3FUCA

Recombinant calf purine nucleoside phosphorylase in a binary complex with multisubstrate analogue inhibitor 9-(5',5'-difluoro-5'-phosphonopentyl)-9-deazaguanine structure in a new space group with one full trimer in the asymmetric unit
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
282
structure length
274
Chain Sequence
NGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESQGKANHEEVLEAGKQAAQKLEQFVSLLMASIPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.45 A resolution crystal structure of recombinant PNP in complex with a pM multisubstrate analogue inhibitor bearing one feature of the postulated transition state.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
total genus 96
structure length 274
sequence length 282
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2009-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fucA00
4LZWA 4R2XA 3NM6B 4M1EA 1RXUA 4EB8A 1Q1GA 2AI2A 1JP7A 1A9RA 1SJ9A 4TS3A 4DARA 3OZEA 3T94A 1PBNA 4F3KA 4L0MA 1XE3A 1YBFA 3OF3A 2QPLA 1SD2A 2AI1A 4OEHA 1LVUA 3ODGA 1K3FA 4L6IA 1PWYE 3FAZA 5K1ZA 3KVVA 1JE1A 1Z5NA 1U1DA 4DA7A 1Z5PA 5F77A 1NC1A 1N3IA 2IQ5A 3NM5A 5F7ZA 3UAXA 4TTAA 1Z37A 4JOSA 2QTTA 2B94A 3UAYA 3GGSA 4LNAA 4RJ2A 1PR6A 4JWTA 1ECPA 1OU4A 4M7WA 2QTGA 3EMVA 3IEXA 4YNBA 1PR0A 1RXSA 4NY1A 3BL6A 4OGKA 5ETJA 5B7NA 2OXFA 3D1VA 1PW7A 5CCDA 1T8YA 1V45E 3BJEA 1Z33A 4TXNA 1RYZA 3E9RA 4TTIA 2PGAA 4NS1A 2I4TA 1SQ6A 1Y1TA 1Z5OA 4IP0A 4F3CA 1Y6RA 4L5YA 4OF4A 4GLJA 1Z35A 4OGLA 3FOWA 2XRFA 5F76A 3E0QA 3EUEA 4BN0A 1C3XA 1A69A 1B8NA 1RCTE 3UAZA 5KB3A 1Z36A 4E1VA 4D9HA 5CXSA 4DAEA 4DA6A 1QE5A 3PHBE 1JPVA 2ON6A 1Z39A 5B7GA 1U1CA 4R31A 2A8YA 1RXCA 3KUKA 2GUWA 2QSUA 1T8SA 1ODIA 1A9PA 1V48A 1PR1A 4DA8A 1WTAA 2A0XA 4G8JA 1A9TA 4L5AA 1Y1SA 3BSFA 5EPUA 4F2WA 1Z38A 4EARA 4DAOA 4I2VA 4D8XA 1Z34A 1LV8A 1RT9A 5B7PA 4GLFA 5IFKA 1V2HE 4WKNA 3KVRA 1VHWA 4MARA 3KVYA 3PNSA 5CXQA 3QPBA 3ENZA 3U40A 5DK6A 1LX7A 4FFSA 4GKAA 1Y6QA 5FAKA 2ISCA 3NM4A 4G89A 4D98A 1PKEA 2A0WA 1TD1A 2H8GA 4ECEA 1TCUA 3TL6A 4YO8A 1YRYE 4D8VA 1JDSA 1YR3A 4U2KA 3F8WA 1TGVA 1A9OA 1VFNA 1A9SA 1NW4A 1ODKA 2HRDA 3C74A 1ZOSA 4DA0A 3OZCA 1T8WA 4QATA 1RXYA 4TXJA 3P0FA 4D8YA 1V41E 3O4VA 4L5CA 1JDTA 5JPCA 1Y1QA 3MMSA 3P0EA 1NC3A 4MCIA 1VHJA 2RJ3A 3KHSA 3IOMA 3LBAA 1JE0A 1JDVA 4QFBA 1YQUA 4PNPA 1ZL2A 1U1FA 3DF9A 4LNHA 1JDZA 5F7XA 4YMLA 2HN9A 1CB0A 4MCHA 1OV6A 2HSWA 3MB8A 4WKCA 1ULAA 3PHCA 3GB9A 4PR3A 3ONVA 5CYFA 4KN5A 4QARA 4TXHA 4WKPA 3EUFA 1Y1RA 3DJFA 4JP5A 5EUBA 4QEZA 1RSZA 4YJKA 3K8QA 2OC9A 1PR5A 4NSNA 1A9QA 4R2WA 4WKBA 1YQQA 4OY3A 1ULBA 1OVGA 1B8OA 1PR4A 1JYSA 3PNPA 3LA8A 5F7OA 1JDUA 2OC4A 1I80A 4LKRA 1U1EA 1PK7A 2P4SA 1TCVA 3K8OE 1M73E 5C80A 5B7QA 2QDKA 4TTJA 4BMYA 4TXMA 4OJTA 5CYGA 4BMZA 1TGYA 1RR6A 3OOHA 3OCCA 4DANA 3FUCA 3SCZA 2OECA 1CG6A 3INYA 5F73A 4WKOA 2AC7A 2HWUA 4K6OA 1ODJA 3NBQA 1PK9A 2BSXA 4TS9A 3OPVA 5EFOA 5F7JA 4QAQA 4BMXA 4QASA 3FWPA 3LGSA 1K9SA 1V3QE 4F1WA 1OTYA 3BGSA 3EEIA 3UAWA 1OTXA 4M3NA 1V4NA 3OZBA 1T0UA 3OZDA 1PR2A 4LDNA 5CCEA 4F2PA 4TXLA 3O6VA 3UT6A 3OOEA 5IU6A 3KU4A 2AI3A 3E9ZA 1PF7E 2A0YA 4X24A 1ODLA 4TYMA 3FB1A 1K27A 1G2OA 3FNQA 4G41A 3DDOA 3DP9A 2Q7OE 3UAVA 1U1GA 3DPSA 4GMHA 1T8RA 5I3CA 1FXUA 2I8AA 1RFGE 1OUMA 4H1TA 4DABA 4P54A 1SD1A 1VMKA 5F78A 4UC0A
chains in the Genus database with same CATH superfamily
3TEMA 4D81A 3K9GA 1THZA 5KKCA 2IGBA 1JWLA 2FOIA 2PZFA 1HG0A 2JLXA 4W5HA 2BR4A 2WAOA 4Y7DA 2GJ8A 3O4GA 2AG0A 4EUFA 3N87A 5GTDA 2Y77A 3PDJA 5K0BA 1BKDR 3AM4A 3BKWA 3OFJA 2IU0A 2D7JA 3L77A 3L0ZA 3ZXUB 4EGSA 1BDHA 2AI2A 3GHYA 4B43A 3UJ8A 2GHTA 2CYCA 2YV1A 3D64A 4MGEA 3M3HA 1HT3A 3PSHA 1ZM3A 4ZCTA 3EF3A 3GQBB 3SIPA 1BCSA 3OZEA 2JLYA 5JCZA 1G8MA 2F62A 4F3KA 3LHFA 1U9JA 2PH1A 1PFVA 2FN8A 3MWEA 4K05A 4Z9YA 1Y6JA 3GLRA 1L5SA 1VECA 3IBTA 2DFKB 1A8UA 4V2IA 3DE2X 6Q21A 1Z63A 4G07A 1K08A 3LH5A 2NUAA 4ZTBA 4DHWA 4MW2A 1VHQA 4G1MB 1M0EA 1X1DA 2G6TA 4P4GA 1KP3A 1PDWA 5B36A 1UEXC 4TQ9A 5EINA 4OUDB 8MHTA 1PNOA 3HJFA 2XKBA 1MVLA 1WHSA 2VWHA 4NDNE 3MN1A 1N25A 1XO1A 5BSWA 4NBTA 3FMIA 3SR0A 3NONA 2LWIA 2CXOA 2CYAA 1JQBA 4BDTA 3ZDYB 1IXZA 1FBTA 2Q9CA 3W2HA 2P4EA 3RYIA 5LKAA 3KTAA 1BX1A 1G41A 2VF5X 3PYXA 5IBQA 3ZWMA 3ZCQA 4CM7A 1U3GA 3TCNA 1G0OA 1SVNA 3C7KA 4ZAXA 3ZU3A 3KJNA 5F1PA 4JLDA 4C0BA 1JHAA 3PWSA 3LXMA 1ABEA 4UTZA 5DTEA 2CNBA 2RCNA 1ODCA 3EIXA 3OTQA 6AT1A 1JEYB 1P1KA 5K3OA 4HUQB 1XRMA 3PNMA 1DCMA 2G07A 3IVMA 2VDUE 3DTNA 5BYKA 1DAPA 1YZYA 3NFRA 4MSUA 1RHKA 4G1FA 1SXGA 3IPXA 3T3IA 4B6PA 1T25A 2ZBDA 3F5FA 4Z0PA 4BN4A 2C88A 3UXYA 4DMRA 3ND6A 4U7FA 4I19A 4JJIA 4RHXA 2CUNA 2G0TA 1ZSYA 4UW9A 3OLZA 1EJ6A 1KFEB 2ZQZA 1P3DA 3W2TA 2G40A 3E22A 5FUMA 4BFXA 2QSJA 3CIOA 4XM1A 3O95A 1AHNA 1OMOA 1AZLA 3DOJA 3WLQA 4C0QC 1Y5LA 3D1VA 4J0IA 4TS4A 4PGMA 1XPJA 1UBKS 2R6AA 4Q3NA 3GT3A 1IJEA 1V45E 2ZI6A 4DCNA 4BC1A 2JFFA 1ZM7A 3TD9A 4KHZA 3F0TA 1IZ0A 1YBHA 1V16B 2WSIA 4TXNA 3TJMA 3WK6A 3TBKA 4C2BA 3E9RA 2AL7A 3U1TA 4G0XA 4UCXA 4EBBA 2F8TA 2H4YA 2H1FA 3DE5X 1HLFA 1N6HA 3GZJA 4LN1A 4O63O 4CL3A 1CUEA 3O1LA 3CISA 1CUFA 4XQ9A 1FIUA 2IFTA 1C8KA 1Z5OA 2FW0A 2PL3A 3G2HA 1V5EA 4A0FA 4BVHA 4LY0A 3UAOA 4XJVA 4BMVA 1MV5A 2RDMA 3TKAA 5LU8A 1SOMA 3NNNA 2I2CA 2D5LA 2QU8A 3CKLA 3FFXA 3WL8A 3LTNC 4GEGA 2O3SA 3GNLA 4O2AF 3L7MA 5EYPA 4TL8A 1WVIA 4J0KA 3RHZA 2IHYA 2GN4A 3L4BC 4JXJA 4N0QA 1SRQA 2PDAA 3X1KA 4OHXA 3RVPA 3EEYA 1GILA 1GRNA 2ZRDA 4FTWA 2ZJ0A 5B58T 2G5TA 1F8FA 3ANLA 4KQIA 1RCTE 4UTRA 2IX9A 3DC2A 3HYLA 3JWIA 1THTA 4YCAA 2XE6A 1QVZA 4GLLA 1ZAYA 3DMGA 4H1VA 3D6NB 1TI7A 2YY5A 3H5WA 2PT6A 4AX8A 1E3MA 4OREX 4C4PA 3VPDA 4JUIA 4DIEA 2BFFA 1XEXB 4OM7A 5A2QA 5AVQA 4G56A 1QFXA 5EJAA 3WL7A 4WJKB 3GROA 3BZBA 2C4VA 2OUIA 4LDPA 4OMFG 4PHGA 4RELA 5IAAA 1YNSA 5JANA 3IH5A 1WXFA 1Q92A 3DUFB 2J31A 3DOCA 3UMFA 2GD6A 1B74A 2ZSHA 5FPHA 1A8HA 3W3AA 5A6SB 3D7MA 1VE6A 4UHEA 1G4AE 2JB9A 5L51A 4YALA 1IDOA 3Q85A 1TU4A 3AETB 3KT0A 2FG5A 2WYOA 1WE2A 4JI2B 5DNUA 3BFVA 1FTQA 4DR3B 3PFCA 1QIMA 1U5CA 4NJMA 3SX2A 1UK7A 1SH7A 1XLVA 3AR2A 3GARA 4DR6B 4O0MA 3S2EA 1Y9JA 4E5NA 3RC3A 4YR9A 2I7TA 3ZWWA 4D1YA 4RTLA 3EGCA 5JALA 4Q3OA 2JVJA 3EQ7A 4AO7A 2G0NA 1E2HA 2WTNA 3C87A 3H87A 4GSKA 4F2WA 1OXKB 4F9GA 4YRGA 3L4EA 3QWIA 1SXJB 4P4SA 3FMPB 5IBRA 5T6BA 1PFKA 5DHUA 1KY4A 3DC7A 4KCGA 1EZ1A 1Q6ZA 1XTRA 3WV5A 4DSTA 1XTIA 2WD7B 3E23A 3O74A 3H19A 1RI5A 1XJ0A 2BZSA 3H16A 1L8AA 3BJZA 4D7AA 3AOEC 3HY3A 2NACA 3KYBA 1O95C 2GHRA 3ANSA 3EQZA 4M55A 4X5OA 4Q39A 2FZCA 2W2PA 3RK1A 5JJIA 4RJTA 3B51X 4KYTA 3GRUA 5EJMA 1KJNA 2DLCX 3C1AA 4KV7A 4CUZA 1OREA 5JTUA 3WGQA 3BL8A 2A57A 3LYHA 4D4KA 5LA6F 3VAZA 4BO6A 1TJPB 3IQFA 1EKXA 4TMYA 1RZRA 2JD0A 2C3PA 4HDKB 1A4RA 1YB7A 3ILHA 1PJ2A 2PJUA 1MAWA 2PGNA 2RHOA 4WDRA 4WOJA 3IXQA 3GIWA 1T6NA 1C3LA 4F5WA 1WCIB 1AMUA 4YP6A 1X7WB 3H1AA 3EXHA 2QLLA 2RGBA 2NU6A 3OA0A 5BW4A 5E9JA 5FH9A 3AKDA 3JATA 3E18A 1VLQA 4OK3A 2VZEA 3K05A 1I3LA 1SKQA 4MGIR 2WKRA 3NV9A 4CMJA 1DDOA 1I2AA 1U0RA 4IYJA 2RD2A 2C8KA 1E4EB 2VR1A 2I03A 2Z57A 4JUFA 1YBMA 2DFLA 4O5AA 3WLOA 3V7WA 3VOTA 4WXMA 1Q16A 3OCJA 3FAKA 1E2QA 2QJWA 1F2VA 2LKDA 1IAQA 3LRTA 3IPRA 4H15A 4RTNA 1SU8A 3VOBA 1ORHA 4PIMA 1ADCA 4LMAA 4NYIQ 1BOOA 1WUYA 1GSHA 4CEIA 2FG7C 5CLFA 4UULA 2GSDA 4WLVA 3H9JA 2IQIA 3LBHA 4UFOA 2QR3A 4U2KA 4MR9B 4QDKA 2X14A 1YA8A 1GWNA 3I5MA 4KXVA 4Q4JB 3VNQA 1L5ZA 1DP4A 4JDUA 2CXSA 3IJPA 1RCFA 3BF8A 3SS8A 2ZRGA 4PN3A 2HRDA 3UUEA 4H59A 3M6WA 2OPHA 4AJNA 4CNQA 5HUJA 1D4FA 1CQXA 2WPDA 2FEKA 3K0EA 3GJ7A 3A9VA 3JYQA 1AQYA 1ZCZA 3QNMA 4CFZA 4DA0A 4FHEA 2W6JA 3K31A 1T8WA 4UFNA 2J08A 3VJRA 1Q0UA 3KQWA 4H3HB 4QBHA 3VBEA 1XMIA 1WV0A 2AMLA 3SNKA 1NN3A 3EZ6A 1JDTA 1Y8QA 3PICA 3UKDA 2EP5A 1KI2A 4LG1A 3HXMA 3O1HB 2D2XA 2I4NA 4JUBA 1G42A 3VH2A 2I2DA 5AOAA 4EY8A 1HXHA 1JVNA 3BHJA 5AKJA 1JKIA 5EA2A 3RKRA 3USES 5ICMA 5EIXA 5JAIA 3OTWA 4P31A 1V6CA 3SDZA 4BPRA 2VLBA 4JKIA 1V96A 3ELYA 1GGHA 1T3GA 4UE2A 5T3YA 1QIEA 1ONNA 1CSEE 3EBOA 4NV3A 1SUFA 3BHIA 5JR3A 3ENKA 3DF9A 3N39C 3OY2A 1XB2A 3L6BA 1REQB 4GL4A 1G8AA 1R0RE 4DJDC 1Z28A 1E64A 3OZWA 3BFPA 5GIPE 1QKKA 3WMGA 1ULAA 3O3CA 2JAUA 1JEOA 3GX1A 1ZGCA 4FC6A 3WZMA 5KNBD 2B4TO 2GFQA 3O84A 3DV9A 1ZINA 3MQ4A 4OD0A 1W59A 3OOWA 3O8DA 4WLNA 5KNLA 4QARA 4GRAA 4QJ5A 1Q20A 1CDEA 2IW1A 4IHJB 3PPVA 3GFFA 4Q48A 1N7GA 2GPBA 4V0MA 1U7HA 1ZN8A 3DJFA 4NCJA 1JDPA 3ZE1B 3CINA 1ZW1A 4J3JA 3JD0A 1R50A 4JGBA 1FVHA 4XB6B 2AFRA 2VF7A 4F2DA 5BN3A 4BCDA 4ZT4A 2HIHA 1XL1A 1B6RA 4NSNA 1SPBS 4O29A 5GM2A 2P68A 2FR8A 5JCJA 3UJBA 1MU0A 1RBYA 3VX4A 2QRVB 1VRWA 3K6JA 3OQMA 4YRAA 4RIFA 4V1CI 1U6IA 4UM9D 5M2QA 5BR7A 3OAAD 5G40A 3PXGA 4FGSA 4PTLA 1TZMA 2VBIA 1U0JA 1YI0A 3RS7A 3RODA 1OV4A 2DSTA 3ENVA 4RQUA 2CLDX 2FZLA 3CG4A 2XMZA 4MGZR 2YUIA 1RACA 1Z73A 4TUYB 3OO1A 5I47A 3RSLA 5ALWA 4YY3B 1YZ3A 1IHOA 1VL1A 2V7BA 1VB5A 2OA0A 2JD1A 2NT4A 2QN8A 3MJDA 4C1BA 1P0MA 2YICA 3HKEB 4KU4A 2FR1A 2AZ4A 4NI5A 1JPJA 2FFRA 3NUGA 1G7CA 1K6XA 1Q1EA 2IC5A 2XCQA 1KEUA 3N76A 2A9OA 1N2CE 2EL7A 2PQ2A 4Z4EA 3KOXA 5CX4A 2VHEA 5G0TA 3V8VA 1RYNA 3KBOA 1IIRA 5JTTA 2GI4A 2H9IA 1XA4A 1EUZA 2HJ9A 1Y3DE 2EDAA 5SY6A 4KDFA 2A92A 2GD1O 3BGDA 4ODIA 4RZXA 5C46F 4KLAA 3LECA 2VXCA 4Y3UA 3DWGA 3PGXA 4LV5B 4P3YA 1G5FA 5IC5A 3GEEA 3D6MA 3X2SA 1UAGA 2FUNB 2VRNA 2AJBA 3B8HA 3HVUA 4HQ6A 3ROXA 4HDSA 2Y05A 3R9XB 1WB6A 4D4HA 4WX2B 4IIFA 4WH0A 1XU7A 4L3OA 1YOVB 2IZOA 3SCZA 1O9GA 2ZCJA 3SQMA 2CZQA 4CM6A 2A4MA 5F35A 4CIWA 3X1JA 2DBYA 5LP6A 3BXZA 1TO1E 1WSAA 2RHDA 2HKIA 3K3PA 3DKPA 4A1FA 3KG2A 1CUXA 3KX2A 3FIUA 3M89A 1GR0A 1DAFA 3UMBA 1I1NA 2Y9MB 4ZZ2A 3IQZA 1ZX1A 1AQNA 4QJIA 2HWYA 1NV8A 1SQ0A 3D0QA 1EP2B 2DHCA 3KZXA 4FHGA 4PFJA 4XTCS 2H29A 3AXTA 4K46A 4MWSA 4GOJA 3B53X 1G20B 3EVTA 3L0BA 4HN2A 3D6HA 3ZIUA 2XXAA 2KS6A 2ZIZA 5LUBA 5EE1A 3REFA 1C81A 3T3OA 1ODTC 2DUJA 4MQFB 4BMXA 9LDBA 4O4JB 4QASA 3E35A 5IUJC 1HDXA 1SXPA 4HVTA 4X94A 3PUXA 1IVNA 2I1VB 2KJQA 3CSUA 1SUWA 3GZ4A 3AETA 1TZBA 3FDXA 5K2OA 1AVTA 5DJ5A 4CF6A 2O3RA 4HGPA 3NP7A 2GZSA 4UAUA 1FRQA 4B35A 1O89A 1OTXA 3EDMA 3UA4A 1QQAA 5ITVA 1PRYA 3TQFA 3SG0A 1LW6E 1Q0SA 4UNSA 4A0SA 2B1JA 3T3MB 1GSAA 2WUWE 3KQPA 3NBFA 4N6OA 4R8SA 4BO2A 1T0HB 5I7EA 1G1MA 5CCEA 1VPWA 1E98A 1FUUA 1XP5A 1YC2A 3HR4A 3WB9A 4PG5A 5D86A 2QV0A 2NZJA 2Y1OA 4DLPA 4HDRB 1FZTA 4G9EA 4IINA 5C4IA 4YJ2A 4L9SA 4ZA2A 1S6YA 2E82A 1ZK4A 2W2LD 2PX5A 2VHQA 3LZCA 2R65A 5LZ9A 4Q9LA 5BQ5A 3MT9A 2X7JA 3DTVA 3R0VA 3LSYA 3AHIA 3OQHA 1T6BY 4O2BB 5LOVF 3ZDDA 1CRLA 1B0AA 1JR3E 1KC1A 1U8YA 2WBLC 2P69A 2WG2A 2ZR7A 2MYTA 4ZVUA 4N41A 4IJQA 4OBWA 1N0UA 4CHTA 4JB3A 1C30B 2A14A 4TT8A 2YCBA 4WKGA 3KFVA 4CV1A 1PT6A 1NW6A 3DO6A 2A0KA 2BKAA 1DZ3A 4JLNA 2GK4A 4LGCA 3UNXA 3VR4H 3C3YA 3FKSD 3WTCA 1AH2A 3RCBA 1Q14A 4JUCA 4PBTA 2Y9PB 1AB6A 3E9EA 5L7YA 4MYCA 1T8UA 1HH4A 1ORRA 1XZAA 3MUNA 3RVQA 3KT8A 3WGHA 2IPOA 3PEFA 4GD3Q 4ZD6A 3PC4A 3ABQB 3ZCPA 5BPFA 2W8BB 1AS0A 1L4LA 1NVEA 1K2VN 2LVBA 3DLAA 5HZGA 3U39A 3U3XA 2ZJ7A 2GPJA 4D80A 2GNPA 3C3BA 3HLTA 5FI0B 2IGTA 4M4SA 1PHRA 2ZBPA 1ZRNA 1PJ8A 1PZHA 1G17A 2N0SA 3AZPA 3ESRA 5KJFA 2HDWA 3DOUA 4XSVA 2FWNA 1OUMA 1NDHA 2XB6A 5FOWA 4DABA 2VRCA 1T4CA 2WLTA 3GGJA 4TOIA 3VSBA 1QQBA 7MHTA 5KWVA 3AVXA 2DHQA 1FJHA 3KJFA 5F1OA 3CVXA 4LQ4A 2PFGA 1W2GA 4JWKA 3IUYA 4AC9A 4S24A 3VMMA 3ZBTA 3LGAA 3EVNA 1PJZA 1XXLA 3GP3A 2RGYA 1TJYA 5DX1A 5BN1A 1Q83A 1S4QA 3R6LA 4LEIA 5EMNA 2PZAA 3OX4A 4I55F 4NU0A 1KEZA 4EW2A 4FCVA 2BHNA 2HJVA 3OPYI 1OH5A 5LCXA 3LX6A 2IIPA 4LJ8A 3EXFB 2BKXA 2J48A 3SZRA 1OHHD 2BFBA 2XUDA 2CXTA 3CF4G 4WJLA 5B1IA 2DH5A 1H66A 2VPWA 1ZOIA 1P18A 2X3YA 4LF8B 2XI4A 4LYHA 4LYAA 1NSFA 5A4KA 2BBOA 1WXWA 4J9VA 5KVQA 1RPZA 1I4TD 2NW6A 2AOWA 2QLFA 2P2NA 1PLLA 4RA9A 2H18A 3DVLA 4BFTA 1KS2A 1LPBB 2GYUA 2QA5A 2BEUB 3VHRA 4I3GA 4DMUB 3D0OA 2FETA 4ZHQB 1SXJD 1GRCA 4P33A 3LY7A 4BBAA 4KLNA 2V7VA 4GC5A 3R41A 1QDEA 4XD7A 1Y5NA 4MV4A 5LDGA 1C7RA 1KNQA 3C5CA 2IZ7A 1E7YA 1KVRA 1QC5A 4KVZA 3QYPA 3CRVA 2GDJA 1MJFA 3LT1A 3A2NA 2C5LA 3IDZA 4RSRA 4F72A 4IIJF 2QUKA 4BFWA 4HQKA 3N59A 3H2HA 5GZ6A 4JJ7A 1N32B 3ZWQA 4KQ6A 5IASA 3FVVA 3WLIA 2R1TA 2ZIVB 1E1DA 4ZAWA 1FNCA 4YMUA 1Q2UA 1TW2A 4KWCA 4R54A 2YYYA 1V8PA 3FSGD 2Q8PA 2RGEA 4GXQA 4DIDA 5L3RA 4DEXA 5JH7A 1T34A 4RVFA 2GTPA 3W5VA 3VYUB 4BASA 1T8TA 1V5FA 2GCNA 4A2CA 4BO4A 4MQEB 3QSYA 3Q88A 1KJJA 3CR7A 1WL8A 5BWBA 2XDYA 3QVVA 1FXSA 4MA5A 4UEQA 1B6GA 1IZ9A 2BEVB 1SELA 3GGSA 1FP4A 2AYYA 1JQ5A 2CL7X 3GRAA 3I52A 4MUEA 3VOAA 3X2EA 1UKBA 5EN4A 3GO4A 1SXHA 4QVGA 4OJNA 1ATZA 3ZWBA 1OPRA 1FRFS 4PTZA 4Y6RA 2E0IA 3DDHA 1N33B 3TE6A 5FWAA 1RJEA 2X8LA 3TH5A 3JRNA 4JL6A 1FQOA 2JA2A 4ZALA 4BO5A 1Z3CA 1IFXA 1QZXA 4DNPA 3PIIA 5CEFA 2C8LA 1EM8A 1VHTA 1XKTA 2JIRA 1ZIDA 3LQKA 2PO7A 3BMNA 3SJ7A 2OO5C 3U4DA 4TVSA 4OSOA 1RQPA 2VO1A 1RJDA 4HXYA 3ZWNA 4PPGA 1QBGA 1V3UA 1JFVA 5ISMA 3K70B 1KFCB 1Z33A 1EFVB 1L1QA 4PLCA 4UVDA 2X0DA 4AO6A 2LXNA 3SBDA 1Z6QA 2JI8A 4O4LF 4BCCA 2I9PA 2R8PA 3KUXA 3O2NA 1XJCA 1EFKA 1S1MA 2IYAA 3OF5A 2ZDHA 2XNCA 1GHTA 1OWNA 4XGIA 3QEOA 5K8LA 4N5NA 1Z2PX 1PD1A 2ZCUA 3LM8A 2COEA 1THMA 3A0RB 2CMDA 5CB8A 1PGOA 3IERA 3K96A 3KFLA 3L07A 1J56A 3LVFO 4W7SA 4L16A 1EBUA 1UDBA 5EXPA 1I30A 3DZIA 1J06A 5FWDA 1X7GA 3GT4A 4OGLA 3FOWA 1SB8A 2IYWA 1Q57A 2Q1SA 3QWFA 4KIUA 4LE2A 2NU9B 3K1TA 1DINA 3KE8A 1NI5A 2WPNA 1LTKA 1E3WB 1IQRA 1TIBA 3KZVA 4GVLA 4BE9A 3CN9A 4RXUA 3Q0IA 4WK4B 3ZJYA 5AW2A 1US8B 2B4RO 3AV3A 3BIOA 4TS1A 4AXXA 4L57A 1M8PA 2E87A 2YOGA 1PJQA 3GPBA 2XMSA 2EKLA 3OTIA 1CJUC 5KB3A 3DTYA 1CZUA 5B1SA 2CNNA 4YP0A 3WWOA 4XUEA 4EENA 4FHDA 4KR7A 1R27A 2GJAA 1BMFA 3HLKA 4MIEA 4CM3A 1U9YA 5HEKA 1Z3IX 3IE0A 4UXIA 4V1CB 3FYUB 4KXNA 2HMUA 5IANA 3DKRA 5AJWA 2JHPA 4QT0A 1O9BA 3OIYA 4PW0A 1NPDA 2F7SA 2ZQ5A 4B0PA 3FTFA 5FTKA 1I4LD 2O1EA 5JI2E 1XTBA 2V7UA 3A4IA 5JARA 5IKXA 1EHCA 2C94A 4QWMA 4YGXB 2JHAA 3IQGX 1HTBA 2G5GX 2YZNA 3PUWA 3NHYA 3QKRB 4MP6A 2Q45A 4QFCA 4YAWA 4ZVQA 3V6LA 2C7PA 3CBGA 2V6FA 1CZRA 1VDZA 4B7UA 3A05A 3CX3A 3HDTA 4DDUA 5LVAA 4RY2A 3GDFA 3IB3A 4L4UA 2RGAA 1CYEA 2R00C 3ZV5A 4ND6A 1G2IA 2I76A 2IS4A 1IBKB 2ACKA 2VI5A 3KZOA 4F85A 2EQ5A 2EBWA 1BH6A 2OORC 3P9RA 3Q8XB 3LPCA 3QXGA 3V3KA 1JTVA 3EJWA 1Y7IA 5LLDA 2XXJA 4H35A 1V1MB 4K86A 2IXTA 4PG7A 2BE9A 3GNTA 4FMBB 3IAFA 4GYJA 5K8UA 3AFIA 5CJ2A 3HA3A 1UC5B 3PHLA 3UHJA 4UM8B 5KSYA 2WQ7A 2RGNC 1A2QA 1DEAA 5HBRA 3KVRA 4BQIA 4FFWA 1VHWA 2F1RA 4ES6A 4J07A 3K15A 4JI8B 2D0IA 1CUGA 1MO5A 1X9GA 3D6UA 4DEYA 1GTRA 2EXXA 5BV0A 1N78A 2QORA 2GCOA 6NULA 1GOTA 1W34A 3JR7A 3AL3A 1OILA 2GBGA 4ND2A 1NBHA 3R6GA 2PPVA 1U0GA 4P1ZA 4U7GA 1X2EA 2RHBA 2YJ3A 3FKQA 1F51E 5DSZA 1DCFA 1LQUA 1TKAA 4DPKA 1JILA 1Z18A 4O3FA 3WLHA 1YRBA 2G9ZA 2UZ1B 4OI1A 3VXKA 2ODEA 2XOXA 3JARA 2A9QA 4B80A 4CKEB 2WNIA 3GUHA 5BORA 5KNCA 3NHWA 5BNIA 1GTVA 4C30A 1GT6A 4HRVA 5DI3B 1XQWA 1AN0A 1XALA 2VUIB 4IL5A 4W5QA 2XHEA 1NP6A 4BNGA 5AKXA 4YV1A 1JHUA 2R6CA 3H1FA 4H6XA 3KLPX 5FUXA 3U7IA 4A23A 2GN0A 1DL5A 4PZUA 2XT6A 2VCYA 1VJGA 2V55B 5C8DA 2YWEA 5DXAA 2VAMA 2YC2C 1NW8A 3H8JA 2FY8A 4A0HA 3QW4B 4U3JA 1IB0A 3CR8A 3LT0A 2I3ZA 4BNMA 3JASB 1UF9A 3QUAA 4KSBA 2HSDA 4UEOA 3EBPA 4CIBA 2UZ1A 3LV8A 5FNVA 4JLMA 1I6LA 2PSJA 3AEXA 5B3JA 4HVCA 1ZIOA 1L7OA 4DUGD 4JSYA 5BSEA 3TL3A 3KZNA 3WMRA 2BEWB 3S8EA 1TO2E 2Y1GA 3PUZA 3G9XA 3UT5A 2WM8A 5ICSA 3MCWA 1NN1A 3MD0A 1OXUA 4ILEA 1Y7PA 4UAJA 2V9ZA 3HCEA 1FYVA 1E6EA 1LLQA 1OC4A 1R4NA 4M6WB 1IY1A 1KJYA 2GXQA 2GYYA 4N6GA 1LI4A 4RPCA 4QQKA 3T7CA 2X5NA 4C9BA 4JXKA 2IUFA 3JATB 4RMNA 2WYHA 3QF7A 4WEOA 4D0LB 3UH1A 4PHFA 2CY0A 4RV5A 4XVCA 3T1HB 2AN9A 4BMCA 4FGKA 5JPCA 2YYAA 5D3QA 2FWBA 2Z8XA 4J3NA 3LA6A 3MTDA 1S2LA 4F4UA 4RZIA 2Y6VA 3M83A 1SPXA 1SC9A 3EARA 3BMQB 4FKMA 3IOMA 4L72A 1DCTA 2P1RA 2BEWA 2D13A 4G1BA 1JNXX 2XCOA 1QHGA 4JJZA 4ZVNA 5CAEB 1IHDA 2QUAA 5JS2A 3O47A 1EDBA 2WLSA 3CBQA 3AR7A 3CE6A 3AVPA 1QLWA 1MG5A 1HE3A 4BNHA 3JQBA 5EUQB 5E7QA 1WHSB 5JZBA 3PEWA 4R8RA 3TE7A 1JB9A 3P9XA 2ISQA 1E6WA 5ALEA 1P0PA 3MWJA 4HOYA 4MEBA 4RLSA 3RSZA 1I3NA 3PR2B 1HT0A 2H2WA 4I46A 1F6BA 1YTLA 4ZQIA 4F3YA 1X7YB 4YP7A 1XF1A 1M2GA 4MR8A 2EWVA 4QD3A 3EVGA 3IPYA 5HKBA 1JLKA 2GZAA 2G9QA 2TMDA 5CYFA 2FVXA 3AR9A 4EJSA 2A9KA 4WWHA 4OHBA 2HUNA 3EUFA 4EQZA 3R24A 2O50A 3RV3A 1JLMA 2QLMA 3T7JA 1D0IA 1J8DA 4BS9A 4CMCA 1QX3A 4NMHA 4H9GA 4TLLB 3FYTA 1H5UA 2COKA 1E63A 5LBIA 3TQIA 1FDOA 1R5JA 3DZCA 3NORA 3I72A 4MV9A 5EGNA 1P4JA 1CUWA 2ZSJA 3ER6A 3RRNA 4F21A 4J16A 5ESRA 1SXJE 5ITZB 2ZJ4A 2IYYA 1DC3A 2BYTA 1WR8A 4C06A 2R1VB 4WKBA 3BULA 1OYYA 1PT5A 4Z0TA 2GF9A 5T3UA 3TLAA 1W85A 4EX7A 2IV3A 4TT3A 4YRTA 5DHSA 5L7WA 1X8KA 4LHEA 1HRDA 3NHSA 2HPHA 5KKAA 3CRW1 2NQ8A 1N9KA 2CDBA 1H93A 4HGYA 3QM1A 3PR1A 3N8DA 4LYDA 1UP4A 5CTJA 5A4JA 4M60A 4B6RA 5F4ZA 3OT5A 4CLEA 2BAGA 4DQLA 4EOGA 3BE6A 4AO8A 2F1IA 4LSGA 1NMYA 3BZUA 1VE9A 3P9CA 5BPHA 3MK31 4N1AA 3U60B 4PQEA 5NULA 3R6WA 4P32A 4CKWB 1RYEA 2W2VA 3G2MA 4S3MA 4UARA 2Q21A 3A3YA 2ZYUX 4II3A 4MR8B 5EPEA 4REMA 1TCVA 1BS9A 3JQCA 7MDHA 3K9FC 4FUQA 4FQ7A 3PHGA 4ETIA 4JASB 3VU8A 1F3LA 2QIPA 2TSYB 1GPAA 4JJEA 5KYYA 3L0YA 4EWLA 4CEHA 4FYYA 2Z04A 3QSGA 4I4IA 1TM2A 1Z68A 2J3QA 1G21A 1P2DA 4ZJZA 1DNPA 3E6AA 4ZQCB 3MBIA 3CVUA 2HGSA 3U4AA 1L7VC 1PL8A 1L5LA 1GU1A 1T15A 1UBRS 2C97A 3DONA 3OKFA 4I5EA 1SUPA 3LK6A 2O0KA 3NETA 5JSKA 2ZT6A 1KI9A 4LBYA 3KV1A 3OCCA 3OQIA 1GUZA 1F6DA 1GZUA 1WZNA 1S8FA 2IHVA 2OMEA 2JIMA 3BD8A 4GNKA 2O07A 2WVHA 5KC9A 4GS5A 2YZKA 4RPLA 5FQNA 3LXRA 2REQA 1BW9B 1UZUA 4E7PA 4DY6A 3KUDA 3BGVA 2CK3D 2RHCA 4IIHA 5LBUA 1M6VA 3N74A 3PXXA 4FOTA 4GAEA 4MIYA 4CM8A 4ZAVA 2EOAA 1P0QA 3ILYA 4K9DA 4M9QA 2G71A 4XWOA 2WFAA 1N6PA 2A86A 2HBZA 1FQWA 1XZIA 4HI0E 3L7YA 5ICEA 3UBMA 5LL6P 3JYPA 5G3ZA 1YB5A 4MRVA 6ADHA 2AOXA 1YE5A 5GMOA 2CB9A 3I1FA 4F86A 2FMHA 3GEGA 4QG7A 4RGYA 1TLLA 4I50F 1UQTA 4LAFA 1ZIPA 4K9NA 5EFOA 2XBMA 3VOSA 1GLVA 4E14A 2FQXA 4ETWA 4HXGA 1KYVA 1A7AA 2F64A 4HH3C 5LP6B 1UK8A 2AUNA 5ALZA 3GVIA 3FHJA 2R47A 1V3QE 4I50B 3EBLA 2O4UX 1FLVA 1P1IA 3HU3A 4G9BA 3EEBA 1SQ5A 5J2UB 3UK6A 3BZWA 3R5KA 1PFWA 1Z29A 2QD3A 4KYVA 4P3XA 5JO0A 5GZ3A 4LHXA 4CMKA 1RS0A 3IAM6 1WB4A 4WEQA 2FPLA 5FR1A 3OZDA 2OM6A 5JWHA 4JV5B 4FFDA 4G8CA 1MEOA 4LDNA 2KQUA 3DDCA 4KLCA 4R16A 5HF9A 1I4EB 1X3SA 2XKJE 3K4HA 3ZHTA 3MTIA 4RORA 4TXLA 4HG2A 4F91B 5AYVA 3R09A 1QJCA 1GU7A 4WERA 1YJAA 2DC1A 2JAWA 4D44A 3E1GA 3KQSA 4OBBA 2A33A 2X4LA 1ST2A 3H5VA 4DPMA 4HPJB 3F74A 3H75A 2AX3A 3EULA 3GD5A 2H52A 2G0AA 1VI5A 2HU2A 2QUHA 3L1HA 4X45A 5EERA 1DQRA 1DCKA 2J3DA 3V8MA 1OBHA 3I0NA 4RTOA 3EEOA 3ZHRA 3AVTA 4PXAA 1O96A 3OBIA 3ZU2A 3FB1A 2PUTA 3H4TA 5LQDA 3ZJ4A 1UL1X 5E3HA 4MV0A 3H5AA 2ZYSA 3UQZA 2HPVA 1EJBA 3CNLA 3ER8A 2WQZA 1T5DX 1HRKA 1PUIA 2H5IA 4XFKA 3R1IA 5EFZA 4ACAA 1PVOA 4TTVA 4GYWA 3S0JA 4CKYA 4MPDA 1AKNA 4E12A 3BICA 4PGHA 4PSVA 4EFDA 4XFJA 5D3KA 3U3MA 5IDYA 1COWD 2JKYA 1J22A 1QH1B 5KYNA 1ISHA 2RBEA 3HZHA 2M32A 1DB3A 2INGX 3O8RA 2PUGA 4DA4A 1NAHA 1RC0A 4L8VA 4E5PA 2WV7A 3EVEA 3ZGZA 2FAXA 3CA8A 3JY6A 1D4OA 4ALMA 1S2OA 4N5MA 2QTNA 3D6JA 1BN6A 2JKVA 4RL4A 1H5QA 1GL3A 2A2ZA 3TTUA 4ZCRA 4L8LA 2W2NA 2WUGA 4AF6A 5AVRA 3TX2A 1VZ2A 1R1DA 1U2PA 2BFCB 3V3TA 3C8HA 3H4VA 4M1EA 1KMIY 5JAZA 2XRZA 4ID3A 4TZ0A 2JANA 1P5JA 2ZR0A 1GYQA 3SKXA 4A92A 4QJBA 2J6HA 5H0IA 4AP5A 3EZXA 1M6EX 4X90A 5FL7D 1SJ9A 1SY7A 2LBPA 2J3IA 4W1RA 4DARA 3O4FA 4M49A 1ECFA 1PTKA 3Q5EA 4BO0A 5K09A 4JYAB 2GMWA 3ASZA 3ZH9B 1N8TA 3AR4A 1XDSA 2YJGA 1OTHA 4ZVRA 3O8CA 1OFHA 2CD7A 5IYZB 4XWGA 4RHTA 1JSRA 4R41A 2AR0A 3DP7A 3VJKA 1UP7A 2QTWB 2X9NA 3FRIA 2Z9CA 1EP3B 2ZWIA 1SKBA 3OIWA 3HVKA 2AB0A 3AEQA 5HM6A 3WK4A 1EXDA 2UVDA 4D3ZA 4KH0A 3DV2A 2I55A 4QSHA 3DDSA 3KAJA 4WLFA 1SVMA 3BXOA 5SICE 1QO9A 2ZFUA 1OYWA 3K5WA 4EYKA 3ZD7A 3MRXA 4O4IB 4LC9A 2G25A 2WNHA 1DZIA 1PEAA 3BD9A 3C5WP 2ANCA 4B34A 2HDNB 2BWJA 1NN5A 2B8WA 2K7ZA 4FDVA 5KAPA 3W0LB 1NC1A 1QX4A 2ZWOA 5L95A 3EGOA 3GLFE 4V38A 3T3EA 2OV1A 3TPZA 3D4BA 2EYQA 3RFCA 2NN3C 3GA7A 4UREA 4LWQA 2Y67A 1Q11A 3WZ2A 4MITA 4R1QA 1U3WA 2ZYRA 3EZNA 3H9BA 3BH6A 3KPVA 4IAOA 2IDMA 3HXTA 3JV7A 5C5CA 1JTFA 4JWTA 3MAAC 3HPQA 4IDEA 4JT4A 3KOZA 2PH5A 3GP5A 2BCGY 2RJOA 3NDJA 1OU4A 3C45A 3L8GA 4LF6B 1IPFA 4Y2YA 2QTGA 1Y3BE 4B8ZA 3G17A 3RREA 1SFRA 1FDTA 3OE7D 1HUQA 1KSJA 1HFKA 2PGJA 4C01A 1LC0A 3L6EA 4R2IA 1V71A 3PUKA 4IRMA 4RADA 4H1UA 4YNBA 3LUHA 5IYZF 3E05A 5K0LA 2UYQA 4ZEMA 5BOSA 3A4YA 2R25B 4OH7A 4W4TA 3TPFA 2IPLA 4PQFA 4TLCA 2I8LA 3B82A 3I4LA 3ZQJA 3LPDA 3GUVA 1NW7A 3ZWVA 3AZOA 3QV1A 3RS9A 3B6KA 1Z4PX 2Q1TA 3CU5A 5HZMA 2J0UA 2XGSA 3E70C 4YJHB 1QP8A 3NT5A 5JD5A 4CTKA 3CNOA 1U8TA 1MQ9A 2HM7A 3BEDA 3D0RA 1NV9A 1M0SA 3EOAI 3N86A 5KWJA 3PDUA 4L75A 1YH3A 4UUOA 2DMRA 1V11A 4WCFC 3U09A 2Q3HA 3ON5A 2F1JA 2OR3A 3QMMA 2IEAA 2RGCA 3D02A 4GX2A 2BEVA 5EZYB 4YWHA 2EQAA 1HOXA 3LI2A 5A1JA 1SQFA 2ZIXA 4XYEA 5L3ZA 5LMZA 4J0FA 4Q03A 4YTEA 1QFSA 1C3JA 4S0ZA 2JDIA 2V6JA 4GT1A 2QD2A 4MX8A 521PA 4LYGA 5LQRA 3KETA 4JHLA 3CNNA 3TF5A 3FVQA 3QI2A 5AJYA 3RIHA 2BCEA 4M9CA 1KE1A 1U2GA 1UFVA 4M54A 2D1QA 1KY3A 2A9JA 4M21A 4RBNA 3C43A 2AVDA 3L8MA 4WOBA 2FEMA 4JJGA 4AKEA 1CYDA 2W43A 3P26A 1ZJ6A 2BDUA 1A96A 3GRYA 1E2PA 3IV6A 3KR9A 4W8GA 4Y6LA 4EHDA 1E1CB 1Q0PA 1ID8A 1KK1A 3STVA 5ELLA 4JELA 2YXPX 4IOKA 4OQEA 4MJXA 1MEJA 3JZFA 3L0CA 1DIOB 3FFWA 4IHJA 1LRKA 4RIEA 3OQ6A 5E3IA 1W9HA 3I05A 2C5HA 2QZSA 3TQTA 2XA9A 5JH7F 1N5OX 5KOIA 2FNAA 5BUCA 4BQPA 3LPAA 3RHFA 1A7KA 1H2HA 1OAKA 1J8YF 3ORHA 2R5FA 1D6NA 3LFHA 3ORSA 4JVLA 2R7KA 4ZCMA 1JXAA 5IMSA 2CF5A 2BDEA 1AG9A 2F43B 3ICOA 3L49A 4GPAA 1GG5A 3WLLA 5ILOA 5EIAA 1AU9A 4O59O 3O82A 1ITZA 1YCGA 4LTNA 3SPXA 2AC2A 1X94A 5JNTA 2QF7A 4NENB 5D8DA 5AMXA 5K0ZA 3AVUA 1YF3A 4EYEA 1CVIA 2V74B 4K9PA 1UDAA 4RK7A 2HD4A 4HWKA 4OG2A 1TK2A 2ACWA 1ZW6A 2XD9A 2JHGA 4FZJA 1GFSA 1F2UA 1GD1O 3KSBC 4FWBA 4KE6A 3FY4A 4YS6A 5FIUA 4ER7A 4HL6A 3VO9A 3GLGA 2G77B 4E03A 4PYRA 5ES4B 1WHTB 1B00A 3O73A 3V2GA 4LJ5A 4D8XA 3VKUA 2V0CA 3FGPA 4OM8A 1NLZA 2PSHA 1L7MA 1MB9A 1NHGA 1R5OA 1RHJA 5EMMA 2H1OA 3OU6A 3K35A 3AEZA 3WI7A 4RZ2A 1UXHA 3BB3A 3COSA 4A8JC 4DVGA 1W0JD 3B2EA 3L8EA 3FCEA 3DDNA 1C9MA 4P7BA 5HKLA 4DCSA 1AK2A 3AK4A 5ADWA 3VV3A 4WVLA 1SKMA 1QO0A 1KU6A 5KQGA 2IZ6A 1D2MA 3AEKA 3IUNA 4YASA 4HAXA 5KOHA 3BCRA 4K0KB 1W2WB 1BD3A 2D5BA 1E9SA 1F2UB 3IMGA 1C8VB 1GXSB 1AZWA 3PF8A 4M7PA 3GN2A 5CM8B 3N6VA 3L93A 2IY8A 5KSWB 3IHTA 2YYZA 1ZRHA 1KDOA 4GPZA 1LX7A 2XYPA 4RD2A 5FLKA 3SQWA 3R6TA 2HLDA 2FXIA 2PAAA 5JO9A 5YASA 3UZUA 2X4DA 2HMVA 4KMRA 5ALUA 1ZDMA 4MVJA 3RS0A 4FFBB 1S9HA 1RVDA 4G4SP 3V7UA 1PDOA 1PQYA 1M34B 3F3SA 4IUCS 2C2XA 4MULA 3QHQA 1TUEA 3CLRD 3OPQA 4IF6A 4C5BA 4A73A 5CFMA 2KMLA 3DEAA 3RO7A 1H1DA 4YUXA 5JJKA 1B76A 5ALNA 5F1YA 1NJ1A 1TZKA 4KQGA 4XARA 5FEMA 1AO3A 4R9NA 1E5XA 4FX2A 2EDCA 2QMOA 2XTMA 1KNXA 1F2DA 3AG6A 4Y2UA 2ZBEA 2WJVA 4YC7A 2UZ0A 2MINB 4UCWA 4K8OA 3IESA 4LNUB 2FLVA 4U9IS 4ARIA 1FSZA 2VPZA 3EHEA 4YI5A 1KO7A 3W77A 1YRYE 4D9NA 3CPHA 1ZHHA 1PGQA 3HN2A 1SIOA 4LJYA 2CUKA 3V5NA 4JOBA 1B6SA 1TKBA 1CB7A 1XZGA 1Z5ZA 1DXQA 2WICA 2I22A 2C4MA 2XVZA 2ALJA 2PFSA 1IQ0A 3QK7A 4REQB 4EHHA 1A5TA 3UK2A 3UWKA 3V1UA 2YVQA 3F8SA 3NHAA 1UADA 1BA3A 3TOCA 3W78A 4OQFA 821PA 1AKMA 5CHYA 1BAPA 1OROA 3OZCA 5B3JC 3E3NA 1CTQA 3JARB 1PT8A 2AEEA 2RK6A 5C7IO 4UQLA 1U3DA 2GAJA 2AZMA 1MB3A 5I7VA 5TX7A 3COWA 5EJFA 2GN6A 2QZ4A 2PQMA 4PFKA 1HSOA 3N2IA 3L46A 3MXOA 4AVYA 4A8TA 4AQYB 4M9UA 3PFNA 1BRMA 4KV9A 1GNRA 2BIFA 3NTQA 3SBXA 4O3MA 1WD5A 2FSVA 1QKJA 3NHBA 3PEVA 4L85A 4TMXA 1RYHA 5CVVA 5IN5A 7GPBA 2H7YA 4PQYA 1NMXA 1QNLA 4Z5XA 1N6LA 2WA1A 4RF4A 1U31A 1MC5A 1JLSA 4JBIA 3MUEA 3A6GA 1YFKA 2G36A 3LHDA 3FRJA 2VZ8A 2YW9A 1GPWB 2C96A 4NBKA 4DSAA 1KF0A 4FKZA 2D1RA 4MWDA 2QS9A 1XL0A 1ZL2A 4B3SB 1N5RA 3CW2A 3RR2A 2QGFA 2C5GA 2WT9A 1EGQA 3L7NA 3UPUA 2PX0A 4X85A 3R5TA 4BNUA 3O4JA 3ZKAA 3RUCA 1ES9A 2HHCA 3HNOA 4H60A 3NTLA 4D5EA 3FGOA 3W34A 1FPMA 4JGGA 4GZ6A 5IJXA 3CS3A 1NA5A 2B1QA 1A77A 1PUJA 2VLIA 4Z2AA 3IYLW 1O77A 5FOUA 1QP4A 2EJCA 3Q5GA 1C1DB 1KBOA 2H1CA 3KP1A 5CX1B 4CTOA 4EF4A 5B4UA 1U90A 2EVWX 3VSAA 1WWKA 1CKEA 3B1YA 2XVMA 1H1LB 3HZZA 4J3FA 4BC0A 5AHWA 2YXBA 3M4XA 2ISSD 5B3KA 4LHSA 3SU8A 4YO7A 2JGDA 3S2YA 2O8EB 3R7WA 1YL5A 3AU8A 5I7SA 2FSFA 1OX5A 2XLBA 1H6BA 2IYLD 4ZP1A 1ZCBA 1ZO8A 1YQQA 3SBOA 1QAMA 3PS9A 4RD3A 3ZI4A 2NQ2C 3SD7A 1NJGA 5IABA 3HKDB 3ZGYA 5FWXA 4DQ0A 2W8ZA 4Q0MA 3NGXA 3BCHA 4HYTA 1VGQA 4B6EA 1NIPA 1Q1QA 3I12A 2Z83A 5JPIA 1TNDA 1P77A 1QYIA 1A2KC 3A6HA 4ZYVA 1EUDB 4G1VA 3OOYA 5L53A 3JWHA 2H2FA 3C1TA 4HDCA 3OCXA 4ZVSA 2EBFX 2QGNA 1C8LA 1KMHA 1YD7A 3FNFA 2GA9A 4PE5B 3C97A 3A1WA 4MAAA 1Z5WA 2ZM6B 3L41A 1WZ2A 2ODBA 3GLTA 4UDXX 3BK2A 1VKRA 3C4VA 1ONBA 4JR1A 5AR1A 5B7QA 2EKZA 1Z4NA 4JP1A 1QK5A 4OP1A 1PYOA 4OA8A 2WTAA 2QDKA 1C0KA 2R66A 1CEEA 1D2RA 1SXIA 1G8PA 2D5CA 2OHGA 4GLBA 1HMYA 4LY6A 5LOVA 5DCYA 3C5EA 1BDMA 3VKGA 1C41A 3T5DA 4ADSG 4BNDA 4LDRA 1NJ6A 5JNWA 3A9SA 1FMJA 2WIFA 1E8NA 1E3WA 2AFIA 3DXZA 2IELA 2JL1A 4J03A 4PX3A 1IRIA 3D81A 1CV2A 4NYJR 1J0EA 1KK3A 3NEJA 3OE5A 1MB4A 4OHUA 2GBFA 1TVCA 1UWLA 1YIOA 4YPFA 4E4TA 3QU7A 3G2OA 4EFKA 2XB2A 4JI3B 2BGLA 5BXYA 3U6KA 3NAMA 3PF9A 4ICIA 5SZHB 2QPOA 1E5QA 4WESA 1G5PA 3U49A 3I64A 3HABA 5IKMA 3PI6A 3NO4A 4NS4A 3BJRA 1TT5B 3QE0A 5B1YA 3E9YA 5HCNA 4YV2A 5FBHA 4PG6A 3NH9A 2N75A 4ZYUA 4HEA1 5A03A 4RM2A 4C20A 3D2LA 3IIJA 4J4HA 2NUPA 3FWYA 3IO5A 5FTMA 4M1TA 2RHHA 2VSQA 5AHRA 1P9WA 3OKCA 1AHIA 3BXEA 4OBXA 3OIUA 4GBGA 1UPCA 1ZY2A 1IAVA 3GGGA 3RC8A 3OQJA 5J4KA 1II9A 3CVVA 4PYMA 2CNLA 1JALA 3FWPA 4F1WA 5JSZA 4N9QA 2FSIA 1Y8CA 2DR3A 4PHTA 2IHBA 1G4UR 2ZJ3A 3EGEA 3L7KA 4GF5A 5G1NA 3B85A 5H4GA 4M0CA 1IM2A 3OETA 2CGEA 3IVAA 1HL3A 4PX5A 3BWBA 5IW8A 4MCJA 3RVNA 2Y0DA 3UMSA 4HDSB 4YRZA 1U0LA 5CNKA 3R9XA 5C52B 1IN1A 1IN8A 5DGDA 3MG9A 1TM7E 2VHCA 4YRJA 4AX4A 4ESEA 2QU7A 1G19A 2JIOA 1PEKE 5CM2Z 4D4GA 1WA5A 3BA6A 4PYKA 1P0CA 4RYLA 2VRCD 2C3UA 3KS9A 4PLWA 1KTIA 2FUG1 4KN8A 4MQ6A 1K92A 4UDYX 5IJZA 5H81A 5JY6A 1L8OA 3QLJA 1NJ5A 4DUPA 1NRIA 3SSNA 2ZCVA 4L51A 5K8JB 3ZGLA 1M76A 1O03A 3PNOA 2O3TA 1DQZA 3KZMA 4N0DA 4P4LA 4AK9A 3KQUA 5KQPA 3AP1A 5B4VA 2G82A 2XD4A 3JVIA 4F6RA 2VEDA 3DQPA 1GZ3A 2PS9A 3ZOKA 3MWLA 4RK0A 1ESMA 3HUEA 3KKEA 4ZI5A 1KOLA 1A8IA 2PUEA 1TQ6A 3ETJA 3OX1A 4KWIA 2C83A 5KCZA 2O7RA 5GZ1A 1N4AA 4TV8A 4QOIA 1L5MA 3DXXA 1XOIA 3K6KA 1ZQ9A 5FCDA 2PFKA 2EF1A 2NT3A 3MUFA 1IU9A 1Q7BA 2VQSA 3GFSA 3ND9A 4OHCA 3V80A 2Q2VA 2BFDA 4Z1MA 3U3KA 4ASUD 3DPSA 2RGDA 3BQ9A 1JHQA 3E9CA 1XELA 3MPUA 4WA7A 5EJGA 4C03A 2FR8C 2GPTA 3FFAA 3CRMA 3MPOA 2IXBA 3PRYA 3PQ6A 2PX6A 2JIDA 4CRWB 2WTXA 2WHXA 3CM0A 3EFBA 1JTEA 3O8OB 3WGGA 3KYIB 5K0FA 3ICWA 3NHFA 3WG9A 3TNFA 3A26A 4U3JB 1UAAA 4AMYA 4RVSA 4RH0A 1PK8A 2BY4A 3R7AA 5ALKA 1ZG3A 1XTPA 3N2NA 3ISJA 2OCGA 2CL5A 4LZWA 4R2XA 2VZ0A 1Y48E 2GXSA 4B44A 5LM3A 1XKLA 1OYVA 1O94D 1IJBA 4IDBA 1ZHFA 1M8KA 4U9HS 4UMDA 2XUZA 3H3FA 8ATCA 3ZW9A 2O59A 2HK9A 3CRZA 5K3FB 4G0ZA 5MGNA 2MMCA 3P0IA 1CDDA 4IDHA 3H5LA 2OL4A 3CURA 3NI2A 4KI7A 3T94A 3WX0A 3ZQKA 1NUPA 1J8MF 2QI9C 4QJ4A 1GLGA 1YTUA 4E46A 1PVDA 3KJQA 1YJQA 3NBYC 1V1MA 1MDFA 4HDOB 4I66A 4RX1A 5CLGA 1RWBA 4TLAA 4DLRA 4X54A 1BZYA 2OO5A 4KODA 4L78A 1ZXLA 2H1VA 1M2EA 4G84A 4WZZA 5DE3A 4CQMD 1K68A 2PD4A 1Y8RB 4L2IB 2O6LA 1KEPA 1PS9A 4JIMA 2PMEA 4URFA 1I10A 1EFUA 1NY6A 1OCEA 3KHKA 1XDDA 4FNMA 3IOCA 5L3QA 1UJBA 4V2UA 4B9AA 4Z4FA 3REQA 1V37A 4DIBA 3IE1A 1ZGZA 3NJRA 2OB1A 4JT8A 1Z07A 1ND5A 3KVVA 5DHFA 4ARSA 1WCIA 4MZXA 5FA6A 4CIDA 4Z7NB 2QKYA 3ZZUA 2QYOA 2YWFA 5HF6A 2JVIA 3F9IA 2NGRA 2C3YA 2P2LA 4BKQA 2TMKA 2D2VA 3N8HA 3M3DA 5EWJB 1NE2A 1V5GA 3O5AA 4G25A 2EKBA 3IAHA 3NP9A 1KSGA 3OPMA 2EEPA 1LH0A 2HSJA 3IUMA 4TTAA 4MYDA 3UY4A 4C4ZA 1EVYA 2PLNA 4JAVC 2R1ZA 3DL0A 3EGVA 4EJMA 5IZ4A 2BM0A 1CDZA 1Z6XA 2NIPA 4FZ3A 4LXXA 2ONJA 2HREA 4BV3A 5FX2A 3FOFC 2YUTA 4HCJA 1BCSB 1HPLA 1U2QA 2QP4A 3DCJA 3DFUA 1DKUA 5FPQA 4OGWA 3OLXA 2Q9BA 2BFEA 4MICA 1KAQA 3DNFA 4C7VA 3RHTA 1T0BA 4KXQA 4KXUA 1B8PA 1W29A 3PD0A 1J97A 2YN2A 4KGZA 4JBNA 4TMFA 5LXTF 3QVJA 3VYSB 4DA9A 4H16A 1UMKA 1GCAA 2XYRA 3X1WA 4IGFA 1EVZA 4KQ1A 2HSZA 5IF3A 4QRIA 3SQDA 2QUJA 3N70A 4OPMA 1HOTA 4J0EA 4PPQA 3UVEA 3NWPA 4EPXA 4TWZA 5M04A 1JG3A 2DH6A 1F9AA 4O2AA 5CPFA 2YV2A 1NRXA 2OHVA 3NHPA 1PW7A 3U4HA 2JBHA 2R751 4R2MA 4YRMA 3VYVA 5BVHB 1XGKA 3JYNA 1FFYA 3TZEA 3GCXA 2J5BA 1RWKA 5JAOA 1HT2E 2AQ8A 3B5EA 5FR2A 4P0TA 4RCZA 4IIGA 4XIGS 1B0UA 2JZNA 1BC5A 1I2BA 4FEYA 1X1EA 1L6IA 1GPH1 3IC5A 4I2NA 2NUTA 3KEMA 3ZXIA 4ER0A 2Y76A 1HGXA 2Q2NA 2FQYA 4NP6A 3SS9X 2WT8A 1DBWA 3VTFA 3OUUA 4MW5A 1D2HA 1YONA 4IP0A 4F3CA 5IUNC 3D7RA 3HJRA 3PKIA 1F38A 2N1MA 2FOLA 5H80A 4HUQA 4NV0A 4A6XA 3AB3A 1NNI1 2DPMA 1XEWX 3A6PC 1D3AA 3PQ2A 3BD6A 4AY6A 2XRFA 3L4SO 6GPBA 4JROA 4IWYA 3K0BA 2FPIB 3OEHD 2NYUA 3PQ4A 4NR0A 1ZGAA 3F98A 1O5IA 4P82A 5AW0A 5KYXA 3W05A 4E2YA 1XMJA 1LDYA 4BLVA 4TZTA 4BN0A 2GXUA 1IXKA 3FTEA 2PGOA 1KYZA 4NESA 1NBWB 2Q2WA 5DM60 4C7JA 2D2IA 5MFZA 2P11A 5ALYA 4RC9A 1ZLXA 1L2TA 2P5SA 1UMDB 3I6YA 4TKMA 3L7CA 4GXRA 4F8YA 1UXIA 1RHUA 2VH1A 5ILQA 2Q0QA 2F8LA 3GQBA 3HCWA 3WWEA 4MEAA 3MTBA 1SK8A 3NT2A 3K7EA 3DAGA 4AS1A 2ECPA 4FGJA 2WILA 1CETA 5BQXA 4U02A 4BVKA 4MB2A 4QRDA 3QELA 4LZAA 1NXSA 3AR8A 4R84A 1ZJZA 4FLMA 4KOAA 4QOHA 4R31A 3EB9A 1TCAA 2NUAB 3W6UA 1YDMA 1Z56C 3QLUA 3VH1A 1C3VA 3KUKA 4GM0A 4IRUB 4NMXB 3N53A 3PA8A 1EAMA 2FZWA 2GVZC 4L02A 2BTQB 3OUZA 1P8AA 5HFNA 3W5IA 5BQFA 1SCNE 2XVXA 3TQRA 1A9PA 1VXOA 2WF9A 2XZLA 1V48A 1Y5RA 1LY1A 4E21A 4KTTE 1J24A 2JFUA 4H1HA 4G37A 2HF7A 3D7NA 1VHLA 4CTJA 3HGMA 4DSOA 4C14A 2A58A 2HXSA 5HPYB 5BW5A 1AUPA 3E27A 3LOPA 5GVRA 4D2IA 1I6WA 3WFIA 4DUZB 3AF3A 1JAYA 5AKIA 2OGZA 1IN6A 1YQTA 1XKXA 4MYHA 5K99A 1CY2A 2VDKB 4YUAA 1NNUA 3AJ9A 1NMQA 4CV3A 1Y8ZA 5HK8A 4G5QA 3V42A 4KQHA 1G38A 1N8KA 3K6RA 1BROA 4KQFA 4XWAA 5CB6A 1LPOA 3P9QA 4D25A 3KYJB 4AJPA 1NASA 4GLFA 1UKVY 1Z4LA 2REOA 2B35A 1LCIA 3H2ZA 3LFUA 3ORRA 4N65A 2LNDA 2ZROA 1KZ1A 4X93A 3Q9LA 2H07A 3KVYA 4Q66C 2W2KA 4NZNA 2ORIA 4V0NA 4BJ5A 3FVRA 1L5QA 1Z2EA 4LS3A 2X58A 2O0JA 1H3EA 4GUDA 3QQ5A 2VDRB 2REXB 3QHPA 2XHZA 1EX7A 2HXGA 4B2LA 4LSMA 4EKIA 1DKOA 5DK6A 5F2NA 1YHYA 4MKIA 1FFDA 1Z0SA 1WKCA 5HIAA 1KJ8A 4B09A 1BA2A 4YMVA 4RNDB 1N1EA 1PT7A 1ZD9A 3AFHA 2OCYC 4YBRA 2NU7A 1J1UA 4B6OA 2VWGA 3QTLA 1XAIA 1VP9A 2GLTA 1WUHS 3FJ1A 4QYTA 4TRRA 1Z7YA 4NPHA 2AEJA 3SC4A 3EGIA 4LOHA 5MN6A 5T6MA 3QVWA 1D2NA 1KVQA 1UBFA 1OX6A 3A31A 1R8XA 3DPUA 3JW8A 3TSYA 3WMEA 4N01A 3URMA 2BGIA 3DAYA 1NLUA 5DNDA 1SVSA 4CE6A 1QM5A 1EFPB 3N05A 3OM9A 2P9BA 4DTCA 2FP3A 2WAYA 3NKFA 4OXXA 2KPOA 2BMDA 4G4SO 3IPAA 4E94A 3GY0A 3CLUC 1P2GA 4RKRA 3UEOA 2FHPA 4IIVA 1J7JA 1XTVA 2DU8A 1WNFA 2XY4A 3I6ZA 3N6XA 2H11A 4LMBA 4OAQA 1YZFA 3RTDA 4JVOA 1C0PA 4R4JA 2I4IA 5TQ0A 2O2EA 1EFAA 3IP5A 4O4HB 2CW5A 2JFGA 1A9OA 3KKQA 1QIHA 1RRVA 2QTVB 3A1NA 4NOKA 1SBNE 4WFIA 3TVTA 3UWMA 3I53A 1R6UA 3H4MA 4J16C 4C7BA 2H3HA 5KQSA 3MW8A 2SECE 4PX2A 2QTLA 1QE0A 2O2YA 2RC6A 4K2HA 2OY0A 1VGRA 3DG9A 1VCOA 2E3JA 2WPDD 1FL9A 1T9CA 2VXBA 2HLHA 2ZPAA 3MMZA 3QA9A 4EG0A 1UMCA 3Q7PA 1SCJA 3BG5A 4KZKA 1ZXXA 4P53A 2IOQA 4F6LA 3A27A 1UBSB 1RJ9B 1TM3E 3UHAA 5HUHA 2UVPA 1ZN7A 3L7BA 2J9RA 4M37A 1CNFA 4DN6A 1SZDA 4EQ6A 3SQNA 1YOBA 3LPLA 3F67A 4CNBA 1P1RA 2R44A 1JDVA 3KDSE 3JAWA 4HATA 4ZAYA 4PVDA 4QFBA 2PTHA 3CUYA 4XUCA 4MV5A 5H7XA 3MCTA 1IWPB 1B0PA 1NW5A 1U1FA 2W2TA 3GRVA 3JASA 3LCVB 1JVSA 4DWJA 5CA0F 5KJ6A 3AEQB 4M7OA 4W6ZA 3F5MA 2W37A 2XOEA 5I7OA 1D0SA 3NBAA 2FZKA 3PHCA 4GXTA 5G02A 4JQOA 1P62B 5AVVA 4Z6KA 1M66A 1SHJA 4Y8VA 1P72A 4RKYA 1RQ2A 2N42A 3I6QA 3OCUA 3T1OA 4N3NA 3VR3A 5K3EA 3TTSA 4UBLA 4KN6A 2OGUA 2Y6UA 3R3ZA 1BD4A 4RL6A 2Q6KA 4JP5A 4RS4A 4PQRA 5EUBA 1GSIA 3QVXA 4OOEA 3R0QA 4DIMA 1WEHA 3W8EA 1NW3A 3FR8A 3RU3A 1N8NA 1AIPA 5DHPA 2VDJA 3U0BA 4DGQA 3LMKA 5IVDA 4L8FA 1FCJA 3ESXA 4G5SA 4TKUA 2I5PO 2V96A 5KWIA 1K66A 1QOPB 2CMGA 2CFOA 3QWBA 2AW3A 1ADFA 2DT5A 2VP9A 1E1QA 3IA7A 3FNEA 3IHWA 2EW2A 1OFGA 2MSKA 3JQ9C 4IIXA 1Y4DE 2C2MA 2BKLA 1JQKA 2JI4A 2OXEA 1BSVA 2PT9A 2ZSEA 3BXHA 2C9BA 4LQCA 3REOA 3W1WA 4B1FA 1E59A 2GBLA 2Z2YA 3HI4A 4KSCA 5B6IA 2FPMA 2Y1CA 6ABPA 4OX9B 1HNWB 2I3DA 1O8CA 1DAEA 1T5OA 3DXFA 3GU3A 4JUDX 3EIWA 2Q5QA 1N57A 4M0MA 4ZQEA 5TQJA 2WSYB 2RHLA 3D43A 3ZV4A 2Z2KA 5KJ1A 3KD3A 1CHNA 4QGGA 3S68A 3UWOA 4J90A 4ZEXA 4BV2A 1QFZA 1DPGA 5KINB 2OEPA 2PKQO 5EXSA 2HWWA 2C4KA 3EQ8A 5CBPA 1Z45A 1ZONA 4IWXA 1KIFA 2EATA 4EITA 1E8DA 2EZ9A 5HCUA 1AKYA 2P4SA 2LDXA 3KHUA 4DCOA 2PJDA 4KNVA 3ZBUA 1PG0A 5ALPA 1C50A 2PWAA 2ZYGA 4HEHA 4Z9XA 1LNQA 1DO8A 1PBTA 3CSDA 2QN1A 3H8SA 5ALQA 2CWDA 4FWIB 3CC8A 4LMPA 1JU3A 2VKTA 3FNIA 3TLBA 1QTIA 3NVAA 1JI0A 4BO8A 3STTA 4OHZA 2PV0A 5EZYA 5HS4A 2F59A 2HA6A 4TTJA 5BQOA 3WRXC 4H6VA 4ETNA 1BYUA 3EE6A 2XDAA 2ZQYA 1W76A 4P22A 4YRFA 4BBZA 2WDZA 3T4EA 2AG8A 3JD3A 5HFJA 4WY2A 2OWDA 4MYTA 1V16A 3QQPA 5JYBA 1P5ZB 3H2YA 4CQMA 4HLNA 5D5QA 2PMFA 3KQMA 5BVGB 2NSYA 1K4MA 1O3YA 3JTMA 3WJ7A 5AVUA 1KOJA 2YC4C 1RIFA 1RBZA 3HV0A 1PLKA 2HV8A 3CT4A 3ELWA 4JSRA 3BIFA 3IEUA 2WSLA 1FFCA 3O91A 2XODA 4XDYA 3U31A 4C0HA 3FTDA 4MQEA 3AL0C 1YNOA 3BRWA 4F93B 2QJOA 4NE2A 4NLLA 3CO5A 4RDIA 4MUKA 2LDBA 3ACCA 2A9FA 3VR6D 1C7QA 4CCSA 4U00A 2EEZA 2N3ZA 1PHPA 1SUSA 3U3RA 4TS9A 3R0XA 5L3SA 4Y2XA 1XNQB 4BZPA 1YS1X 1P4SA 5EQTA 4UZFA 2VPPA 2P65A 2OENG 3KQHA 3G9TA 1U2GC 2OGWA 2QQ0A 2ZUVA 4QHSA 3RVLA 4FSHA 1YVUA 3N58A 2JGNA 1J25A 2HU8A 2VHYA 1JKFA 3ZZ1A 2OBMA 1U8ZA 1JWBB 1FNNA 3X2FA 3RFTA 5U4QA 5FPKA 1TCBA 1K7CA 1NG1A 1GZHB 1NR1A 2AD5A 1C7IA 3I9KA 1NFFA 1YQGA 3IQHX 4PZ0A 4J0HA 3HDHA 1MRZA 2HJWA 3FD8A 4LRWA 4RIGA 5ENVA 1SIUA 1GL9B 4EX6A 1BNCA 2TMGA 3O8LA 4GPEA 1X77A 3JSAA 1M1NA 5E7IA 3ZDAA 3EZLA 3EYAA 1GKIA 1YQXA 1PEDA 3EMBA 3GJSA 2OVBA 4OATA 5DWQA 4BTLA 2ZPTX 5BWMA 4U7DA 1KBZA 3WK5A 5IBCA 2VTKA 3MSCA 2QL9A 3ZLUA 2PA3A 5CFNA 2R1UA 1KVSA 2IU4A 1GV0A 1T4BA 3RT1A 4XX0B 4BOYA 1T6ZA 3T9FA 2UYCA 2CN1A 4QFDA 3SF8A 2HYDA 3CLUD 1AQJA 3H1PA 1NXPA 3BGWA 5JZMA 4IM7A 5IHXA 1ODLA 3DMRA 1HURA 4TMTA 4XGQA 2IBSA 1K27A 4XDZA 2YS6A 5F2EA 3UK1A 4M9RA 5U9CA 4RTPA 2WHQA 4IOLA 4JJ4A 4IJUA 1AGRA 4FR0A 3M4JA 1CC1S 1GPJA 1ZITA 2ERXA 3LX4A 1TMGE 2OV6A 3GYBA 3FNQA 3HA2A 4QEDA 4WK6A 4BJ6A 2ZP1A 4DG8A 3SOZA 3PXCX 4B6SA 4A2QA 1WVMA 2IDZA 3DBHB 1JFRA 1VYHA 1UBNA 1KYWA 3IBGA 4JP3A 1KWKA 4HLDA 4PPFA 5FPYA 2KLBA 2W6QA 4M9XA 3GJXC 4AZVA 4FBGA 3FPHA 1B93A 1Y3FE 2JI9A 1KH1A 1QONA 2ILTA 1E2DA 1W7AA 2OWEA 3E58A 1RPTA 2POQX 1A9YA 2QK4A 4HDRA 4B9EA 1ZH4A 4KACA 2ZU0C 4A27A 3ZXYA 5KX5A 1T2DA 1U0HC 1TU0A 4EH1A 4NEQA 3UV6A 3BCUA 3KSUA 2ZRMA 3DB1A 2CD9A 3V1KA 4UBOA 3Q0TA 2Z1DA 1E4EA 2ONYA 1GZ6A 4P4UA 2GOYA 1SG9A 3DEIA 4EB8A 4NBSA 1E9EA 4X6LA 1Q1GA 2PRYA 1DT5A 1LNZA 2DQYA 2WKWA 5FPTA 4FQ5A 4TL7A 2QMQA 5HIMA 4CCYB 4WFKA 2FDXA 4BP8A 4XRRA 3RJMA 3H05A 1K5HA 1PJLA 1JSLA 4NULA 2AG1A 1XMSA 5AK5A 1MENA 1D1QA 5LC1A 1Q5PA 3OSUA 2XCRB 2LPMA 3T0IA 2PU5A 1BXRB 1J39A 3F6SA 3VPCA 4EHIA 5EIFA 2JK1A 3DE3X 2BGKA 2I4RA 1D9ZA 2FX5A 1GA6A 2AOUB 3LC1O 4HAVA 5JSHA 1ACMA 5LLTA 4MR9A 1K9VF 4JNCA 4YDRA 4OIMA 3DBLB 2BRUC 2NZ2A 4Y2TA 3I0MA 3JQ8A 5DOVA 4EL5A 4EDHA 4O8CA 1IYZA 4DZZA 5KJCA 2WWWA 5K1ZA 2RMKA 1T4CB 4M76B 4O4JA 4HY3A 4OXQA 5EE3A 2J33A 5C8ZA 3L3BA 4BQRA 1FJGB 1BJKA 2E4XA 1J99A 3CZAA 2KI5A 2B21A 2DEUA 1G6OA 4WI1A 1JHXA 4KAXA 2FFQA 1VJRA 4F9EA 4BGIA 1NOJA 2HRQA 5BO5A 2GESA 4BQFA 1T9BA 2VAPA 5F77A 3OEWA 1QYWA 2FW6A 2CLIB 3A4NA 3VR2A 5L8VA 1H2EA 2W22A 1NKSA 3CF2A 1GKUB 3SF0A 2CLMB 2X40A 1M8GA 2ZIEA 3WWPA 3M1LA 5C1BA 1H9CA 2P4QA 3WQRA 3VKHA 3QFFA 4WN3A 2HMTA 5T4FA 4XD7D 3HL4A 1JA9A 4IDCA 1DADA 1QXSA 3BMXA 4KWEA 5IDXA 4OQNA 4JY7A 3ZWXA 3GZNB 1T13A 4TSFA 2BFAA 4DRXA 3WGUA 3GD7A 2CVOA 3CR3C 2C54A 1K8RA 3G6WA 3GLQA 3TCKA 4BO3A 4GWKA 2Z4RA 4X44A 2PVCA 1LUAA 1E3QA 4O2BA 1RRMA 1VPVA 1DBQA 2JJ1A 5CITA 1TA9A 3HN7A 3H13A 4P83A 1QHSA 2CHFA 5CTAA 1T1EA 3EMVA 2ECKA 3P9ZA 1HTTA 1QK3A 1Q0QA 5AM3A 3A3PA 5AI5A 3J80A 3AY6A 3ZWAA 1WP9A 4ZICA 2R7AA 2ID4A 3G8AA 3QPCA 3RFUA 1XLWA 3DWEX 4FT4A 4FUTA 3MF4A 4KGVA 4DNOA 5C18A 5KU1A 1LPMA 4TTSA 4P08A 1MAAA 3U0VA 2A5LA 1ADBA 1PL7A 3QRWA 3LWDA 2JFOA 5AK4A 5FPSA 1O2DA 3SYRA 4PSAA 4M88A 3TTYA 1G8YA 2YHSA 3NBMA 4BFCA 3PHIA 1UJ5A 3EA5A 1XRLA 3GLHE 2B8EA 4L3WA 4A3SA 3H0EA 5K01A 1WP4A 2QLNA 4TWRA 3COZA 1EBBA 1VYTA 2Z5LA 3ZDZB 3FCUB 2JJ2D 3AIOA 4BDSA 4RABA 2GLXA 3F6BX 1I0IA 2CMHA 3Q9NA 1H3FA 3WXBA 1XZMA 2RH4A 3OT4A 4QYIB 3FZQA 3WO1A 4JC5A 2G1KA 4B76A 1L8LA 1WSBA 3ETNA 2D0PB 3ZOZA 3H9QA 16PKA 3FI0A 3A1EA 4FIDA 1NM5C 2FPOA 5IK2D 2XV1A 1M34E 3NWOA 3PQ5A 1EFHA 1NXTA 1GITA 1SHZA 2G63A 2PYZA 3HB0A 1ESDA 4LSZA 3GPDG 1B8NA 1OSNA 1ZD1A 2J07A 4E1VA 1FPQA 5CM9C 1ZK0A 2WM3A 1SVWA 3DD1A 4G1UC 4BKOA 4OQMA 4KRFA 2IOYA 4HMPA 2QQGA 4PM4A 3FDZB 1QFJA 2IDKA 2ON6A 4QPPA 1BDBA 2HF2A 3GRCA 4DB4A 1KDPA 3IRUA 3LX5A 4JR0A 4RHCA 1XG5A 4JJKA 3BSWA 1NZDA 3PG5A 4PRLA 5LLSA 3M6FA 5CVCA 3C85A 2NP7A 2QV7A 1RXCA 1AKTA 2G72A 2GPAA 3BKXA 3D31A 5H9VA 5IM5A 5FBVB 3QEBZ 2LGJA 2YJ6A 3GEPA 4DV5B 3RFFA 1WM1A 3PPWA 3N8IA 4ZO7A 2CBXA 2D54A 3VRHA 1HEYA 3YASA 4YRIA 2PLRA 4KJZA 4Z7JA 5HYVA 1YE3A 3A4MA 4YECA 1PR1A 1R18A 4XAQA 3SXUB 2ECOA 4ZYYA 4XYMA 1J8VA 3C6XA 1LNSA 3QEJA 4B3IA 5A5VA 3L6OO 4DBVO 1WDKA 3LUFA 2JLRA 2J8ZA 1WDLA 2CJWB 2H0QA 3KKPA 3LO5A 3N6RA 1BO6A 5CG1A 1CS0A 1M8FA 2XXAB 1SC1A 1OXMA 4K81B 3TLCA 1MJGA 3FCSB 3GBSA 3IP9A 1RI2A 4EARA 4CL2A 2E85A 4I3FA 4YMIA 5I4KA 1SUIA 5H3CA 1UINA 4Z3KA 1JEEA 1LBIA 2B8NA 2YWGA 3I2KA 4WW0A 2YIJA 3KXKA 3T6KA 3C8ZA 1TQDA 3EXG1 1G5QA 1LVGA 2ZRCA 3GHHA 4CKBA 2FDCA 1Q50A 2P9ZA 4TT3D 4MAMA 3ESYA 2XWSA 1E8MA 4Q1VA 3ZY5A 1IDN1 3WRWA 4WADA 2GBPA 1CY4A 3RT7A 1U0SY 2BMFA 3EODA 2VDOB 1RAIA 1YGYA 3E48A 3EXG2 3DMTA 3QYFA 3BIXA 2A5JA 3DMYA 1E0SA 2D06A 2J9FB 2PMCA 3NPAA 5TMDA 3RRZA 1Q0TA 3G2QA 4IIDA 1QFYA 2XT0A 4U63A 1T2CA 3U4MA 5EJ9A 4KPEC 4L4XA 2NZYA 3IULA 4P4TA 4OP3A 3R7NA 1HLDA 3A6EA 3BFJA 3GH3A 3VPSA 5B2ZA 3WWCA 5J43A 5HQ3B 1ZMRA 1MOZA 2XNJA 2CHGA 2V0NA 4HSEA 2DB3A 3M2TA 3R0ZA 3FZNA 3I73A 3K1JA 1Q0LA 2GASA 3RC2A 4NENA 3ZGOA 4B3FX 3ZWYA 4D6PA 1K0FA 3NHZA 4WSOA 1P1BA 3AI3A 3PJRA 4IXDA 4EAQA 2Q5FA 4N76A 2BMVA 3ESZA 3T4UA 1NVVR 1B1CA 1NUQA 2D1TA 1B6TA 1ZQ1A 3HRHA 3T38A 3MYRA 2HTFA 1NJFA 2DLNA 2I2AA 2QT0A 3GJTA 2OOSA 4HGOA 4IIUA 4M8IA 4XCXA 3T9BA 3FPGA 2G9UA 3OE7A 3HRIA 1DT3A 3A06A 3B9RA 3IJRA 4YVFA 5AW6A 5IBPA 1UOPA 2H8GA 1N0WA 2YIMA 3PQ8A 3RFXA 4HPWA 3EXAA 1EM6A 1DEKA 1PAUA 3G1TA 3SHQA 2BD0A 4DR4B 4MQBA 1XLTC 2PZKA 2Z2XA 3K53A 1JXOA 1WY7A 4I5IA 4DR5B 2IWHA 4LRYA 1QS0B 1X15A 1SHTX 5E38A 2OFFA 2E1RA 2ETVA 2VKQA 3BJMA 2AW5A 5AM0A 3UGTA 1KI4A 4EG6A 2HIAA 2WWYA 3A4VA 5H3LA 4DBZA 2IHZA 4AF7A 3NWEA 2QB5A 1J1ZA 4HNHA 4TLDA 5LZ8A 3TLYA 2DG2A 2V3VA 1XMQB 2UUBB 2BM9A 2BMWA 1CEXA 4JLOA 2X77A 3IJ5A 4LXIA 5BT8A 1HLGA 4OYLA 1GGNA 4Y0VA 3SYKA 2A5DA 3BM5A 2Y1EA 3GRZA 4K6KA 1VL0A 2HADA 3OWXA 1R4ZA 1TK9A 2O1XA 2Z4SA 1U7XA 4LHVA 4Q7JB 3V1NA 2VYND 3I23A 3T3PB 3OJXA 1W1IA 3VTZA 1CIJA 4EO7A 2O20A 1KMCA 3D3JA 3T1QA 2Z2JA 2PUDA 2ZSAA 4AG5A 3EOZA 3VPGA 3EG9B 3IMEA 2CFSA 4FEEA 2YCLA 3K9HA 1HE8B 2Q0XA 4J9UE 1GGMA 1JQEA 2CSUA 3AB8A 3CVYA 4B46A 3TUZC 1V5WA 3QMPA 1PYDA 4C7OA 3T3GA 1UJNA 5DM1A 4CKZA 1UH5A 1DUVG 1F06A 4FD2A 5BXQC 2C7RA 1N9ZA 3RC1A 4IDPA 4GNRA 1B7GO 5BQ3A 2A0UA 2APJA 3HHPA 2GZHA 4R8LA 5TSDA 3PWZA 2BFNA 5DM2A 3B6ZA 3DZ8A 3K0FA 4HWGA 4OQQA 1VOTA 1C1YA 4Q24A 2PH7A 4U6NA 3SQOA 3H04A 3O9VA 4HTAA 2IKSA 1CR1A 5HRCA 3SHVA 3GB9A 2Q5IA 2WJ6A 4ZKEA 5KNBA 2F4VB 2IEDA 2R8RA 1E3IA 2BFPA 1KBQA 1XUOA 2CLEB 3RH0A 5KC8A 1CUHA 2I33A 4WKPA 4V0SA 4M8SA 3OA2A 4C7MA 3TNYA 1CUUA 1UMCB 5AUNB 4NC9A 3F46A 3F6EX 4DLUA 2JASA 3ELBA 3WBFA 2RH5A 4NX2A 4TWJA 2D3TA 4BGEA 2B4YA 3H5NA 1SULA 5DN9A 2IUTA 5KYWA 1IMOA 3V4VB 3OZIA 1M67A 2O7QA 3GEBA 2OKGA 5LIRA 2PRZA 1DJNA 3KZCA 3EXIB 1MOPA 3A32A 4MROA 2X5OA 4OXYA 1D8AA 2FQQA 4OXKA 4K6HA 1IZ7A 3WAGA 1WAMA 1QZZA 2Y92A 2P3SA 3V8NA 4RS3A 5AW7A 3CVOA 1JYSA 4UPDA 3ZE7A 3E82A 1D6SA 5GONB 1LB1B 1I32A 2GPWA 2FP4B 3NPMA 4KXMA 4AIIA 3U7JA 2VQ3A 2JGLA 2O7VA 1JSXA 1DOAA 4I4NA 1L5YA 4G01B 4TMKA 2XUJA 5AVWA 2AZTA 4JGIA 4HZGA 3H8VA 1WS6A 1RAFA 1U99A 1DELA 3RGWS 3VPAA 2WSBA 1TPZA 1T5TA 4HNQA 4JJFA 3ABRB 1DIGA 3KAQA 4WCVA 3OJEA 3TOSA 3MMPA 3SXJA 2Q41A 2BUBA 1EG2A 4UE6A 4BKMA 2G08A 3EXIA 4NE9A 1SIBE 3GVPA 3MWEB 3R3HA 2ZRJA 4CLHA 1FU4A 2B0CA 3EPKA 1QWOA 2PSEA 3C16C 2HUPA 3ADCA 4ZCIA 2YHIA 1H1LA 4KMMA 5CYOA 3JWEA 2CE2X 2RAFA 5BWLA 5ENDA 3MQFA 3K0HA 1UQUA 3UK7A 4B32A 2OBFA 3NEPX 4U0JA 2E49A 3SSAA 3SX4A 1U2DA 1NQAO 4L27A 3MA0A 3VDMA 5L9AA 2UYYA 4XCVA 1CJVC 2MSLA 3IEIA 4OQXA 3LE8A 3E53A 1Y82A 3NEAA 4ER6A 1UPTA 2GAAA 3UFXA 3S6JA 4UNQA 3U4GA 2P9FA 5FI3A 1PN3A 4I9NA 3UJ9A 2TRSB 4UHJA 4JC0A 4CIAA 1IBMB 2X2EA 4JD5A 3RYIB 2FW9A 2OK7A 1S8AA 1Y1LA 3MJSA 1ZSVA 4L95C 4KJXA 5DLYA 3COYA 5EHZA 3NC4A 2OD9A 4FZVA 4G2NA 4IGKA 1P7PA 5FOXA 1I1QB 3NIFB 3WIVA 1QVVA 1ODJA 3O90A 3PTAA 4GVPA 4O1HA 5DM4A 2VJYA 5JYDA 4BO1A 4MMYB 1PK9A 3FPAA 3KC2A 3BWCA 2PUHA 4W5JA 3VC3A 5A7GA 4QQRA 1QG0A 5WRFA 2R97A 1L4BA 1QIDA 5KSPA 1QGDA 3G2PA 5DX8A 4V3CA 4ZT7A 4C6SA 1LQTA 1KIMA 1PVVA 2C3OA 4QAQA 3IL2A 4X84A 3WB1A 3T12A 4MUYA 3OKAA 3HKBB 1Z6GA 2P9EA 4KVFA 4NZZA 4Z9BA 1YS9A 1QR6A 2WMDA 1POXA 4JS0A 3BGSA 1NYRA 1ORWA 4QRHA 1EFRD 4CQMB 2XKKA 4EB6B 1ADJA 2R3SA 3FOBA 2Q49A 4LSWA 5ESWA 1BCRB 1UC9A 4J6EA 2XOKA 1FDUA 1TYZA 2PHZA 5P8WA 1RYDA 3FZGA 4YT5A 3KTOA 2BR5A 4YIHA 4YBZA 1D7AA 2I4OA 1UXOA 1L5RA 4WESB 1MX5A 1L4NA 3PGJA 3UT6A 2ZUEA 4PS0A 2Z6QA 1P6QA 4Q7MB 1VE7A 2FZEA 1HLPA 1N6OA 2VNHA 3BSYA 2L0XA 2XGOA 1EHIA 3R3XA 4HRXA 4C5CA 2K7FA 4CM4B 2ADMA 1GAWA 3H5OA 4MUNA 1E4VA 1EGHA 4AJJA 1PNTA 2UDPA 1VSQA 5DBGA 5KYVA 3ROGA 1FTYA 2NZWA 4Y6SA 1PQUA 3SR3A 4HV4A 3K70C 4WMLA 2ZYTX 4CXMA 1F60A 4PRYA 3IAM1 3RU7A 1W1UA 3D6FA 1TTHA 4KQMA 5LZ7A