3CZMA 4HUJA 2E48A 2YY7A 3AUUA 1RM4A 1YOVB 2ZJ1A 3OBBA 2QIOA 3PDJA 2GD1O 1HE2A 1B7GO 1ONNA 1HXHA 1LU9A 3G0OA 3WQSB 5KKCA 3G79A 2C20A 1VKNA 3KVOA 2TMGA 1P0CA 1P1FA 2O3JA 5TS3A 1P33A 2IDZA 2P4HX 9LDTA 3I9LA 1GADO 5TC4A 4RF5A 3H6KA 4MVJE 4LSWA 1SB9A 2HMTA 4D3SA 2RH4A 1J49A 4KOAA 2O50A 3PHLA 2AHRA 1N7GA 4FCCA 4IS2A 3ZHBA 2P9EA 1Y81A 4Y8VA 1G1AA 2CNBA 5JDCC 4EITA 3PP8A 5A9TA 2CDBA 2J3KA 2JD2A 4YT8A 3NTQA 4CMJA 4Q3CA 4RLSA 6LDHA 4JP3A 2NVUA 1V0JA 3VH4A 3WTBA 4XB1A 2EIHA 4FGSA 3LF1A 1H5QA 2B69A 2F00A 4RO0A 4FOSA 4BNUA 1E1LA 5U1PA 3MJVA 5KJ1A 2VN8A 3NT5A 2IYPA 3QWIA 4IQGA 4OQYA 1PJSA 1ADCA 4CUZA 3UICA 3DAFA 3OJEA 3M1LA 4G81A 4CL8A 2JD1A 3VAZA 3EUWA 2O2SA 2VUSA 5AOVA 1FK8A 4GL4A 1YQGA 1VJ1A 3PVZA 3GG9A 2DLDA 1F17A 5CDYA 5IZCA 4EI2A 3WFJA 4YCAA 1HDRA 3JQBC 4GX0A 4NIMA 3GRKA 3RVDA 3S55A 3RUEA 3ZWBA 3AWDA 2NNLD 3R0IA 3WGTA 4E5YA 3LQFA 3RUCA 4BO6A 3ZWMA 1LC3A 2FY8A 3PZBA 1G0OA 2X86A 2PD6A 4LN1A 1RWBA 5EESA 1LEHA 3DZBA 2BH9A 5COBA 1XYGA 1BMDA 2AMFA 3LT2A 3GG2A 1C0KA 5KKAA 1A72A 2BFOA 4O5OA 4YAGA 2FHSA 1H6CA 2J3JA 3H7AA 3LT4A 3M6IA 4BO4A 9LDBA 3ZW8A 3EHEA 1YB4A 2X5KO 2P5YA 2I6TA 1PS9A 4FJ1A 2BF7A 3U62A 1EZ4A 3LT1A 3Q6IA 2JFGA 5IXYA 1GYRA 1D1SA 3PHIA 1PSDA 4O63O 4H7PA 2FR1A 4OSPA 4EJ6A 1I36A 4TRRA 3T4EA 5A5FA 4NU5A 4JBHA 1SBYA 1HE5A 1E7QA 3OJOA 1P74A 1T2DA 4TWRA 2P91A 4IM7A 4NFYA 4RPGA 1ZH8A 4OQZA 2NWQA 1H9BA 4I9HA 3V2HA 3MEQA 1U4OA 1Q0LA 1ONPA 1NFFA 1DAOA 4IDAA 1IB6A 1EUDA 5TJ9A 1NPYA 4ND3A 1LLQA 3S1LA 3HDJA 4C7KA 4D43A 1C1XB 4O0LA 4MVJA 2PA3A 5JW6A 4XYGA 5CEJA 2X5OA 1ZNQO 2EP5A 4BNIA 2Z1MA 4LCEA 3Q11A 5KVQA 5TQVA 5A06A 4WGGA 5ILOA 2X9NA 4F3YA 5L4NA 4WCFA 1WDLA 3E03A 3L07A 4FC7A 1WDKA 1Q0QA 3JYLA 4AJ1A 4Y6SA 2FPPA 3RQSA 5T64A 3JD2A 2NTNA 4GSKA 3DZIA 4XKJA 1XCBA 4FFNA 3B20A 4U0KA 3OHSX 3GN1A 4NQZA 3OH8A 3GH3A 1UP6A 1VKOA 1PIWA 4NDNE 3JQ9A 1HETA 1KOLA 5C3MA 1C3VA 1P0FA 2YW9A 1BRMA 1E3SA 1E6UA 1T4BA 4MP6A 4HXYA 4L73A 4PVDA 5T6BA 2CY0A 4BMNA 3GNTA 3D3WB 4ZA2A 3DHYA 4L76A 1ZW1A 2EP7A 4J1SA 5IN4A 4OH1A 2Q50A 3O8QA 3ZI0A 3ZV3A 1DC4A 4R5MA 3WIEA 3SC4A 5CDTA 1AXEA 3A14A 3RWBA 2IEDA 1E3EA 1LDGA 2NADA 2YDXA 5DDIP 3PJDA 4J0EA 3CZRA 1K0UA 4ZVVA 3RC7A 2W2LA 1NFQA 2PTGA 3VH3A 1HL3A 1E3LA 4BMVA 3ZH2A 1YQXA 5GY7A 1PJCA 1PJ3A 2NU7A 1DIRA 4JQCA 3F5QA 3NGXA 4EUFA 1IPEA 1BXZA 3ZWCA 1OMOA 3FHLA 2DKNA 4EDFA 4BB5A 4PLPA 1DXYA 4XR4A 3HDYA 2QQ5A 4FGWA 4Z6KA 8ADHA 4WJZA 3GZ4A 1QYCA 3UHAA 4TKLA 4C4OA 1P44A 3G17A 3GUCA 4TRNA 2EKLA 1T1RA 3GRPA 4DGSA 5DCWA 5DT9A 1PJLA 1LI4A 2Y1CA 4ZN6A 5KVSA 1N9GA 2C2YA 3EVTA 3KZVA 2J6IA 5HA5A 2Z95A 1CIVA 3K9QO 2GN6A 2JFHA 1GQ2A 2Q2VA 2WEKA 1IHYA 1H94A 4UAGA 3I6IA 2NSDA 1UXKA 2Y0EA 2Y67A 4AJKA 1EDZA 4WLEA 1E3WB 1PS8A 3DBLA 3PYLA 3RBVA 2EKQA 1LRLA 3WNQA 2VHXA 1W8DA 5MGBA 4FC6A 1EBFA 1T2FA 1YJQA 4J7CA 2EGHA 5I7SA 2VYVD 4IJKA 3SJ7A 4BUCA 5HWSA 4MKRA 5T67A 1QR6A 1ZJYA 4IDCA 4XGKA 4FFMA 5DP1A 2Q46A 1NQ5A 1BDMA 4DLBA 3SX2A 4NBTA 3JQDA 3NYWA 1PEDA 5CG1A 5H83A 3K73O 2CFCA 4B7XA 5JSFA 1ZEJA 2QHXA 3H2ZA 5KVCA 4DMMA 4O1MA 4XDYA 5G0TA 3TZHA 1LSOA 2FZEA 1PZFA 3D4PA 5JYEA 3GUYA 2NLOA 3PJFA 2C7VA 4LRSB 5T57A 5THKA 4RVFA 2X1HA 1X7HA 2PGDA 4P8RA 4FFOA 2CF6A 1DIGA 1U3UA 3H9EO 4CLXA 4PG8A 4PG4A 4K28A 3CE6A 3QQPA 1B3BA 3Q0EA 4HFRA 4OXKA 4PLFA 4QSMA 2HK9A 4R3WA 5DBIA 2OHXA 4WLFA 2CDAA 4U6QA 4E33A 3RKRA 2R2GA 2GERA 4PIVA 4RV9A 1QYWA 5TT1A 1E5QA 4GX1A 4HFMA 1NHGA 3RROA 3DZKA 3ZHYA 1YOVA 3GHHA 4YJDA 5JO0A 3ZWNA 4BGEA 4IPTA 3E82A 1A7AA 3QHAA 3KM0A 2C2XA 1V8BA 3NX4A 2GRAA 4M54A 4JN6B 2B83A 1Z45A 2CUKA 3HSKA 3ROQA 3JQAB 4CV0A 4ESOA 4TKMA 1X1TA 2B5VA 3UOGA 4E5PA 2B0JA 5I9MA 3V1YA 3PGJA 4BQPA 1V6AA 4R1SA 4CUKA 3GY0A 1CQIA 4B3JA 4NBUA 1XG5A 3BYZA 4XCVA 3VDRA 5FEUA 2Q4BA 3ZWYA 4NJMB 2VRCA 3ITDA 2DTXA 5K0ZA 2GZ2A 3M2PA 4AL4A 1DPGA 1A4IA 4KUHA 4L75A 4E4YA 2VZ9A 1NQTA 4RJTA 4AJNA 3DL2A 2Q1WA 3BHJA 4UEJA 4I5FA 1K2WA 4Q3NA 1E7SA 1A7KA 3ZWXA 2GYYA 3PQDA 4TQGA 1HEUA 1ZUD1 3FI9A 8LDHA 1XQ6A 2ZQZA 4MVJF 2POQX 3BMQB 2PD3A 2YYYA 2H9IA 2XXJA 1B26A 3D0OA 4II3A 5JC1A 1E7RA 2WYVA 3VVBA 1U2DA 4JGBA 2VZ8A 2X9GA 4B79A 5BNFA 1H0KA 5I7VA 1NVGA 2J3HA 2PV7A 2E82A 1PWZA 1UP7A 4RPHA 3SC6A 1LXCA 2PZLA 3I9KA 3MWEB 4YJFB 5ER6A 4IMRA 4LVUA 1JAYA 1CDOA 4CUJA 4BNGA 1LSUA 2ZYGA 1ULUA 5BQFA 3AU8A 3EMKA 1K6JA 4CLRB 2OZPA 1OC2A 4MJLA 3AJRA 5JMPA 4CM7A 1P1HA 3KSDO 3T7CA 4YRBA 3TZQA 2R00C 2ZB3A 4XJSA 1FDTA 3QIVA 2EG9A 3QVWA 4DTIA 5C7OO 3DZJA 2NTVA 1LX6A 5KCZA 3DOOA 2O48X 3OETA 1VL0A 3DTTA 3IDSA 1K89A 3WQQA 3C7DB 2V6GA 4AJHA 3S2EA 4PN3A 4NU6A 4MVJH 5EJ2A 2AEJA 1E7WA 5C37A 2H63A 1YRLA 2C7GA 3EC7A 5IF3A 3PIDA 2YQ5A 1DIAA 1JW9B 3BIOA 4FJ0A 1PZGA 3H3FA 2A9FA 3H4VA 3P2YA 3RFXA 4A2CA 1QYVA 3OECA 1ONOA 3FD8A 4R3NA 3ZHXA 4MVJD 3P19A 2SCUA 3GFBA 1IL0A 4NZ9A 1HE4A 4DPKA 1EQ2A 1MB4A 1GZ3A 1L7EA 3W8FA 1PQWA 4BB6A 2EGGA 2O3QA 1R4MB 2W8ZA 1WAMA 2Y99A 4FQ8A 4Z9XA 5EL0A 4RF4A 4BNLA 1XIVA 2W90A 3BMNB 3N7UA 1JU9A 4MVJG 4UVHA 1B8VA 5BNIA 1O8CA 5TRTA 1C1XA 3DMYA 4IQ8A 3E5RA 1GCOA 5ENVA 1PGPA 3X2FA 1Z7EA 4J9UE 1YVEI 1IULA 4N18A 3LU1A 3PGXA 4H16A 3C1TA 1J6UA 4CJXA 1HDGO 1EVYA 4Y98A 4IIUA 3UCEA 3WGIA 5AVOA 4FR5A 1P9LA 2OP0A 1YXMA 1GL3A 4QXMA 1Y6JA 2A35A 4OOEA 2P9GA 3K6JA 3SEFA 4CQMB 2QG4A 1HDCA 3CMMA 3PEFA 5K6AC 2ZCVA 4GI2A 4TMFA 4D3FA 5IZ4A 3L4BA 4N7RA 3W8EA 3TZ6A 1NVTA 1ZFNA 4Z0PA 1T2AA 1N5DA 2GR9A 3ETEA 1HYHA 1NFRA 1SCUA 3VHRA 3HN7A 1DEHA 5CAEA 4P4LA 5L3ZA 4B4VA 3D3WA 2GN8A 2W2LD 4E2XA 5ICSA 4ALNA 4HKTA 3O9ZA 4DMLA 1DC5A 2WYUA 5ITWA 5KJCA 1U4SA 5IFLA 5TGDA 4ILKA 5HM8A 4Q3AA 5JBIA 3JD0A 3RFVA 4YQZA 5BSGA 2OP1A 7MDHA 4RLHA 4DPMA 4C7JA 4ZQGA 5ES3A 4MVJP 4BNFA 1RYEA 2FP4A 3ZNOA 3ULKA 4YBZA 3E9MA 3WSVA 4IXTA 1H6BA 1RKXA 1ZZEA 3PWSA 3SJUA 3HFSA 4JK3A 4R68A 3UVEA 3OQBA 5JY6A 4HADA 2DC1A 3FR7A 3MWDB 2EXXA 3WBFA 4CLEA 4UUOA 3TFQA 4II2A 2ZQYA 3AY7A 1KEVA 5DOZA 1B14A 3QVTA 3IOYA 4R4JA 3BAZA 5JCJA 2AA3A 1Y9AA 3LT0A 5A3VA 2ZB4A 3JQ7B 3C1AA 3MJEA 3I3OA 4WCDA 1S7CA 2VNAA 3GC6A 2P2SA 2WD7B 5K9ZA 1WMAA 1E3WA 2G5CA 1E6EA 4BNYA 4JJFA 2CSUA 2BGLA 4GVXA 3CKYA 3WDSA 3E5MA 3ZN2A 4Y6PA 3AW9A 1FJHA 1TLTA 4A0SA 2IXBA 2EW8A 1SOWA 2HSDA 4Q39A 1HSZA 4B8WA 3WGQA 4D42A 3PLNA 1HWYA 1H9AA 3JQFA 2YHIB 3H9QA 4Z3KA 4IZHA 1ISGA 3IIEA 2DFDA 4W6ZA 3AM3A 3OEWA 1L7DA 2W4QA 3OQ1A 1HTBA 3NEPX 4PCVA 3DQPA 1LBEA 5TIIA 2G82A 3UW3A 2HJSA 4J4BA 4R51A 4YJGB 1RM3A 1UH5A 4MIYA 2XF8A 1SB8A 3MJSA 5ICMA 1GPJA 2BFPA 4BMSA 1VM6A 2HMUA 4DLAA 2X0JA 3E6AA 4R41A 3ABIA 4S1VA 1R4NB 2UUOA 3DDNA 2H1SA 1DRVA 1GYPA 3IUPA 1TEHA 2VNSA 4RVDA 3WMXA 3F1KA 4W7HA 1VL8A 4BO5A 1GY8A 3H2SA 3SBOA 2EJVA 3DFZA 1X7GA 1U3TA 3Q9UA 3WTCA 2DQ4A 3KEQA 3U4IA 4XWYA 1NASA 1OOEA 4EUHA 5CEEA 3WB9A 3GMSA 2V6MA 1U8FO 1JDJA 4RGBA 4E30A 2D5AA 4GBJA 1LRJA 1XWFA 3QWFA 1WZEA 2BLLA 3JQBA 4GGOA 1SAYA 1P1RA 1UXJA 4XB2A 5JAMA 3WLFA 5AYVA 4MVJI 1EBUA 4YPOA 4NI5A 3LK7A 2Y68A 3MOGA 4E32A 4M8SA 3WYCA 4CM8B 4JLWA 2X23A 5CEFA 1U3WA 4OYRA 3GHYA 1BXKA 1X0VA 3E9NA 4R5HA 4WNIA 2UV8A 2FPIA 1LSSA 2JAPA 4FOOA 3U9LA 2BGMA 4B3HA 1R37A 3DZHA 3K2EA 2B4TO 3DBHB 1E92A 4Q9NA 1CRWG 3V2UA 2ET6A 2RBEA 4E5MA 3VPFA 4ALLA 1B15A 3JQAA 2PH3A 4KQWA 2VRCD 1T26A 5FI3A 3DOCA 3PYMA 3TSCA 4IMPA 1BVUA 5BSHA 4LW8A 1BGVA 1VLLA 2CZCA 2OUIA 3O03A 3WGGA 1GU7A 4KTVE 2VHVA 4RORA 1I0ZA 2ILTA 4NJMA 3RU7A 2X0IA 3GZNB 4A5OA 5A5EA 1Q2XA 1I8TA 1B16A 1J4AA 3HN2A 1DJNA 4G2NA 5JDIC 3FWZA 4YJHB 3RKUA 2ZTVA 4XIYA 1VL6A 4UEKA 2GNAA 1GUYA 1M67A 3D5TA 3SXPA 3T7EA 5DBFA 4CMEC 5JCXA 4QFCA 4I5EA 3U4CA 1MUUA 3GDOA 1PZEA 3UF0A 3JCZA 4YR9A 2EW2A 3S2GA 2QRLA 3ETDA 1KBZA 3U4HA 3GK3A 1U5CA 4JX8A 2AQ8A 2Y66A 2YV2A 4OIMA 2X5JO 2RH8A 4E13A 1YL7A 4LCJA 4W4TA 4OSOA 1IY8A 3OJ0A 4A03A 5K1SA 4LMRA 1UUFA 1J5PA 3GN2A 3PQEA 2UYYA 4N5NA 5HBRA 4BO3A 1DB3A 5CPFA 2OORA 2XOXA 4RVSA 4QECA 4ZQFA 1YE3A 4YJFA 3IQDB 5GMOA 4ZRMA 2Y05A 3WGZA 3M2TA 5F1PA 5CDUA 5EINA 4JJGA 5JLAA 4BO8A 1NM5A 1X0XA 2DPHA 2Y1GA 5JS6A 1Z73A 4CLRA 4J90A 3JV7A 3NV9A 4AJJA 3KEOA 4FFPA 4UVGA 3U3XA 3NGLA 3WYBA 1AGNA 1GR0A 1EUZA 2DVMA 5T8KA 4IJWA 1C1DB 4ALIA 4FDAA 3OFSA 1KETA 2NM0A 3TDKA 2VHYA 4TRMA 4CM1A 5F3RA 4EJMA 3A28A 4JBIA 1ZSVA 1M6WA 2NVWA 1C0LA 3BTUA 4XYEA 1Y9EA 4YXFA 4PRLA 2HRZA 4JIGA 1U28A 4NG5A 4CMHA 2DT5A 3F6YA 1CEQA 2QYSA 3WR5A 1QSGA 3HADA 4J1NA 4YAKA 3LDHA 3KOUA 3LVFO 2DUWA 4NK5A 1QMGA 2LDBA 1HSOA 3NJ8A 4NFSA 1LDYA 3N58A 3D4OA 5JE8A 3ZCXA 4B3IA 4EUEA 4R01A 3ZNPA 3AOGA 1R4MA 3Q3CA 5IZCC 1NYTA 3I6QA 3GGGA 3BMNA 2DTEA 4YEDA 2IZ1A 2H5LA 3KLMX 3PK0A 3C1OA 3OJFA 1DSSG 1KERA 1ZMOA 3TOXA 3ZWWA 4XGIA 1F0YA 3EW7A 4HFJA 4AJLA 1SMKA 4PLTA 4XQEA 4RZIA 3ONFA 1AHIA 1GV1A 2HO5A 5DBGA 4YT2A 1MC5A 2WJPA 4DBVO 4FS3A 1LUAA 1WW8A 2LDXA 2GGSA 4RQUA 2VWHA 3ADPA 2E49A 2Y1DA 1R66A 2X0RA 4A27A 4CQMA 3S8MA 1D8AA 3G49A 3U09A 1WVGA 2AG5A 3ZWVA 3VDQA 1PL7A 5TNXA 1CJCA 2PGLA 4K1LA 1EVZA 4B7UA 1U8XX 1DC6A 1BXGB 1QLHA 1E5LA 4WECA 5G0SA 1UDBA 5IN5A 3NUGA 4L4RA 3V1UA 1I3LA 4L4XA 5G0VA 2DUUA 4XR9A 4OHUA 1VSVA 4DBZA 2RHRA 5JY1A 4H15A 3K30A 4ITUA 3H9JA 3ZNNA 3QRWA 4UUMA 4DREA 1ZKMA 1O94A 3ONEA 1OZAA 4CMAA 4IDDA 3OM9A 1RYDA 3O4RA 4XRRA 3TQHA 2D0IA 1IPFA 1TT5A 4WEOA 3IJPA 1E7YA 4X54A 1BDBA 1P3DA 3E18A 3FR8A 2VRBA 4LISA 4MKZA 5DP2A 1VI2A 4NH4A 4WOKA 2VUUA 5G4LA 1EE9A 4OO3A 5I8ZA 5A3JA 1A5ZA 1F14A
chains in the Genus database with same CATH superfamily
2GJ8A 3QE4A 2BFCA 4MV5A 1PYDA 1Z4PX 4C87A 1USWA 4FEAA 4WACA 4BDSA 4DR2B 1PEYA 4D25A 2F9MA 1G8PA 1P4AA 3S8YA 4LOAA 3IB6A 3OCUA 2JI8A 1JQ5A 1SQ0A 4LRTB 1L7MA 1X1QA 4C0WA 1AS0A 1YNOA 3L79A 1PT7A 4IH1A 7GPBA 4MHTA 5IJ9A 1IM2A 2NU9B 5L3QB 2SHKA 3CZ4A 2QEQA 4PS0A 4HNUA 1SGWA 3LQ1A 3EZ6A 4MW1A 2BT4A 2QR5A 3CUYA 1P18A 3MBOA 4RDIA 4B2LA 4L6AA 3OIGA 2WU0A 2BKUA 3LHIA 1YBAA 1SD2A 3P0RA 4BCDA 2EFJA 2GZRA 4OJNA 3TXYA 7ABPA 1CSEE 5JRDS 3X1XA 2R5WA 4UPVA 2ODAA 3NWJA 3WGYA 4D4HA 1CW2B 4UM9D 4WZZA 1WCV1 4CM3A 2RK4A 1V7QA 3BWEA 5BMVA 3O8LA 4L9WA 5IWCA 3F1LA 2ZM6B 1KI4A 2DMRA 2FCAA 4FN4A 3UMJA 1NUQA 4BFWA 4MKIA 4QYTA 4YCLA 2DCMA 4C76A 4BYGA 2BISA 1TTPB 3K7EA 4C0KA 1JWLA 3BCUA 1MAVA 4ID9A 4TV9F 1RKVA 4ZAWA 3T9FA 3I1IA 4K46A 1HFWA 4I1IA 1Q83A 3PBKA 2Y93A 4H7KA 1KYQA 3OF5A 4I55A 3SVLA 2QRHA 2YHIA 3PIIA 4WXHA 3QV1A 3GAAA 4LF9B 4W7IA 3WXBA 2WAXA 3K2BA 3PFNA 3AFMA 4QQRA 2OENG 1TIKA 1VYUA 1YZVA 4F5ZA 1Y3HA 2BE7A 3FBGA 3MINA 1T0UA 3CLHA 4X92A 3TVDA 1F5SA 2ZTLA 2WD9A 3BHMA 1A27A 1PJ4A 2ID9A 1T2EA 3OI7A 3ASUA 1NQAO 5EJEA 2B4AA 5EXPA 3VC7A 3GI1A 5IBQA 1T9GS 4PAMA 4PAWA 1SZPA 2XB8A 3G8CA 2RI0A 2HSZA 1JE0A 1PK7A 4IOKA 3HE3A 1R15A 4BO7A 1UPAA 2TSYB 5U9CA 2J5KA 5AXAA 1K8RA 4JJIA 3VPBA 1NUPA 2WAAA 3H9UA 4HVTA 4A82A 5DNYB 2WM3A 3GBVA 3I52A 4JODA 3IAXA 4EVRA 1SPBS 3ENNA 3JZFA 3RRXA 4D56A 2IBMA 2PMFA 1MV8A 1OKKA 2PYZA 4GNKA 5CB6A 2B4YA 4GF5A 3E0XA 3TZKA 1ODKA 3MM4A 2ALJA 4PRKA 1CUFA 1I4EB 4ZU1X 2JCVA 1RTTA 1VSTA 4BTEA 1SC4A 1UK7A 1YCFA 4HAWA 3BGSA 5BUZA 2XEXA 2B4KA 1IWOA 1EHIA 4EJ0A 1QV6A 3MERA 3MJTA 5AJHA 1URPA 4QUKA 4DXDA 1T6YA 2I8LA 2XTMA 5ADWA 4LFCB 1VJCA 2DFPA 4LS3A 1CERA 2XMPA 1B0AA 3M82A 2OCKA 4RHXA 5DF1A 5DM60 5C8DA 5I3ZA 4KC0A 5FNZA 3CJRA 3TQQA 2H85A 4MV4A 4M1SA 1W9MA 1DADA 4ZO6A 5TDHA 3DCJA 1RQNA 3WHIA 3VR2A 3K0HA 4DA7A 3H84A 4IO0A 4IV0A 1T1EA 3IE0A 4PF1A 1JE1A 2P41A 1G9TA 3IBTA 2ZAMA 3GGCA 4IJQA 4K26A 2GWHA 4J76A 4MEJA 3FZGA 3WB0A 4GBED 3MXOA 1V43A 2M6KA 4L27A 1QRDA 3NH9A 5K0EA 1BGWA 1LVUA 4MWGA 2GFIA 1IZ8A 1G5FA 3H5WA 4RX1A 3SBDA 3VGJA 4CLHA 1NJ8A 2A5GA 3NTOA 3GJ3A 3QU4A 1M75A 2HF8A 1QXSA 3SLGA 5EKDA 1DHTA 1F2TA 3B9PA 4RTOA 2GN2A 2JA2A 5EE5B 3LWNA 2JLAA 1DWQA 1MR3F 3TH5A 5AJWA 5AKLA 2RIRA 1NYRA 4JQOA 4M38A 1LPAB 2RCYA 2X4GA 1VBNA 1X38A 2Y1EA 2GZAA 3LCMA 2Q5EA 2AI1A 2WTMA 1QTRA 3MTEA 3SZLA 1R6VA 3WBKA 2OL4A 3I30X 5JADA 2C8LA 1WUHS 4AYTA 4GI7A 1WSAA 1LQ2A 4G1VA 3C3CA 1L1EA 1SG0A 2QZSA 3GZNA 1R12A 1E77A 3IH5A 5B4VA 2BM9A 4JP8A 1KDRA 1Y82A 3B9QA 3MT7A 5CLHA 5ENDA 4X6LA 4N6GA 2GT1A 3LY8A 4MR8A 4BGUA 1SU7A 5HF5A 1MOQA 1FDWA 1ZICA 2ZIAA 4YJHA 4BLWA 4CIWA 1U5BB 5GZ1A 5HGXA 2F2TA 2EYQA 4HQ6A 4EPRA 2NSHA 5H59A 1GRCA 4R2MA 4E21A 3EPPA 3CG4A 1LI7A 5BXYA 1OYVA 3ESXA 1EQUA 1OWOA 1XZQA 1ZK1A 3SMQA 1XTTA 1KAOA 2J5XA 4DIOA 4PLHA 4K9MA 2VF4X 4KN8A 4FQ5A 5EQFA 2AFHA 2GJSA 1NT2A 3IMCA 4H3VA 1M1ZA 5AO9A 4PCAA 4PY2A 5F9FA 5CT5A 3KLPX 1JH8A 2VBGA 4OUKX 2IK8A 2H1VA 2JBAA 1P31A 3I34X 1KGDA 3KT6A 3WX0A 4WUTA 3DOFA 5E4FA 4N9WA 1N2CE 3N0WA 5JO9A 5GAJA 3N05A 1R18A 4D8TA 1KH1A 4XUEA 3LQRA 4MQ5A 3LZ6A 4UATA 4CMIB 4DBLC 5KJ6A 3A3NA 3EODA 2ZS7A 5TVKA 4MI3A 3PPWA 4KREA 1RS0A 4R2JA 3GEMA 8ABPA 2QJOA 4F4HA 4AB1A 3IIIA 4DRYA 2PRIA 4K9NA 2EKZA 1I30A 3M49A 1SOVA 4ITVA 4CTJA 4GL2A 1OT3A 1QG6A 2WUFA 4BWYA 4YP7A 1GPH1 1T5DX 4DQ0A 1XZLA 2I0FA 3UA4A 1YF3A 5FBLB 3LHDA 3CLVA 5JRJA 3U5TA 3UMSA 4X66B 3PE6A 3TUJC 4TTSA 4X95A 2PGAA 2WTEA 1E64A 4KN9S 4Y2QA 3OLCX 1UBNA 5DNWA 3J7AC 1BE0A 1ANKA 4IBOA 3ZG6A 3P0FA 3DJYA 1N6PA 2ESRA 2LNDA 4F12A 1H6DA 2WTXA 4GXRA 4DA0A 4EG8A 3C97A 1EE1A 2QENA 2WM2A 4I4LA 3HDHA 1GZDA 1T6XA 4GYYA 2WYIA 4HLQB 3IOMA 1SHLA 3DUFA 5AW3A 3DMTC 1KEEA 2XCQA 1YVDA 3O92A 1K6EA 1XCOA 1OBCA 2GCOA 4US2R 3ST7A 1DU4A 3CLUD 3QUQA 1E1YA 4PG5A 1MEEA 3EOAI 2QMQA 2WKSA 4EW6A 1FPMA 3DCYA 4HX9A 4AYWA 3F47A 4ZI7A 4NYMQ 4B6JA 5H80A 2ODTX 1NF9A 2FZWA 4NCNA 3M1AA 3QEKA 4J0HA 3JZDA 5IAJA 4B8ZA 4R1UA 2HO4A 4DAEA 5ALNA 5EFOA 1Y37A 4JR1A 4X6UA 1S96A 2GPTA 5BRJA 1X7YA 3Q2OA 3WL5A 5DWVA 4JI0B 5DHPA 4I6GA 4P32A 1MOPA 2I80A 4JXZA 3V1NA 2E4VA 4HVCA 4JNKA 4DLRA 3DDUA 4IZIA 4GAEA 3R7SA 4GGPA 4QHTA 1DBVO 1NV8A 3DF7A 3V4SA 1J25A 1TTHA 1C7ZA 2O3UA 1ULZA 3FW1A 3IBGA 3O9MA 3OZ7A 1NI4A 2BEUB 3IELA 3LBFA 3SDBA 3MBIA 3CG0A 3QVOA 4MUFA 2MSEB 1V9LA 1E8MA 2FSIA 4KXUA 2R3SA 3OTQA 4TKZA 4DSOA 1PHPA 3ET4A 2REOA 3OLWA 4BQRA 3R7FA 2O7SA 3AJ8A 2QYTA 2QMUA 4LWPA 4MPDA 3HP4A 5COAA 4KLNA 4H7JA 4FR2A 4MYCA 2QU8A 2Q7OE 3F73A 4QDUA 4R9RA 5BMVF 4GKBA 3B1YA 1M1YB 5KHAA 5L7TA 2B4RO 2JZCA 1KOGA 3MTJA 1NDUA 3LKZA 1JIUA 2PXHA 1N9KA 4G5YA 2XE8A 1C8VB 1EP1B 2PZJA 3EXEB 4XWWA 1R6DA 5ALZA 2IYXA 1GL9B 1M34A 4R2WA 4R2XA 5A05A 1PFQA 1XU4A 3HB7A 1Z13A 3BGOS 1J9GA 2QPLA 4I55F 2AF4C 1O94D 4O2BA 2Q3JA 3VZRA 2ECFA 4L5JA 1HT2E 5EQDA 4D3DA 1Y8QB 3LO5A 1F2UB 2NP6A 5K8UA 1YB1A 2HCJB 2ZRNA 2GSDA 3WGUA 5ALVA 2DBYA 3FDXA 3RHSA 4OGKA 2C4MA 3A7EA 1H1LA 1EFLA 3TQIA 4B7CA 3H0EA 4KODA 5MGNA 4Q3KA 3FMIA 3WYEA 3P2OA 4AMYA 3ZI4A 1AK1A 3NBKA 1TD9A 1Z8HA 4W82A 1OR8A 5AKJA 5HG0A 4Z0HO 5B58T 3RK0A 3TZCA 3VR1A 4EQ6B 5ADVA 3O83A 4YECA 4XX0B 2XBUA 4ZYLA 2PWZA 1Y3IA 3QW4B 1G3RA 4E7OA 4DNOA 5A0VA 1JP7A 3D6MA 2IE8A 3U26A 2WI8A 1QHYA 3QXHA 1I7QB 1DBPA 1MO3A 4BNHA 3G3EA 3CEHA 4ABYA 4R69A 2PEYA 3Q2IA 3RVQA 5FBQB 5HIMA 4JASB 5KOHA 4DLSA 4YB8A 1J2TA 2VTDA 2MCFA 3QBJA 1WNTA 4B46A 3ZDEA 1UKCA 3TK1A 1RC1A 4UBMA 3A9CA 5ALIA 1EWTA 3KYDB 3X43A 4FB4A 3ANSA 5K8LA 5JLJA 3PC8A 2O3SA 4DDUA 2IA5A 4HNTA 1LTHR 3AEKB 4PE5B 2O14A 4DAOA 1KYVA 4NENA 5FWAA 3EIXA 5CG2A 1D2HA 7ADHA 1E5DA 3KE8A 2J7PA 3NKLA 3VZCA 3WWZA 5KAMA 1SXJE 1PW5A 3G8YA 4RSHA 4E09A 4JX9A 3ZH9B 1RPZA 1NLUA 2GRUA 3SXUB 2VQDA 4BGDA 4J7XA 5JD5A 2A14A 3M9LA 5TGZA 3HYCA 3UOAB 4RXUA 5FA5A 4HLUA 2IYWA 3PQ8A 4ID3A 4DDWA 3AY6A 1CZNA 5HBGA 3VRHA 2W11A 3KFXA 3KUUA 2O0LA 2QF7A 3LDGA 2N1BA 3VPSA 2AE2A 2QYOA 4BWFB 1T2CA 3CONA 2AFVA 1U2RA 5AXDA 1ISJA 2B8WA 4UOEA 1H2BA 5AW2A 1AIPA 3DKKA 3G2HA 3OEYA 2V6BA 2DT8A 4KSBA 2Y1XA 2YY6A 4NBRA 2HMYB 3AF6A 3AUAA 4IXWA 3UAWA 5LQAA 2Z1NA 3EFOB 4D9EA 3OKPA 3UPDA 2DQZA 3WGMA 1TYAE 5FCDA 3W2FA 3VM6A 2IS6A 5DXJA 3A1DA 2YOHA 4B75A 1M2NA 4CF3A 2OCIA 1FP7A 3HK2A 1XNGA 2ERCA 1XCJA 2ZE7A 4GZ6A 2YS6A 4NMHA 5L7YA 3FIUA 4ZICA 5CW1A 3S8EA 1TEVA 4N4AA 2C2KA 2C82A 2PQ2A 3R7WB 4CKCB 3S1SA 2O8EA 3AR4A 2QRZA 1NBOA 2VQ6A 3WV5A 5D5PA 1ULSA 1YO6A 1S5PA 3L7JA 3VUEA 2PFSA 3R9KA 4AX8A 1OKKD 1ISRA 2QUHA 4X44A 4OMCA 3QQ5A 1Q0UA 2OZLB 3EVNA 4YMUA 4I9GA 2V6IA 4S1TA 4CBVA 1I2CA 4N40A 2Z83A 1NBWB 1YFLA 3HABA 2XHZA 1ISHA 4H0FA 4S0ZA 4ZREA 3D5QA 3CRNA 2AOUA 3RGGA 2D7DA 1I13A 4PZEA 3KPVA 4UVEA 4UNIA 1DNPA 2Z2XA 3AZPA 2CVQA 4F7DA 2ORVA 5I4KA 3U17A 4IW3B 2ZSBA 1X7DA 3Q8WA 4RKRA 2GEKA 1NXQA 1C9MA 1KZ7B 1JECA 5EP1A 2JJ1D 3SJBA 2DPGA 3GEIA 3AFOA 3JQ8A 3GEHA 3VR2D 4NCKA 2C4HA 3ETHA 3DS8A 2QN2A 5JYDA 1LRKA 3CS3A 4IDQA 4REQB 4E5DA 3IP9A 1SHTX 3EEQA 4LXIA 3B6JA 4M88A 3P0IA 1BSVA 1NW5A 1O97D 1NSYA 1QQ5A 1SG6A 2ZTUA 3I9NA 2HQBA 2OQ2A 4FZRA 4WOBA 4BTLA 1FBNA 2OBYA 5FBRB 2YUIA 3OG9A 4P7KA 4LOHA 5K2MA 4EYEA 6CHYA 5HJ5A 4PX2A 2HIHA 5HJ7A 1H2RS 4MGKR 1EWVA 3VPXA 4BVEA 5DRYA 1VJRA 3ESZA 5KMGB 1L7XA 1J56A 3BXOA 1S1CA 3L0DA 3SHOA 1X15A 4AECA 3EEFA 3B70A 3I45A 2VT6A 3ILVA 1RI5A 2J0UA 3HJTA 3LWDA 2QAIA 3DKRA 4LNHA 4E2WA 3KJEA 3DPUA 3K5PA 1Z63A 4C0AC 3G0DA 4PLZA 5KWVA 3W5DA 1N3IA 1QP4A 4MUAA 3DZCA 5ER9A 1Z2NX 1TO1E 3RSHA 4RKQA 2I65A 2BJVA 4TVOA 4I8XA 1X13A 4Q6WA 4X61A 5IBCA 2ZPUA 4YC7A 4KKXB 3JQRA 2LCQA 1VJTA 4V3CA 3RU2A 1M6HA 4DRXA 3K4QA 1TECE 1U0EA 1ZCBA 1ZJZA 3AHIA 4GSLA 4PC1A 1WVMA 2JLUA 2AWNA 1XF9A 4I66A 4ZI7F 3PFWO 4F56A 2Z58A 5IVDA 4XASA 3UHOA 1AUXA 4N8EA 1NNEA 5DCLA 3NHUA 4H4CA 5AXCA 3NFRA 4QPCA 1F3LA 2ZIUB 4WA8A 3TVTA 5A4MS 1ARZA 3TLJA 3ZIAA 2R7LA 4BKUA 1FMFA 2BSAA 5GTDA 1KVRA 2JFUA 2R25B 3A06A 4RZQA 3KUXA 4CR8A 3PRHA 5ULLA 3VHQA 4S2EA 4F93B 2O2YA 2FWIA 5DTRA 4KXMA 2JDIA 3MRVA 1H3EA 4WXMA 4RV5A 2WJHA 3TF5A 4DS3A 2WDZA 4HEQA 2ZUCA 1PJTA 1NYQA 4NNJA 4A0FA 4CQLA 1PQPA 1UXIA 3CNNA 1JQEA 1SVKA 3EQ9A 3QNWA 1FFEA 1V3QE 3CF2A 1ZMXA 5EXXA 5JAIA 1IUKA 2OM2A 2Q4OA 4E3WA 1FCJA 1L9XA 1W581 1YMQA 3OUZA 3PZRA 4EGFA 4DSAA 5C5IA 2ZIVB 3GLGA 2VJPA 2QGFA 5LP6C 5C46F 3HYSA 1RI4A 4R9UC 1XJCA 1ZXLA 4MUBA 4WH0A 1ZK2A 3I9OA 4WNCA 2FN8A 3ONNA 2VJMA 2DU8A 4P0PB 3STVA 1FYXA 4FFLA 4RZ3A 1G5HA 4X7MA 5H4GA 4H6XA 1NU8A 2QP9X 4O2BF 2DBRA 2ZRPA 3FBTA 3C3JA 5FF9A 1T91A 5LMZA 3H5RA 3NALA 3OQ6A 1CFZA 3Q10A 2BKVA 4HP8A 2FZCA 1G19A 2CW5A 2FPSA 3D2AA 3E7DA 3NHKA 4NE9A 3UFXB 3OTIA 2ZB2A 3IP7A 5SZIA 2VLIA 5JATA 2RGWA 3B6MA 4LXYA 1L4HA 1XZKA 2R9VA 3PC7A 5TQ0A 3ZLBA 1FNSA 1GG8A 2B7BA 3ML1A 1IXYA 1MB0A 3KYJB 4HB3A 1UZNA 3AIIA 2RHDA 3EA5A 5CA0B 3UXYA 4HTAA 3ETCA 2IHTA 1L3IA 3BOSA 3DNPA 1AK9A 2EJUA 1JKJB 4KYVA 4OM7A 2XXAA 4RVOA 3TTTA 1K3TA 3K94A 3O26A 1OXTA 5IARA 4D80A 2EKBA 2ZANA 4NBVA 4R9SA 1UDWA 3V1MA 3CLSC 3RVOA 1FBTA 3FCUB 4LG1A 1ECFA 1MC4A 2IYOA 3RKSA 3ROTA 5BSRA 1OREA 4GXQA 3F71A 4UDOA 2ICAA 5C5CA 2VAWA 3CX3A 3LX4A 3MAAC 5T3UA 1LPSA 4LWOA 4L74A 4MWOA 1RXSA 2B7CA 1PK8A 3AQIA 4JXJA 4B73A 3GLHE 3P97A 1QORA 3ACDA 4GS5A 4AQDA 3IJ5A 3CZQA 5EIBD 2DBVO 4MO9A 1CE8A 3D6FA 2GN4A 3F6SA 4GQBA 4IHKA 5FBZA 1H4SA 1TUBB 4B09A 3KO8A 2NMVA 2PKWA 1M3SA 2ZLBA 5T5QA 1FLVA 1AKQA 2GF2A 1GTMA 1ULTA 3MJHA 1WU7A 1EG7A 2ASEA 2OV8A 3EQ7A 2OHIA 4JXKA 4IS3A 4HNQA 2WF6A 3GNSA 3AVYA 2I9PA 3KB6A 3I62A 1RJDA 3MZ0A 1A77A 5B6IA 3CH6A 4DIBA 2ZJ3A 5J4YA 3C15C 1UK9A 1YBMA 2CB9A 2O1EA 2OHVA 3T52A 4EEXA 3I23A 3AXSA 2CXUA 3IESA 4F96A 4HNGA 3IVXA 3EC2A 4OL9A 3HY4A 3NVMB 2C0CA 5CAEB 3V8PA 3ANLA 3QX9A 1UBOS 3F5FA 2ZBQA 4R84A 3G2JA 5KPJA 2JKVA 5TPZA 3SNKA 5A9RA 3HY6A 3CR7A 3EXIA 5EGSA 3S5JA 4ACBA 1EK0A 1EXNA 2XRZA 2V6FA 1HOTA 1IHXA 2CXPA 1B8UA 1RXCA 2OSBA 3C6XA 3I0NA 2OT3B 2UYOA 3K8ZA 3T5MA 3T9CA 4JR0A 1EVKA 4BQNA 2ZQ5A 1BHO1 1C3EA 2K2QB 2B20A 3JYNA 2UDPA 1DG3A 3B6ZA 3CCCA 4BNVA 3EIQA 4PHTA 4DCCA 4HB2A 1FSZA 1EZ1A 2J3LA 2ZBEA 5D5QA 1O5IA 1MCZA 4PAQA 1EK6A 1HRKA 3BULA 2LVBA 1Q0ZA 2IVZA 2X8LA 1EFKA 4IFEA 2WYHA 2XUPA 3EB9A 4ATNA 4R1MA 4ZMSA 3CGWA 1P75A 1FL9A 1KZ1A 4YJ2B 3SPXA 2ERXA 4X71A 4KQCA 2IXFA 4L6CA 4CDGA 5LWHA 3AOEA 1RKBA 2DBQA 2FZGA 3NDIA 5ETJA 3WA7A 1KDOA 3DT9A 2VK1A 1V2HE 4B3SB 3PKZA 2Z5LA 1IWBB 5IC6A 4RXTA 3KLOA 1GZ5A 2PXCA 1QZTA 2AVDA 3RSZA 2HR1A 1X70A 4A6PA 2V7XA 1B1CA 2PH7A 2J7PD 3OF2A 4HDMB 5AUQA 4OAQA 4ZOLA 5K99A 1DXOA 1G3UA 2Z5VA 3NFYA 3GJ4A 3OT1A 2LGJA 2VRNA 2ZEJA 3MJCA 1XDWA 1P29A 3GGSA 1C29B 1GA6A 4NH0A 3MGCA 4WK0B 3NYRA 2ISCA 4H7FA 1C5KA 4EX6A 1Z22A 5EWJA 5EUMA 1LPMA 4YDHB 5EMJA 3UV7A 5DNCA 1UM9A 1G8FA 1N92A 3BS4A 4MMZB 3HB0A 4M89A 1XXLA 2PG3A 3QVXA 2D59A 2PCJA 3IUJA 4BNNA 4HNHA 2BKXA 4MVCA 2QBYB 4Y3UA 3VR5H 4E7PA 5HMLA 1PX0A 4W1SA 2KX7A 2X22A 4KDFA 4Y9TA 2BY4A 1PWEA 3BIFA 3IT1A 3ORQA 1Q1ZA 4QYWA 2GJKA 4V0LA 2WP8J 4S2UA 4RBNA 4QSHA 1JR6A 2EERA 4LXGA 3FOAA 5IK2A 4AF8A 3DEJA 2D00A 3V9AA 3EAGA 2C4TA 1X94A 2BYTA 2OXTA 1N0HA 2EZ8A 3K0EA 1MQAA 4ZZ3A 4MCHA 4C43A 4OXYA 1VCHA 3VKUA 3H1FA 1O95A 4QJBA 3QPDA 4ZVQA 2PUWA 2I4RA 2I6QA 2GLXA 3OZIA 3EA0A 1SG9A 3DDOA 1R4AA 1YUNA 3IVAA 1IBCA 2B1JA 1P39A 2CCJA 2ZULA 3OIFA 4MYSA 1OAOC 3M5WA 4MVJM 4M8LA 3Q3JB 3SX0A 4JI4B 4IV8A 4EGCB 1NAIA 2ZAIA 2ATIA 5ARDA 1DLJA 3L0SA 3I73A 3FNHA 1AKMA 3LP5A 1GAEO 3TXAA 1PGJA 2BIFA 5TE9A 1TD1A 3T9DA 1KZHA 1N1EA 4LDQA 4FFBA 1U11A 1VRWA 1M7GA 1RCTE 2WWIA 2K6GA 2IZ7A 1DWPA 1SBCA 3GGOA 3L04A 4XLZA 5FPSA 3WK4A 5HOQA 1Q12A 3B3GA 2XWSA 2ZJ8A 7MHTA 2EC5A 4C7BA 4UHHA 2W4IA 3BTSA 3KR2A 3FHOA 1U1EA 3BMCB 3FOCA 5I9TA 4ENWA 1JDVA 2JI6A 4R1TA 1T13A 2AOVA 4YV2A 2FLWA 2FPGA 1THMA 4IOLA 2VUTA 1OROA 1ISPA 4IF6A 1JIJA 3L4JA 5CT8A 1M73E 3P9SA 1U1CA 4TT3A 3R9XB 1TQ8A 5IDWA 1UKZA 3LYAA 1SD1A 3AERB 3VYWA 2JBHA 3QHPA 4LOKA 4GUAA 3ZV6A 4E2FA 2GEFA 3JSXA 1DE0A 5E1BA 1RI2A 4HRAA 1UDCA 1VHJA 3SC2B 2BR5A 1VSUA 2LIVA 3VTZA 3PSAA 1DAPA 1YQTA 1C7IA 5JXWA 1TVEA 1MW9X 2ZCUA 4II7A 3RJTA 1E0AA 1ZG3A 2PR7A 1ESNA 4MK4A 2WQZA 3MWGA 3PUHA 4D9CA 3QW2A 3DOJA 3N2ZB 1Z0ZA 1ECCA 2A1IA 2P9FA 2PK3A 4U0JA 1ADFA 1E59A 4WFQA 4LZZA 1NVKA 4EUNA 3DYVA 4ZWNA 1V8PA 3KQLA 5FTMA 4P86A 4Z3DA 1XK7A 5REQA 5BWCA 1J24A 2QPOA 2FFHA 2X41A 4TWJA 2HFKA 5CX4A 1DOHA 2NVUB 1S8AA 2HSJA 5JNVA 3JPWA 3O95A 2Q99A 2B9VA 2I33A 5CU7A 3H9GA 2UZAA 3CV3A 4HWRA 4IOMA 2J59A 1ZHFA 1G98A 4QUIA 3GFVA 3EIFA 1KS9A 2J9RA 3DR3A 3KQSA 3HHEA 4EOGA 5JTTA 2WVJA 4FCVA 1OFUX 4CR7A 2OLKA 2QI9C 3K92A 4EAQA 4JUFA 3KQKA 2ZIZA 3P2EA 4NR0A 2YFYA 3Q0TA 4WXYB 3EXHC 2XT9A 3WOHA 5CIQA 1KDPA 3LPLA 4BNMA 4J0IA 1UQTA 3DT8A 1EQAA 3GLKA 5JEDA 3ZIAD 2ZSFA 2G36A 1E1DA 2X58A 3DHNA 3U37A 1NAHA 3Q3HA 3PGMA 4ROTA 3C3WA 4RGVA 3W5JA 3FYUB 1RLOA 1CPYA 1IJBA 4FWBA 2YFQA 4MUEA 2YHBA 4XXHA 3PHCA 3ZS8A 4DVGA 3WHPA 5A03A 2JDID 2FZLA 1OAAA 4A92A 3B85A 3A2KA 1XK6A 5AXBA 4H1UA 1X1EA 3DE2X 4RIFA 1OFGA 1EMDA 2FMKA 1R9GA 5AJVB 2VCEA 1YDWA 2ODEA 1NQVA 3DMPA 4M86A 4XD2A 2PVPA 2B8NA 2BFFA 2VKQA 4M1ZA 4UVIA 3RBAA 4EHBA 3UGKA 5EJFA 4CMGA 1B6GA 3HVJA 4MINA 1Y5MA 3K31A 2WQ7A 5I9LA 4F60A 3HRKA 4BCCA 2E0IA 2XGSA 3WKDA 1I1HA 3DL4A 4X3PA 3TRKA 3WO0A 1QIJA 2HC9A 4MX8A 3RS7A 3HJCA 1W94A 3EF1A 1A7UA 2HBQA 4G6ZA 4HDQB 2X19A 2JFBA 3SI7A 3SS8A 3NRCA 3I6BA 1QUEA 4LRWA 5EPUA 1E0SA 1UXHA 3A4IA 1G8AA 4R7ZA 3HFGA 4TVBA 4V2IA 2V0NA 2YCLA 2LUOA 1UQRA 5TF4A 3GVCA 1SURA 2GPYA 3UBMA 2GVZC 2Q1SA 3WB2A 3MHTA 1TRHA 2ZBRA 4XWGA 3ZDFA 1R27A 3ZWAA 1UJMA 1GTG1 4C05A 5K0JA 3JQCA 4H08A 3FSEA 2OFXA 5T3YA 3LKBA 3QUCA 2VPIA 1GQFA 4RK4A 4XJXA 2X6QA 1YA6A 2BMVA 2QUKA 3ETJA 1K6MA 3WZLA 3T5AA 3AVWA 5AH0A 2BFWA 2PZGA 3DBVO 4Y2UA 3N8GA 1EVJA 1G8JA 1G18A 4FHZA 4FE7A 4KWIA 2XJ9A 4UFPA 3RSLA 1IB0A 2GPJA 3JWHA 4G0NA 3AR3A 4J2OA 2ZI4A 4KQGA 4BL5A 2ZETA 2A9PA 4OGLA 1PZXA 4DABA 3KG2A 5LQKA 2PNJA 2BH2A 4NVRA 1L5WA 3I5UA 1ZGBA 2C5EA 1XEXB 3IE2A 1DIHA 4DG8A 2GILA 4BX8A 1Y5LA 4P7BA 2OFOA 1IY1A 1ADBA 3EE6A 3FCEA 3PDCA 1Y8RA 2A5JA 3E61A 4P9NA 4BTVA 3B82A 2NO5A 5LDDC 4WCFB 2IUUA 3RD5A 5IH7A 1QG0A 3T4XA 1QOQB 2UAGA 4H7IA 4MO2A 1B8PA 1UM8A 2N42A 3L7BA 4ZOLF 4UMVA 4AY4A 2CYBA 1JLKA 3M7IA 2VSNA 3FNBA 4E0BA 3D0QA 4DV6B 1Y7TA 2JFYA 4ZT3A 1CQZA 4G0PA 3JZAA 5FPPA 3EG9B 1IAVA 5I45A 2X2PA 3N5KA 1J9ZA 5CVJA 4YLYA 6NULA 5K5EA 2J3MA 4M1EA 3RJ5A 1T25A 5A0FA 3WKBA 4EPXA 3O91A 2VDQB 1ZC4A 1Z6TA 1M2FA 4MXDA 4Y2PA 3I4FA 4IDOA 4UD6A 3E1KA 4PHHA 4Y67A 1ES9A 3X2SA 1MG0A 1Q74A 1WSDA 2BGUA 1WCXA 4WDRA 3AMVA 3U7FB 3DLHA 2K7ZA 4EG1A 1JHDA 2ODWA 3TL6A 5HZGA 2B35A 1FIUA 3RVJA 4PC6A 4Q03A 5KZMB 3H05A 1UBMS 4TLMB 1U0JA 3FAZA 1GPDG 2FSVC 1TMYA 5CXXA 3RAFC 5TPZD 4FHFA 1T15A 1Y5RA 2QRPA 1XXHB 3A1TA 4C89A 2Q9BA 3MK31 2H2AA 2X8WA 2FW1A 3ICOA 4ND1A 4YCNA 1A9QA 3BWMA 2AD1A 4FCWA 2JG3A 1AZWA 4BC0A 3ZU6A 2HRBA 3GDGA 3R2JA 2PO7A 1NRWA 4YCDA 2PQMA 3MTAA 1AN9A 1CUZA 3EVFA 4AQ7A 3K1YA 3MWYW 1VMAA 5E4YA 1DAIA 3LSTA 3L8HA 1DEAA 1OE0A 4WVLA 1BX3A 3AVOA 3FF4A 4D98A 4F45A 4ZK2A 3GLQA 4ZU3A 2X5NA 2PAFA 2O1WA 3KUCA 1XZCA 1DL5A 1V96A 2JD0A 1QF9A 2IFTA 1BH2A 3D1VA 3IMKA 3KXDA 3I6ZA 5D00A 5ALDA 3RG8A 3VPGA 4EZBA 2R1VA 2ECQA 3P9IA 4JJ6A 4IF4A 1Z88A 5K6TA 4BHTA 3FFWA 2ABWA 3QKRA 2YNMC 3CLTD 4DWVA 4MR9B 1D6JA 2OYSA 1W85B 4K0RA 1IEWA 1JZSA 1YR2A 3B38A 3NTRA 4C4ZA 1L4LA 4QOJA 4WERA 1IZ0A 3K96A 5JROA 4EVSA 5JT1A 1N9GB 2B6HA 2BDUA 2XZTA 5ELMA 1IATA 3IKJA 4H77A 3W79A 4OJKA 3OTGA 3L1UA 1LPBB 1R3DA 4JEHA 2FUKA 2ARKA 4UNRA 2HQ1A 1IBLB 1KL7A 2IXGA 3ADBA 1KVSA 2WK1A 3KB8A 3E5NA 4I4TA 2JJYA 1ZI8A 1LJ8A 4M9RA 3U40A 1M2JA 2YY5A 3VC3A 1ZCJA 3DBLB 2HHJA 5GGYA 1JUDA 4CM9A 2WZCA 2VEDA 4LJ5A 4XYBA 1VLQA 3DXXA 4RZSA 1JILA 5JYCA 5ITVA 3ESBA 4PSVA 1P1KA 5JJBA 5SYNA 3KAKA 3DKIA 1U02A 5IK2D 2VHQA 4Z54A 5H81A 1BDHA 3JVIA 1DWOA 5A3SA 2HQSA 3RHTA 2OHJA 3D43A 2QV0A 2W58A 5JBNA 4AUNA 1RQPA 4AJOA 2X7JA 3CVWA 1O95D 4RACA 2GNOA 6PFKA 2Y4OA 3PFHA 2W5UA 1YULA 2H5JA 2WUEA 3DONA 4FJ2A 1JHOA 2ZB7A 4JT4A 1FX1A 5DNAA 4B33A 3PRJA 4ZRDA 5FTWA 1EAMA 4Q7JB 3O8CA 1E63A 3HU5A 1EA7A 2F6RA 1RFLA 1UL1X 3AIMA 3BKWA 3MILA 4G26A 4J2TA 2VYVA 3UHPA 3B12A 2RJ3A 3I9V1 3AI3A 3KALA 3LIIA 2XE4A 3PU6A 2P4SA 3SDSA 4Z7QB 1X7ZB 4FI3F 2QVBA 3OQJA 4LHEA 4Y2VA 3FMGA 4RD2A 5H82A 4B2IA 4D7AA 2R7MA 1RIFA 1NVBA 2OQVA 4FZVA 5AVUA 4YVFA 2C2HA 3T5GA 1KYZA 2FP3A 4LZJA 4INJA 3SVZA 4PZUA 4HWTA 2CBXA 1HDOA 2MINB 2KB0A 4D1YA 1HTTA 3CJQA 4GWKA 1ORVA 1JLHA 2ID7A 1BXRB 1W5EA 3CRRA 4Z9FA 2Z6AA 3AFHA 3W05A 3GEDA 2FMTA 1HE8B 2FETA 4UEOA 4TT3D 2HI0A 3COWA 3V4FA 1WIWA 1YHNA 4HDCA 1D2NA 1TJ5A 3RYFA 2Y8EA 5SZHB 5BN4B 4IIXA 4DUPA 2XUOA 5FQOA 4KVZA 4IDGA 1POWA 4RF3A 3SC3A 3GD7A 5JZBA 3O8RA 1MGPA 2YY7A 1UDXA 5LMCA 1JLMA 3EBOA 3ZE8A 2F17A 1JIKA 2D06A 1XMPA 3PDJA 2R85A 2I8AA 2PCLA 3WQSB 1LU9A 3G0OA 2QU7A 4U1RA 3W5CA 3OHPA 2Q8NA 5B6PA 4EYQA 3ZDCA 1VKNA 3BZBA 3OMWA 4EB3A 2TMGA 1P1FA 2O3JA 5IAKA 4CEJA 1EM6A 2BAGA 2UZ3A 1E6KA 3AKZA 1Z18A 4CGYA 3DPIA 1W9HA 4PNEA 1OY1A 2VF7A 3H83A 1FSFA 1MABB 3TUIC 1SB9A 2HMTA 4COKA 4DLYA 5SICE 2RH4A 4KPUA 5ICEA 5TR9A 1LK7A 3FYTA 3R4VA 2FSGA 2QQ0A 2WF9A 4L7QA 3OJWA 4FCCA 2GEUA 1NLMA 3T4PA 5FLEX 4HO1X 1VLHA 3WNDA 3KJNA 4X00A 1G1AA 1ACLA 1F38A 2Y9MB 5FBWB 1NOKA 2GD2A 3T61A 2WUDA 5KVAA 2WA2A 1KARA 2Z30A 3IVRA 3LA8A 4Q4JB 1Y9JA 2JC3A 3CNLA 1DINA 4JP3A 3GZJA 2F4NA 1GRQA 2YZKA 1TQ4A 4QQ8A 4XB1A 1YZHA 1Y3BE 2GLUA 3FWHA 1XQ9A 3IQXA 4Y9SA 1H5QA 1ZM9A 3QFSA 4XDHA 1CJSA 5FNVB 2JIMA 3PLAE 1TIBA 4G3XA 1GGFA 3FCYA 3SOPA 2FQXA 1Q22A 2IWRA 5KJ1A 4RANA 5CIYA 2VUIB 3QWIA 2AEEA 4KPGA 4IQGA 5DWQA 4RD0A 4KGZA 1VIVA 2CLIB 3IQIX 5SY9A 5K3OA 4YRLA 1T4CB 3DAFA 5DTEA 1M6VB 3I53A 4MS4B 2XCIA 3AF0A 4JKYA 1QBGA 2JD1A 4ED9A 3OTOB 1FU8A 1SCBA 1U3DA 2VUSA 5F33A 3K0SA 1KDYA 1YQGA 3S3TA 4URUR 3UKDA 2Q28A 1E2KA 3PVZA 2O0KA 3GG9A 4O29A 4TYWA 1RBMA 3HBLA 5K4HA 1T3TA 2RGDA 1WKCA 3JVEA 4YCAA 5AW1A 3MTIA 3DQZA 4W8GA 4RHEA 4NIMA 3BDIA 4QNNA 5L8VA 4ZAFA 3AWDA 5JXJA 1SCNE 3ZGOA 4ZV9A 2FMHA 2SKDA 4EY7A 2G40A 2W6NA 5LUAA 3TQTA 3DE3X 3IUYA 5DV9A 3ZVKA 3ZWMA 5E9QA 1LC3A 3PZBA 3RIEA 1B43A 2PD6A 2W2PA 2P9ZA 3BKXA 3HVHA 3L0ZA 1UMCB 2B99A 2VJNA 5DVZA 5HOEA 2CK3D 2Y92A 4KFSA 4O5OA 3R7BA 4YAGA 1H6CA 1R6TA 1NOIA 3KSAC 3H7AA 2XQIA 1UCFA 4IJMA 2PLWA 3PDHA 3EHEA 3MXTA 2X5KO 1TVMA 2P5YA 4DM7A 2Z6VA 2D2XA 3U62A 2A78A 3HUFA 3PUJA 5IT0A 4JA0A 4P4UA 2QSJA 4KLRA 1NU6A 2ZVDA 1XZDA 3WY9A 4ZEVA 1TF7A 1ZQ9A 3ZJ5A 4FMCB 3FVRA 2C3UA 2OOKA 1OXSC 1NVEA 3Q6IA 4KGXA 3DE0X 5HP4A 3PHIA 1PSDA 5C1DA 3Q5EA 5HZMA 1QDUA 1XZFA 4EJ6A 1GNVA 1I36A 3OHMA 3FAKA 4P3OA 3M6VA 3OOJA 1SBYA 4OHPA 2I78A 4H4EA 5C1IA 3T8YA 4PRZA 1INLA 3DR5A 4PV7A 4RPGA 3CURA 1L4BA 3DUFB 3HN6A 3LYHA 1WXXA 4HGOA 2NWQA 4YO7A 3HJFA 1JJBA 4I9HA 4JEIA 1U4OA 4JLNA 3V8NA 2QIPA 2ZREA 3O4IA 1ONPA 1RWVA 1BHJA 3KQUA 1E9SA 3A6FA 3QI2A 3STTA 3HDJA 1XRMA 4D43A 4ZI7B 3LZCA 2WNSA 3DBOB 3CRVA 4O0LA 4MVJA 4D8XA 2PA3A 2FPKA 5CDFA 1VCMA 5DGTA 2C84A 3GDWA 3KJGA 2Z1MA 5A7HA 4LCEA 3HNRA 4DCNA 1PK9A 4CKEB 1EZZA 1DJOA 2V97A 1EJ2A 2X9NA 1H8EA 2AOTA 4MRMB 4QGFA 5LQMA 5ILOA 4OI4A 1W5AA 4I4TF 3WGKA 2WJVA 1DRKA 3IEPA 2ZG6A 3NEJA 2QUZA 4Y6SA 1O8BA 2X76A 4KE7A 3M3HA 4PX5A 1YZTA 5CCDA 5F78A 4URXR 3JD2A 1ZIPA 3DKVA 5JHGB 3DZIA 3SCZA 2MYPA 4FFNA 4GI5A 3G9ZA 3B20A 4YQFA 1REQA 5K3SA 5IT9A 3V4RA 3MS4A 4NQZA 2ZZNA 2PU7A 3M0EA 2ROQA 3GH3A 2QRMA 4QAQA 4W9RA 5H02A 2IPNA 3KQHA 1MIOA 3AZQA 4KPEC 4LECA 2Q6TA 3RASA 1ZJ4A 3K9CA 4D96A 4HXYA 1YUBA 1UBUS 4MICA 3Q5DA 4TMZA 2R68A 4A0RA 3GNTA 2ZYUX 4TM7A 4O0MA 3DHYA 3GJXC 4Y6LA 2RIPA 1LVGA 2CNDA 3NHBA 3ZCVA 2PJUA 2O59A 3H8WA 3IFSA 5ALSA 3WIUA 3ZI0A 2PMKA 1SRRA 1FU7A 1Z6YA