3FU8A

Melanocarpus albomyces laccase crystal soaked (10 sec) with 2,6-dimethoxyphenol
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
559
structure length
558
Chain Sequence
EPTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Function Studies of a Melanocarpus albomyces Laccase Suggest a Pathway for Oxidation of Phenolic Compounds.
pubmed doi rcsb
source organism Melanocarpus albomyces
molecule tags Oxidoreductase
molecule keywords Laccase-1
total genus 178
structure length 558
sequence length 559
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2009-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fu8A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fu8A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fu8A03
3X1NA 1N68A 1PLBA 1E30A 5D4IA 5AZUA 4A66A 1MG3C 3OMAB 2DYSB 4HCIA 2HLEB 2IAAC 3QJRB 1SDDA 1SFHA 5A7EA 2P80D 3H4HA 1OF0A 2OCCB 3FPYA 1CYXA 2FQGA 3FU9A 4KOCA 4A2FA 4N4YB 2E86A 2UXFA 5I5JA 5I6NA 2HX8A 4DP9X 1A4AA 1CURA 4P5SA 2FTAA 3EH5B 1QLEB 2WSDA 1JXDA 1GSKA 2XX1A 1KYAA 2BZCA 2DY2A 2PPDA 3MBWB 1GYCA 1GS6X 2CBPA 5B1JA 1AS7A 2ZXWB 1AR1B 2PPEA 1M57B 3X1EA 4YSEA 4KNTA 5I6LA 1JXFA 1SF3A 4DPAX 3OM3B 7PAZA 4G70B 3CZUB 3CDZA 4WKXA 4AKQA 1WS7A 5PCYA 2DV6A 4Q89A 4BXSV 1KBWA 3QJVB 3D12B 4HHWA 3N2JA 3V9CA 4DP0X 1PZCA 3ABGA 6PCYA 3PXLA 2QDWA 1GY1A 4BDVB 2HX7A 2B3IA 4ZK8A 3WKPA 1GS8A 2CUAA 2DYRB 1CUOA 5I6KA 3CVDA 4YSTA 2EIJB 4RH4A 1YLBB 1KCWA 1MZZA 2VW6A 2XUWA 5B7EA 3KW7A 4DP7X 4E9QA 4YSQA 3UABA 1OE2A 3IEAA 4HIPA 3X2QB 3UGEA 4GY4A 1BQRA 2FT7A 4G71B 4EF3A 4F2EA 3DKHA 1N70A 1SHXA 1RZPA 3IN0A 3S8GB 2FQFA 4DP8X 2WO3B 3ABMB 3NJJA 2CALA 2FQDA 1IBYA 1MDAA 3FQ1A 2GSMB 2N0MA 1MZYA 3NYKA 4DP6X 2PP8A 4G72B 2BWDA 3AY2A 1EZLA 3UAAA 1PLCA 5I6OA 1AZRA 2TSBA 3T6XA 5B3SB 4DP5X 2PPCA 3RYMA 5B1KA 1TKWA 8PAZA 4DPBX 4YSUA 3AG2B 1W8EA 1J5DA 5B7FA 3X1GA 1L9OA 4N8UA 3WI9A 4KOBA 2IWKA 2HXAA 2XXGA 3L45A 3H56A 2YAFA 1X9UA 1ASPA 3CVBA 3UACA 3EHBB 2XVBA 1BEXA 4HHGA 1QHQA 1ILUA 4AKOA 2R7EB 2FQEA 2OV0A 3ZDWA 1JZFA 3FYEB 3FU7A 2XX0A 1JZEA 2MTAA 1AAJA 3QJQB 4JHVA 2TSAA 4YSOA 4A2HA 4A2GA 4ENZA 2I7OA 3QPKA 2GBAA 1OE3A 1GR7A 5F7AA 4YSAA 2UXGA 1AZNA 1B3IA 3EH4B 1ILSA 5F7BA 1ZV2A 2HZHA 4A2EA 2FT6A 4YSRA 1ASQA 2YXVA 5B1BB 6PAZA 1GS7A 2I7SA 1PZAA 2BO0A 3IE9A 3GXUB 1AANA 4BK5C 1SJMA 2YAMA 1OOWA 2H47C 4DPCX 2A3TA 1AS6A 3U25A 1OCCB 4CSPA 2UX6A 1BQ5A 2BZ7A 3TASA 1E5YA 1J9RA 4BDVA 2WO2B 4YSSA 3PLYA 3ZX1A 3T6WA 2BP8B 1XMEB 1E67A 5D4HA 1TEFA 1L9PA 4HAKA 1PNCA 1BYPA 1V55B 3CG8A 2IDSA 4BWWA 1NWOA 1WA2X 4E9WA 1AG6A 2IWFA 2PLTA 4MFHA 2PP7A 3QJTB 1J9SA 1OE1A 3DTUB 1URIA 1WAEA 2XXFA 3NT0A 3QJSB 3FPXA 4YVNA 3NP3A 5TK2A 3X1BA 2BP0A 2IDFA 3AG1B 2BW5A 4KO9A 1NIBA 3HB3B 4A2DA 1AG0A 1HFUA 3FT0A 2PPAA 2VM3A 3TU6A 4KO6A 5LDUA 2VM4A 4PAZA 2IDUA 2Y1AA 4X4KA 4UF7C 2PPFA 9PCYA 1OCOB 2QPEB 4M3HA 2CJ3A 2XU9A 4F2FA 3WNIA 2GIMA 4YL4A 1NDTA 4DP2X 3CDZB 3NJKA 3FQYA 3AZUA 3PAUA 1JOIA 2VMJA 3BVDB 3NJHA 1A65A 1NIDA 3NJLA 1QNIA 1EHKB 2JKWA 3T9WA 1NZRA 2UXTA 4HCGA 3OMNB 1FA4A 4G7QB 4AX3A 4YSDA 2DWTA 1RKRA 3T71A 2VW7A 3ASOB 3FQ2A 1VLXA 4HCFA 4A67A 1ASOA 2ZOOA 3ABLB 1SHWA 3G5WA 3JT2A 5I28A 2UXVA 3AW5A 1XB6A 1JZJA 1KGYE 3FSWA 1UATA 1M56B 3OD3A 4P5RA 4Q8BA 4TXVB 2XWZA 1PF3A 4UAHA 3SQRA 5I5IA 2RACA 3C75A 4YSCA 2VSMB 1BQKA 2IDTA 3UADA 1JVLA 1BXAA 2AZUA 3UAEA 1V10A 3JTBA 3FU8A 1J9TA 3OQRA 5I6PA 4BXVA 3NSFA 3N55A 1ZPUA 2H5UA 1SF5A 3GYRA 1SDDB 1JZHA 3ASNB 1SFDA 2ZWNA 3T6ZA 5I6MA 3HEIB 1BAWA 1V54B 4AI7A 2B08A 4HALA 1OV8A 3PAVA 1BXUA 2GHZA 2AZAA 2JXMA 2GC7C 4UANA 3KW8A 3FSAA 1WA1X 2BHFA 4GP4B 4GXFA 4L0PB 1A3ZA 2HRGA 1XB8A 1L9TA 1W6WA 1RCYA 1T5KA 4QLWA 2XV0A 4E9VA 2YAEA 2CCWA 4PCYA 2PP9A 3IN2A 4HZ1A 1JXGA 1W6LA 3NJNA 1ET7A 3SBPA 1J9QA 1F56A 1PLAA 3SBQA 1AOZA 1PZBA 3S3DB 2YXWA 3PAZA 3ABKB 2LLNA 3SBRA 1NPJA 3OMIB 2J57A 4WTQA 2NRDA 4E9SA 1NWPA 2VSKB 2HRHA 4K9JA 2IH8A 2H3XC 1I53A 2PCFA 2XYBA 3DIVA 3WIAA 2GC4C 3FS9A 3PPSA 1X9RA 2GB2A 5TK4A 1IC0A 3NP4A 1AS8A 1NINA 2HX9A 4JHUA 3NSYA 1NICA 3FYIB 1ZDQA 3ERXA 2UX7A 1WS8A 1AZBA 4FAAB 5I5MA 1AQ8A 1WA0X 3QJUB 3AG3B 1AACA 2IWEA 1BXVA 1IKOP 2ZONA 5AFAA 3S8FB 1FFTB 1HAWA 1PNDA 4E9RA 3TBBA 4AZUA 2I85A 5E9NA 1OCZB 2AANA 3WNJA 1BYOA 1J5CA 2YAHA 1HAUA 1PCSA 5ANHA 2IH9A 4W9ZA 2FNWA 5EHFA 3S3CB 1IBZA 5I26A 1MG2C 4M4RB 4FA7B 1DZ0A 2JFCA 1ETJA 1PAZA 1DYZA 4DP1X 2EIKB 2W88A 2YAQA 1NTDA 4E9TA 3NSDA 1E5ZA 2FWLB 1IUZA 3FU7B 4GP5B 2YARA 4DP4X 1NIAA 1XB3A 4A68A 2BWIA 3T6VA 1NPNA 1A4CA 3QQXA 2AFNA 4F7KA 1ZDSA 3FSZA 1JZIA 3AG4B 1KBVA 1ZIAA 4GYBA 1AZCA 3EH3B 1A4BA 2X87A 1AIZA 3FSVA 1JZGA 5D4JA 3PCYA 1GY2A 4W1TA 2XV3A 4BWUA 1TU2A 1ID2A 2CAKA 5B1JC 2J55A 5B1AB 7PCYA 2PCYA 3TBCA 2BP8A 2W8CA 1L9RA 4NERA 1A8ZA 4YSPA 1KCBA 4KO5A 2J5WA 2EINB 3NSCA 3V9EA 5FC9A 1NIFA 2FJSA 2QDVA 1KDIA 3X1FA 4NB7A 5AKRA 1CC3A 2Q9OA 3CVCA 5B7MA 2OJ1A 1SNRA 2BP0B 2AVFA 4KNUA 2FT8A 2YQBA 3TA4D 1L9SA 1OCRB 4G7SB 2MRYA 2XV2A 1ZIBA 1AZUA 1ET8A 1ET5A 1E65A 1FWXA 2J56A 1TEGA 2YAPA 4CSZA 1JERA 2R7EA 1L9QA 2Q5BA 2X88A 4AKPA 2P80A 4NAJA 3S3BB 3NJIA 3NJGA 2XLLA 5PAZA 1PY0A 1PMYA 4E9YA 3IBOA 2Y69B 4QKTA 4E9XA 1R1CA 2EIMB 2BW4A 2GI0A 5IY5B 4YVUA 3ZBMA 2VN3A 1CYWA 3WKQA 2QT6A 2DWSA 3NJFA 2QPDB 4GP8B 1KV7A 3EF4A 3ZIYA 1ADWA 3BQVA 4KO7A 1JVOA 1M9WA 1RZQA 3H4FA 4JKNA 4G7RB 4KNSA 1GW0A 2YAOA 1KDJA 2EILB 3GDCA 3MX0B 3NJMA 3WG7B 4BWTA 2IDQA 1NIEA 2VW4A
chains in the Genus database with same CATH superfamily
1JHKH 5F7EH 2IMMA 1PLBA 2W81C 2Z8SA 3WV0A 2AQNA 4HUXA 4TOYL 1NMCC 4UQ2A 1RXLA 4XO3A 1SN5A 2BSED 2GUYA 4F57H 3QUKB 1BQLL 3IFPB 3MRLB 4IRJB 1KJVA 3GMRB 1XF2B 1T1XB 2VQ4A 4XPTH 2K70A 3ZOAA 4A2FA 1QPPA 4J4PA 4UQAA 4TUKL 1PD6A 2A6DB 5DS8A 3OGOE 2QQLH 4QT5A 3MLVL 4ODXA 5IG7A 4PP1C 2JH2A 4Q74A 1DANU 1A6PA 4BH7A 1QLEB 1S7UB 2HTLC 1NL0L 4PRNA 2P5WB 3UC0L 3PWPE 2PWEA 4WSGA 5E95B 1IMHC 1OL0A 3SD5A 5CHNB 1D9KB 1NGQH 4RMQA 5AWNH 1VB9A 3LRHA 1SF3A 4ADIA 5F3BB 1P5VA 2KL6A 5IOKA 1IVTA 2B1AL 5D1QA 5HI5D 4GSDL 2DV6A 4Q89A 2FATH 3S3JA 5EIIB 4LSTL 3S3SA 5CJXA 2GJ6A 4DP0X 3O4LE 4PUBH 4W9GC 3LRLA 4APQC 1SDYA 5CJOL 1UASA 4RVBA 3QJFA 1A9BA 4OQTH 4ACTA 2CPCA 3C8HA 3WFDH 4BCYA 3WU1A 4F58L 1C9SA 2CJTA 4XVJH 1HWHB 3GK8H 4FNTA 3L5JA 3SKMB 4CN4A 3IEAA 3SQBB 2DKUA 4XB8A 5J1AA 1UFGA 5BVPL 4R2GD 1Z2KA 5LBGA 4MZRA 5TF1L 4UTCA 1BQHA 5C3LD 1G4RA 3QO1A 1RVFL 5ESVB 3X13B 2VB5A 3RAJL 2FEEI 2E47A 1SQMA 3KNBA 1IBYA 5FECB 1WZKA 2P45B 4P23C 5D70L 3LV3B 5G5DB 4PRPB 2N0MA 3CFUA 1FUNA 4BFGA 1T7YA 1E27A 2HFEA 3QIUD 1PLCA 4HJJL 3F5WB 4K7PY 5D7SL 5DJYB 3VXTA 2ZKXA 3PL6C 2AMGA 4OCWL 4V1DA 1E4KC 4W9CC 5F7EL 4NOBA 3FF8A 1I3GH 2X1PA 4MB4A 5I1EL 2FECI 3CDGA 3KPLA 3T3PB 3F62A 4HFUH 2NNAA 4F57L 1ZLUH 1T0NA 4G2AA 3CWGA 4D0CA 4F37K 2JE8A 3F83A 3L45A 1PKOA 5HY9A 2BCKA 2HG0A 1CFQB 1E4WH 1MCOH 3QEUB 2O6FA 4WI0B 3WUWB 1EHXA 2OV0A 1HHGB 4M93B 3VRJA 3RVUD 3MJ9A 2CO1A 4XAKE 5EMYA 2LFEA 3VXMB 5TFSL 4A2HA 2Q8BL 4KJYA 1E9QB 4NPYB 4ZSOE 4PTUB 2Q76A 5CHNA 1XL6A 3ULUE 3U4KA 3QS3A 5G5DA 1H15B 3I3DA 3V4PA 4TQEL 2VXUH 2E4TA 1ASQA 3M88A 2AAAA 5F96H 4PS8A 5E8PB 5DMKA 3NAAL 2I7SA 4BK8A 2OTUB 2MCG1 2AJZA 2A9NL 3GXUB 4XNQA 1R3KB 2VSDA 1LO3L 2HFGH 4F7EA 3L3GB 5SV3A 3DMMA 1RZJH 2GK2A 1FO0H 3QFJE 4FQJL 3VD4A 1ZVSA 3DROB 1NA8A 2WXRA 2ZOWA 3RB7A 4YHOH 5AD0A 1CF8L 5GGVL 4EZMA 1ZLSL 5HY9B 5D2LA 2RR3A 4FNPA 3T0EA 2GAZB 3BP6A 4OZHA 5K33A 1IJNA 4M8QA 4QXVA 3TO4B 1F86A 4P2QE 4LSSH 1FHGA 4FI7A 1DTUA 1ZT4B 1UUSA 4QOKB 4XRCA 5CZXC 4ABUA 1D5BB 1X6LA 4MA3B 2C1OB 1JTOA 2VN4A 3IFOA 4X7DC 1G9NH 2EO9A 1ZWIA 5DHYA 5EU4A 2XXFA 3LAFA 1JV5B 5ESQB 4KX7A 2R2BA 5JW5B 4X99A 1B0WA 4WHYG 3RX5A 4X8JB 5BRPA 2RQEA 3MOBL 4JKLA 3DURB 5IBTH 4H44C 5F93C 2GI7A 5D1QE 1CPUA 4N0FB 3OKDB 3NACH 4HLZG 4WW1B 1A6TA 3QWQB 3PGCB 2WNKA 4POUB 2CLRA 2QQNH 1ZHBA 3GXMA 1OCOB 3QUYD 3O6KH 3FFDB 3B7SA 4JPVH 1UD5A 2VDMB 4GLRH 2UY7A 4HH9A 3VFOA 5IB3B 2K3HA 3IJHA 4X6DB 4TMPA 2YD8A 1RZGB 3ZKMC 3DX8B 3D3VB 4IRZH 4MMZA 3SDXF 5IMMB 4GG6F 2WQRA 1CXKA 3RX8A 1V3LA 2XXMB 3EW3B 3OXSA 4ONFH 4RGND 4ZTOH 4KKAC 4L5FL 1T7WA 2HKHL 2Q8AL 2EDEA 4GQQA 4JN2A 3N42B 4ZXBC 1S46A 5KYWB 2KLSA 5FKAB 1JZ8A 2J25A 3N1PC 3FUNA 3QIWD 4B5EA 3U30B 2GJ6D 3FQ2A 1OT2A 4LAJH 3KLAA 5A2IH 3IGLA 1KIUB 3P73B 4GAAA 3L5WA 2YWYA 5CD3B 3B2UD 4AT6B 3SY0A 1TQBC 3JT2A 4TSCH 3GEWB 1K5NA 3O9WC 4NQQA 1KC5H 2A5UA 4UYPA 3PY9A 1DQLL 4FZ8H 3HCVB 3LXCA 4WNSA 5AOLA 2HA1A 3U0TA 4N0YL 3GPSA 4MCYA 1S9WB 5DJDB 5EFIB 3ZL1A 2AJVL 5AVQB 5EEZA 2F54D 1E5CA 1C5DB 4LSPL 1EDYA 3FO2B 5HHMD 3FZUD 3H9SA 5CKAA 3OHXA 3I2CH 3FU8A 3OQRA 1OSPH 4YN3A 3CHRA 4JZOB 2ARJQ 4TUJA 1DVFD 4J4PD 3ASNB 4KZ0A 4JLRA 3OXSB 3P11H 2OJEB 1OK0A 5ENWA 3S36H 3LHAA 5AVSB 4NYLA 4XXDB 2OJZH 4R96A 4YE0A 1KCSH 1QFPA 1U8OA 2MQCA 5FHBH 4GP4B 1OGPA 3RTQC 2ZG3A 1JK9A 3MNMA 3FO0L 1JP5A 4M6NH 1KIUA 4JHWH 4G9FA 3VFTA 3CFTA 1CLZL 1XFPA 2VN6A 3GHEH 4G59C 5D6DC 2IH1A 2FX7H 1UOWA 5M7QA 4XBEH 2MQ0A 1A0QL 2JQAA 2GJZA 5FW8A 3CSGA 4PCYA 3KPSA 3AM8A 4M43H 4N8PA 4WFFE 1ITCA 3WYRA 1W6LA 5LLIC 2PMZA 3NJNA 3UH8A 3P0YL 3ALWA 5H37A 5KEZA 3MODL 4HCRA 4GMSL 1USQA 4NSKA 1J88A 1MFBL 2XKNA 1E8ZA 2IC2A 4G8IB 4LLAA 4JZOA 5ITFB 2WXQA 4Z7QE 2LR4A 4JLRB 4RBPH 1GJWA 4Y1AE 2W5PA 2HTLD 3MGAA 4FKEA 1MFCL 4R97B 3FAXA 5HGDB 5K1NA 1PKQA 2ALWA 3MJ9L 1BZDA 1KTRL 1LL1A 2WANA 1IC0A 3NN8A 4UT9H 1IGIL 1K6QL 4JG0L 5T1LB 1JYWA 3ZQ9A 3EOTL 4ZW6A 2UX7A 1WS8A 5IREA 4AL8H 4R0LB 4OLVH 2W60B 5CCKH 3VXQA 5EC1B 1B3JA 1G6RB 3FRUB 4ZTOL 2G2RB 2VUOA 4OFDA 1G7MA 1BVLA 1FNSL 3DSNB 4WDIB 3HZVA 2F53E 1TOXA 1LWHA 1JWSA 3Q9PA 3S48A 1RJCA 2A9MH 4HJSA 4L1DA 1UEMA 3EYOA 1YEKH 4HUXB 1X6NA 2R69L 5EHFA 5IHZA 3QFDA 2EDQA 4GUPA 4JREB 1C16B 1OSZB 3O6KL 5B38A 2QELA 4HX1A 4F8QA 3E8UL 2CUMA 2ZCZA 3HUJA 3GMPB 4ZQTA 2X4QB 4UDTB 5BS0A 2CJUH 1A7RH 3QG6A 2BSEA 4XNZB 2GCYB 4X4XB 5C0BE 4NRYA 3FQNA 3KWTA 4P2QB 3VTAA 3ARWA 1BAFL 3QA3A 3W9EB 3FU7B 1IAIL 4I9WE 4PR5A 2CIKA 3STZB 3O2VL 2NT0A 5I71B 1MJ8L 5H37H 2PTUA 2XY2A 4JE0A 4DGUA 3A24A 1CLZH 2P47B 1JTPA 3K46A 2VLRB 4F7PB 1ETB1 1KIPA 3RILA 3IVKA 5ICYA 4HGWA 3FTGA 5F0JB 1AD0A 3U0WH 2EDKA 4Z8FL 4JG1H 4JFFB 1JD9A 4NQDB 2APSA 1KMGA 1NSNH 5FB8A 1TPXC 5D7LB 3UTSA 5ADPH 1J7VR 5CSBA 2X12A 2X1XR 4AYMC 2JI3A 1G7LB 4U05A 1LE9B 7TAAA 1U8QA 3IS0X 4ZQKA 1ZHNA 2H3NB 1RPQA 3K6OA 4IIQB 2PWGA 2Y5TA 5IB1B 1O5DT 2W65A 3TXAA 3VFNA 1WWAX 4NRYB 1BVNP 3N40F 4JZNB 3T4AB 4UIMA 4OM0L 2YD6A 3QHTC 4QXGH 4Z95H 1RL1A 3TBVA 4C83A 2FVNA 2NR6D 3A6BL 3IU4H 3BXNB 4X0NA 3D0LB 4O58L 4ZUVB 5HGAB 4BA0A 5D1XB 4FG6D 4NQEB 5IJKA 4GW1B 2FH6A 1UUNA 1EAJA 3BP7B 4PJCE 4ZUUB 3QEGL 1EZVY 1UD3A 4XCNB 4DFIA 4NKMA 1YMHB 3IDNA 2GG1A 4MJIB 1SXAA 3F5WA 4KGLA 3REWB 5G4NA 4I3RL 3P30L 4ODVL 2K4WA 3SDXB 5D7LA 1JWUB 3WIIL 1INDH 1MN4A 3F7YB 4P4KC 3T3MF 1NFKA 2VDRH 3RVTC 3D4ZA 3GXPA 4D9LH 4DGYH 2FGWH 3GRGA 1T0NB 4U3XA 1E6JL 3C09C 5IHUH 5A2KH 5DVKA 1DJZA 3LMJH 3TJEL 3GRWL 1ZTXE 3D9AL 1KCVL 2B0SL 2PTVA 5C0CD 3OX8B 1ORSA 1F0LA 2VLJB 3L3OB 2ZYSA 3QT2A 3LN9A 5F6HJ 2EADA 5DWUL 3ZDZE 4OJYA 4AJYV 3CVHL 3VXUA 1N64L 1KXTA 2GI0A 1HHHA 1OGAD 4F91B 1R17A 2BIMA 3DA0A 4LDLB 1TEYA 1KV7A 5DRNB 1M9SA 2QKIB 1UM4L 2WCGA 4GSRA 1AQDB 4NC0B 5DI8B 3BQVA 3UPAA 4KNSA 1DBKH 2W07B 5GZOC 1KIRB 5KYYA 4D9QD 1CT8A 1ZTXH 3U1PA 4BBWA 4YDZA 1GGYA 1SBSL 4YXHL 2AXJA 4UM9A 4XHJD 3DBXA 2VDKB 1SMDA 4PM1A 2K9FB 5C97A 5E9DD 5IB5B 4NO2A 3X1NA 2XVKA 2XG4B 3IDJA 4XP5L 1NGWB 4N2GA 1HNYA 1LDSA 2IAAC 2CLZB 1HC1A 1MHPH 2WXMA 3SE9H 2P80D 2QTEA 3WS6C 4QF1B 4BH8A 4CVUA 5A7BA 2ESVE 1H9DA 1JHTA 3T65A 1NCIA 1NFIB 2FQGA 4AV0A 5MERA 2K6YA 4ICWA 4TYUA 5AOMA 5EN3A 2JB6B 5FIEA 3TYFB 2W9DH 1MRFL 1IGMH 2IANE 1KCKA 2OMVA 1ZHKB 3T0ED 4R3SA 2N01B 3KYNB 4BFNA 4YXLL 3J8F7 4PGDB 2HPTA 1NL0H 4WU5B 4Y16A 3LJ3A 2C9AA 2WMPA 4Q2ZB 4GS7B 4TL5A 4G6FD 3IKCB 4YSEA 2EO1A 3OM3B 4TUOA 4XO8A 4JQIA 5H8DA 4M5YH 1MRCH 3VB9A 2CO7B 5JOPE 3PUUA 5PCYA 4FQQB 4JB9H 3KCWA 4M1CC 4NQXA 4FQCL 4U7SA 4CMHB 3QJZA 2HLFD 2Z0UA 3GM0A 4LP5A 1YEJL 5DEJA 2DYRB 2YUWA 5GGRA 3HFMH 1NCOA 4N20A 4WFGD 4XMWA 4XMKL 2R56L 1CDBA 4C56E 4LSQL 1MI5A 1D7CA 4X8CA 1NOFA 2BSTA 4NCDA 3ES6B 3ARBC 1L0QA 2BNRA 2CHXA 3BPLC 1TZIB 1FL6B 1V7NL 3QCUL 2WN3A 1NH6A 3L48A 5CBAA 4GO8A 4UINL 5DO8A 3DDGA 3UZQA 2FEDC 2GSMB 5DO2D 4Q2ZA 5CEXA 2CKBL 2M2DA 4LVEA 5CLWA 3V52L 4AQEA 4YGAB 3UAAA 4KKBD 2RA1A 3WIFB 3UIZA 5B3SB 1BBJA 2E6JA 2ZAHA 2F1AA 1AXTL 5MENE 4LCIH 2HFFB 1CVRA 2EO7A 3ESUF 4UT6H 3ZTCC 1TKWA 3TVMC 1CXHA 1RJLB 3HE7D 4RETB 1JUFA 3X1GA 1IC7H 4NJAH 4JKPL 4G6JH 4MCYB 2Y36H 2HLFC 5AB2A 1F3DJ 1E50A 2P5WD 5D1ZI 5F2FA 1C5DA 4YQXH 2QFRA 1X9UA 3ZW3A 5D7HA 4ZI8A 5DTFA 1ID5I 2WBKA 3OG6B 4AIXA 3WNNA 5KSBB 1MW3A 5BRZA 4PY8I 1QFWL 4XCFH 1A3RL 1X44A 2GHWB 3DOSA 4U33A 2OJEA 5ENWB 3QPQD 4OQTA 3DJ9A 5IQ9B 4QTHA 4X5LA 4H1LH 1QSEB 4JM2F 4XTRC 4YSRA 4Z95L 3C6EA 5DEFB 4HS8H 3SZ6A 4YFEA 1JYVA 4X98B 5HHOB 2DQIH 1BBJB 1GS7A 3CFKA 4ZBJA 4MMYB 1MSPA 3IE9A 2YA0A 5JO5B 3V9FA 4XPAH 1OD7A 4OCLC 2FJGB 4P4RA 3M17B 2QGEA 5GRJL 3P3RA 1JPTL 1WFMA 3L9RA 1VHPA 1WG3A 1WFNA 4QOKD 3HC2A 3LEVL 1M7DA 4N5EC 1KPVA 5CN3A 3TBTB 2IFGA 5I1CL 5EUOA 3ARPA 4GG8B 1NAKL 3EZJB 3MRNA 2EDXA 1I1AA 1CGYA 1PCXA 1WZ1H 1XF5B 4LRIA 3G6DL 1KGUA 4AK1A 4DKTA 2IANA 4P9ML 1LO0L 3PWJB 3UCQA 2OMYA 3VXPB 2IQ9L 4FEMA 1YEEH 4MZ2A 3GRWH 4C8XA 5L2JB 3OAUL 2WUCL 4OZIB 4CAGA 2PP7A 4ZS7H 5KVGE 3HFFA 4N2OA 3AM8C 3HZKA 5A2BA 3T3MB 1S5IL 4JCMA 1F00I 4CBPA 2ED9A 1M1XB 1ETA1 3D33A 3LKSB 2FJHB 5IBLC 2J6EA 5KBLA 4QCIB 3HE6C 2VWEC 3AMLA 3DV4B 2BSSB 1WRFA 4GAJL 3VXMD 4F93B 3IBEA 5EU7C 3RGVB 4I1PA 1S9YA 1CBVH 9PCYA 4K8RH 2EZ0D 4MJJA 2Z8WC 3U2JA 1TSRA 3FQYA 4UV4L 4LLUB 2HTKD 2F5AH 4ZZKA 2IPUK 4UV7H 1QTSA 3KBHE 1VZGA 2DTSA 1CLYL 1GHFH 4X7SH 2Y72A 4RWHA 3OHXC 4JKPH 5AW2B 2PCPB 4Y9FA 3M1BB 3MTRA 1HHIB 4Z7NB 5ISZB 1C12A 1OAKL 3IDIB 4NAMA 5SWQA 4XH2A 1QI4A 1OIOA 1XF3A 2J43A 4GI6A 2H0JA 3K7UA 4PR5B 4YDVA 2E76C 5FDWA 3QDHA 3TEWA 2M26A 4O00A 3K1KC 5CD5C 4ZPTB 2VAAB 3ZTJH 3EUUA 4JRXE 2AKRA 2F53D 1QO3A 3O3DA 4XMUA 4LEXH 1V5JA 4K15A 5LGKA 1Q9KA 3WLBA 1HEZA 5KYUB 4YSCA 4MWFA 4G9FE 1AYRA 1ZA6A 1D5XA 3NABL 4KXZH 3UADA 5IR1B 5AW0B 3KPNA 3JTBA 4JFEB 5FGSA 4M6OL 3WFHA 2VJ0A 4K7PL 5DQ9B 1WIPA 3GYRA 5FDYA 1MCQA 4RSYA 3MBXL 4NQCB 3N1GC 4MDRA 4RIRA 4EI5D 1FZOA 4M9OA 2Q2LA 5D5MF 3ZKND 2ZD0A 4K3EL 5ISZA 1EVTC 3LDBB 1BLNB 1ONQA 4KK8D 5J6SA 4LLDA 5E24E 2X4RA 1F58L 1KWKA 3IU3B 4HUNB 3SDDB 3D2TA 3FSAA 3GNML 1IFRA 5DVNA 2QR0A 1QLFA 4OD3H 3V55A 3MA9L 3D0LA 1LD9B 3VD9A 4OFVA 2AP2A 2OKMA 2VABB 2VAAA 2IPKB 3DV6B 4L4VA 4RMUA 5ECGA 5EF3A 4U7MA 3JVGC 4DKEH 1TVHB 3VXNA 5DJ0B 3CX2A 4M5SA 4GQZA 5H2BB 3MKKA 2CDGA 2EDLA 1SVCP 3AXIA 1AIFA 5KVDE 4NRZA 3MAWA 2D7MA 4OGZA 1F3DH 4FP8L 2WLZA 1AOZA 1HX0A 1MCPH 4KTEH 3VM7A 2VH5H 5JYMA 5TFSH 1T0MB 5IT2L 1A6WL 4HJGB 1NM4A 4F1SA 4H0IA 4HLJA 3RWDA 3QQ3A 4DVRH 4L3CA 4QJ5B 2OSXA 1X7SA 2R4RL 2XN9B 1H8NA 3DIVA 4BH7B 3BCDA 4L3ED 1B9ZA 3K6NA 3MJGX 4GKSB 4M48L 4YR6B 1CGSH 4F8TA 2P5WA 4TTDD 2VKXA 4MNHA 1XIWB 1P4LA 2OMXB 2WZ0A 3CC1A 1U6AL 4IMLB 5LAXA 4UZGA 5HHOE 1YPZE 4HWUA 4OI7A 1NQBA 1MEXH 2UV3A 4DN3H 4BZ2L 1MCNA 4O9HH 2WCPA 5CILL 1RJYA 3WIHL 3UBXB 1HVXA 4YNYA 5HTSA 3E9UA 4K23L 3JWNH 1H6TA 4OZFB 4IU2A 3RVUC 3GMMA 1G7JB 2VNCA 3HVNA 4CVXB 5E9NA 5DMGD 3RL2B 3TZVD 1YEGL 3EYSH 4AYID 1SHMA 1IBZA 4YEFA 4JHWL 2D3VA 3EJQA 4X5QA 4P59L 4PRDA 5JHBA 3FQXB 3B8SA 1JHLH 3MYJB 4RCAA 4AUUA 3MCKA 1N6VA 2QEJA 4KRPB 2N1KA 1T1ZA 3BZDA 4EZJA 1U8LA 1J9CT 3SDDC 1VKXA 2X4NB 4JFOB 1GHFL 4X7SL 3Q01A 3QZWA 2BS71 4NFCA 3IFNH 5D1ZB 3CFIC 3L54A 4YBHA 3VFUB 5CMAA 2ZWYA 4GQ9H 3BW9A 4ZFQA 2H6PB 3JTSA 4DTGH 4H2AA 3GIVB 1IGTA 2A6KB 4UAOB 2WINA 5DRZA 2Y3NA 3MRQB 1F6AB 3MLSH 4XBMA 3AU1A 1P4IH 1DQLH 1H3PH 4YDKL 3ZDXF 2XYCA 1QLEL 2NY5L 2PXYB 2NNAB 3KR3H 5EH1A 1U8KA 4U3SA 3VGEA 1P69B 2OQJA 5TPWL 4LLVB 3UTPD 2A77H 5CCKL 5CKGA 3K80A 1GZPB 4O02A 3RPBA 3FOLB 43C9B 1FFQA 1JZ2A 1TTGA 4PLOB 5L0QC 4P2OD 5B1AB 1V3KA 5IVXB 2HVBA 3VFWB 1MI5B 3NQIA 4IJ3B 2X09A 5T33L 5I1DB 1KJ3H 4BKLB 2A74C 3KPRD 2ZXBA 3RLSA 3U0WL 4XX1E 4NP4L 3WSQH 1FYHB 1J1OL 2WKGA 3FUJA 3HR5B 32C2B 5IW1A 3HVDA 3VFSB 3MJ6A 5KBMA 4RDBA 1XDTT 2IEPA 1IKNA 4NM4L 1PIGA 2XTJE 1L7TL 1HSBB 2E7DA 4FFVD 3WDHA 4LBAA 5CBEB 5JHLH 5I8EA 3WIFA 1CI3M 2YQBA 2EVIA 1N6UA 2X9XA 5K39B 2DBJA 1BAFH 3OB0K 4IOIA 2EECA 1ET5A 2VL4A 3CSTA 5F9WC 2V7NA 2VCOA 2OYLA 3H9HA 1MFUA 3WY3A 3ESVF 1L9QA 2I24N 3WIIH 4F8PA 1EJOH 1D5ZB 1JPGA 3VI4F 1MLBA 2YD3A 4F7MA 4C56B 1S7VB 1Z66A 1M2VA 5EU6D 3RNKB 1JCVA 2PW2B 1OCWL 1IBDA 2NZ9D 1T1YA 5I1GL 3UFIA 3EFOA 3D4CA 3S37H 3JUZA 2FL5A 3EYQC 2C9UA 5KUMA 2Y07H 3IGKA 4NBZB 3ZBMA 3TF7C 3SPCA 5HDBE 3ZN6A 5IEHA 4Z7IA 5L6YL 5DZLA 1TTCA 1WFUA 3FFOA 4X99B 3NGBC 1T04A 1MLCA 3ARFD 1BM3H 3OJDB 5JYLA 2F8OA 2EUWA 2YRBA 2P8PB 1P7HL 3FUMA 1GW0A 4N8CL 3WHE0 3LEXA 4AV5A 4Z77B 4N0FA 2W9EL 4BWTA 2MH4A 4KFMA 1MHEB 2GFBA 3QQ9D 1NIEA 2VC2H 2HG5B 4OCRL 2YRLA 5C8JB 2D3LA 1DFBH 1AJ7H 3HC3L 2JCCE 1SPDA 3HC0A 5FOBA 3B2VH 3ARYA 5JLZB 4L8CB 3GQFA 2D8KA 2KQNA 1VPOL 2VXUL 4YC2B 2AC0A 4S10A 4RGMB 1CL7H 3H4HA 5D6DA 4G6KL 3T0WA 1RZFH 2KZBA 1MHPL 2VERA 4LSTH 1TTAA 1I1AC 4K8RC 2ICWI 3DSFH 4EI5A 1MAMH 4GAYA 5A40E 4N4YB 1DEEB 1EJFA 1UB5A 4KDVA 5AALA 4XP1H 1E6OL 4BM7A 5JIDA 2N0KA 5KVEL 3VI3B 4MQ7A 4E36A 1I7RA 3KLDA 1XGYH 3ARGC 3M1CA 2CHNA 1KYAA 4LLWB 1MCSA 5L2JA 3IYLW 3WDJA 5IUCA 2V9RA 4R84A 4HUUA 3WSQL 2IWGA 1VZHA 1I7UA 4MNQE 4Y19D 1QRNE 1NCWL 2HT2C 1L7TH 5FF6A 3O3BA 1AGEA 2C5DC 4UT6A 3TZVB 4L8BB 3Q5TA 4LPUA 3QUMB 1G7PA 2CH8A 4N2BA 5JDSA 4DZ8B 5F9OL 3M86A 3ABGA 3QH3A 4NP4H 4HGKC 5D7SH 1GY1A 2FGWL 2Q1EA 5A43C 4QRRA 1Q8MA 2RFXA 3GKZA 3ZKXC 5BOZG 3HRZC 3C2SA 2KLTA 1YLBB 4YSQA 2XRAL 5IGXH 1CDIA 3QSKB 4NEHB 2VISA 3QEQD 4MGXA 1CFNB 4YHIA 2WKOA 4S0SD 4YDKH 2PO6B 2X40A 4H1LB 4OFYD 3WO3B 1CFMA 4TULL 4F24A 3AS2A 2D3JA 3IDIA 1MREH 3OKEA 2JI1A 4J5VA 4DO6A 4PH8A 5J3HC 1P9MA 3TBSB 4JZJB 2Y7OA 3H9SD 5D96B 2OMTB 2DQHL 1PEZA 2YEZA 3WJJC 1D9KD 1I31A 1JPFA 3D51A 4NM8L 3FTZA 5I8CA 3B6SB 1U92A 3FONA 2B9AA 3GLDA 4MS8C 3KS0J 4Q14A 5HJ3B 5C0AB 2D4DA 2X6CA 3IJ8A 4A39A 3G9AB 1HOCB 5INDB 5HYQA 3U48A 1ACYL 3D09A 4HBCL 4M5ZH 3RZCC 4XBPB 1T21A 2VC2L 4R6UA 3HMXH 3FT2B 4HWEL 2KZ1B 2CLVB 3FUHA 3ZT6A 1SLXA 2IVFC 2AI0H 4ZOEA 1JZ4A 2MSPA 2IV9A 2A4EA 2BSBA 4IDJL 3TO2B 5IFJA 2CBTA 3CFJA 1GH7A 3RB5A 1B3IA 1E4XH 1IU1A 2GJJA 3L1OH 5AOIA 3WN6A 2ICWB 4Z7WA 2FWOB 3IXAA 4WI3A 1IBBA 4JRXD 2MHAA 5F44A 3BESR 3DO7A 4PRIB 4XMKH 3X3GL 4G8AC 1EBAA 3T0EC 1E8YA 3AS1A 1QNZL 4JDEB 1MCDA 4JHAL 4PV1C 4YDMA 4YPGA 5C09E 5C0IB 1KUMA 2QPSA 5D7KE 1OHQA 3EUDA 1JWSB 3FFCB 3RKDC 5MEOB 5F89A 2Y7LA 2YAMA 1OOWA 1AS6A 1MAJA 1MFDL 1MRDL 4WFED 3VMOA 1HYSC 5JOFB 4JFEE 2V8MA 3HI1B 1A6ZA 1E90A 1Z9LA 3KLLA 4LVNC 5AKTA 4D3CL 5I1IL 1NFDE 4ZO9A 4EIBA 2XQYK 3TWCL 3MLYL 4MA8L 3OC5A 3EGXA 2XQYA 1I8MB 3GB7B 1L9PA 4AGNA 3NDYE 4DHLA 2OZNA 2DLGA 4I4WB 1AJ7L 4A7TA 5AVZB 4PJ8A 3BUIA 3MJ8A 2VM9A 3KPRE 2Y2TA 1B6DA 5IF0B 1OE1A 4KTDL 3KJ4B 3B37A 1KZYA 4YVNA 4BZ1L 3X1BA 3Q8EA 2CD0A 4X8XA 2HKHH 2X05A 3AG1B 1N8OE 4LGPB 3QRBA 5FECA 4XWOC 2JIXA 1OTSD 2UZXA 5I1KL 2OCFD 3NOIA 5TGBB 4DESA 1LXMA 5T3ZH 5T5NF 3CIQA 4CSSA 1IJ9A 2DLFL 4KUCD 2DLIA 4ODWB 2CR6A 3WY4A 1OARL 3RZCB 4GRLD 2YXMA 2O5YH 4TNFA 4JK0D 3IFPA 3P0YH 3WUZA 1CDYA 2EE2A 3FTXA 5BO0D 2W95A 2YS4A 4HUCA 2FR4B 3WHE1 2WSPA 3GBLA 2G60L 2XN9E 2HWZH 3PDDA 3MYJA 1A0QH 2QADB 1NFAA 2VRAA 4G7QB 5T5FA 3V79C 3DPBB 4HK3N 2EC9T 1U8CB 2VXTH 3TBVB 4BZ2A 2QMKA 4C83B 4ZNEE 5LQBL 5EBGA 3LN4A 2HSIA 1LEIA 1BBDL 4CN1A 3WTTA 3RTLA 1F42A 2XV6B 3VXOA 5BXFB 4M7ZC 4OCXL 1OVZA 4HCFA 4WW2C 5L2KA 3KPMA 3CAFA 4MCMA 1BD2E 3TT1H 1XWVA 3E3QE 3VFUA 5E1GA 2UZXB 3UO8B 5IJKC 2YQ2A 2PCXA 4WTWA 1KELL 2BH0A 4OZ4A 4PV8A 1XH1A 5TGBA 5CFAA 2Z4TA 1YEFH 4OJDH 4ACPA 1SLUA 3QXTA 3RWFA 2YPLB 5CWSA 2CQVA 5E03A 3WMSA 3EJRA 4MDJB 2G3NA 1ZGLM 3CFCH 2IADB 4HQQL 3V6FB 3OBAA 4XN1A 1TENA 1AKJD 3O2DH 4U1KB 4HOMA 1OWRM 3NSFA 1HDMB 1MKFA 4YFLI 4JUTA 5BMFL 1NGYA 5DZJA 4G5ZL 4U6XA 4JFYA 3FU0A 4L8SC 5TQ0H 1OV8A 1KXTB 2ZXDA 3DI2B 2AZAA 2JXMA 4TNVK 3QNYB 3UPRA 3LN4B 1HK6A 4MA3A 5KOVC 5I1LB 5DRNA 5I16B 1G9MC 1RZIA 1L9MA 1OPOA 1XCTA 2D0FA 4J4PC 1ZS2A 5DLMH 4OGAD 4WY7L 1A7PL 5JW5A 4RAVA 5ANMB 1E27B 4LEOB 3OLEA 3CH1B 2X1QA 5AWNL 32C2A 1BF2A 1HH6B 2GYSA 4OLYL 4P2OB 5CSZA 3WJLA 4EOWL 1RZKH 4J28A 1YQVH 5C0CE 4U6YB 4FXGB 5DUPH 1UXWB 3LNGA 5SX4I 3PAYA 2UWEF 4JANA 2EDMA 3KH4A 4OLXH 4PCKA 4M00A 4WGVB 1IGYA 2CLZA 3WE1A 3FCUB 2J12B 4MJ6B 3PE9A 3Q3GA 3BHBA 3EJZC 4RQQB 3O3EB 8FABB 2O30A 1GPOL 1ETZB 1B0RA 1S7WA 4AGQA 2E7HA 2EEXA 1MCWW 3ABKB 4R26L 2LLNA 4FQHB 2H9GB 4WI0A 3WUWA 3HBPA 3A47A 3EXJA 3DX8A 4MMZB 3BT2H 4G3YL 1LVEA 4XMLH 1G87A 2OP4L 2OX5A 1U3JA 3EFOB 2WWOA 4P46C 5DD6B 4MBRA 4ZMYA 1AMYA 3ZKSD 4APXA 5EOCH 1E9PA 2D9CA 5TF1H 4AIOA 3F8UB 3ERXA 3CC5A 1J18A 2F68X 3IPEA 2YA1A 3I3EA 3II1A 5BJTB 1H19A 5F7YC 5CD3A 2FX8L 4PJBB 2LTQC 5DFTA 2AJZB 4KRPD 4RRPA 1VGEL 4BSVA 2P24A 1K5NB 3CQFA 1FVCA 2P3YA 4XGZA 4Y2DD 3CX5K 5GGSA 1UADC 3M1OA 4GXUN 3CV5A 3O45A 5GXBB 3K6SA 3KE0A 1KJ2H 2JFCA 4X9BA 4NC2B 2NX5B 2Q6WB 4N86A 4PJAA 3ISYA 1AFVL 4ODHH 5IESH 2NX5E 5JMOC 5LXVA 4EI5B 1R3IL 1IC4L 4U3HA 4WW2F 3JZ7A 2BS9A 2P44B 1NC4A 2YLHA 2MCPL 4X4YA 3CC5B 4N3UA 5ADPL 1A4KA 3O9WB 1HYSD 1JPEA 3E38A 4YBQD 1QEWA 2H1LM 2JKIS 4FFYL 2DQCH 1FZMA 2JF1A 4CSTA 2XVLA 3VWJD 2VMEA 4G8GE 2B59B 4WW1A 1MRDH 1RZ8B 4I18B 4MAYB 5C7ZA 4NWTL 5EO0A 3MRRB 2Q7AA 3QWOB 2BPBA 1U41A 3QUMA 2ZP9A 2Z8RA 4UTAA 1M53A 3WGUB 3U83A 1BYNA 1UURA 4WUUA 5FXCH 2OL3H 1MF2L 4XVOA 2IMNA 3CZFA 12E8L 1ID2A 2HT4D 1S5HB 1QA9A 1YMMA 2AAVA 3B83A 3HN5A 1P5UC 2QV4A 1L9RA 2R0WH 3FQWA 4RGNB 3TLRA 2WLNA 4RA3A 2VLJE 5DZ9A 3HFML 5ID1B 5FC9A 3GSNB 3QIBC 3O9WA 4OF8A 4ONHB 3O6FB 5J6HB 1N64H 3IRZA 3QIWC 5IWLC 3VXRA 4E0RA 1AR1C 4L3FA 5JO5A 2P1YA 2V2TB 1MJ7H 1EAPB 1KGCD 5C0CA 3W82A 1A4JA 1DQDL 3LMJL 3TJEH 4RAHA 5MENB 4XC3L 1VRSA 3TT3L 2GEEA 3VE0A 1WT5A 4Z7UE 1BVLB 4CKVX 4KKQA 1NUGA 1A3LL 1NEZB 1U3YA 1YQVL 1CDHA 1Q0XL 4UBDC 4JFED 2IBBA 3LQAL 1NC2B 4FG4A 3AADB 3B3BA 2CO2A 3AQZA 4HBQA 3HOGA 1VFAB 3CCHB 3QHFH 1MWAH 5BZDA 2NPLX 2B16A 4EMZA 3NJIA 5D2NE 4GUOA 1AY1H 1QKZH 5FUZL 3KS0H 4E9YA 3VGHA 3N44B 3RU8L 1YUHB 2YWZA 3BSHA 1P1ZB 1IM9B 4JN1L 5J1TC 1FYTE 2A73B 1T6VN 43CAA 3WNOA 4ZX3A 1CYWA 1T0PB 4L5FH 1EEYB 3NJFA 5A2AA 5DC2A 4BGLA 5C0AE 1RLBA 4FQXC 4BIKA 1DE4B 1RZQA 1VACB 3AUVA 1B2WL 4G7RB 1NC2D 4FX5A 4J6RH 1QSZA 1EFXB 1KCRL 4X7TA 3UERA 2WWMC 3KBEA 5TTRA 3GSVB 4OKVB 3S5ZA 4N8CH 4Y9EA 3VE0B 4PSRA 5SWZE 1RUPL 2GJZB 1MHHB 5H37G 4E68A 4MQXD 2NTSP 3A4FA 3GJFA 2K45A 1XIWC 5D7JC 1I4FA 2DYSB 5HI5C 3KDPB 5LBSL 1SDDA 3QJXA 3T0EE 5FO7A 3SPVA 1FZJA 1OLZA 3O6FD 1M3IA 1P5UB 1K2DA 4KOCA 2QGDA 4GMTH 4QHMA 4U1MA 3T3PE 3BC9A 2TAAA 3CN0A 5I5JA 5CCHE 4CDHA 43CAB 2G4GA 3FNKA 3EH5B 3GSUA 4FTDA 1E6OH 1BVNT 3GTVA 1UACL 1QQDB 2Y5EA 4N2DA 1F02I 4L18A 1DVQA 2D2CC 1IO4C 2XT1B 4M8RA 1ZLWH 1DUYA 1KXQA 4JKMA 1A14H 3U1SH 4K3JL 3AC0A 1JXFA 3GRWA 1R5WA 2XWBA 4KJPC 4LSUH 1OSEA 4JQVA 2E9BA 2JIXB 2Z0BA 3KGTA 4AQAB 2VR9A 2DQCL 5DGQA 4H25B 4N6RB 5DK2B 1BVKB 1JF5A 4A7VA 4YK4B 3V9CA 1RZJL 4F8LA 3D8MA 1X9LA 5HXMA 4NKIL 2C9VA 3SGEI 4NZDA 1OAXH 3HZYA 3RVWD 3B3IB 2JJSC 5HI3C 3JV6A 3O6LL 4G8EA 2BNQA 3GUFA 1A5FL 4PREA 4FFYH 3U9UB 3RDTB 3PG2A 1QVOA 2WD0A 2ZP0T 3QJHA 4KY1H 5IW3A 3SDYL 1NCCH 3T4YB 3HAEH 4YFLF 2MWCA 1DVXA 2K8QA 1RZPA 2A1WL 2K3TA 2I27N 3MCG1 3NAAH 3UX9B 1MQ8A 4MNGE 3WXWH 1N6QL 4J3VA 5MI0C 3BUDA 2UUDK 4ZZFA 2EDWA 2I60L 2DEXX 3ZL4L 2FECL 1H3PL 1RSFA 1UZGA 5HHVH 4YFDB 2FDBP 4N8VB 1AQDA 2WXKA 1OAQH 3OKLA 3TFKC 3I50H 4P23A 4N2KA 3RYMA 3TPUB 1R3JA 4M61B 5H2BA 4F92B 3PWPD 4UM9B 3AG2B 3US0A 2AS5M 1W8EA 4FLQA 4HEME 1FG2B 3RIFF 1S3KL 4F9LC 2B3RA 4I2XA 4NENB 1WITA 4PRHD 3HZMB 2AXGA 1AQHA 3EJTA 2XTJB 3H56A 5DZPA 4PG2A 4R4BA 4OAWA 4AJWA 2NYZA 5IJCC 2XVBA 1TITA 1MXDA 1SJEA 1X5AA 4L4TB 1KJ3L 4NKOA 3AS0A 4DIXA 3TURA 5AB0A 2WP3T 2X6UA 4WNQA 3RIAK 4ADJA 2AI0L 3MN8A 4XXCA 4UI2A 5DZOA 5C7XH 3TNNB 2BSCA 1WE5A 3DGGB 1E9QA 1WPCA 3MPCA 4PGDA 3ARBA 1B0GB 1YNKL 2Z92A 3N9GL 1HE8A 2WMPB 1ZAGA 3MBEA 4EZLA 3FB7A 5E6ZA 1F4WL 4XCNA 5LB1A 2W0FA 4KKCD 2LAGB 4H0GA 3UTTD 3PWLB 5AZEH 3WEAA 5E0FA 2YMOA 2X4OA 1CG9A 1I7TB 1N59B 5CSZB 3RVXC 1D6EA 3E6FA 4XMPL 1FPTL 2OL3L 4EN3B 1QPKA 2IJ0C 3L1FA 1OALA 2ESVB 1F4XL 1R33A 2ZOLA 5GHWL 3MR9A 4HU8A 5B8CC 2WO2B 4ZD3H 4MMXA 2FO4A 2DF3A 2AV1B 4MXVF 2ITEA 5JIIA 4M1DH 5BO1H 2H2PC 2H9GA 3K71B 2PLTA 2F58H 2EICA 1J9SA 3CN4A 3D39E 2R23B 5M94B 3FPXA 4HKZB 3IFOB 1DDHB 2NY0D 3DGGA 3HG1E 1FN4B 5AW5B 2JQZA 1AKJB 3GMLB 2AV7A 1DFBL 3LPWA 3HNTH 1ZD6A 1TTFA 3UBHA 5JW3H 3TT3H 3V5DB 4QEGA 1UQSA 3WJMB 5LDUA 4ANUA 2YPLD 4LQ1A 5BPPA 1YUKB 3B9KC 3N44F 1TZHA 1KTJA 2HJLB 4HIIA 4OB5H 4NGHH 4Y7MA 3FZUC 1UB6B 5C2BL 4U3SB 5LN8A 1KB5A 2ZOLB 1NDTA 1KIQA 4N3TA 4CL7A 2J73A 3WIHH 4Q9QH 5EN2A 3AZUA 4NKDB 5FKPA 4HEMA 1QW8A 3ARDB 3D34A 3T0AA 4IS6A 3ROLB 4B41A 2G4EA 3WEXB 3P3TA 4PJAB 5F1IA 4IBQA 5I75B 1FA4A 3CK0H 3DI3B 5B1CA 5KVFL 3RGHA 3LIZA 5DQJB 3G08A 1BQSA 5CJOH 2VXTL 5BS0D 3FFCE 1GGCL 5F72S 1D6VL 4LGSB 4OGYL 4FYTA 3OKKB 1OAYL 4J3BA 3U9WA 5J0BA 4NFBA 4PWHA 3VFSA 4M6MH 4YX2H 4XE5B 2V33A 2JMRA 4P48A 3E9TA 4ECNA 5DJAB 3V0WL 3BDXA 4P5TD 1TCRB 4LDCA 4JL2A 4Q0XL 3IAGC 4QXGL 2FJGA 4F33A 3KVDD 2VLLA 2FLMA 5B8CB 3DJSA 3GSXB 3UAEA 1JPGB 4F7MB 1TNMA 1ZK5A 2C3VA 4WK2B 5GZNA 5C70A 1GZHA 4P57A 4NHUA 5E70A 1M2VB 5HPOA 5ID0A 3ILDA 3KCPA 4KPHH 3WE6A 3TL5A 1KLFA 3OXRB 4YHZH 1EANA 3HTLX 4J3OD 4L2YA 4O2EA 4J3OG 2B08A 1DO5A 2J6EL 3KGUA 1JV2A 2OTWB 5TH2A 3CQPA 4QRAA 3WO4B 4XVTH 1L3NA 4UANA 5HYSB 2AEOA 5C08A 3VXPA 4Z8FH 2EXWC 2FX9L 1PEWA 3DPDA 3QPXL 2ZKMX 4AZ8B 2DQHH 2EDRA 2B5IC 3MROA 4LBEA 4IDLA 2Y4SA 4MX7A 4HF5H 4DO5A 3BAIA 4OM1L 1J10A 2QVFB 3GIZL 3SYPA 1HIMH 4HT1H 1RCYA 1GOHA 3BJ91 1L4IA 5E7FA 2IH1B 2E59A 3MREB 2BSSA 2Z31B 2X7LA 1A7RL 5F1NA 4WI6A 4NXSA 2WAQA 2XN1A 4QJ4B 1DBBH 2XWTB 1KB5H 3KCPB 4NCC2 3ZO0A 1U93A 1CF8H 5GRUL 3NH7L 2X3CA 4UQDA 2F9BT 4CJ0A 4AIZA 3PQYB 1S8DA 3L6FB 1M6UA 3MRHA 3VH8A 1IIIA 1E4HA 1CICA 2BP5M 3UP1A 3K5RA 4K23H 3QQDB 1IM9A 2GVYA 4R9HA 2A73A 2L04A 4TQPA 3T4AC 3P1VA 2HX9A 2HH0L 4LBEB 3UJTH 4OLYH 4EOWH 2AK4B 3ZSTA 1WA0X 4RGMC 5CAYB 4UDUB 1RHHB 2AJXL 1T1WA 2M8XA 2P42B 3SGEH 4KHXL 5CZVH 5F7FA 3IDMB 5F8QC 3VXQB 4PD4J 1ZSHA 2VGLM 4O5LH 5F96L 3BUYB 3Q05A 1U3HA 2VDOH 4WI7A 1LE5A 3GUTA 2O5ZL 1NBCA 4GKOA 5F1NB 1RUML 5AAWA 1PCSA 4RZCA 2FNWA 5F7LB 1BAGA 2VERN 2VDRB 1MJUL 2FB4L 3D69A 5AQ0A 3NSXA 4F27A 2WYIA 1S8DB 1S7SB 4DEPC 5JTWA 2AABH 2V9TA 1FFPA 3ZHKA 3ILPA 1TJGL 4ZD3L 1JDDA 1X7QB 5FK9A 2SEBA 3IPFA 4FNSA 1PY9A 1LK2A 4GP5B 5TE7H 1BLNA 1ONQB 5EUOF 1XB3A 4O2FB 3V4VB 3VG0L 3STLA 3FRPG 3BPOC 4PJ5E 5ACZA 5KSAC 4FQ1H 2AFNA 1YHPA 1NMAH 1NOLA 2QR0B 3CFCL 3OMZA 4CVZB 2ZUQC 3DECA 3BKCH 4AQOA 1QHOA 3B9EA 4X5RA 4DSYA 1Q1JL 1KELH 3MV9D 4W93A 3ZYJA 1IIKA 4GRMB 1QLRB 2NXZD 3GI9L 1E6JH 5IHUL 1RLWA 1N8ZB 4HD5A 1NKGA 4U1HA 1W0YT 1EAOA 3S2CA 3EH2A 1TO5A 1U8IB 5D4JA 3LEVH 1RFDL 1KB5L 2EIBA 3TCLB 5GGVY 4FCAA 3QNXA 4YBLC 3I2CL 4I1NB 2PR4H 1WJ3A 3CSYA 5KJRH 1XR8A 1KV3A 2F61A 4LRIC 4PJFF 3BWUF 3MOBH 2CDFA 2EIEA 1Y0LB 1MAML 4UTAL 3W2DL 1M6OA 2OMWA 3HNSH 4MCZA 3U6XA 5TDOB 5HGBA 4JJ5B 4NPJA 4H8VA 1B88A 1L0PA 3S4SB 5DZAA 4Z5RB 2J8OA 3MLUL 3U36B 1L0YA 1QYGH 3FT3B 2JV6A 4HFWB 2Q7YB 3RE0A 2FJSA 3S36X 3U4EB 4LHJB 2YRPA 4G80A 4KK9C 3DYPA 4NFDA 1WAAA 2NYYD 5AKRA 4KPHL 4M62L 1I75A 3RPIA 4PBWD 4OJEH 2ZXQA 4LIQE 3NJXA 4GUQA 5F6IC 4HULB 2XZCH 4KH9A 4UM8A 3I6GA 4X5PA 2X53A 1RH8A 3ZY7A 4UNVA 3DVGA 1NCDL 5DUPL 2MRYA 1HEZB 3ILQC 3U30C 5BUAA 1YMHA 1CB4A 3IDNB 1B6UA 5LWYH 2VL5B 1J0IA 4XO5A 3KZ8A 2R7EA 5D7IF 1G7JA 1SGKA 2D03H 1TMQA 2I9LA 5IVXF 3SE4A 1OP4A 2Z91A 4GO9A 5CZKA 3O3AA 1NAMB 3IGUA 4D9QE 1H8OA 4L0YA 4ERSH 2F53B 3NJGA 4HXAH 4AYFB 1U2HA 2LU7A 1QSEE 3FB5A 4E9XA 1R1CA 3C87A 4MCZB 4OJAA 5EO1A 1ES0A 1HU8A 5KS9F 4PJGE 1M71A 5EG6C 2OCJA 3L3OA 1MFCH 2Y7MA 5EUKB 5BQDA 1U95A 5DS1A 3UAJA 4PV9B 2BM3A 3GJEB 5I66B 1QRNB 1DLFH 3DRQB 1J5OH 4R4ND 3G5XB 5SX5H 3RPIB 4XNAA 4L4VB 3GDCA 4XHQA 3AREC 2H6PA 3JTSB 3OB0H 1FNEB 5I6XB 3MBEB 3DTXA 3VI4B 4HDIA 2DI8A 3BZ4A 2IFFH 2L4OA 4XPHL 1TMCB 3RVVD 3KBPA 1BIIA 3NMEA 3CLFH 5EF0A 3WFCL 1ZK9A 3ULUL 1ORQA 3L3DB 1UKSA 5EOTA 1WZ1L 1AO7D 1JIBA 3QJFB 1C5CL 3QUYB 3WXVL 4Z3FA 1NOAA 5DJXA 1Q1JH 4M6AA 4HBCH 2R39A 4MMXB 2VZVA 3QW9A 4B0MB 2LABA 3NIFF 1URZA 1T3FB 1ZT1B 3NCCB 1OM3H 3DUSA 4O02L 1H6EA 1BZ7A 1B2WH 4Q56A 2NY0B 2PPDA 3N91A 4GFTB 3M7FB 4PJDB 1ACYH 3V0VB 4LL9A 1ULVA 5HHQB 2CE6A 3NK4A 4ZO7A 1KG0A 4FL4C 3FO1B 4F7TB 5DHEA 4JCWA 3HR5A 3MV7D 4E41B 4JQXA 2ZYIA 1IGFH 4PI0A 1KJ2L 3QJVB 1YN6B 5D2NC 3ELQA 4P46D 3MLRL 1Z32X 1GS8A 4HWZA 5I6KA 4OLUH 4XOEA 1HNGA 1UA3A 3CVDA 3LKRB 2ZXCA 4PJHF 1WISA 2VW6A 2XUWA 4LCWA 1WSST 1TQUA 4Z7VF 1A7OH 1R24A 3LRMA 4MASA 3KYOA 4PRBA 3FB8B 2FT7A 3K4AA 3U2SA 3OF6D 3D50A 4PJ8D 3LS5L 3WNPA 1UH3A 1Z9SA 2Z35A 4HWBH 4PJEE 4QNPF 3UJTL 1N70A 4BZ1A 3BO8A 5LGHL 3S8GB 2ADGB 4HUVB 1RZIB 1Z3RA 3ECVA 1GC1H 5E00B 5L88H 3V7MA 4WWNA 5D70H 1EUUA 1HN1A 1T04B 3GMNB 3QQ4A 4TLSA 3VG0H 4CMMB 3MRJA 2A6KA 3D08A 1CLOH 4JGUA 5DRZB 4TOYH 2X28A 8PAZA 4YSUA 1BBDH 3HC4H 3W3BA 1JSYA 5CS7A 5A1AA 1IGYB 12E8H 1TCRA 2OLDA 4FLSA 1L9OA 4Z7WE 3ULUH 2FUQA 1QNZH 4DK6A 1U8JA 3UZVB 2UWEB 3W0WB 3DUUB 3UACA 1RIVL 1NCAL 1XIWD 3PL6A 4MD4A 3VSUA 5J11B 1JNNL 4ABWA 2BNRE 5EEYA 3KYKH 2BJMH 3FYEB 5DTFB 1FORH 2JJVA 2VDPH 3QJQB 4GAYB 4Z7AA 3JWOH 5DFVD 5GGSY 2X6BA 4P2OC 4A37A 1MCRA 2IPTH 1T20A 1OAZH 2NXZB 3B2PA 4I3GA 2V2XA 4P4KA 5BRZD 1DEDA 1ILSA 3UTZA 1YNLL 3VX0A 4GB9A 3NIFB 5E56A 2ICEA 1R34A 4RDQG 2XSKA 1AZZC 1FLTX 5IQ9A 5DRWA 3MJ7B 2XI9A 3QUZD 4ETYA 2XBZA 3I9GL 3QXAB 4P3DB 2NW2B 2WVSA 3BVWA 2DD8H 4L8BA 2R69A 5CUSH 4P46B 3KVQA 3SKOA 5FOJA 1ZHBB 2X9WA 2QSVA 5DUBB 1EHNA 1U8JB 3O8XA 2Z31A 2NY6D 3SPIA 1CGXA 3VGDA 3VD7A 1VFUA 4QY8A 5JNYB 5ICXB 2BP8B 4P07A 1M7DB 2R2CA 4AENB 3KPTA 3OPZL 3A21A 3HAEB 5D4HA 3ZZ1A 5DZVA 3PXHA 1RD6A 4FI8A 4PJ5D 2HMIC 4AIZB 1WA2X 3PQYA 1JF6A 4Z6AT 1V8HA 3CHSA 1D2OA 1DVZA 2EAEA 4PJHB 5KVFE 3MFFB 3SBWC 2V2XB 1ZLWK 1W2KT 4N9OB 3UTZB 1AGFA 5LKNA 1A8JH 4W6WB 4X42A 3KBFA 2WIIB 4Y8AA 4AMKH 3GBNH 4LSQH 1JNJA 1ERNA 4S1SL 4Z7QF 5DT1H 5IROC 1IBGH 3E2HC 2RH0A 2YO3A 1C8QA 1HFUA 4XBGA 3BIKB 3FT0A 2PPAA 1MCCA 2PYFA 4QXTB 2ZX9A 4MD0A 1ZT7B 3T77A 2Y1AA 1DBKL 3X14B 3IDMA 4LRNH 2HRLA 1U92B 4KI5C 4MZIA 2OSLA 2E6QA 4MZ3A 5HVHB 2A2QT 2GIMA 3RI5F 3JT0A 5C0AA 1N5YH 3MRCA 3KMDA 3CZFB 1JOIA 3QWRA 2WV3A 4JFZH 1IB5A 1A65A 4AQ1C 1FFRA 3O4LA 3SE6A 3UTOA 3QULB 2OPCA 1SY6L 4U1JB 3MRDA 3REVA 4XPFH 4U1SA 1OD9A 1RZKL 1TT6A 3FU3A 4PCSA 5BV7B 2NY4B 3GMQB 1U3HC 3Q8FA 4KJQC 1PG7W 2WBJC 4W6YB 3VI3A 4BCXA 3H2PA 3MC0A 3K6DA 5EZJA 1QASA 4WWKC 1IM3A 4U2ZA 3I9IA 2A99A 3IETB 3KDMB 2YMTA 3L4ZA 4J2QA 4NC1E 2HT2D 3MYZA 1FORL 5DWPA 1UHVA 2AEPH 1EAPA 1P4IL 5C0CB 1LGVA 3NCJL 4ZDHA 3CFEA 4G1MA 4UAHA 5DLML 2XICA 1VADB 3MLTB 4WJG3 1BPLB 4ZS6D 5CLYA 1F4XH 3HG2A 5JDSB 4X7CC 3OWEA 25C8L 1DZBA 4IKJA 2HRPL 1YO4A 3IFNL 3O4LB 3CK0L 3JZYA 1ZPUA 1NGZA 1MW0A 3T6ZA 2BVPB 2DYPB 2YGVA 3QNZA 4H20L 4JM2D 3HS9A 4U1SB 1V54B 4PJEB 5E2WL 1CFNA 3PAVA 4TVUA 3ULSB 1RP8A 5FFLA 3EG9B 4P99A 3L13A 4MS8D 2MCAA 2A0LD 3E3QC 2L7UA 2OFQA 3PGFH 2XTJC 4ODXB 3Q8BA 4JJ5A 3F7LA 4OD1L 5C2BH 3DVNB 1KCSL 4GXFA 3LS5H 1JPST 1A3ZA 3QEHB 4P9MH 4R0LA 3MRFB 4LCYA 3BPNC 4G80B 4K3GA 5FW7A 4HMCA 2WZ6A 3B5GA 2TRYA 5GS3A 4PB0H 2VABA 3SKUD 5C71A 1K8IA 2EDJA 5I8CB 5ICUA 1TVHA 1HQ4A 5AW4B 4UM8B 5HGGS 1IAOB 2EIDA 2NUPB 1I9EA 2G3XA 3HPJB 4MJ2A 2F74B 4QMEA 3MMEB 1RMFH 4WTZG 4X9HA 3E80A 5FW6A 3SBPA 3VRIB 5A2JH 5EIIA 2ATKA 2VL5A 1QSED 3GFUA 4QHLA 3BAKA 1C16A 1OSZA 2EXTA 4JPWL 1MCEA 3P9WB 4QYAA 1OB1A 1YEIL 4RGOL 1QOKA 2NW3B 5E9AA 3Q2WA 2WLMA 3OPZH 2Y23A 3VUAA 2V9QA 1TYRA 3OB8A 5L0QB 3APFA 4XNMA 3GSUB 4OM1H 3MGOB 3JV0A 4U4BA 3ZZQA 4P2QA 2H41A 3B2VL 4WWKB 1NBZA 4R7XA 4PW3A 4IJ3C 4J3UA 3CFJB 1WAPA 4HKXB 1NMCB 5ALBH 3SOBL 1A1MB 1RSYA 2DWXA 3LZNA 4BK4A 1AZBA 1HH9B 4U0RB 1KXHA 1CICD 3PDOA 3QVAA 1BJMA 2EZ0C 3VGAC 3AG3B 4JGMA 1SZNA 2NY3C 5GGTA 1LILA 1UWEH 2VLKD 3D0VA 4B9IA 4A6YH 4IRZL 2XXCB 4UTBA 3KPPA 5DJYA 1UJTA 1D7BA 1J86A 4E42A 5FYKH 4YO0A 4KKLC 1BOGA 3HZ3A 1G7LA 2WLLA 3BPLB 4JM0A 3CDGB 4GXVH 4K8RL 2DIAA 1TTUA 2X4PB 5DC9B 1NBQA 2BNQB 1E3ZA 1GGCH 4NUJA 3V0HA 1GCFA 2BJML 2ADFL 2VT0A 5E6IA 4W70A 5CINH 4Y19A 3SJVA 1QVOB 3T4YA 1VCBC 2GW5A 4R90H 4CDGC 3L3HB 4EN3D 2P8MB 4S0TD 4G9FD 1E5ZA 4I8DA 1DJWA 2A6DA 2COQA 4UIKL 3B9KA 1TZOA 1IUZA 4DP4X 1TTBA 3RDJA 35C8H 2BWIA 3WOVA 3BLKA 1I82A 2ZWKA 3QQ9C 3GIZH 3V0FA 3QZWB 3RWIB 1KTDB 3ABZA 4HD9A 2XWEA 5E2TL 1J8HD 1KPUA 1JZIA 1S3RA 4NGHL 3EH3B 4N0UB 3TPUA 3LZRA 3MNZB 5CJBA 3S35L 1O7DC 3KYMB 5LBSA 2BC4B 4XE0A 3PQYE 4X6DF 4X6EB 4FJ6A 2V5YA 2R2HA 2Z31D 1VPOH 1FNSH 1XAKA 3B2MA 5E5MB 3SCMA 2RMNA 2DDQH 2IQAB 2CK2A 2APWA 3RURA 1LO4L 2NXYC 4FZEL 1L3WA 8FABA 2XTJD 4XCCH 2LU4A 5HSFA 3I6SA 3X3FL 4JFHD 4FNLL 5DF0A 5FYJU 1USZA 3RHWK 2JSFA 4MB1A 5DD1L 5K59F 4NERA 1R24B 1T6WA 2AQSA 2IOIA 1A8ZA 1BM3L 3CDYA 1RK1A 4ODUB 3PWPB 4E41E 2QJDA 1P6WA 5IVXA 3P3UA 4OI8A 1EWHA 2ED7A 2XKUA 4KKAD 2WZPD 1WUNT 3UCRA 2QDVA 2JCCF 4JN1H 4LKCB 3QGVA 3H7BB 3ECQA 4N0YH 2BOBB 2YPKA 5IVZA 1DQJB 5L2KB 1JV5A 2BIPA 3KVPA 4EN2A 3K8MA 2BZDA 3GMNA 2VDOL 2X5PA 3IDGA 3RG1C 1IAKB 3MRJB 5JZ7D 1RI8A 3FT4A 5HHMB 4JVUA 2Y06L 1PD0A 2R29A 2JKJA 4M3JA 4G6ML 1AVAA 2KUTA 3VG9B 2LOEA 2ED8A 2VMFA 4M7LH 3Q1SL 2CLRB 1MVUA 2I5YH 5IFHL 4ETQA 4URTB 3FFDA 4NAJA 4OUUA 1ZV5A 3HHRB 3DX3A 4QAMB 5IB3A 2VRKA 4ZYKB 2IH3B 4IDJH 4PGJA 1FNHA 5I2IA 4FEIA 5DXWA 3NIGF 4WAFA 4LDEB 4PJGF 3CVIL 1BGXH 2R23A 3RGVC 1W72B 4MAUH 4JN2B 3CXHK 4HIHB 3UYRH 3UG5A 2A4ZA 3GZOA 3EAKA 3UJJL 1NCBL 2DYPD 3CU7A 4BZ2H 4PIBA 3DDFA 5HDWA 2C9RA 5C0FA 3AITA 1LMKA 5E2VH 4F3FA 4N1CA 2VLME 2ROYA 2HJLA 4HIIB 4BJLA 4M48H 4A66A 1MG3C 2P5EB 3GMOB 3NCXA 5CJ8A 4NUGH 2VIRA 1DP0A 2L7JA 5EIVA 5DURD 1ZVHA 3L95A 2HUHA 2NOYA 5EZOL 5KJ4A 4I3RH 4ODVH 4H8WL 4XNUH 2F15A 4R7NB 4XP4H 5D1XD 2AK1L 5AD0B 1YEWA 3I84A 4ENEC 3MLSL 4IHBA 3O0RL 1P7QB 2JJSA 4LLMB 2C9QA 1DN0A 4DPRA 3BWZA 5DUML 1IM3D 3WTYA 3MV7A 1JF1B 2E86A 3B5TA 3CGTA 4PMEA 3HAEA 2GUOB 3QO0A 3QZOA 1NCTA 1VCAA 3BN9C 2WVVA 5T3ZL 1A4AA 4ZX4A 3QR1A 1D5BA 1L7IH 3HN3A 5E6RB 1TJHH 4KC3B 2CBPA 5B1JA 2WXNA 1JZ3A 4Y4KB 2GIYA 5AW1B 1MCWM 2VZOA 1SQ2N 5AKSA 1ZGLB 5ALBL 3WFCH 4KMTH 5J6GB 3AY4C 4KVNL 4AKQA 5GRXG 2EVJA 2RJMA 2NXYD 2NCEA 3FHQA 3GNMH 2LLLA 1M2OA 2IDCA 3RY5A 3F05A 5FGCE 5MENA 3PXLA 2KPWA 3CPLA 5INCB 3MCLL 4EUPA 4FFZL 1O7DE 3T04D 1VZIA 1YEIH 2OMUA 1A6UL 3LN5A 1KCWA 1IC1A 5CEZE 3CXDH 3FUDA 4XX1G 2P4AB 3QI9B 1E8XA 4G8IA 5L4IA 3L1OL 1CIDA 5JHLA 4ZTEA 3REVB 1YUHA 3DKHA 1MNNA 4ZMZA 4FQ2H 1DVFA 1G5GA 2YPLE 2PO6A 1BD2A 4H8HA 4HKBA 1DQKA 3NYKA 5GSVB 1X5GA 1G9ML 4L4TD 1WGOA 4HEPG 4YDNA 4A6YL 4ZUSA 4ZFZB 1KCVH 2B0SH 2EE6A 3C8DA 4JRFA 4JZJA 4LSVH 5FYKL 3HS8A 4PRHB 4PLJD 5INCA 1F8TL 1QBLH 3D5OF 2VR5A 1KPVB 3K0WA 2B5IB 2B1HL 1WYJA 1KBKA 3TONA 3IGAB 1U21A 1IQDB 1DSWA 4J23A 3ARTA 4TN9A 1IGML 4UQ3A 4AITA 1ZHLB 2A83B 4IRSC 3GI8H 2ADJA 2IGTA 4LVOC 1T0OA 2PYED 1CICC 3LH2L 2GBAA 4XNUL 3MUJA 1AXIB 4PY7B 2NY5H 7FABH 3AQXA 5KYNA 2BVQB 4QRTB 5IW6B 1NGXB 4WWPA 2BLFA 3MRIB 2QVTA 4OU3A 4Y5VA 3T3PF 1IE5A 1UD2A 4IU3B 1T66D 2V8LA 3D07A 1F2XK 1W9XA 5HHXL 3T8MA 4F7PA 4W4OA 4C47A 5E8OB 3FTGB 4H25A 2DDQL 1ZS8B 1AYOA 1IC5H 1P7KA 4ZAKB 1OCCB 3W39A 1PZUB 1IFHH 2BZ7A 3MI6A 4ANKA 4EXPX 5C0ND 1E5YA 2FGZA 2J71A 5LBVA 4XC1H 1RERA 1X5YA 1PZ5A 2ZYRA 2LW3A 2F1BA 1EA9C 1C1EH 2DH2A 5E08H 3TWYA 3CH8A 3QG7H 4LO9A 1FFPB 3R19A 3ATBA 4V2BA 1W0WB 1I1FA 2H2SC 1V55B 3Q13A 4ZQKB 1S4IA 4OCXH 4E9WA 3DX2A 1UGNA 1FFNA 2WWKT 4NXKA 4FKKA 4L5FE 4ZFFA 2ARJA 3DTUB 3MU3A 3NT0A 4HSCX 4R97C 4I77L 4TNWF 1UXSB 3CXDL 2AJYL 1T83A 2WNXA 4Z7NF 5C0RL 1GZQA 1WC7B 1UD6A 4CVZA 2IFFL 5I1AB 5LGJB 1NIBA 3HB3B 4C59B 5A2FA 1CO1A 1AG0A 1EV2E 3IDXH 2VXSH 3V6OC 3DK0A 4R0LC 3FRUA 4KK5D 1DLHB 2J1WA 1DVSA 1A64A 4WDIA 4JB9L 3DX4A 4KVNH 2CNYA 4F2FA 5BMFH 4NZJA 1IBFA 4W4OC 3BSZL 4NENA 3L9EA 3H9SE 4ELMA 3C6LB 4MXQD 3DUHA 2XPZA 4YO0B 5DLLA 5C0GA 2GJ6B 2WK2A 3E6HB 4WJ5A 4ISVA 4DGWC 1KCLA 3GSQB 5B38B 2JKWA 2PCFB 5IKCB 1SN2A 2ZKWA 4MVBC 2UXTA 3GC3A 3HUJF 4YC2C 4AW4A 1UWGH 4LMQE 1JZ7A 1YNTF 2JK5A 2VOTA 3UC2A 5DJ2B 2J1KA 3NPSB 3UJIH 1Q72L 5AOJA 2CHDA 4JNXA 2R9HC 1JG9A 5BNXD 1R3KA 2G9HA 4NZTH 5F9WB 3MLWL 3E1F1 3VYOA 3DXAD 4GBXD 1RURH 4LRNL 1OK8A 2HKFL 3TGXA 1BQHB 4KY2A 2QSCL 4G82A 5E5RB 4TKWA 1DLHA 1N7MH 2R4SH 1RJZB 3FSWA 4P5RA 5C6TL 1VGEH 3AABA 3AT0A 2LTQB 1KGXA 2VSMB 3DBXB 1U0QA 4PV8B 2DLHA 2BC4A 3NVQA 5IB5A 2QGBA 5AW7B 5HDQH 4X6EA 4GBXC 4JHZA 4Z3JA 3H42L 1PZ2A 3LX9A 3U1QA 4FFZA 4BQ6A 5E5MA 3SCMB 3G9VA 4PJ7F 5EBLA 1WWCA 2YJQA 5CEZH 3IAPA 5IKCA 1ICTA 3WFBH 3KPOA 1SFDA 2W0LA 3VI4E 1JNLL 2HVJB 3FH5A 2M83A 2FE0A 1M71B 2CJUL 4HT1L 1GIGL 1OGAA 3FMGH 4TVPL 2GC7C 3PJSB 4H1LG 4MD5A 3KW8A 5IFAH 3Q6GL 4TF4A 5D7EA 1FO0B 2BHFA 2UY6B 3CBJB 3KPRB 3LH2H 2VKWA 2CR3A 2OMVB 3ELAT 4I0PA 4LOFA 4C4UA 2OMNA 4L0PB 4JFSA 1OAKH 2G5UA 3PGCA 1FN4A 2DBLL 4FQ1L 4NX0A 3MV8B 3S36L 3SD2A 1W0VB 1L9TA 3GKWL 1GMEA 3U6RB 3R8QA 5J7CC 2ZAGA 1UWXK 2XY1A 2CCWA 1PQZA 2WYTA 1DQVA 2B7DT 3W37A 1YA5A 3HRPA 3UO1H 2HT3D 3U7YH 5DMKB 5IVNA 2DD8L 5CUSL 2X6VA 2GTWB 1AFVH 4ODHL 2J6WA 1C7SA 3HE7A 4CC1A 2AERT 3GBML 2DQJL 3IF1B 3S3DB 4JFTA 2AVGA 4NZUH 2IPTL 4H8QA 3VWJB 2UVFA 4WV1B 1ZRUA 1X5JA 3RBGA 4KZDL 4PBDA 1F1AA 1NWPA 3ROLA 2P8LB 1XGQA 3WIAA 5G4OA 1KSRA 2QQKH 1MJUH 2X42A 4M8QB 2X1WL 2WTPA 3NP4A 4O4YH 1MFBH 1BIHA 2ODIA 1SYSA 2OX5B 3N40P 1DVUA 5FWQA 3EOAB 3UTQB 2V5RA 3HCVA 3ZLQC 3BW9B 5K9KA 5EFIA 3BZFA 3TN0D 1F1GA 1U42A 3G6AA 3FN0L 5KW9H 1SY6H 2H4EA 2OW6A 3ZKNC 2EQDA 2X2IA 5L7XH 3ESMA 4E9RA 2OXHA 1F4YL 4QRRD 2B4CH 2XFXA 4XT1C 5HHNB 4N9GA 3CLEH 4ZUWB 1JYXA 1NGWA 4CA4A 2HKFH 1FVCB 1ODAA 4AVHA 1DZ0A 5GGSB 5T3XE 3TNMB 4F15B 3ZKQD 4CNIB 1T03H 5DVPA 2O5NA 3L7EB 4OZIF 2AV1A 5CZXD 5I74C 2W88A 1OF2A 1T5WB 3F04A 3IJHB 4X6DA 4F7CA 4PJ9A 3ETTA 4LVNB 4FFYA 2HN7B 2GUOA 3QO0B 4K3DH 1CDJA 5DUJA 3TYFA 3TN0A 2WQ8A 4HEPA 3D06A 3WFZA 4ZX6A 1H5BC 3GSOB 5D2NB 5JIQA 1A4CA 5LQBH 1FIEA 2WTRA 5BUPA 8CGTA 4HKZA 3KJ6L 2AV7B 4D9RD 2AXHA 2NZ9C 4GSDH 1ZIAA 2G60H 1MIML 1YPZF 5KUKA 2NT1A 3DRTB 2UZIL 2VO5A 1R75A 4Y4HD 1HHJB 4FNUA 3UZEA 3U6XS 1GW6A 1N0LA 1WIUA 4FERA 3ZDXE 2DLEA 2UYLB 4BFIB 4GFXA 1KZQA 3ASWA 1D5MA 5EO0B 1CJYA 2DQJH 3HIZA 4PJIB 5F7DB 2KPNA 3LQZB 4A04A 2IPUG 5GRYA 1MJJA 3B4NA 1IAIM 4ATWA 1RK0B 4Z7WF 2FIKB 3O2DL 2JLLA 1U33A 4GAGH 4NO3B 5ABDE 4IRSD 3MA9H 1SBSH 1UA6L 3NA4A 5EUOB 1U4FA 5T1LA 3MXWH 3FH7A 5GGRY 4F2MB 7PCYA 2P48B 3LKOB 4JFPB 3QI9A 4UWQB 4P59H 2JTYA 4YHNA 4YS4A 5IBLD 1AZVA 3GHBH 2YD7A 1GIGH 4TRPH 5D2NA 4DGVH 1IQWL 3L4CA 1SVZA 5DEGB 2ZWSA 1WBXB 2Q9OA 4HWBA 1LO2H 3C5ZA 3L3IB 2DMKA 1QUNB 3F7RA 4LHUD 2C3GA 5MP6H 5E1AA 4QRPE 2PO6D 2EVHA 1OCRB 2X0VA 4B9CA 5H35A 2XIBA 3BN3B 1G1YA 3HUJB 1TEGA 1JERA 1ZTMA 2R4SL 3CMGA 2DWDB 3L3JB 1OT4A 2LV4A 5ICXA 4HJTA 2TRHA 3N6YA 1IT9L 4FQLL 4Q9QL 4FQXA 5CJQH 1XT5A 3DNKA 4CADA 3M6DA 3BGMA 2CIKB 2DQGL 3IGAA 4YHOL 2R56H 3STZA 2Y69B 4XN4A 5JPNB 1OAQL 1S9VB 3BAYA 1INEL 1OGTB 3D85B 3MFFA 4YVUA 1Z5LA 3BT2L 4G3YH 2VLRA 1A2YB 4R8WL 4LSSL 3ZHDA 4JPSA 2SEBB 2FYYA 3PV6A 3L16A 4JDVB 5KYXA 1PJWA 3LKNB 2AW2A 5LGHH 1PG7X 3X12B 3WTUA 1CDUA 5DFVC 2FHFA 4HS6A 1KXVA 2YAOA 4KK5C 1N19A 3NJMA 3WMPA 1TJIL 1UC6A 3PHOB 5D9SA 4HOXA 3D87B 3BD5A 4U6VL 1AHWA 2E9IA 4NCC1 4PG9A 4Z7UA 3BRDA 4LLQB 1X5FA 4NO5B 1HXYA 4EXKA 2EYRB 2YA2A 3TV3H 3UAJC 2CPUA 2WWNA 3OMAB 3C8KB 2CRZA 2X44D 4HW6A 1G7MB 1U8HB 3DSNA 2GKIA 2F54E 4ZPVB 2ITDB 1BZ8A 1CYXA 2LGNA 1IZJA 4XNZC 1L6ZA 4BFJA 5HJGA 3VH8G 5AVTB 2NY2C 4M1DL 4M7ZB 3ZKMD 1FVEB 3QIBA 1LP9F 2K6WA 1OT1A 4Q9RH 5E2TH 1GL4B 3IRPX 4GO6B 3TVMD 1K2DB 2MPVA 2UZPA 4L4VD 4MQSB 4DP9X 5I71C 3HI5H 1S7RB 4X0KA 4AGPA 1M6OB 2OMWB 3BQUC 3UJJH 3P54A 3QQDA 4FXKC 4TLUA 3DX9A 4YDLB 4IEFB 4X4XA 5J3HD 1FPTH 1DQIA 5E2VL 2WUBL 4NQUA 4Y5VC 3L4YA 5E94B 5BOPA 2ID5A 4EIZC 1FZKA 5KBDA 1ZEAL 2CO3A 4R26H 1IM9D 5KSUA 2ZXAA 4TSBH 2AQPA 1MUJB 1WFOA 2XG5B 4XVSH 2PXYD 5DD3L 1JZ5A 4HLZH 1U3HB 1RPKA 1AO7A 3OX8A 4IRSA 4H7VA 2VTFA 4XN8A 5L7XL 2AQ2A 1TUPA 1VJSA 5B7EA 4GI8A 2H3KA 5I0ZA 1FVEA 2J8UF 2EUZA 3JV6B 1AGCB 2P5EE 2A0LC 5BRZE 3B7RL 1KTCA 3GS4A 4PREB 1W72H 4NOFA 4EVNB 2ERJB 4G42A 4KZCA 2HB0A 1CK0L 1NGPL 1SHXA 3LZFH 2ZPKH 3OLIA 5BVJB 5KSAD 3V4VA 2WO3B 4IEFA 1SM3H 4PLJC 1AY1L 3DIFB 1ZJAA 4QO1B 1CFBA 3DARA 2MOVA 5JZ7C 3AY2A 2YRZA 3O11B 4NUMA 3T6XA 3NBNA 2CIIA 3ULUC 1PYWA 2VDQH 5B1KA 4EKJA 3WNMA 4FD0A 1OPGL 2EDHA 3BSZA 2C7FA 4YNYB 1QFWH 4JRYE 4U4IA 3TTSA 5CP3H 5LJYH 3ATEA 1KWGA 1N8ZA 1JGUL 4QHKJ 3T2OA 4ELMF 5C0AD 5HDBF 5FO8A 2IWKA 3KXFA 1BIIB 1ASPA 2ZUYA 4LNVA 1I9RH 5EOTB 3F7YA 4MAUL 1XF4A 4XPGL 2BSRB 3JYCA 3SIKA 1XR9B 3RNQB 2XX0A 4TNEA 3V95A 2P46B 4KDTA 3G3LA 4WWKA 5CGYD 5GRVK 4D0BB 5FEBA 1XGPA 4L3EB 4NIYE 3S8WA 3DUSB 5FHBL 4KUCF 5I9QB 2IG2H 1YN7A 2DL2A 4OV5A 4A2EA 1QACA 2FT6A 1MJ8H 5MEPB 1Z0NA 5E2WH 3BAJA 5C86A 4DQOL 2ZICA 3ZJAA 2G3MA 5DK3A 2GPZA 4DUWA 2P7TA 4EO5A 1MFEH 2Z7WA 4P5KB 3DO4A 3ROOB 3VXNB 2HJFB 2NY1B 2H47C 2KI6A 1KIRA 2D7PA 2A3TA 5KYYB 3TA3C 1DVTA 3K91A 3CSBA 3V10A 1BG9A 4XN5A 3T0XA 2UX6A 5LXGL 3CPUA 5C0DB 2BNRB 5F0LB 3O3AB 1RK7A 3RKPA 4Y19B 3VXSA 3GHBL 1GGIL 4PJFE 3CFBA 3UTTE 5MERB 3L5HA 2QPUA 1JRHI 1XGPB 4L3EA 2XN9A 2A7BA 3GEFA 2VDMH 4L8SA 4NZ8A 5DYOB 5IMLB 4AL8L 1K8DB 1A6VH 4WUKL 5EOCJ 3X11B 4AIEA 5IMOA 5TQ2L 5TK2A 3II3A 1L0XA 3QO1B 3GJEA 1G7IA 3INOA 2BW5A 3F65A 4LHUG 4MA7L 3TC9A 1ZANL 4IGBA 3C60C 1CGTA 3WNKA 5KS9A 3FBQA 2J5LC 4UUJB 4UV7L 5FM5M 3BZFB 5AW6B 1KYUA 3S5YA 2HJFA 4JR9L 4BV1A