3FTTA

Crystal structure of the galactoside o-acetyltransferase from staphylococcus aureus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
188
structure length
188
Chain Sequence
MTEKEKMLAEKWYDANFDQYLINERARAKDICFELNHTRPSATNKRKELIDQLFQTTTDNVSISIPFDTDYGWNVKLGKNVYVNTNCYFMDGGQITIGDNVFIGPNCGFYTATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKVVRKIDNDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative acetyltransferase SACOL2570
publication title Biophysical analysis of the putative acetyltransferase SACOL2570 from methicillin-resistant Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus col
molecule tags Transferase
total genus 67
structure length 188
sequence length 188
ec nomenclature ec 2.3.1.-:
pdb deposition date 2009-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12464 Mac Maltose acetyltransferase
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3fttA00
1V67A 4M2AA 2IU9A 3D98A 1QREA 3SRTA 3VBMA 5DEMA 4EA8A 3R2WA 4ISXA 4J09A 4HCQA 3R5BA 3TWDA 3DHOA 3DJ4A 5ADXU 1OCXA 1SSQA 3BFPA 3DK5A 1G95A 4MFGA 5E3PA 3GUEA 3T57A 4KNRA 2XATA 3OTZA 2WLFA 3VBPA 2QKXA 3C8VA 3MQHA 3IXCA 3TV0A 1XHDA 4J18A 3EH0A 4E6UA 3R8YA 4EA9A 2GGOA 4M98A 2OI7A 1HV9A 3FOQA 4EABA 2TDTA 3OW5A 4R7PA 3BSYA 4EQYA 2OEGA 2RIJA 3BRKX 1S80A 5U2KA 2OI6A 1SSMA 2I5KA 5AFUV 1TDTA 3R0SA 2WLDA 1FWYA 4IHGA 1QRLA 1KK5A 2IU8A 4N6AA 4EA7A 1KRUA 4E6TA 2OI5A 3VBLA 3I3XA 2IC7A 3R3IA 1HM9A 1FXJA 4HZDA 3HJJA 4G3QA 3VBIA 3PMOA 3HSQA 3KWCA 2NPOA 3IGJA 1QRGA 4H7OA 2GGQA 4N69A 1J2ZA 3CJ8A 1T3DA 3FSCA 2V0IA 1LXAA 4HZCA 5L6SA 1THJA 2V0LA 1KRRA 4EAAA 5E3RA 1MR9A 4G3PA 1HM8A 3BXYA 2FKOA 3P1BA 3FSYA 1G97A 5F42A 1YP2A 2W0VA 3MQGA 1KGTA 3FWWA 3TIOA 1KK6A 1Z90A 3KWDA 1SSTA 1YP4A 4K6RA 4HURA 3R5CA 3R3RA 3VBJA 4KNXA 4M9CA 3VBKA 4N27A 5ADXV 3BSSA 4KQLA 4M2BA 2W0WA 3GOSA 5DG3A 4AC3A 3TDTA 4G87A 2VHEA 4E75A 4HUSA 4EGGA 1MR7A 1QRMA 3EEVA 1KQAA 1YP3A 3FS8A 3R5AA 2ICXA 3BSWA 4G3SA 3TK8A 2VD4A 2V0JA 3MC4A 3GVDA 3OU9A 4MYOA 2P2OA 1MRLA 4KPZA 1KRVA 4M28A 2AQ9A 4E79A 4FCEA 5L6VA 4R36A 4AA7A 4R37A 3VBNA 3SPTA 4DCLA 4IHHA 2QIAA 4KPXA 1KHRA 2ICYA 1KGQA 3F1XA 3R5DA 5E3QA 3TISA 3FSBA 5DEPA 1QQ0A 4MZUA 1XATA 3KWEA 3R1WA 3I3AA 2OEFA 3FSXA 3NZ2A 4N6BA 2JF2A 3FTTA 1V3WA 3ECTA 1HM0A 4M99A 4AAWA 4E1KA 2WLCA 3OUPA 3OTMA 5AFUU 2IUAA 2V0HA 3JQYA 3P47A 2WLEA 3Q1XA 4IHFA 2Q4JA 1QRFA 3D8VA 3VNPA 2V0KA 3V4EA 3ST8A 3EG4A 2QIVX 2WLGA 1KK4A 2JF3A
chains in the Genus database with same CATH superfamily
1V67A 4M2AA 2IU9A 3D98A 1QREA 3SRTA 3VBMA 5DEMA 4EA8A 3R2WA 4ISXA 4J09A 4HCQA 3R5BA 3TWDA 3DHOA 3DJ4A 5ADXU 1OCXA 1SSQA 3BFPA 3DK5A 1G95A 4MFGA 5E3PA 3GUEA 3T57A 3OH2A 4KNRA 2XATA 3OTZA 2WLFA 3VBPA 2QKXA 1Z2FA 3C8VA 3MQHA 3IXCA 3TV0A 1XHDA 4J18A 3EH0A 4E6UA 3R8YA 4EA9A 2GGOA 4M98A 2OI7A 1HV9A 3FOQA 4EABA 2TDTA 3OW5A 4R7PA 3BSYA 4EQYA 2OEGA 2RIJA 3BRKX 1S80A 5U2KA 2OI6A 1SSMA 2I5KA 5AFUV 1TDTA 3R0SA 2WLDA 1FWYA 4IHGA 1QRLA 3GQ7A 1KK5A 2IU8A 4N6AA 4EA7A 1KRUA 4E6TA 2OI5A 3VBLA 1L0SA 3I3XA 3OH0A 2IC7A 3R3IA 1HM9A 1FXJA 4HZDA 3HJJA 4G3QA 3VBIA 3PMOA 3HSQA 1EWWA 3SUCA 3KWCA 2NPOA 3OH4A 3GQ8A 1QRGA 3IGJA 4H7OA 2GGQA 4N69A 1J2ZA 3CJ8A 1T3DA 3OH3A 3OH1A 3FSCA 2V0IA 1LXAA 4HZCA 5L6SA 1THJA 2V0LA 1KRRA 4EAAA 5E3RA 1MR9A 3GQAA 4G3PA 1HM8A 1N4IA 3BXYA 3OGZA 2FKOA 3P1BA 3FSYA 1G97A 5F42A 1YP2A 2W0VA 3MQGA 1KGTA 3FWWA 3TIOA 1KK6A 1Z90A 3KWDA 1SSTA 1YP4A 4K6RA 4HURA 3R5CA 3R3RA 3VBJA 4KNXA 4M9CA 3VBKA 4N27A 5ADXV 3BSSA 4KQLA 4M2BA 2W0WA 3GOSA 5DG3A 4AC3A 3TDTA 4G87A 2VHEA 4E75A 4HUSA 4EGGA 1MR7A 1QRMA 3EEVA 1KQAA 1YP3A 3FS8A 3R5AA 2ICXA 3BSWA 4G3SA 3TK8A 2VD4A 2V0JA 3MC4A 3GVDA 3OU9A 4MYOA 2P2OA 1MRLA 4KPZA 1KRVA 4M28A 2AQ9A 4E79A 4FCEA 5L6VA 4R36A 4AA7A 4R37A 3VBNA 3SPTA 4DCLA 4IHHA 2QIAA 4KPXA 1KHRA 2ICYA 1KGQA 3F1XA 3R5DA 5E3QA 3TISA 3FSBA 5DEPA 1QQ0A 4MZUA 1XATA 3KWEA 3R1WA 3I3AA 2OEFA 3FSXA 3NZ2A 4N6BA 2JF2A 3FTTA 1V3WA 3ECTA 1HM0A 4M99A 4AAWA 4E1KA 2WLCA 3GQ9A 3OUPA 3OTMA 5AFUU 2IUAA 2V0HA 3JQYA 1M8NA 2WLEA 3P47A 3Q1XA 4IHFA 2Q4JA 1QRFA 3D8VA 3VNPA 2V0KA 3V4EA 3ST8A 3EG4A 2QIVX 2WLGA 1KK4A 2JF3A
chains in the Genus database with same CATH topology
1V67A 4M2AA 2IU9A 3D98A 1QREA 3SRTA 3VBMA 5DEMA 4EA8A 3R2WA 4ISXA 4J09A 4HCQA 3R5BA 3TWDA 3DHOA 3DJ4A 5ADXU 1OCXA 1SSQA 3BFPA 3DK5A 1G95A 4MFGA 5E3PA 3GUEA 3T57A 4KNRA 2XATA 3OTZA 2WLFA 3VBPA 2QKXA 3C8VA 3MQHA 3IXCA 3TV0A 1XHDA 4J18A 3EH0A 4E6UA 3R8YA 4EA9A 2GGOA 4M98A 2OI7A 1HV9A 3FOQA 4EABA 2TDTA 3OW5A 4R7PA 3BSYA 4EQYA 2OEGA 2RIJA 3BRKX 1S80A 5U2KA 2OI6A 1SSMA 2I5KA 5AFUV 1TDTA 3R0SA 2WLDA 1FWYA 4IHGA 1QRLA 1KK5A 2IU8A 4N6AA 4EA7A 1KRUA 4E6TA 2OI5A 3VBLA 3I3XA 2IC7A 3R3IA 1HM9A 1FXJA 4HZDA 3HJJA 4G3QA 3VBIA 3PMOA 3HSQA 3KWCA 2NPOA 3IGJA 1QRGA 4H7OA 2GGQA 4N69A 1J2ZA 3CJ8A 1T3DA 3FSCA 2V0IA 1LXAA 4HZCA 5L6SA 1THJA 2V0LA 1KRRA 4EAAA 5E3RA 1MR9A 4G3PA 1HM8A 3BXYA 2FKOA 3P1BA 3FSYA 1G97A 5F42A 1YP2A 2W0VA 3MQGA 1KGTA 3FWWA 3TIOA 1KK6A 1Z90A 3KWDA 1SSTA 1YP4A 4K6RA 4HURA 3R5CA 3R3RA 3VBJA 4KNXA 4M9CA 3VBKA 4N27A 5ADXV 3BSSA 4KQLA 4M2BA 2W0WA 3GOSA 5DG3A 4AC3A 3TDTA 4G87A 2VHEA 4E75A 4HUSA 4EGGA 1MR7A 1QRMA 3EEVA 1KQAA 1YP3A 3FS8A 3R5AA 2ICXA 3BSWA 4G3SA 3TK8A 2VD4A 2V0JA 3MC4A 3GVDA 3OU9A 4MYOA 2P2OA 1MRLA 4KPZA 1KRVA 4M28A 2AQ9A 4E79A 4FCEA 5L6VA 4R36A 4AA7A 4R37A 3VBNA 3SPTA 4DCLA 4IHHA 2QIAA 4KPXA 1KHRA 2ICYA 1KGQA 3F1XA 3R5DA 5E3QA 3TISA 3FSBA 5DEPA 1QQ0A 4MZUA 1XATA 3KWEA 3R1WA 3I3AA 2OEFA 3FSXA 3NZ2A 4N6BA 2JF2A 3FTTA 1V3WA 3ECTA 1HM0A 4M99A 4AAWA 4E1KA 2WLCA 3OUPA 3OTMA 5AFUU 2IUAA 2V0HA 3JQYA 3P47A 2WLEA 3Q1XA 4IHFA 2Q4JA 1QRFA 3D8VA 3VNPA 2V0KA 3V4EA 3ST8A 3EG4A 2QIVX 2WLGA 1KK4A 2JF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V67 A;  4M2A A;  2IU9 A;  3D98 A;  1QRE A;  3SRT A;  3VBM A;  5DEM A;  4EA8 A;  3R2W A;  4ISX A;  4J09 A;  4HCQ A;  3R5B A;  3TWD A;  3DHO A;  3DJ4 A;  5ADX U;  1OCX A;  1SSQ A;  3BFP A;  3DK5 A;  1G95 A;  4MFG A;  5E3P A;  3GUE A;  3T57 A;  4KNR A;  2XAT A;  3OTZ A;  2WLF A;  3VBP A;  2QKX A;  3C8V A;  3MQH A;  3IXC A;  3TV0 A;  1XHD A;  4J18 A;  3EH0 A;  4E6U A;  3R8Y A;  4EA9 A;  2GGO A;  4M98 A;  2OI7 A;  1HV9 A;  3FOQ A;  4EAB A;  2TDT A;  3OW5 A;  4R7P A;  3BSY A;  4EQY A;  2OEG A;  2RIJ A;  3BRK X;  1S80 A;  5U2K A;  2OI6 A;  1SSM A;  2I5K A;  5AFU V;  1TDT A;  3R0S A;  2WLD A;  1FWY A;  4IHG A;  1QRL A;  1KK5 A;  2IU8 A;  4N6A A;  4EA7 A;  1KRU A;  4E6T A;  2OI5 A;  3VBL A;  3I3X A;  2IC7 A;  3R3I A;  1HM9 A;  1FXJ A;  4HZD A;  3HJJ A;  4G3Q A;  3VBI A;  3PMO A;  3HSQ A;  3KWC A;  2NPO A;  3IGJ A;  1QRG A;  4H7O A;  2GGQ A;  4N69 A;  1J2Z A;  3CJ8 A;  1T3D A;  3FSC A;  2V0I A;  1LXA A;  4HZC A;  5L6S A;  1THJ A;  2V0L A;  1KRR A;  4EAA A;  5E3R A;  1MR9 A;  4G3P A;  1HM8 A;  3BXY A;  2FKO A;  3P1B A;  3FSY A;  1G97 A;  5F42 A;  1YP2 A;  2W0V A;  3MQG A;  1KGT A;  3FWW A;  3TIO A;  1KK6 A;  1Z90 A;  3KWD A;  1SST A;  1YP4 A;  4K6R A;  4HUR A;  3R5C A;  3R3R A;  3VBJ A;  4KNX A;  4M9C A;  3VBK A;  4N27 A;  5ADX V;  3BSS A;  4KQL A;  4M2B A;  2W0W A;  3GOS A;  5DG3 A;  4AC3 A;  3TDT A;  4G87 A;  2VHE A;  4E75 A;  4HUS A;  4EGG A;  1MR7 A;  1QRM A;  3EEV A;  1KQA A;  1YP3 A;  3FS8 A;  3R5A A;  2ICX A;  3BSW A;  4G3S A;  3TK8 A;  2VD4 A;  2V0J A;  3MC4 A;  3GVD A;  3OU9 A;  4MYO A;  2P2O A;  1MRL A;  4KPZ A;  1KRV A;  4M28 A;  2AQ9 A;  4E79 A;  4FCE A;  5L6V A;  4R36 A;  4AA7 A;  4R37 A;  3VBN A;  3SPT A;  4DCL A;  4IHH A;  2QIA A;  4KPX A;  1KHR A;  2ICY A;  1KGQ A;  3F1X A;  3R5D A;  5E3Q A;  3TIS A;  3FSB A;  5DEP A;  1QQ0 A;  4MZU A;  1XAT A;  3KWE A;  3R1W A;  3I3A A;  2OEF A;  3FSX A;  3NZ2 A;  4N6B A;  2JF2 A;  3FTT A;  1V3W A;  3ECT A;  1HM0 A;  4M99 A;  4AAW A;  4E1K A;  2WLC A;  3OUP A;  3OTM A;  5AFU U;  2IUA A;  2V0H A;  3JQY A;  3P47 A;  2WLE A;  3Q1X A;  4IHF A;  2Q4J A;  1QRF A;  3D8V A;  3VNP A;  2V0K A;  3V4E A;  3ST8 A;  3EG4 A;  2QIV X;  2WLG A;  1KK4 A;  2JF3 A; 
#chains in the Genus database with same CATH topology
 1V67 A;  4M2A A;  2IU9 A;  3D98 A;  1QRE A;  3SRT A;  3VBM A;  5DEM A;  4EA8 A;  3R2W A;  4ISX A;  4J09 A;  4HCQ A;  3R5B A;  3TWD A;  3DHO A;  3DJ4 A;  5ADX U;  1OCX A;  1SSQ A;  3BFP A;  3DK5 A;  1G95 A;  4MFG A;  5E3P A;  3GUE A;  3T57 A;  3OH2 A;  4KNR A;  2XAT A;  3OTZ A;  2WLF A;  3VBP A;  2QKX A;  1Z2F A;  3C8V A;  3MQH A;  3IXC A;  3TV0 A;  1XHD A;  4J18 A;  3EH0 A;  4E6U A;  3R8Y A;  4EA9 A;  2GGO A;  4M98 A;  2OI7 A;  1HV9 A;  3FOQ A;  4EAB A;  2TDT A;  3OW5 A;  4R7P A;  3BSY A;  4EQY A;  2OEG A;  2RIJ A;  3BRK X;  1S80 A;  5U2K A;  2OI6 A;  1SSM A;  2I5K A;  5AFU V;  1TDT A;  3R0S A;  2WLD A;  1FWY A;  4IHG A;  1QRL A;  3GQ7 A;  1KK5 A;  2IU8 A;  4N6A A;  4EA7 A;  1KRU A;  4E6T A;  2OI5 A;  3VBL A;  1L0S A;  3I3X A;  3OH0 A;  2IC7 A;  3R3I A;  1HM9 A;  1FXJ A;  4HZD A;  3HJJ A;  4G3Q A;  3VBI A;  3PMO A;  3HSQ A;  1EWW A;  3SUC A;  3KWC A;  2NPO A;  3OH4 A;  3GQ8 A;  1QRG A;  3IGJ A;  4H7O A;  2GGQ A;  4N69 A;  1J2Z A;  3CJ8 A;  1T3D A;  3OH3 A;  3OH1 A;  3FSC A;  2V0I A;  1LXA A;  4HZC A;  5L6S A;  1THJ A;  2V0L A;  1KRR A;  4EAA A;  5E3R A;  1MR9 A;  3GQA A;  4G3P A;  1HM8 A;  1N4I A;  3BXY A;  3OGZ A;  2FKO A;  3P1B A;  3FSY A;  1G97 A;  5F42 A;  1YP2 A;  2W0V A;  3MQG A;  1KGT A;  3FWW A;  3TIO A;  1KK6 A;  1Z90 A;  3KWD A;  1SST A;  1YP4 A;  4K6R A;  4HUR A;  3R5C A;  3R3R A;  3VBJ A;  4KNX A;  4M9C A;  3VBK A;  4N27 A;  5ADX V;  3BSS A;  4KQL A;  4M2B A;  2W0W A;  3GOS A;  5DG3 A;  4AC3 A;  3TDT A;  4G87 A;  2VHE A;  4E75 A;  4HUS A;  4EGG A;  1MR7 A;  1QRM A;  3EEV A;  1KQA A;  1YP3 A;  3FS8 A;  3R5A A;  2ICX A;  3BSW A;  4G3S A;  3TK8 A;  2VD4 A;  2V0J A;  3MC4 A;  3GVD A;  3OU9 A;  4MYO A;  2P2O A;  1MRL A;  4KPZ A;  1KRV A;  4M28 A;  2AQ9 A;  4E79 A;  4FCE A;  5L6V A;  4R36 A;  4AA7 A;  4R37 A;  3VBN A;  3SPT A;  4DCL A;  4IHH A;  2QIA A;  4KPX A;  1KHR A;  2ICY A;  1KGQ A;  3F1X A;  3R5D A;  5E3Q A;  3TIS A;  3FSB A;  5DEP A;  1QQ0 A;  4MZU A;  1XAT A;  3KWE A;  3R1W A;  3I3A A;  2OEF A;  3FSX A;  3NZ2 A;  4N6B A;  2JF2 A;  3FTT A;  1V3W A;  3ECT A;  1HM0 A;  4M99 A;  4AAW A;  4E1K A;  2WLC A;  3GQ9 A;  3OUP A;  3OTM A;  5AFU U;  2IUA A;  2V0H A;  3JQY A;  1M8N A;  2WLE A;  3P47 A;  3Q1X A;  4IHF A;  2Q4J A;  1QRF A;  3D8V A;  3VNP A;  2V0K A;  3V4E A;  3ST8 A;  3EG4 A;  2QIV X;  2WLG A;  1KK4 A;  2JF3 A; 
#chains in the Genus database with same CATH homology
 1V67 A;  4M2A A;  2IU9 A;  3D98 A;  1QRE A;  3SRT A;  3VBM A;  5DEM A;  4EA8 A;  3R2W A;  4ISX A;  4J09 A;  4HCQ A;  3R5B A;  3TWD A;  3DHO A;  3DJ4 A;  5ADX U;  1OCX A;  1SSQ A;  3BFP A;  3DK5 A;  1G95 A;  4MFG A;  5E3P A;  3GUE A;  3T57 A;  4KNR A;  2XAT A;  3OTZ A;  2WLF A;  3VBP A;  2QKX A;  3C8V A;  3MQH A;  3IXC A;  3TV0 A;  1XHD A;  4J18 A;  3EH0 A;  4E6U A;  3R8Y A;  4EA9 A;  2GGO A;  4M98 A;  2OI7 A;  1HV9 A;  3FOQ A;  4EAB A;  2TDT A;  3OW5 A;  4R7P A;  3BSY A;  4EQY A;  2OEG A;  2RIJ A;  3BRK X;  1S80 A;  5U2K A;  2OI6 A;  1SSM A;  2I5K A;  5AFU V;  1TDT A;  3R0S A;  2WLD A;  1FWY A;  4IHG A;  1QRL A;  1KK5 A;  2IU8 A;  4N6A A;  4EA7 A;  1KRU A;  4E6T A;  2OI5 A;  3VBL A;  3I3X A;  2IC7 A;  3R3I A;  1HM9 A;  1FXJ A;  4HZD A;  3HJJ A;  4G3Q A;  3VBI A;  3PMO A;  3HSQ A;  3KWC A;  2NPO A;  3IGJ A;  1QRG A;  4H7O A;  2GGQ A;  4N69 A;  1J2Z A;  3CJ8 A;  1T3D A;  3FSC A;  2V0I A;  1LXA A;  4HZC A;  5L6S A;  1THJ A;  2V0L A;  1KRR A;  4EAA A;  5E3R A;  1MR9 A;  4G3P A;  1HM8 A;  3BXY A;  2FKO A;  3P1B A;  3FSY A;  1G97 A;  5F42 A;  1YP2 A;  2W0V A;  3MQG A;  1KGT A;  3FWW A;  3TIO A;  1KK6 A;  1Z90 A;  3KWD A;  1SST A;  1YP4 A;  4K6R A;  4HUR A;  3R5C A;  3R3R A;  3VBJ A;  4KNX A;  4M9C A;  3VBK A;  4N27 A;  5ADX V;  3BSS A;  4KQL A;  4M2B A;  2W0W A;  3GOS A;  5DG3 A;  4AC3 A;  3TDT A;  4G87 A;  2VHE A;  4E75 A;  4HUS A;  4EGG A;  1MR7 A;  1QRM A;  3EEV A;  1KQA A;  1YP3 A;  3FS8 A;  3R5A A;  2ICX A;  3BSW A;  4G3S A;  3TK8 A;  2VD4 A;  2V0J A;  3MC4 A;  3GVD A;  3OU9 A;  4MYO A;  2P2O A;  1MRL A;  4KPZ A;  1KRV A;  4M28 A;  2AQ9 A;  4E79 A;  4FCE A;  5L6V A;  4R36 A;  4AA7 A;  4R37 A;  3VBN A;  3SPT A;  4DCL A;  4IHH A;  2QIA A;  4KPX A;  1KHR A;  2ICY A;  1KGQ A;  3F1X A;  3R5D A;  5E3Q A;  3TIS A;  3FSB A;  5DEP A;  1QQ0 A;  4MZU A;  1XAT A;  3KWE A;  3R1W A;  3I3A A;  2OEF A;  3FSX A;  3NZ2 A;  4N6B A;  2JF2 A;  3FTT A;  1V3W A;  3ECT A;  1HM0 A;  4M99 A;  4AAW A;  4E1K A;  2WLC A;  3OUP A;  3OTM A;  5AFU U;  2IUA A;  2V0H A;  3JQY A;  3P47 A;  2WLE A;  3Q1X A;  4IHF A;  2Q4J A;  1QRF A;  3D8V A;  3VNP A;  2V0K A;  3V4E A;  3ST8 A;  3EG4 A;  2QIV X;  2WLG A;  1KK4 A;  2JF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...