3FUQA

Glycosylated sv2 and gangliosides as dual receptors for botulinum neurotoxin serotype f
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
411
structure length
399
Chain Sequence
b'DNSILDMRYENNKFIDISGYGSNISINGDVYIYSTNRNQFGIYSSKPSEVNIAQNNDIIYNGRYQNFSISFWVRIPKYFNKVNLNNEYTIIDCIRNNNSGWKISLNYNKIIWTLQDTAGNNQKLVFNYTQMISISDYINKWIFVTITNNRLGNSRIYINGNLIDEKSISNLGDIHVSDNILFKIVGCNDTRYVGIRYFKVFDTELGKTEIETLYSDEPDPSILKDFWGNYLLYNKRYYLLNLLRTDKSITQNSNFLNINQQRGVYQKPNIFSNTRLYTGVEVIIRKNNTDNFVRKNDLAYINVVDRDVEYRLYADISIAKPEKIIKLIRTLGQIIVMDSIGNNCTMNFQNNNGGNIGLLGFHSNNLVASSWYYNNIRKNTSSNGCFWSFISKEHGWQEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BoNT/F (Neurotoxin type F)
publication title Glycosylated SV2 and gangliosides as dual receptors for botulinum neurotoxin serotype F
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Toxin
total genus 101
structure length 399
sequence length 411
ec nomenclature ec 3.4.24.69: Bontoxilysin.
pdb deposition date 2009-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07951 Toxin_R_bind_C Clostridium neurotoxin, C-terminal receptor binding
A PF07953 Toxin_R_bind_N Clostridium neurotoxin, N-terminal receptor binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3fuqA01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3fuqA02
2NTDA 1CE7B 1L2HA 3PJQA 2A6WA 3UJ4A 5KXDA 1BLAA 4I4QA 1BQPA 1JXNA 2AREA 4GAIA 3D4KA 3Q7XA 2HW9A 2JE7A 3FJJA 5JOXA 5H9PA 4IY8A 4NOTA 3RTJB 3B00A 3BAUA 3TB0A 1MZ6A 1V6WA 3VT2A 2PHWA 2OVUA 3E8LC 4ZA3B 1W6PB 1ILR1 1QNWA 2AYHA 3AP4A 3A0KA 2GNTA 3FJHA 3Q7YA 1UZZA 1PZ9A 5E88A 2VSAA 1OFSA 1AXZA 4PBOA 1XG6A 4YM0A 1AXKA 3WLUA 1NLSA 3AKIA 3OY8A 1LOFA 2UWBA 3UJ0A 3N7JA 3FJKA 3HMYA 3AXEA 2DVGA 5DG1A 2Y9WC 3ZSJA 1DLLA 3NV2A 1WW5A 1MC9A 2Z49A 4YOLA 2HZ9A 2WBCA 2FDBM 1TOOA 2CWMA 2ZHMA 1DFCA 4XKIA 4M3CF 1IRAX 2ZGUA 1QQKA 2Q9XA 5SV8A 4I3NA 2D6KA 3V64A 4QC4A 4YW3A 1HWPB 1DGLA 2YXSA 1QF3A 3N7KA 1QU0A 1CIWA 1VAVA 5DUVA 1BFBA 4ASMB 4FOVA 1DIWA 4YLZA 3UD9A 1W6NA 4XXAA 3AYCA 1YTOA 4JPZA 3M2MA 2ZGNA 4CTEA 1Z4SA 5T5OA 4Y22B 1EVTA 5KXCA 3ILAA 2P37A 1G9AA 3O4AA 1F5FA 2YMZA 2EALA 5FZUA 3A4UA 3V0AB 2E53A 2ZGTA 3OJMA 1II4A 1IS4A 3VKLA 2D6LX 2ZHNA 3T8SA 2BQPA 4D8HA 1IKPA 3QCWA 3F62B 4R9BA 1VAMA 4JQ0A 4YGEA 4QD2C 3I4IA 5D62A 2HYKA 2AR6A 4GKXA 1MZ5A 1W6MB 1HQWA 1LECA 1EYLA 4AYUA 2BEBA 4GOYA 2P34A 2P2KA 3O0VA 2Y9GA 1IS5A 1AVXB 1A78A 5DUWA 3VKMA 3O4CA 4XE9A 2G4IA 1FWUA 3JRRA 2ZA9A 1BFCA 4FPCA 1UMZA 3BB2A 1IKQA 4CZSA 3O0XA 3EF2A 4LBQD 3VT1A 4I1EA 2F8XC 1AXYA 3OYWA 1K5VA 1E0OA 4XJZA 1A8DA 2F2FC 1KJLA 2D3PA 1AX2A 4XOGA 2KH2A 4SLIA 3CA3A 1SBFA 1EPWA 2A6YA 4KBBA 3QR5A 3OY8B 1S0DA 3IM0A 4RL7A 4G9NA 5D63A 1BXHA 4R9AA 1N4KA 4R9CA 2D7IA 3OGGA 4D0ZA 5DXDA 1CVNA 2EXKA 4DEPA 2K8RA 4FPEA 1ISWA 2V73A 4L8QA 4L4IA 1MVEA 4I8MA 4LBOA 1O4ZA 2K43A 1CPNA 1QNYA 2SLIA 1DZQA 1SFYA 3U4XA 3CA4A 1YYNA 2DYCA 4BQ1A 4IHZA 1MS3A 1CN1A 2DRYA 4EB2B 2C5DA 1FV3A 1WW7A 5GLZA 5T54A 1EV2A 4J2YA 2FFVA 5FNWA 4TZDA 1HWMB 2ZGQA 4BM8A 2GMEA 3LLPA 3A0NA 3VEQA 3IM5A 1ENQA 3WDYA 3IPVB 1W6NB 5LK5A 4GP3A 3AP6A 2A3XA 3VT0A 3WDVA 1UL9A 5T50A 4LO3A 1SR4C 2JDZA 2GZBA 4BLIA 3ZVXA 1JYCA 1N1SA 2ZHLA 4I4XA 5GZEA 1HKNA 1W3FA 3NBNA 1SCSA 3RMXA 4Z9WB 3FLTA 2YY1A 3MEPA 1YBIA 2DUQA 4R6UB 1F9KA 1W6OB 4DRVA 2D6NA 3UJQA 1YF8B 3SNVA 4JAWA 4Q9PA 5I1BA 4AGVA 3LTQA 3BIWE 1MVQA 3O44A 4QKRA 1DQ4A 2AUYA 1M2TB 2HWMA 1LHUA 1CR7A 3H0OA 3IKWA 2YUGA 4JKXB 1BARA 4YZ2A 3AYAA 3WG1A 3OJBA 4A7KA 4P6AA 4XMIA 2FHRA 1PUMB 4QBCA 3WUCA 4XJWA 3T2TA 1RY7A 2VSEA 3N36A 3B69A 2R49A 2WSUA 1RINA 3R4UA 2I1BA 2D1ZA 3RSJA 3POSA 4EKXB 5IK7A 2JE9A 4D0TA 2WRYA 1GGPB 1QXMA 4FOWA 1PZ8A 1JQZA 5IK8A 4YW2A 1WW6A 4P9WA 2KI6B 4QKSA 2Y9XE 4AVTA 2PHRA 1QOOA 4FOQA 3W58A 3FJFA 5T52A 5F90A 3MW4A 2DRZA 3S8KA 2E4MC 3B9UA 4BMBA 3I2AA 4I6IA 1GYKA 5H9QA 4FPHA 1I1EA 1LHWA 3N7MA 4GWNA 4EEEB 3ATGA 1LEMA 2ERFA 5E24E 4LO1C 5HCAA 2ZMLA 2R9KB 2DTWA 4P9XA 2WT2A 1BYHA 5T5PA 1LU2A 2WQZC 1HWOB 1G9CA 1LOEA 3NV4A 4Q2FA 1ENRA 4L4HA 4H55A 2VXTI 1CQ9A 4K1YA 2VU9A 4GXLA 4P9YA 1X50A 2Q3NB 3PVOA 1LOAA 2GMPA 1G86A 4H04A 2D20A 5BQUC 4LO8B 5GALA 1QQLA 3NWKA 5DVHA 3W9TA 4D69A 1C1FA 5GZDA 1HCDA 3INAA 4FPOB 4Y22A 2EAKA 3WOGA 3WA1A 3ZSLA 2K4AB 1K5UA 4XTMA 2C9AA 1DQ5A 3CA6A 3V0AA 3AP5A 1P63A 1ULDA 3MW3A 1DQGA 2SBAA 4YM1A 4XXPA 1DYPA 5GM0A 1FYUA 4OWLA 5FZZA 2GDFA 1QGLA 1JN2P 4LBNA 2LIQA 1YRZA 3ZSMA 1V00A 1CPMA 4GA9A 4I96A 1G82A 2ERMA 4OEEA 4ZBVB 1Q8SA 5IT6A 4P0JA 1LHVA 4J2XA 4U2AA 4PBPA 2Z42A 1W6MA 1W0PA 1ONKB 4I1BA 1VLNA 1QOTA 4Y1XA 2A5ZA 5FREA 1V6MA 4XFTA 1AFCA 5EC5A 2ZABA 1LGBA 1N3QA 5CB7A 1V6XA 1IS6A 1KJRA 2ENRA 2PHXA 2WLQA 3C2UA 1DZCA 1SLIA 3ENRA 3BAVA 2F2FA 2UWAA 2NMNA 2JD4A 1HQLA 2UWCA 1ISYA 2WSVA 4LO0C 3UK9A 1AJOA 1BZWA 3WZ1A 2DTYA 4M01A 1NUNA 5JMCA 2JECA 4FPLA 4LBJA 3Q7WA 2RSTA 2ZMKA 2IWTB 4DENA 5IK4A 1DJSB 5EXOA 4IZEA 1H9PA 3RS6A 2CNAA 2VXRA 3BRGC 1R8OA 1IJTA 2AGSA 4ZKTB 1BFGA 1W3AA 3UJOA 3AJ6A 4KEJA 2Z48A 1G7YA 2ZGMA 3KM5A 3WDUA 2GALA 2ET2A 3ILFA 1V6OA 1A3KA 2NP0A 4LO2A 3WCRA 2GNDA 4DPNA 4HL0A 4H9WA 3OJVA 2DVDA 1UAIA 1URXA 1S0EA 1F31A 3POKA 1LODA 1IOAA 2DUPA 4YGCA 2W68A 3VUOA 1TFMB 3I2XA 2BEAA 1SR4A 3IPVA 4IYBA 3BADA 3TAYA 1FMMS 1OQLB 1PUUB 1ULEA 4ZGRB 1LULA 2GMMA 4XBQA 1RG8A 3B3QE 3PMEA 2D3SA 3A22A 1JLXA 4WVVA 3H6RA 5EYYA 2P23A 1SLBA 1MS1A 1J1TA 4FQZA 3FFZA 2JKBA 3D7WB 1ISZA 3O3QA 1ISXA 3R4SA 4LO7B 1S0CA 3MPPG 2VLCA 1Q56A 2KLLA 1W6OA 3OBTA 3SITA 4YFWA 1V6JA 4GOVA 3FJIA 4ZXKA 4QD2B 1G9DA 2VY0A 1IRPA 4XIKA 2ARXA 4LO7C 5HPZA 1JT3A 2DVFA 1Q03A 4OEGA 3ZPYA 1PZ7A 2XOAA 5H9RA 5GJ6A 4I7IA 4CJMA 4OW4A 2ZQOA 5T5LA 4P0LA 1Q1UA 3N3HA 1T4QA 3FJDA 3SLIA 1QMJA 2X2SA 3ILNA 3AYDA 3ILRA 1FMZA 2VH9A 2Y9FA 4KEKA 3BRDA 1AZDA 9ILBA 1N47A 3VKOA 4Y1YA 1SLLA 1GLHA 1DZDA 5CNAA 3T1MA 4YW4A 1WLCA 4BLJA 3TC2A 2JJ6A 1AF9A 1D2SA 2PELA 1GV9A 3HOMA 2A6ZA 4YG0A 5JVVA 3NBEA 3WINC 3SH3A 5CAZA 2D7FA 2GNMA 1V6UA 1SZ6B 3CQAA 3LCPA 4LO1A 1JT5A 2ZMNA 4DS0A 1TWMA 5T55A 3AJYA 2A71A 1ONAA 1LHOA 3M3EA 3NBCA 1QDCA 1HLCA 1JT4A 1O4YA 4USPA 4DCKC 1RMLA 4G9MA 1BFFA 3FJ8A 2FMDA 3QLQA 3N0KA 2ES3A 4NO4A 5BQUA 4FPFA 3AFKA 1KQRA 2YZ4A 4YZ5A 3WUDA 3FLPA 4FPJA 1JHNA 3M3CA 1AVBA 1LCLA 5HCBA 3ZXGA 1N1VA 1S0JA 1V6IA 4FPYA 1SLCA 3B01A 5BXPA 4JC1A 4OWKA 5T5JA 3WO2A 4AWDA 2VW1A 4K20A 4GKYA 3CA1A 4K1ZA 2DUOA 1AVUA 3FUQA 1W6QB 1ZM1A 2ZR1B 5JLVA 3OGFA 1Q8QA 4IONA 1GZWB 2WT1A 3AKFA 3LSEA 3ZXLA 3NV1A 4BMEA 4TLPA 2VUAA 2E7QA 1GNHA 4Q8KA 3LSDA 3C9ZA 3H6RB 1KNMA 4X37A 5F8YA 3RRDA 4WVWA 3AZZA 1S0IA 3WVJA 1SLAA 4I4OA 4UW5A 1AX1A 1CJPA 3FJBA 4X3AA 1V6NA 4EFQA 3MALA 1G8WA 4OEFA 5BXSA 5BXTA 3Q9OA 3O4DA 4ISRA 2ZGKA 4J2KA 1AJKA 1LEDA 1W0OA 4OWJA 1UX6A 2VW2A 1S1AA 2ZKNA 4Q1PA 5F8SA 4GWMA 3AK0A 4UW6A 1S0GA 1FV2A 3FJAA 4XJUA 1PZZA 5DG2A 4FPKA 3BAHA 2D6MA 4ATFA 4LO0A 1DHKB 4HA2A 2FFUA 5DUUA 2WJSA 7I1BA 1DQOA 1Q04A 3WO3A 4LBQB 1LGCA 1UN1A 4PQ9A 2ZBJA 2NZ9A 3UDAA 4TYSA 3AH2A 2UU8A 1WD4A 2MIBA 8I1BA 1JYIA 4I37A 1JT7A 4HR6C 1ITBA 4XMAA 1OKQA 5CA6A 1GKBA 1CVSA 2NYYA 4A7YA 1SLTA 5DZFA 4K21A 1WLDA 1SCRA 3BRFA 3F1RA 5GLTA 2WNEA 4Q91A 1LU1A 5L73A 5F8WA 3DUIA 1R1ZA 3JUTA 3HR9A 1CESA 1FNYA 1WBFA 3UD8A 2R16A 3FGMA 1T9FA 1BASA 1NXD1 3GALA 2AFGA 4F34A 3OJ2A 4Z8SB 2GN7A 4ITCA 3BAOA 3ZXEA 3QYDA 4WV8A 4ZLBB 5JOYA 1ISVA 5DSSB 3BA4A 2RQ9A 2IHOA 4QALA 5AVAA 4DRRA 2L5XA 3UL2A 3O5WB 1ULFA 4M00A 2D24A 4WBCA 3KQRA 1ENSA 3WMVA 4DQAA 4PF5A 2LTNA 3BAGA 3NV3A 1JLYA 4J23B 2MLLB 2A6VA 4Q26A 4P14A 1MS4A 3O4OA 5E8AA 1WD3A 5GAQA 3HSMA 2QYIB 4Y20B 4WZFA 1GZCA 1PC8B 4XJAA 3WDXA 2P3JA 4A7ZA 3ZXFA 2RG9B 3AZWA 3O12A 4YG6A 1BA7A 4FP2A 3FUOA 2D6PA 3ZXJA 4I4PA 4PC4A 1VIWB 4CRQA 1DQ1A 2DVAA 3T1LA 2CYFA 4YZ4A 5JDBA 3SH4A 2DREA 1LTEA 4AN7B 4J2SA 2OW4A 4UW4A 5BP5C 1V6KA 1U0AA 1KDKA 2LALA 4AGRA 3WINA 1FGAA 1YXWA 4XHXA 3RMYA 2R0FA 3O49A 3BA5A 2ZGOA 4Y1ZA 1BLDA 1Z78A 4I30A 1MS0A 2A75A 5DZGA 1QKQA 3BAQA 3BX1C 3ASIA 4I0YA 1JY0A 3IMNA 2D43A 1M16A 3BTAA 3ZXKA 3M3QA 2D6OX 1V6LA 2A7AA 3I8TA 3WG3A 1ULGA 3WO4A 3FLRA 4Y1VA 4I2SA 1H30A 3PVNA 2CTVA 2GNBA 3L2YA 3B9CA 4EFRA 1KDMA 1VCLA 2W39A 3WHUA 2CWSA 4RA0A 3RG0A 1YO8A 2QN4A 1TEIA 4IQPA 4MYEA 1BJQA 1R8NA 4C1XA 2EF6A 3IAGC 2WT0A 3O0WA 3WV6A 1I3HA 2YV8A 3AX4A 1IT0A 3P6JA 1FATA 1N1YA 3IN9A 3POWA 1HKDA 5GLVA 3AKGA 4XBLA 5BVPI 2P3IA 4JCKA 1MR5A 5E89A 2E7TA 4BPZA 2ZZJA 4QBVA 1W6QA 4YW1A 5GZFA 3S8JA 3FBYA 4M3CA 4FOYA 1GZWA 3OBRA 1N1TA 5DUXA 2MC2A 1DQ0A 3SNMA 1G9FA 3I29B 2ZGPA 4XTPA 1LOCA 4HANA 1MS5A 3NBDA 2I2SA 2ZGRA 3WG4A 3WDTA 2D22A 1LENA 1Z0HA 3HBWA 1XYFA 1W3GA 4ZFWB 5KXEA 1IOBA 3K1XA 4EFPA 3W59A 1GSLA 3CAHA 1PWAA 2A3WA 3PG0A 4ISQA 4OZXA 1CONA 5GLWA 1TIEA 1JTCA 5HCFA 3AXDA 1I1BA 4Q1RA 4XZPA 3O4BA 3UD7A 2P39A 1MD6A 2TEPA 41BIA 5CBLA 3FJ9A 1HDKA 2WKKA 4YFZA 3BODA 1MACA 2A6XA 4G6MA 4G1RA 5FRAA 4LBQA 2VW0A 4Q27A 4I4UA 1GNZA 4Y24A 4FGFA 5IUQA 4II0A 2B7YA 4FQ4A 2DWRA 2ZACA 1UPSA 5F9TA 2NN8A 1TP0A 1WBCA 2DU0A 1DYKA 3VSFA 3WMUA 3D5OA 1SACA 2DVBA 3M3OA 4GAFA 2OUJA 2P3KA 4FVVA 3V79C 2V5YA 1SBDA 2E4MA 4XBNA 1LESA 4ENDA 1MS8A 3N7LA 4GP0A 1WUVA 3V65A 1WBAA 1ZA4A 4IY9A 1WLWA 2KKIA 1J0SA 4QO3A 5GZCA 4XDQA 1B09A 1OQ1A 4U36A 2W08A 3NJ5A 4XIOA 1G9BA 4F83A 3SISA 3PHZA 1H9WA 3WG2A 1WBLA 1IS3A 4Z8BA 2R1BA 2D44A 3AZYA 2AQZA 3SH5A 3AJZA 3ZYRA 2H0BA 5G00A 3CRIA 1XZZA 2X2TA 2FGFA 3AP9A 1LOFC 5BYNA 4ZFUB 4JP0A 3BA7A 3VSZA 2E51A 4XJ8A 4LBLA 4C1WA 4JKQA 2AH2A 2DU1A 2UUSA 4I4SA 1S0LA 3CU1B 1Q8VA 2R1DA 1S0BA 2NM1A 3H6QA 1FWVA 1BKZA 4YM2A 4ZFYB 2EIGA 2AXMA 3ZX7A 4G6JA 1GBGA 1JW6A 3DGTA 2DURA 4FP3A 1UZYA 1XHBA 4USOA 4GALA 2PHFA 1KITA 3USUA 1LOGA 3HN1A 2M49A 2AENA 2ZAAA 4M3CB 4AGGA 4Y20A 3HALA 4YG3A 3D6EA 2KM2A 2XB6C 1XQNA 3JU9A 4Q9GA 4LO2C 2XG3A 2ZQNA 1SBEA 2DV9A 3CRGA 1JBCA 1D0HA 4LBKA 2D3RA 6I1BA 4AN6A 5EHAA 4X38A 4JRAA 4PCRA 1NZKA 3VV1A 3FJEA 4KEIA 2D7RA 4M3CE 3V0BA 3ZC9A 5BP5A 5H9SA 2D23A 4XFUA 4XFSA 1GZ9A 3PVEA 1HCEA 5FZYA 1VALA 1LJ7A 2AAIB 4XJ9A 1QOSA 2ZGSA 2KI4A 4ATEA 5IK5A 3P6IA 4FPGA 1N3PA 1GICA 3RQ0A 2NVHA 4I4YA 5D61A 5GLUA 3ZSKA 2ARBA 3AYEA 4Y26A 3M1HA 1FAYA 5DZUA 4KC3A 4BOWA 2W52A 2ZHKA 5FNXA 4ZOTA 4UW3A 3WNXA 3ZXDA 4Q8LA 3IM6A 2A70A 5DUYA 2PHTA 3RTIB 2FO1A 2Q5TA 3POYA 1Q8OA 3FJCA 2YROA 3ZYPA 2BFHA 1LOBA 1WW4A 4YM3A 1W6PA 5JOZA 3P53A 2EXIA 2GN3A 5BOWA 1V6VA 3APBA 3H6SE 4YZ1A 3IIRA 2EXHA 1IHKA 1N3OA 2CL2A 3IM7A 2J3PA 1FQ9A 4HJJA 1Q8PA 3AZVA 1YIFA 4DFSA 1APNA 1JUIA 1C4RA 2A3YA 2NMOA 4P0KA 1DQ2A 1LGNA 4XHBA 3AP7A 3JUUA 4YGDA 1DBNA 1FX5A 1QDOA 1C1LA 2E6VA 1KRIA 1IILA 1MS9A 3OYWB 3WHTA 5KXBA 3CRHA 1AX0A 1YI7A 31BIA 2DS0A 3PUBA 4YW5A 3VWCA 3A07A 4AVSA 1HWNB 4XYXA 3BOPA 3AZXA 2HWAA 3VKNA 1S0FA 4R9DA 1Z2VA 4OUJA 1AVWB 1RIRA 1DFQA 4LBMA 3WCSA 5EYXA 3A21A 3ZC8A 3O5SA 4Y1UA 3AJ5A 1C57A 4W65A 1FN0A 3MW2A 1Y7BA 1TWEA 3N35A 2CY6A 3GNEA 3VKFC 3KMVA 3CNAA 2EXJA 1TTUA 2RHPA 1RZOB 5DZEA 1WCSA 1GANA 2UURA 3USUB 5EWSA 4IZXA 2ESUA 1RITA 3AH4A 4YGBA 2LIEA 3AKHA 3R05A 2OUHA 4AVVA 3OPZA 3WDWA 5JOWA 1ABRB 5EG6C 4I4VA 1FNZA 4I4RA 2R0HA 3AH1A 5B2HA 4X39A 3A23A 1DQ6A 5F5QA 3V0BB 5GZGA 1HIBA 3CA5A 5BXRA 4XILA 1UKGA 4YZ3A 1LHNA 4LO3C 3CA0A 1AVAC 1JOJA 1ULCA 2ZGLA 2PHUA 1AXMA 21BIA 2GO2A
chains in the Genus database with same CATH superfamily
2NTDA 4MXVA 3T3YA 1CE7B 1YNAA 3KCXA 1GWLA 3HOBA 2QQPA 1L2HA 2JB4A 2A6WA 3PJQA 4RFT0 4YVWA 3MZHA 3UJ4A 1EAH1 5KXDA 1BLAA 4I4QA 1HB3A 4N53A 1HB1A 2XLFA 1BQPA 1JXNA 2AREA 1ULPA 2OQ6A 3JQWA 3D4KA 5ACA3 2HH9A 1SG3A 4GAIA 4DMIA 3KQ4B 1JH5A 4B1MA 3Q7XA 2HW9A 4QDSA 4Y33A 2JDUA 2JE7A 1XU1A 3SMHA 2BOJA 4D3WA 1ND3C 3WP6A 3FJJA 5JOXA 1W8ZA 1WZXA 4ZHNA 5H9PA 4IY8A 1R1A1 1VB4A 1RHI3 4NOTA 4ORFA 3B00A 3SCFA 2XWBB 3BAUA 3RTJB 2JWPA 3TB0A 3AVSA 3QACA 4PI0A 1MZ6A 2JDHA 5EZWA 5BNPC 1V6WA 3VT2A 2PHWA 4LJHA 1H2MA 2OVUA 5I8TA 4COYA 3NQHA 3E8LC 4FO9A 4AW7A 3VDDA 4ZA3B 3L2HA 3THCA 2R30A 1RUJ1 1W6PB 4CCJA 1ILR1 3K75B 1QNWA 2Y6HA 4HETA 1YQ8A 2AYHA 3AP4A 3A0KA 4CDQA 1L7LA 2GNTA 3FJHA 1V0AA 2B5HA 3Q7YA 4AI0A 4RQPB 2BVVA 5A33A 1UZZA 1PZ9A 4HKLA 1UOJA 4QQLA 4QXHA 3ZO0B 2X53S 4O9GA 1QXRA 4OUSA 4PJYA 1UCXA 5IWFA 5JSRA 4XUOA 2GH8A 5E88A 2X5IC 4PT6A 2VSAA 5FZHA 4CU9A 4XZUG 3PIJA 1OFSA 5ACA2 1AXZA 2GC3A 4RQPC 4QGLA 4PBOA 1XG6A 1ASJ1 3IBMA 4LO5B 3THTA 3PTYA 4YM0A 1AL23 1AXKA 1HQNA 4HKOA 3WLUA 3O1RA 1Q5OA 3GBWA 1NLSA 1UY2A 3AKIA 1XU2A 3MIHA 3OY8A 4GZ9A 3O1MA 1LOFA 2UWBA 3VD7A 3UJ0A 1RHI2 3N7JA 4P9LA 4IEVA 3FJKA 3HMYA 3AXEA 4WVMA 2DVGA 5DG1A 4SBVA 4DXRA 2Y9WC 5DQ0A 3P1IA 3ZSJA 1OVPA 1OBNA 1DLLA 4LMFA 2MEV2 3NV2A 5FY0A 5I0TA 2EIEA 1WW5A 4O61A 4NHYA 2HWE1 1MC9A 2Z49A 4YOLA 4XFIA 2HZ9A 2WBCA 2WNVA 4E8CA 1RUG3 5C3QA 3I2DA 4JTNA 5IVJA 5IVEA 2OYZA 1TOOA 2CWMA 3FE5A 3VBSB 3LIGA 2P5BA 1U5IA 1WA4A 2IVJA 2WNUC 3RI8A 5DMYA 1WCKA 4AHYA 5GKAC 4A3XA 2ZHMA 4FTEA 1DFCA 4XKIA 4LKSA 3ZFEB 4M3CF 2XOMA 5LCWL 5L9VA 2ZGUA 1IRAX 2BDRA 2RM21 5FYHA 5AFEA 1QQKA 2Q9XA 4XPVA 5KHKA 2PAEA 5SV8A 3VBSC 4I3NA 2D6KA 5LK7B 4HSJA 3ELNA 1UXZA 3FL7A 4LNVA 3V64A 5KC5A 3OG2A 4UOJA 4QC4A 1AL22 4YW3A 2FDHA 4B7KA 1HWPB 1DGLA 4E4ZA 5CFDB 2YXSA 1QF3A 3ZFEC 3N7KA 1QU0A 3J26N 4KI5M 5J3UA 1W8FA 2XDVA 2J1AA 4V1PA 1CIWA 3ZYBA 5FZ9A 1EY2A 4BQ5A 1ACCA 1B35A 2WQ4A 1OH4A 5FYYA 1VAVA 3D0JA 3EJKA 2WS91 1QJZA 4I0BA 5DUVA 5CFDC 1BFBA 1UO9A 2VZQA 1EV13 1RYYA 4QDRA 1FPN3 4MXWB 1UZVA 3IDCB 4ASMB 1AR73 2FDKA 4FOVA 3ABZA 2BOIA 1C8M2 4LPLA 1DIWA 4YLZA 4JDOA 1W6NA 4XXAA 3UD9A 3AYCA 1YTOA 4JPZA 1SPPB 3M2MA 3CBNA 1UQXA 5FZ4A 5A3NA 1OA2A 2ZGNA 5F5IA 4CTEA 1Z4SA 5I8SA 5T5OA 4Y22B 3B7MA 1EVTA 1BVP1 3KLSA 1MQTB 3B94A 5KXCA 2ZX4A 4QM8A 4Z82A 3MUY1 3ILAA 2P37A 2HWD2 1DP0A 1VBB3 5TSWA 1G9AA 1TE1B 3O4AA 4UI9L 3VBUB 5CYYA 4BK4A 1F5FA 2YMZA 2EALA 3M4FA 5HCHA 4LLOA 5FZUA 3A4UA 4A6SA 4W6YA 3V0AB 4EV0A 1F5JA 1MQTC 2E53A 2WAOA 2ZGTA 1SFPA 2XKPA 3OJMA 4C91A 1NCRA 1II4A 1HXS2 2C1FA 1IS4A 2OPKA 2YG0A 3CZJA 2XJVA 2VE1A 4Q4W1 3VBUC 3VKLA 1H1IA 1F15A 2W94A 2BNNA 3H8UA 2FD8A 1RUF3 5KR7A 1NQDA 2D6LX 2ZHNA 4H7MA 2BEAA 1ZBE3 3T8SA 4BISA 5K0UA 1CAUA 2BQPA 4D8HA 5C70A 1FPN2 2UY9A 5FZ6A 2HBTA 1AR72 3N9OA 1IKPA 4L97A 4CCNA 3QCWA 1QJU3 1Y4WA 3F62B 4WM7B 3ZPOA 4R9BA 1UYYA 3AMQA 1VAMA 3AVRA 1H8VA 3CJIA 4PQQA 4YGEA 1X9PA 1SDWA 2WZR3 3F95A 5J98B 4JQ0A 1ZZ9A 2Y60A 3O1SA 4QD2C 4COWA 2Z79A 3C7FA 2YC4A 1SFNA 3I4IA 3UV9A 5D62A 2HYKA 2ARCA 4WM7C 2AR6A 1VBA3 2DCKA 1MZ5A 1JU4A 4GKXA 4CDUA 1VBB2 1W6MB 1JOPA 1HQWA 1LECA 1EYLA 2B39A 4AYUA 4GWJA 3WR0A 4D7SA 2BEBA 1RUOA 2DFCA 1O91A 3HVDA 4JX0A 1UU6A 4GOYA 1WGPA 2P34A 2P2KA 3GHMA 3O0VA 4QU2A 4BJ0A 3R0RA 3RZJA 4AEDA 3OBAA 4QQOA 3U37A 4MGSA 2Y9GA 3BIEA 1IS5A 1AVXB 2WO3A 3AB0A 2VZSA 2QKDA 1A78A 1S4CA 4LO4B 5DUWA 3VKMA 4RFRB 3O4CA 1OQEA 1GZTA 2C9KA 4XE9A 2G4IA 4RHV1 5FTTC 2VQUA 4E2QA 3VD9A 2ZA9A 1FWUA 3JRRA 1VRH1 4AE2A 1R093 4XUPA 1QWRA 1BFCA 1F8VA 1DG6A 3OD0A 4FPCA 4AQSA 1QJU2 1UMZA 1VBD3 2XJTA 3ZKYA 5J1XA 1WLTA 5JWPA 3BB2A 1IKQA 4LLFA 3VN4A 4I0AA 1IZ3A 4CZSA 2BWCA 3O0XA 3Q8EA 2WZR2 4P9IA 1D2QA 3EF2A 1NZIA 4LBQD 1X9TA 3VT1A 3EHKA 3T2OA 5BNQA 4RN5A 1YQCA 2ZEXA 1YIPA 1QJX3 4QX5A 2LS6A 4XFFA 3LZZA 4CDQB 5FJKA 4CUBA 4I1EA 4B3NA 1VBA2 2VCCA 1H8TC 1OQDA 4MUVA 2F8XC 1KD7A 3H50A 3T0DA 1AXYA 3OYWA 2WFPA 5L9RA 1K5VA 1VBC3 4XJZA 1HJGA 2JICA 4EN6B 1E0OA 1Y43B 4HVOA 3LDKA 1A8DA 2F2FC 1KJLA 2XH6A 2D3PA 2JG8A 5ABJC 1K3IA 2ADDA 5J7MA 4XVHA 1AX2A 1XPWA 4XOGA 5B4NA 2BWAA 4CYDA 5JMOA 1NYWA 2KH2A 4SLIA 3WF2A 3CA3A 1SBFA 1XNKA 4IV3B 3X29B 4BCUA 4CDWB 1EPWA 1NCQB 2A6YA 3EMRA 4KBBA 3QR5A 3OY8B 5AC91 3E97A 4BQ3A 1S0DA 3IM0A 4RL7A 4NRMA 4G9NA 3IZOA 1BCXA 1Z7S2 3S5QA 2BVBA 5D63A 5FZMA 1VBD2 1BXHA 1CAVA 4R9AA 5L7OA 4OHVA 1N4KA 4R9CA 3SCHA 1C5IA 3WF4A 4CDWC 1NCQC 4QXBA 2D7IA 1TQ5A 3J4UH 1RG8A 3OGGA 4D0ZA 5DAVA 5DXDA 1CVNA 1HRV2 2Q8CA 1R082 2EXKA 2EVXA 3EBRA 4HPKB 4DEPA 5IATA 4JAAA 4FPEA 1ISWA 2K8RA 1OH3A 4PLMA 1OA4A 1QJX2 2QQJA 2V73A 2W47A 4L8QA 2Q8OA 5A32A 1RVF3 4L4IA 1MEC2 2VXTI 1MVEA 4I8MA 4LBOA 2DCJA 1O4ZA 1VBC2 3PHMA 2R6QA 4RSUA 3OD4A 2K43A 1CPNA 4YSFA 1QNYA 2SLIA 2RS53 1BVVA 1DZQA 2ET1A 5DAPA 1SFYA 5C8CA 1D4VB 3U4XA 5A7WB 3CA4A 3USSA 4DUWA 4IDZA 2Y6GA 5D8AA 1YYNA 1E57A 1HX6A 5KC6A 3P6BA 1TME3 3LD8A 1W90A 4PDWC 2DYCA 4BQ1A 1K5MB 3CLPA 1MS3A 1IPJA 1CN1A 3VD4A 2DRYA 4IHZA 3OEAA 1KFUL 2C5DA 1AYN1 1FV3A 1WW7A 2VD7A 3IWZA 4GMP1 5GLZA 3PL0A 2F4LA 1E5HA 5T54A 1EV2A 4J2YA 2P1BA 2FFVA 5FNWA 4TZDA 4CUGA 1HWMB 5LZ6A 4AHZA 5FP8A 1P8JA 2ZGQA 4BM8A 2K9ZA 1UY1A 4COUA 2B42B 2GMEA 2FDJA 2WO2A 4AI2A 3KV9A 3LLPA 3A0NA 3GM8A 4HT1T 1TMF3 3UT0A 1K5MC 3IM5A 3VEQA 1YJLA 4OCTA 1ENQA 3HT1A 3WDYA 5FZ8A 3S30A 3KV6A 3ZXAC 1OKOA 3IPVB 3MIEA 3UETA 1W6NB 5LK5A 2BUKA 3WT3A 3ZYIB 1PO13 2VMGA 4GP3A 1RVF2 4B4QA 3AP6A 2A3XA 1FI2A 4S2DA 5IAXA 1CAWB 3VT0A 4GJZA 5JIAA 3WDVA 1KS5A 1UL9A 1XNTA 2R071 2VO5A 2WYFA 5T50A 1NKGA 3VL9A 3WQ7A 3ZFGB 5FQ0A 4LO3A 1SR4C 2JDZA 2ZX3A 1UU5A 2GZBA 4BLIA 1NA1A 3ZVXA 1JYCA 4IGOA 1N1SA 2ZHLA 1DGRA 4I4XA 4W6XA 5GZEA 1TME2 1J3QA 5JZGB 2VTXA 3DEMA 4LORA 4QB2A 3ZFGC 4D94A 2Y26A 2P3YA 2Z4FA 5CG9A 1HKNA 1W3FA 4LITA 2XHNA 3NBNA 1SCSA 5FMCA 1GP5A 2QUOA 3RMXA 3FLTA 4Z9WB 2YY1A 3KMHA 4P5YA 2VQ0A 3MEPA 3WW1A 2W1QA 5C3SA 3ZMOA 2DUQA 1YBIA 4R6UB 1C8M1 3RYKA 1ENXA 1F4HA 1F9KA 2OKXA 4LOSA 1W6OB 4DRVA 2D6NA 3UJQA 3K4ZA 1ASJ3 3MICA 5FPAA 1ND3A 5JZGC 4CCKA 1YF8B 3SNVA 2VMHA 2Y64A 1TMF2 1V9U1 4JAWA 1W8TA 4Q9PA 4XUNA 1C3HA 5FYMA 2RJLA 5I1BA 2VMFA 4AGVA 4AVBA 3LTQA 2VZVA 1AR61 3BIWE 4LUKA 1MVQA 5HV4A 2YPJA 1POV0 4HN0A 4W50A 4CXXA 5BNPA 3LFIA 3WD5A 3O44A 4QKRA 5F5CA 1DQ4A 5FYTA 4MHRA 2AUYA 1PO12 5I0SA 2ZXQA 1M2TB 2I74A 4R52A 2HWMA 1RUH3 1H4HA 1VP6A 4JZRA 2ZCWA 5LWBA 4JQRA 5FY9A 4IE0A 1LHUA 4MZGB 1CR7A 1X7NA 3H0OA 2HWE3 3IKWA 1XE8A 2YUGA 3I59A 4L0PA 4JKXB 1YQ5A 4CDUB 4GD4A 1HXS1 4P08A 1BARA 4YZ2A 3AYAA 2RE9A 3WG1A 3OJBA 4DEVA 4A7KA 4P6AA 4XMIA 5HI0A 2XQXA 1IQDC 2QVSB 2FHRA 2PLV2 1PUMB 4QBCA 1BHGA 2PN5A 3WUCA 1GU3A 4NRQA 3VBHB 3ZR5A 2J22A 4XJWA 5FZLA 3T2TA 5EIYB 1AR93 1RY7A 1C5HA 3OPWA 2GU9A 2JX9A 3N36A 5E1RA 3B69A 3T2QA 2R49A 2D93A 2WSUA 1RINA 4Q4X2 3R4UA 4RQPA 5F7UA 2I1BA 2D1ZA 4UXAA 4DXTA 2IXIA 3RSJA 2PQSA 5EJZB 1OOPC 3POSA 4S2GA 4E4DX 4FAHA 3J7MA 4EKXB 5IK7A 1W3VA 2JE9A 4D0TA 2WRYA 4XQDA 1GGPB 3AL6A 5EHDA 1QXMA 4FOWA 5LRRA 1PZ8A 2C0ZA 4BB3A 1REEA 5F3CA 3ZYJB 5G04L 2CHHA 4H14A 5CKNA 3GBGA 5IK8A 1JQZA 4N9IA 5LW9A 3IB3A 2WS93 5D21A 4YW2A 1WW6A 3ZN4A 1BLZA 1RUH2 4P9WA 4XF9A 2KI6B 4QT6A 3N9PA 3GJAA 4B4RA 3F2ZA 4CUAA 4LT5A 4QKSA 2TNFA 2ZS6B 2ZPXA 4Z1VA 3LWCA 3CZUA 2Y9XE 4AVTA 1ODNA 2PHRA 2RDNA 1QOOA 4Q0QA 4FOQA 1JZ3A 3W58A 1UIJA 1AR83 2WNUA 3MLLA 1VMFA 4BZ4A 4S2FA 5AFBA 3WNNA 3O1OA 5KHHA 2QQKA 5DDJ3 3FHAA 5T52A 5F90A 3NNMA 3MW4A 4N43B 5A3PA 1JZ7A 2DRZA 5JUVA 3S8KA 2NLRA 3OGRA 3M7AA 2W2IA 1I6XA 1PX3A 2DCTA 1SDDB 1AR92 2E4MC 1PX4A 4BMBA 4E2GA 3B9UA 3I2AA 3VBSA 4I6IA 1GYKA 4URTA 3T2PA 5H9QA 4NIDA 1ZX5A 4FPHA 1VJ2A 4R8HA 3L9JT 1I1EA 2Y0IA 1LHWA 3N7MA 3C7OA 3ETQA 3D8CA 2BBAA 4GWNA 3ATGA 4JGZB 4N43C 5J09A 4EEEB 1LEMA 2ERFA 5FYBA 3ZFEA 2WL1A 5E24E 4HN1A 4LO1C 5HCAA 1DGRN 2ZMLA 4R4ZA 2HEYF 4W8JA 1X8EA 3ZN6A 2R9KB 2DTWA 4P9XA 2W91A 4PIYA 4O9EA 1HN0A 2WT2A 5L7OB 2Z2SB 2R061 4JGZC 5CFDA 1PGL2 1BYHA 3T4VA 4ASLA 4XFBA 5F3IA 4K8FA 2ZEWA 4MH0E 5T5PA 4OQ8A 3PDQA 1LU2A 2FCUA 2WQZC 1HWOB 1G9CA 4IV1C 1LOEA 1OPOA 1QY4A 2VCMA 3NV4A 4Q2FA 1ENRA 4EJRA 4L4HA 4ZU4A 4H55A 3NVCA 4FAGA 2IVIB 1CQ9A 2XKOA 4K1YA 4QPGB 2VU9A 5A32B 3H8OA 1U12A 3KV5A 4GXLA 2F4PA 4P9YA 4N90A 1X50A 4AI9A 2VMEA 3PVOA 2Q3NB 5A1AA 1AR82 3IMMA 1LOAA 2J1RA 2XQRA 2ZX2A 3S7EA 2GMPA 1G86A 3WEZA 5DDJ2 4NRPA 4DZGA 2XUMA 4Q4V1 3M3IA 5FO9B 4MXWA 2D20A 4H04A 5BQUC 4LO8B 1QJFA 5GALA 1QQLA 3NWKA 5JI7A 3LIHA 4IETA 2OS2A 1J58A 4QPGC 5DVHA 2FCTA 2VOTA 2VZOA 1Z7S1 3W9TA 4MV2A 1SPPA 1C1FA 3GHNA 4D69A 1JI6A 5JPNB 4CEWB 1QIQA 5GZDA 4AEKA 2WO7A 1HCDA 3INAA 4FPOB 1ALYA 4Y22A 2WFF3 2EAKA 1MQTA 4LR4A 3KV4A 1PVC2 4NR1A 2XUEA 4NN0A 4QX7A 5FWEA 3WOGA 3WA1A 1YJKA 3ZSLA 1HRV1 1R081 2K4AB 3FHIB 2BEOA 3MIBA 4XTMA 1BBT1 1K5UA 1SQ4A 4IERA 4XFAA 1L3JA 5FIXA 3VBUA 5IVFA 1PHMA 1S2KA 5D1IA 2C9AA 4CEWC 1DQ5A 3CA6A 4Q0VA 3WP5A 4Y5SA 4A44A 3ON7A 1OURA 2WZ8A 3V0AA 1FMD1 4PI2A 3AP5A 4GH4B 1O4TA 1QJY2 1P63A 1ULDA 4FFHA 1XJAA 3MW3A 1JZ5A 4ZS3A 2SBAA 1DQGA 4E4HA 4YM1A 1XOYA 1MZFA 5FBZA 4WZCA 4YVSB 4XXPA 2XPJA 1UXXX 2VZRA 1DYPA 2X8KA 5GM0A 1EPZA 1FYUA 3N9NA 1ZRDA 4OWLA 5FZZA 2XVKA 3OGSA 4UFLA 2GDFA 1OLME 1O8PA 3LPFA 1HW5A 1QGLA 2D5FA 2VUDA 4GH4C 1K5JA 1JN2P 4LBNA 1GP6A 4QD2A 5JR2A 1HRI2 4JKMA 1IGOA 4QXCA 1YRZA 3Q8BA 2LIQA 4XFGA 5FZGA 4AEMA 2RDRA 3UNPA 3JXSA 4YVSC 3ZSMA 1V00A 4WM7A 4I4OA 1CPMA 2IUWA 2AC1A 1NAEA 4LHLA 5F2WA 2FDFA 1NA1B 3I97A 1U5ZA 4GA9A 4HK9A 3MLJA 4NHXA 4CA9A 1G82A 2R041 3VHRA 3ZDVA 1Q8SA 2ERMA 5FY4A 4OEEA 2JG9B 4ZBVB 3ZOIA 5IT6A 4P0JA 1LHVA 4J2XA 4U2AA 3J7HA 4PBPA 1J3PA 5L36A 2Z42A 3I2GA 2F17A 1POV1 4ZY9A 2ATFA 4D6RA 3KS7A 3HBKA 3MFAA 1PNFA 3W20A 2VBPA 4CPBA 1W6MA 1W0PA 3H1MA 1UOGA 2B8MA 3JBG3 4MGZE 5DABA 5HV0A 3NAPB 2JG9C 5DN2A 4A3ZA 1ND3B 5FYCA 1GWKA 4FXKB 2HWF1 1ONKB 3J8F3 4LTAA 1JUHA 1NX9A 4LKEA 4OFGA 2L9LA 4CXWA 2WZPP 4I1BA 1VLNA 5J37A 5BNPB 1F2NA 1QOTA 3GF6A 3NAPC 4Y1XA 5ERLA 1CX1A 5F6KA 2QZ3A 1RUE1 4JKLA 5JSPA 5DAQA 2A5ZA 5FREA 2JDYA 1V6MA 2ID4A 3ZSEA 4XFTA 1AFCA 1PIV3 3OUJA 5T3NA 3I3MA 4IEOA 5EC5A 3MUZ1 1M4WA 2AZ5A 3NW4A 3TEYA 1CAXB 5C4WB 2ZABA 3HNYM 2OZ6A 1LGBA 1N3QA 5CB7A 1V6XA 1BEV2 1IS6A 1KJRA 4MGKE 1JYTA 3I59B 5C71A 1PO23 2A73B 2ENRA 3TYJA 3U07A 2PHXA 4MSVA 1H8TA 1PGW2 4XC9A 2WLQA 1ZRFA 3EQEA 3C2UA 3I2XA 4QKFA 3BVCA 1DZCA 2QJVA 4META 3B02A 1DF0A 2BBVA 2WA4A 1SLIA 5J36A 3ENRA 3LE0A 2RS13 4KU7A 4QB1A 5C4WC 3BAVA 2F2FA 1G6NA 2UWAA 2NMNA 2W1UA 2X5IB 5ABJA 1PM7A 1W8HA 2VMCA 2JD4A 1HQLA 2UWCA 1XYOA 5A1LA 2VULA 3D3AA 1ISYA 1RUI1 2WSVA 4LO0C 3JBG2 2VG9A 1AJOA 3NJZA 3UK9A 1TNRA 1BZWA 4LE4A 2FFUA 3LEGA 3VBOC 3WZ1A 2DTYA 1VPHA 2QQNA 4M01A 1I5PA 4TN7A 3VB9A 3GCXA 3J8F2 1NUNA 5JMCA 2JECA 3TN91 2VXJA 4GMP3 2VZ3A 1PM4A 3OF1A 2BPA2 4FPLA 1J1LA 4LBJA 4OVEA 3Q7WA 2RSTA 4MGQA 4LO6B 1WA6X 2ZMKA 4IV3A 2K2SA 3EO6A 3WSOA 4E2SA 2IWTB 4CDWA 4DENA 1NCQA 5IK4A 1Y9QA 1DJSB 3C3VA 1NY72 3NMBA 1PIV2 1ZA7A 5EXOA 4IZEA 3RDIA 5HBAA 4CCEA 2OXBA 1H9PA 2PLV1 1UOBA 5LASA 4NAMA 3RS6A 4EN8B 2CNAA 2VXRA 2GAUA 3RYPA 4CCCA 3BRGC 1R8OA 2JEMA 1JZ6A 1SZBA 2RMU3 1C28A 3TWIA 1W28A 4C90A 5C5TA 1F4AA 4QGNA 2YBSA 2XBO1 4Q4X1 2AGSA 3VBFB 2RJKA 4LOTA 2WNUB 1VBE3 4FFFA 3MPBA 4Q5OA 2HWC1 4PLNA 4ZKTB 2RS12 4NUBA 4HPKA 4QX8A 4QX2A 2WWUA 1OLMA 1NOVA 1BFGA 2HWB1 5I93A 1FOD3 4Y5TA 3B5LB 1W3AA 2OZJA 4E4SA 2RR11 3W5MA 4UYBA 3VBFC 4BWOA 4C0HA 3UJOA 3AJ6A 5A7SA 2QQWA 4KEJA 1DZTA 2Z48A 1G7YA 2WUHA 3H9AA 4KL1A 4PDWA 1O8SA 3IIIA 1CZTA 4D6QA 4D0QA 2ZGMA 3KM5A 3CDZB 2YB7A 3WDUA 2VUCA 2GALA 3O5WB 2ET2A 4I3PA 1U5XA 2ZKLA 2X29A 3ILFA 1V6OA 3CJXA 5A7WA 1CGPA 3WW3A 5EQUA 3ZN6B 5FWJA 2Q1FA 1A3KA 2JIJA 2YPDA 4JGYC 5C5UA 2NP0A 5FUPA 2IC1A 4LO2A 3WCRA 4EN7B 1K5MA 2GNDA 4DPNA 3DYPA 4CP9A 4HL0A 1A34A 2HLEA 4H9WA 3OJVA 2DVDA 1UAIA 1URXA 1S0EA 3I54A 1F31A 3I2OA 2FDIA 5FR3A 5F2SA 3POKA 1XNCA 5C7GA 1V70A 1RMU3 1LODA 4AFBA 1IOAA 2DUPA 1XNBA 2RMU2 4YGCA 1Y9GA 5FUNA 4UBHA 3NNLA 4KWLA 1W8WA 2BGPA 4FFIA 4I09A 4TLFA 1VBE2 1UKRA 2IZWA 3VZOA 1IJTA 1OXCA 2OQ7A 4GWIA 2W68A 3GYDA 3VUOA 1TFMB 1NT0A 4L11A 1YFUA 3BCWA 3LFMA 5A7PA 2BV4A 1SR4A 3BB6A 3IPVA 3UYJA 3WF1A 4Z07A 3I3DA 4D7YA 1X36A 1RUG2 2Q1MA 5FPVA 3UKVA 3BADA 4IYBA 3NSTA 3TAYA 1CWPA 2VMDA 2DBNA 1FMMS 4GB31 1OQLB 1PUUB 5FP9A 3P5BA 1CAWA 2XLGA 1ULEA 4ZGRB 2O8OA 4K9SA 1LULA 2GMMA 4XBQA 2XJSA 3B3QE 4WM8C 5J96B 3ZFGA 2ARAA 3PMEA 2D3SA 3A22A 4JRLA 1PGL1 1JLXA 3CHXA 4WVVA 1US3A 3H6RA 1OD3A 5EYYA 4KGQA 4KWUA 5I8YA 2P23A 3TOJA 3OTFA 3LDRA 2ETEA 4NE9A 1SLBA 2TUNA 1IPSA 1MS1A 4ONUA 5B4XA 1J1TA 4FQZA 3ROUA 3FFZA 4P00B 4AQTA 5JZGA 1GQGA 2JKBA 5FV3A 5A7NA 1GMMA 3OUIA 1HV1A 5C8WA 2E7AA 1ISZA 3D7WB 1ISXA 3O3QA 4IEXA 3R4SA 4NAOA 3P3NA 5IW0A 4LO7B 1S0CA 3MPPG 2VLCA 1Q56A 2GZWA 2KLLA 1RMU2 4OZOA 1W6OA 3OBTA 3SITA 5JPMB 3M8LA 4YFWA 4NIAA 1V6JA 4GOVA 5ISLA 4NPRA 3FJIA 4ZXKA 1JYNA 1EV12 3CO2A 3GZEA 3ZIWA 5BNOB 4QD2B 1G9DA 1PVC1 2GP3A 2VY0A 3J7NA 4XIKA 5FP7A 4C0BA 2ARXA 2E9QA 1IRPA 3TRSB 5BY5A 4LO7C 4ZONA 3C7HA 2GH2A 1RUD3 2OT7A 4XETA 5F1RA 4MZFB 5HPZA 1QXPA 2QTWB 2KD7A 2WNOA 1C8NA 1QEXA 3I2KA 5FO7B 1ND2B 1Y9MA 4YW6A 3LAGA 3WQ1A 3N9QA 1JT3A 1J83A 1AYM3 2DVFA 2MNGA 2XVGA 5BNOC 1Q03A 4OEGA 3RJRA 1QJY1 3ZPYA 3HNBM 1KEXA 1PZ7A 2XOAA 4Q0UA 2WN3A 5H9RA 5GJ6A 4I7IA 4CJMA 5FLHA 1TZOA 4OW4A 1COV3 2ZQOA 5A3MA 5T5LA 3GGLA 4P0LA 1D4M3 1Q1UA 3DV8A 1ND2C 3N3HA 5I0UA 1T4QA 3FJDA 1ST8A 4C8DA 5BNNB 5A6QA 1XB9A 1QMJA 1OOPA 3SLIA 2X2SA 3ILNA 3AYDA 1PMJX 3ILRA 1FMZA 2VH9A 2VOXA 3VHNA 3VBHA 4ES9A 1HRI1 2R32A 3AKSA 3KVAA 4XDPA 2Y9FA 5K4LA 4KEKA 3BRDA 2GP5A 1AZDA 4XCBA 9ILBA 4RR3C 1N47A 3QD6A 3VKOA 2RS33 3I49A 4Y1YA 1STMA 1SLLA 5FJHA 4BK5A 2W1SA 4E27A 3RJ2X 1RUF2 5BNNC 4J25A 5C33A 1GLHA 3NO8A 1SHWB 3JD71 4DIQA 1DZDA 1ZBE2 1QQP1 5KHGA 1WKYA 1UMHA 4NMIA 5CNAA 3T1MA 4YW4A 1WLCA 4JV4A 4BLJA 4EYUA 3N9LA 4MLOA 3WF0A 3TC2A 2JJ6A 1H8TB 1AF9A 1D2SA 3FC0A 3PUQA 3AFGA 4Q4Y1 3ZN5A 1W9FA 2PELA 1GV9A 3HOMA 2D98A 1H6XA 2A6ZA 5FOJB 1OHFA 4YG0A 5A6XA 5ABJB 2J1EA 5FYVA 5JVVA 3PU3A 3NBEA 4YVWC 3WINC 1RUC3 5A3WA 3SH3A 5CAZA 2LRPA 4A41A 2W92A 4WBBA 1D4M2 2D7FA 3DN7A 4DOUA 3KGZA 3EB7A 4N43A 3WW2A 5IVVA 4AVCA 2GNMA 1OD5A 2VUJA 3LA2A 1SZ6B 4FCAA 1V6UA 3CQAA 4JKKA 1UWWA 3K46A 3G7DA 3LCPA 4LO1A 1JT5A 4Y5Z0 2YHJA 4IL7A 1RXFA 5C6CA 1WMXA 5FMOL 2ZMNA 4DS0A 2CGOA 2VZUA 4FTSA 5FY8A 1TWMA 5T55A 1BBT3 1UOFA 2RS32 3VL8A 4FFGA 4Z2WA 1AL0G 5APAA 2HBUA 1AUYA 1HJFA 3AJYA 3P3PA 4JGZA 1BK0A 1W39A 5K8SA 4FTBA 2A71A 1ONAA 1LHOA 3BOWA 3M3EA 4A42A 3NBCA 1QDCA 1FMD3 2WAAA 3OB8A 5CU1A 4IV1A 1HLCA 3CIHA 1JT4A 4LE3A 1R092 3VLBB 1O4YA 1T6BX 4USPA 2BERA 2ORZA 3IT8A 3JB4C 1NQJA 4DCKC 1RMLA 2JDMA 5EV7A 4G9MA 1J84A 4UWDA 2W46A 3KHCA 5A80A 3LB9A 1BFFA 3FJ8A 2F6BA 2FMDA 3QLQA 3N0KA 2ES3A 4NO4A 3BU7A 5FPLA 5FZ7A 5IJRA 5BQUA 4FPFA 2PHLA 3AFKA 2HEWF 4QKBA 1KQRA 2YZ4A 1POQA 1IPKA 4QPGA 2W3JA 1RUC2 2VQAA 3WUDA 4AAPA 4YZ5A 5ACA1 5KBFA 3FLPA 4FPJA 3W21A 1JHNA 5FP3A 3TNPB 2IXJA 3NJXA 3M3CA 3U78A 4PDWB 2QDRA 2JDPA 4LO8A 3HQXA 1AVBA 4RYDA 1LCLA 3T09A 4M0NA 5HCBA 1RHI1 2C26A 2IXHA 2W1WA 3ES1A 5JI9A 1YHFA 2XGXA 4R4XA 2WQ8A 3ZXGA 1N1VA 1NLQA 1S0JA 1V6IA 2JXAA 1ZZ7A 4IGQA 3FJSA 2TBVA 4FPYA 4CEWA 5CEHA 5I91A 1SLCA 2QNKA 3B01A 5BXPA 1U5YA 1ZBA3 4JC1A 2MEV1 3BX1C 4OWKA 5T5JA 2I07B 4CP9B 3WO2A 4MX3A 3HQRA 1OFNA 4OI1A 3E5XA 4KNCA 1ZVFA 1EAH3 1X8MA 2VW1A 1YC61 4AWDA 4K20A 4V2WA 4RGGA 2P17A 4CCMA 1QXJA 2PAKA 4J1XA 4BXSV 3BTXA 4GKYA 4LK7A 3CEWA 2BJSA 2LW8A 3CA1A 3I3EA 4GH4A 3KWVA 2G19A 1W06A 5DAWA 2VM9A 4K1ZA 4XAEA 3WX5A 1F35A 5KHJA 2DUOA 1R64A 1PNGA 2BGCA 1R1A3 1AVUA 3FUQA 3DCQA 4AOCA 4YVSA 4L99A 1W6QB 1ZM1A 4AK3A 2ZR1B 5JLVA 3OGFA 4XW3A 1Q8QA 5FZ3A 4IONA 2DDUA 5FXXA 1GZWB 1JYWA 2WT1A 5CADA 3AKFA 2IFWA 1AL21 2P6CA 3LSEA 3RGBA 3ZXLA 3NV1A 3UGHA 4BMEA 2CU5A 4TLPA 2V5DA 3ZR6A 1RUJ3 1REFA 4QB6A 2VUAA 2RS52 2E7QA 2NQYA 1GNHA 3MGUA 4HG6B 4Q8KA 3LSDA 2CGPA 3C9ZA 3H6RB 3RZMA 2ZAHA 1KNMA 4X37A 4YYOA 3ETPA 3VHOA 3M70A 5F8YA 4NHMA 3RRDA 1XSQA 3AZZA 4WVWA 1S0IA 2B4KA 5K7PA 1YFWA 4K3UA 2JG9A 3WVJA 4B8EA 3I2JA 1OC1A 1SLAA 1XXNA 2FCVA 1ZBA2 4HZFA 4J1WA 4UW5A 3CL1A 1AX1A 4L92A 5FLIA 3RI9A 1CJPA 4X6RB 4K8RB 3FJBA 4B29A 1CIYA 3AKRA 1W03A 1EAH2 3LEIA 3E6CC 5L9BA 3K51A 3OEBA 3KZ4C 4AI1A 3NAPA 3POJA 4LIUA 4X3AA 4A4AA 1V6NA 2QBXA 4EFQA 2KA3A 1YEWA 3NNFA 3RWNA 3KF5A 3MALA 1G8WA 4OEFA 5BXSA 2VOKA 2WIIB 5BXTA 3Q9OA 5IVYA 1W2NA 2VVEA 3O4DA 4ISRA 2ZGKA 1W8OA 3J9SA 4J2KA 1AJKA 1R1A2 2B9UA 3NJVA 3WNPA 5JSOA 1LEDA 1W0OA 3O1TA 4I2OA 2HWD1 5I0RA 4OWJA 1UX6A 2VW2A 1S1AA 5FY7A 1DDLA 4UY4A 2ZKNA 4Q1PA 5F8SA 3UKTA 4GWMA 4BQ4A 1OUSA 1OLQA 3AK0A 4UW6A 4JQTA 4L9BA 1CAXA 4RS5C 1S0GA 5C4WA 1FV2A 3FJAA 4XJUA 1UYZA 3H7YA 3LF7A 5L19A 1RUJ2 1PZZA 1D0GA 2AACA 4IE4A 4M4RA 1OPMA 5DG2A 4FPKA 1Q3EA 4MVTA 3BAHA 2D6MA 4ATFA 4LO0A 1DHKB 1UY4A 2PA7A 2ZEZA 4HA2A 2RR13 2ZJCA 4AFDA 2V4AA 2W0XA 4HBNA 4ZU5A 5DUUA 3VBOA 2WJSA 3HAGA 3WQ0A 1OOPB 3FZ3A 1NLRA 4YWAA 1ZZCA 3SEPA 3THDA 1OVSA 4W6WA 7I1BA 4MGYE 2LROA 1DQOA 2X5IA 2OIIA 4S2HA 2Y34A 1XYNA 1FPN1 1Q04A 3WO3A 4LBQB 4OHYA 1WMDA 1AR71 1PK6B 5A7OA 2MHFA 2RM23 3C7EA 3WXPA 4ARYA 4IUGA 3ACLA 2J1VA 2XJUA 2YFZA 3GZAA 3AKQA 3KCCA 3BU0A 1ASJ2 1LGCA 3JB8A 2G1MA 1XE7A 1UN1A 2PYTA 4GJYA 5FK7A 3WNKA 5A3UA 2B9VA 2JDAA 1ULOA 1XNAA 5IVBA 2YBPA 2QE3A 4PQ9A 2ZBJA 3KHBA 3MFCA 2NZ9A 4HXCA 4NROA 2JDNA 4NVPA 3UDAA 3POIA 1PK6C 3PJYA 4TYSA 4XACA 4YARA 5LA9A 1VBB1 4BE3A 3IAPA 2FMYA 5F37A 3WF3A 3AH2A 1S55A 4INDA 1YWKA 2UU8A 1WD4A 1DCSA 2ZEYA 4HFSA 4OMDA 2MIBA 8I1BA 4G4FA 3SHRA 1JYIA 4I37A 1JT7A 5JXIA 5F32A 4HR6C 2HWE2 1TVGA 1VAKA 1H2KA 2IXCA 4XMAA 1ITBA 3BN6A 3KSCA 1OKQA 5CA6A 1GKBA 3LA7A 3ITQA 3VBFA 1CVSA 1LR5A 5A1FA 2NYYA 5F39A 1GWMA 2JE8A 1SLTA 4A7YA 1RUF1 1GP4A 5DZFA 2EIDA 5JXGA 3I2IA 2ZZQA 2YU1A 4K21A 3HEIA 1WLDA 1ZBE1 1UZ0A 1SCRA 2VECA 3I7DA 3RZZA 2VNVA 2E63A 4A6OA 1ODMA 2WRAA 3O1PA 1YUDA 1TNFA 4Y3OA 3BRFA 4DEQA 3F1RA 2UYAA 1QJU1 4JGYA 4Q29A 5M0TA 1ZREA 5IFPA 5GLTA 2WNEA 2V09A 3AMHA 1LU1A 5L73A 4Q91A 5HXVA 5F8WA 3E5QA 3KF3A 1JZ8A 1GQHA 1Q43A 2WZR1 1HB2A 3DUIA 3DF0A 3BTYA 3O1UA 1R1ZA 4IV1B 4JHTA 3VDCA 3JUTA 3HR9A 1CESA 1FNYA 4CU6A 2VNOA 5FZOB 2VTFA 5LY2A 1KGYA 1VBA1 4Q4W3 3KT1A 1M06G 1UU4A 4AEJA 1WBFA 3UD8A 2R16A 2WS92 4UF0B 1DGWX 1Y3TA 1T9FA 3FGMA 1BASA 4MZHA 2O8QA 1NXD1 2H0VA 2WINB 3FMGA 3GALA 3UESA 5IYYA 2AFGA 5FZBA 1UYXA 4F34A 2VVDA 4PLOA 4BIFA 3EYPA 3ACIA 1EP0A 5D2AA 3OJ2A 2GN7A 4XQWA 4ITCA 3BAOA 4Z8SB 2JDKA 3FX3A 3H1WA 3ECQA 4LEJA 1AHSA 1O59A 4TLGA 2WBKA 1JZ2A 4XURA 4WM8A 3ZXEA 4OUEA 3QYDA 3D82A 4AFAA 1HV0A 3VZJA 1QH7A 4WV8A 2YC0A 2VZTA 2BNMA 2LM3A 1W9SA 4ZLBB 2HKXA 5JOYA 1ISVA 3Q8FA 5FPUA 3SXWA 5DSSB 3BA4A 5IAVA 1ZYBA 4Z2AA 1VBD1 4NIGA 2RQ9A 2IHOA 4QALA 1UY0A 2Q4SA 3PVBB 5AVAA 3OSDA 5LA2A 3UL2A 4DRRA 1W9WA 2L5XA 1ULFA 1HIXA 2P6HA 4BA6A 2GO2A 4M00A 2D24A 3ZIXA 4WBCA 2XL7A 3OPTA 4QU1A 4KBZA 3KQRA 5FO8B 4CP0A 1OT5A 1RC6A 4NHLA 1ENSA 2PMWB 1PGSA 1QJX1 4QHZA 3WMVA 4DQAA 4PF5A 4UAPA 4CU7A 2LTNA 4Q4W2 2JD9A 1W04A 4QGMA 5FZCA 1MEC1 4XFCA 2W87A 5FMDA 4EE2A 3BAGA 4P02B 3KD4A 3NV3A 4XUQA 4JDNA 5FYSA 4DB5A 1JLYA 4J23B 1OA3A 4NPLA 4IESA 1VBC1 2MLLB 1O3RA 2A6VA 4HLTA 4RHV3 4URAA 3DL3A 4Q26A 1VRH3 4K7JA 4LO7A 4LKFA 4P14A 1MS4A 3O4OA 3HNMA 5E8AA 4MG2A 1WD3A 3VZLA 1XBFA 5GAQA 2Y33A 1REDA 2GC1A 2QYIB 2WC2A 4LHNA 3HSMA 4Y20B 5FY1A 3S7IA 4WZFA 1GZCA 5D8AC 1PC8B 3SKJE 5BNOA 4IGPA 5FPBA 4KG0A 4DXZA 4XJAA 4P9JA 4BQWA 3DPRB 2P3JA 4XDOA 3WDXA 4A7ZA 3H1YA 1JS9A 1GFF2 3KB5A 3ZXFA 1ND2A 4UFMA 2RG9B 3AZWA 2ZOEB 2Y6FA 3VD3A 3O12A 3ZFFB 4YG6A 5KWRA 4E8DA 1BA7A 4UFKA 2WFF2 3DXUA 4FP2A 4XF0A 3C7GA 3FUOA 2H6CA 2A1XA 2VOWA 4QDQA 3NRUA 4KG8A 5FUIA 2D6PA 3DPRC 3ZXJA 2VOVA 1GNYA 1RJ8A 1VIWB 2WABA 3BALA 3PTRB 3VZNA 4EWEA 4Z92B 1IQAA 4PC4A 3ZLIA 4RR3A 2QQIA 4CRQA 3MI8A 1DQ1A 4X8NA 1VMHA 5A3LA 2DVAA 3LKJA 3RYRA 2J42A 1RVF1 3ZFFC 1OLRA 2NPIA 3OCPA 3T1LA 5BNNA 4M4PA 4QHOA 2VJXA 2CYFA 4XFHA 4YZ4A 3VGIA 3LGRA 1OF3A 5JDBA 4RHV2 5AC93 1WCQA 2RS51 5ANQA 4K40A 1VRH2 3SH4A 4GQ7A 4QAWA 2OA2A 5LBFA 5J48A 3DYOA 2DREA 4V2VA 3WQBA 1LTEA 4AN7B 1SEFA 4Q0PA 4J2SA 1O5UA 1W8NA 2IWGB 4UFHA 2OW4A 4UW4A 5BP5C 1TME1 5FY5A 3GDBA 4TWTA 3LPGA 3H3LA 4X8PA 1V6KA 4F3JA 1U0AA 2RDSA 3NNJA 1ZRRA 4AI8A 4HMZA 4AI3A 4XABA 1KDKA 1JYXA 2LALA 5FPZA 4AGRA 3WINA 3T0BA 1FGAA 2X09A 1YXWA 1J3RA 2JIGA 5FZIA 2W5FA 4HVRA 4XHXA 3RMYA 3VBOB 2DF7A 2PAMA 3WW4A 2PQQA 4CCLA 5B2GB 5FXZA 5HPOA 1TMF1 2R0FA 3O49A 5EPAA 3LEKA 4OULA 2RVAA 3BA5A 2ZGOA 4Y1ZA 1BLDA 2VQTA 1Z78A 4I30A 4NIIA 1QJEA 1MS0A 2A75A 5DZGA 3SKVA 2D40A 4CPBD 1QKQA 4JVAA 1YQ6A 5FZAA 5BV6A 4LA3A 3PUSA 1GOHA 4NJ4A 5FZEA 3ASIA 4OYUA 1BK1A 1PO11 4ZXEA 4DINB 1WMEA 1JY0A 4I0YA 3IMNA 1YQ2A 2D43A 3NNGA 4F8AA 4ZZ8A 3ZYGA 5DAXA 1M16A 2MEV3 3BTAA 3ZXKA 3HT2A 3M3QA 2D6OX 1AYN3 1V6LA 4IEUA 2A7AA 3I8TA 3K4AA 5AC92 3WG3A 2Y6KA 3RZKA 4BDVB 1ULGA 2EIBA 2HYXA 2OPWA 3AKTA 4FBFA 3WO4A 3QOPA 3OGJA 3FLRA 4Y1VA 3TNQA 4I2SA 1X82A 3S57A 1H30A 3PVNA 3ZDSA 2VAUA 2BRTA 2CTVA 2EAAA 2GNBA 4BQ2A 1H1MA 2CV6A 3L2YA 3B9CA 1PO22 4EFRA 1S2BA 1KDMA 3A7QA 4KH9A 1LAJA 2XJPA 5CKMA 3UKNA 4I96A 3MLKA 5A6ZA 1VCLA 3B9IA 2W39A 4QPIB 1FXZA 1O6UA 2G9FA 3WHUA 2VMIA 2CWSA 3UGFA 2R073 3I2FA 3H7JA 3PMSA 1T6GC 1YO8A 4HK8A 4RA0A 3RG0A 4QPWA 5JXJA 4XF4A 4A2UA 2QN4A 1RL3A 2WN2A 4OHWA 4HKWA 4AHWA 4JGYB 1TEIA 5FLJA 4IQPA 5JXHA 4NPMA 4MYEA 4QPIC 1RB8G 1BJQA 4CEYB 4AQ6A 3LA3A 5F8PA 4C1XA 1R8NA 1RUH1 2EF6A 5E16A 3IAGC 3ZKUA 3R4DB 2WT0A 2BU9A 4AF9A 3LOBA 3O0WA 1AYN2 4FI9A 3B93A 3WV6A 4YNIA 4QX3A 3RZHA 4HVQA 3S0MA 1KS4A 4GIQA 1WCUA 3ORJA 1C8M3 2XVLA 1I3HA 3K4DA 2YV8A 3AX4A 3VZKA 3LQCA 1JOBA 4CEYC 2DCYA 1US2A 2Y6JA 3IAQA 3RZGA 1IT0A 3P6JA 2BYVE 3BUCA 1FATA 1N1YA 1V9U3 2VNGA 3N9MA 3KGLA 4CCDA 3TEWA 2AEYA 1AR63 4OI4A 1UIKA 3VDAA 1AR91 1WWYA 3IN9A 3POWA 1HKDA 5GLVA 4H75A 4NIHA 1CZVA 2HWD3 3LDBA 4CU8A 1ZZBA 3AKGA 4I0WB 4XBLA 1QHDA 5C9AB 5BVPI 4AFMA 4WM8B 2P3IA 2NS2A 4DO0A 4JCKA 2C6SA 2ADEA 1MR5A 2XJQA 2E7TA 2X10A 1RJ7A 2ZZJA 3KVBA 5E89A 4BPZA 2R072 3IDEA 4QBVA 3KT7A 4EZHA 1W6QA 5CFCB 2Q8DA 1FOD2 4YW1A 3BYWA 5GZFA 3H3ZA 3S8JA 3FBYA 4M3CA 5EP9A 1HXS3 1W0NA 4FOYA 1GZWA 4X6QB 3PURA 5C9AC 3OBRA 4PIZA 3POGA 1N1TA 2K46A 2WYSA 5BXXA 5DUXA 2MC2A 2DCZA 1DQ0A 4COZA 3SNMA 3VD5A 1G9FA 1MZEA 4DY3A 3I29B 2ZGPA 2YU2A 5CFCC 4COVA 3QBQA 2YYOA 1O3QA 4XTPA 1LOCA 5A3OA 5FZFA 3CKHA 3O7OA 4IE5A 4HANA 4AXOA 1MS5A 2QQLA 4GMP0 4H7LA 4KU8A 2I2SA 5G05L 1J59A 3NBDA 5FMOS 2HJIA 2ZGRA 1H0BA 1AR81 5KHIA 5LRSA 1O5LA 4CP1A 2ILMA 3WG4A 3WDTA 5DDJ1 2D22A 1LENA 4ARXA 1V9U2 2O1QA 2XJRA 1Z0HA 3HBWA 1XYFA 3J7LA 3DKWA 4AR2A 4QKNA 3PUAA 1AR62 1W3GA 4ZFWB 3HWJA 5KXEA 1YLLA 4GULA 1IOBA 1VE0A 2J1TA 3K1XA 4EFPA 3I3QA 3TBDA 3W59A 1GSLA 3AMMA 3CAHA 1PWAA 4AHXA 4QQPA 1YI9A 2XMLA 5JAXA 4RS5A 4E9KA 2A3WA 1LB2A 3PG0A 4ISQA 5AVPA 2FBEA 5LBEA 4QX0A 4OZXA 1CJDA 1CZSA 2PFWA 2PXJA 1WCDJ 4ZS2A 1CONA 3MIGA 5GLWA 3WP3A 1TIEA 1JTCA 5HCFA 3AXDA 3K77A 4Q1RA 4D7TA 1XRUA 4XZPA 1I1BA 3O4BA 1GR3A 2C24A 5LATA 3IDBB 3MDPA 4ES8A 3UD7A 3ACGA 3AM2A 3O14A 1MD6A 2P39A 2Q0AA 1QH6A 3LOIA 2TEPA 4K6BA 4AZZA 41BIA 5CBLA 4MHUA 2QDNA 4N7IA 4OLLA 4Y4RA 3VBRB 3FJ9A 3IDAA 5FOBB 1HDKA 4RR3B 4CDXB 4JHZA 2WKKA 1RXGA 3HBZA 5CIRA 4YFZA 3S5AA 2V72A 2W9XA 3BODA 2WWSA 2BGOA 1MACA 3HIFA 2A6XA 4D6SA 4G6MA 1PVXA 1EUTA 4G1RA 2Q30A 3K3OA 5FKBA 2Q8EA 5FRAA 3FWEA 4LBQA 3VBRC 2VW0A 3CMGA 1PK6A 4B7EA 4EN0A 4CDXC 4ZPIA 2PTMA 4Q27A 4I4UA 1GNZA 4Y24A 1GOFA 2X05A 4AG4A 4FGFA 5IUQA 1NZCA 4II0A 2B7YA 4EN9B 4FQ4A 1IHMA 3OBZA 2R063 4OI0A 2DWRA 2ZACA 3PUIA 1UPSA 2WFF1 5F9TA 2YDEA 1W99A 2CDOA 2C4XA 3AC0A 4BIOA 2NN8A 3FFQA 4QM9A 5LBCA 1TP0A 4MZUA 3AMPA 3U0ZA 4N7UA 4YVWB 1CX4A 1IG0A 2DU0A 2VGDA 1DYKA 1RUD2 2HEVF 1WBCA 5FPXA 3VSFA 3I3BA 3WMUA 3D5OA 4N53B 3ACFA 2W95A 1SACA 3H8RA 5FCCA 5A7QA 1E5IA 4DUVA 3RWKX 1AYM2 2DVBA 4J6GA 3M3OA 5F6LB 2OUJA 2P3KA 4MOAA 4FVVA 4NWVA 4GAFA 3V79C 3LEMA 2V5YA 4Q4V3 3U14A 2YGLA 5C3OA 1SBDA 2E4MA 2WWJA 4KWJA 4N53C 4XBNA 1COV2 3ACHA 1LESA 1I9RA 4ENDA 1MS8A 4BU2A 3WY6A 3E5UA 1SMVA 1Z7S3 3ES4A 3N7LA 2Q1ZB 4GP0A 1WUVA 5EJ1B 3V65A 1WBAA 5LEKA 1W3XA 1ZA4A 2E33A 4IY9A 1WLWA 2VL4A 2DBIA 2IFRA 2KKIA 1J0SA 3BKZA 4I01A 1KXGA 3VDDB 3GBFA 2YUEA 3AMNA 5FYZA 1HRV3 2GC0A 1R083 1BEV1 3U75A 4EROA 2CDPA 5A3TA 3K48A 4QO3A 1E5RA 1L7QA 2R7EB 2RJ2A 1PGW1 1H1AA 4KGGA 5F5AA 4OHZA 4MO3M 3RNSA 3U11A 4BQYA 5GZCA 2Z5WA 2FDBM 4PF1A 1JTZX 1B09A 1MEC3 1VRBA 4XDQA 2R062 1OQ1A 5FXVA 2FZ1A 2PHDA 4U36A 3VDDC 2ORXA 5A33B 5LY1A 1BMV2 1VB2A 2ZX1A 1EYBA 2W08A 3NJ5A 3DYMA 3ME2A 3ZYFA 4EWAA 3V56A 4XIOA 5CG8A 5FZOA 3RVHA 1A8MA 2CGNA 1G9BA 4F83A 3FN9A 1EUUA 4OUMA 3SISA 5CVRA 4CDQC 3PHZA 2VCBA 3JBG1 3BTZA 3N4MA 1H9WA 3JQXA 4UF0A 3ZMNA 2VNRA 3WG2A 3O1VA 2XR4A 4ET7A 3POEA 1WBLA 1K12A 4BHPA 1IS3A 1JHJA 4Z8BA 2R1BA 3J8F1 3RZLA 4Q4V2 1UW8A 4LHKA 4N8MA 2D44A 3C8XA 3BI3A 1OUXA 1JU3A 3AZYA 4LUMA 4IEPA 3Q8CA 4QQ2A 4FT8A 3SH5A 3AJZA 2QCSB 3ZYRA 1O3TA 2AQZA 4LQRA 3HN3A 4WVMB 4DUXA 3THPA 1JODA 3PLQA 2H0BA 2R043 3DKQA 3SQOA 2Z69A 4LIVA 4UFJA 3CRIA 1NY71 4IV3C 5G00A 1XZZA 2X2TA 1PIV1 3ZM8A 1JZ4A 2FGFA 1JMUB 1POV3 1LOFC 3AP9A 5BYNA 4ZFUB 2AEZA 3HPNA 3NJYA 2G9GA 3VHPA 4JP0A 3T4HB 1W2AX 3BA7A 1BBT2 1PO21 1W8UA 2E51A 3U1XA 3VSZA 2K0GA 2WNVB 1VR3A 4XJ8A 4LBLA 4C1WA 4AQ2A 4JKQA 1NG0A 3HQUA 2AH2A 3POBA 2DU1A 3QH7A 1XNDA 1YCIA 1FMD2 2HWF3 2RS11 2YGMA 5I0DA 2UUSA 4I4SA 1ZNPA 1ZRIA 2JENA 1S0LA 2E26A 3CU1B 1Q8VA 4F7ZA 2R1DA 1S0BA 2NM1A 2GSYA 4QQHA 4TSVA 4CVUA 1BKZA 4YM2A 2CAVA 3RPQA 1ZZ6A 5JIUA 2WNVC 1FWVA 4ZFYB 2VSEA 1LNSA 2EIGA 2AXMA 4HOOA 1RUE3 2BFUS 2JB8A 4G3YC 3ZX7A 1GBGA 4G6JA 1JW6A 3DGTA 4IE6A 2DURA 1W05A 1UZYA 4FP3A 3FHQA 2QQVA 1XHBA 4USOA 2WR9A 4GALA 3WNOA 3WNLA 2PHFA 2ZTNA 1KITA 3JZVA 3MV01 2QFEA 3USUA 1LOGA 4HONA 3HN1A 2M49A 2AENA 2ZAAA 4DXSA 2Y6LA 4M3CB 4AGGA 4Y20A 3TEXA 3HALA 4YG3A 3D6EA 2KM2A 4ZZ5A 1B35B 1KFXL 2XB6C 2RV9A 5DPNA 1XQNA 2R042 2YFUA 3JU9A 4Q9GA 1H6YA 3MV11 2MPFA 4BH9A 4LO2C 1A6CA 2XG3A 1NXMA 2ZQNA 1UPIA 4CCOA 3DPRA 3FJFA 1UF2C 4XAAA 1NE4A 1SBEA 1K45A 2DV9A 1UY3A 2QZ2A 5SV5A 1JBCA 4UT5A 4AVAA 3CRGA 1D0HA 2RMU1 2GC2A 4LBKA 1B35C 1RUI3 2J1SA 3ZFFA 4CSWA 4BXFA 3CU7A 2D3RA 1VBE1 6I1BA 3FBMA 4CE8A 4AN6A 5EHAA 2VVFA 4XCAA 3SCGA 4X38A 2HWF2 4LULA 4LK6A 4JRAA 1GOGA 1HN1A 4HSLA 4QHBA 4PCRA 3TN93 2UYBA 1NZKA 2XXZA 1RUG1 3VV1A 3FJEA 4KEIA 1FOD1 5IVCA 1RTVA 4RGAA 1NE6A 2D7RA 1RGSA 3UGGA 2BP6A 4QMAA 1UX7A 3GJBA 3V0BA 3H8XA 1D7PM 3ZC9A 1RUE2 5BP5A 2N7GA 3JCIA 5H9SA 1RUNA 5FFOC 3SC7X 2O14A 2D23A 5FKCA 4RS5B 4XFSA 4XFUA 1GZ9A 3PVEA 4H3WA 1HCEA 1DU3D 1VALA 5FZYA 1LJ7A 2AAIB 4L2NA 2PLV3 4XJ9A 1QOSA 2ZGSA 3NL1A 3OUHA 2KI4A 4ATEA 1NCRB 4OMCA 4IXLA 3T30A 5IK5A 4PHZA 1DZRA 1NUKA 2XBO3 4Q4X3 4XF1A 4AAXA 5C3RA 3P6IA 3PUHA 3AL5A 2P4EA 5K9YA 2VTXJ 4FPGA 1UYPA 1O3SA 2HWC3 4FXGB 1N3PA 2WDBA 1GICA 3MF9A 3RQ0A 2QQOA 2NVHA 4I4YA 5D61A 5GLUA 3ZSKA 2ARBA 3AYEA 1ZRCA 3OGVA 4IEQA 4Y26A 3M1HA 4M0HA 1CAUB 2HWB3 5K0UB 1NCRC 1FAYA 1WMFA 5DZUA 2I45A 4KC3A 3GZUC 1RMU1 4BOWA 2W52A 3MO4A 1RUI2 1W2UA 3GCWA 2ZHKA 4EQVA 4YRDA 2XHKA 3PU8A 2XONA 1UMIA 2Y38A 5FZ1A 5FNXA 4ZOTA 2G9ZA 2WLPA 4QKDA 4UW3A 1EV11 3AKPA 3WNXA 3CJIB 3ZXDA 4Q8LA 3KCYA 5C3PA 1UD1A 4BQXA 5K0UC 2DFBA 2YBKA 5FK8A 3TN92 3IM6A 2A70A 1L7RA 4ASKA 5DUYA 2PHTA 4A45A 3RTIB 2FO1A 2Q5TA 3POYA 1Q8OA 2UY8A 4RGKA 4XUTA 5FP4A 2FZ2A 2YROA 4ZU7A 3FJCA 4IEYA 3H6QA 3ZYPA 2KR2A 2BFHA 1XC6A 3PNAA 2FDGA 1LOBA 3CJIC 1WW4A 3IIAA 3VZMA 4YM3A 2RDQA 1W6PA 5JOZA 3P53A 2EXIA 2BFUL 4UBGA 3T08A 2GN3A 5BOWA 4NWWA 1V6VA 1YFXA 5FMBA 4AEDB 4CDUC 3APBA 3H6SE 2D97A 4YZ1A 3Q8AA 2XBO2 5LB6A 2LUWA 3MIFA 3IIRA 4EB2B 2EXHA 4GAZA 1IHKA 4DNYA 1N3OA 2CL2A 3H3UA 3NKGA 1XYPA 4N9HA 4P9GA 2J3PA 2HWC2 3IM7A 4BYYA 4H2AA 4RD7A 2XL9A 5BPXA 1FQ9A 5LA1A 5LEJA 4HJJA 1H4GA 3W9AA 1HB4A 1Q8PA 3POFA 3VBHC 2HWB2 1O7FA 1W2OA 1YIFA 3AZVA 3MF6A 2VBBA 5FYIA 4AEDC 4DFSA 4LA2A 4D8MA 4GB33 2RR12 1APNA 3MHZA 4O65A 5LA0A 4QPIA 1JUIA 4TTGA 2YC2A 1C4RA 2A3YA 2NMOA 1FT9A 3R6SA 4CP2A 4P0KA 1DQ2A 1LGNA 4XHBA 4W4ZA 4I02A 5JCTA 5IHRA 1W9YA 2WO1A 3MBWA 3G6JB 2BW8A 3AP7A 2RM22 1MPXA 1TG7A 1ZZ8A 4P5HA 3T0AA 1RUD1 3JUUA 4YGDA 1T2XA 1DBNA 1FX5A 1QDOA 4KQ7A 4CEYA 1C1LA 1PMHX 2E6VA 1KRIA 1IILA 2J1UA 3EXUA 4Y4YA 3S6PA 1MS9A 1AYM1 3OYWB 5JR7B 2B46X 3WHTA 5KXBA 3D0SA 3CRHA 4QX1A 5ANNA 1AX0A 3WP4A 1PMIA 1K42A 1YI7A 2JG8B 1XSRA 2ET7A 5CISA 5HXMA 31BIA 2DS0A 3PUBA 1COV1 3ALQA 3HD8B 21BIA 2OX0A 1D4M1 4YW5A 2QQUA 4IE7A 3VWCA 3A07A 2O0OA 3WINE 4AVSA 1HWNB 2J7MA 4XEZA 2B45X 4XYXA 5FYUA 1UNBA 4PIXA 4MGIE 3BOPA 3AZXA 2HWAA 5FZKA 1PVC3 3GXUA 2JG8C 3DXTA 2H6BA 3VKNA 1S0FA 4KMQA 3DECA 4JTOA 4R9DA 3ST7A 1DLCA 3PIGA 2VR4A 2RS31 1Z2VA 5CZKA 1DGWA 2XLAA 2VPVA 4GB32 5FZDA 5C9AA 2EICA 4OUJA 2ZX0A 3RFRA 1UZWA 1AVWB 1RIRA 4YPJA 1CAVB 1X33A 2CSGA 3TEZA 4LXLA 1BMV1 1DFQA 1QJY3 4QPYA 1W2TA 5CFCA 4AL9A 3BPZA 1R091 4LBMA 3WCSA 1GQPA 4B4PA 3A21A 5EYXA 1W9TA 3ZC8A 2JKXA 3O5SA 2WA3A 4Y1UA 2EA7A 3VDBA 3AJ5A 1C57A 4UFIA 4KWKA 4W65A 1FN0A 5L7OC 4IW3A 3MW2A 5E6HA 1Y7BA 1TWEA 4EWDA 3N35A 4YW7A 2CY6A 1HRI3 2BZDA 2BNOA 3GNEA 4EZ4A 1YFYA 1E5SA 3VKFC 3KMVA 2XWJB 3CNAA 4O7XA 1RUC1 2EXJA 5CKQA 5C8CB 1TTUA 3OOXA 4CUCA 4IEWA 2RHPA 5FDBA 1OSGA 4Q0SA 1JYVA 2Y8KA 3U4SA 2IXLA 4MGTA 4I3GA 4NHKA 5D8AB 2BTVC 3JD73 1RZOB 5F3GA 1H2LA 5DZEA 5BUVA 1QQP3 2RG4A 1WCSA 2E31A 4LHSA 1GANA 3ZYHA 3E6DA 2UURA 2VBDA 3SEEA 1VMJA 4XQ4A 3USUB 5F3EA 5FBJA 1XE0A 5C8CC 5EWSA 4OHXA 3HJRA 4IZXA 3KT4A 4XF3A 2Y0OA 4JDMA 5FXWA 5A70A 1OMIA 3MIDA 3QH6A 5FZ0A 3K3NA 4FSJA 2ESUA 1RITA 4Q4Y3 3AH4A 4G9SB 4WVZA 4YGBA 4OQ9A 4B1LA 2LIEA 3AKHA 4TXWA 3R05A 2OUHA 2V4VA 1OF4A 3E6BA 3OPZA 3WDWA 4AVVA 5JOWA 1ABRB 2D5HA 3CQOA 3NKTA 5EG6C 5LBBA 3BAQA 4I4VA 3WNMA 1FNZA 1OI6A 3E1F1 1DYOA 4I4RA 2R0HA 3BGAA 5EFUA 3MYXA 3W5NA 3AH1A 3K2OA 4I4PA 2VZ1A 2VCAA 2VZPA 5B2HA 3VBRA 4QWNA 2QQMA 4X39A 4DY5A 3A23A 5FQ0B 5FAXA 4CDXA 2VC9A 1LRHA 1DQ6A 4MADA 3URFA 1BEV3 1S2EA 4CXYA 5F5QA 3U10A 2FQPA 5GZGA 3V0BB 2KXLA 4AFCA 1HIBA 3CA5A 5BXRA 2CAUA 1UKGA 3JD72 4IEZA 1I5ZA 4LKDA 4XILA 3CF6E 2WZEA 1QQP2 3GZTB 4YZ3A 5IFTA 5EJ3A 1LHNA 3BPSA 1LKNA 4LO3C 1IG3A 3CA0A 1AVAC 1GUIA 4QXKA 3H42B 1JOJA 2IXKA 2E32A 1ULCA 3I2HA 1NA1C 4OI2A 5A6YA 2ZGLA 1H2NA 2PHUA 1AXMA 4Q4Y2 1ZBA1 4M3CE 1CD3G
chains in the Genus database with same CATH topology
2NTDA 4MXVA 1CE7B 1YNAA 3KCXA 2QQPA 1L2HA 3PJQA 2A6WA 4RFT0 4YVWA 3MZHA 3UJ4A 1EAH1 5KXDA 1BLAA 4I4QA 4N53A 2XLFA 5ACA3 1BQPA 1JXNA 2AREA 3JQWA 4GAIA 3D4KA 4DMIA 1JH5A 3Q7XA 2HW9A 3SMHA 2JE7A 1XU1A 4D3WA 1ND3C 3WP6A 3FJJA 5JOXA 5H9PA 4IY8A 1R1A1 1VB4A 1RHI3 4NOTA 4ORFA 3B00A 3SCFA 2XWBB 3BAUA 3RTJB 3TB0A 3QACA 1MZ6A 5BNPC 5EZWA 1V6WA 3VT2A 2PHWA 1H2MA 2OVUA 5I8TA 4COYA 3E8LC 4FO9A 4AW7A 3VDDA 4ZA3B 3L2HA 2R30A 1RUJ1 1W6PB 1ILR1 1QNWA 4HETA 2AYHA 3AP4A 3A0KA 4CDQA 2GNTA 3FJHA 2B5HA 3Q7YA 4AI0A 4RQPB 2BVVA 5A33A 1UZZA 1PZ9A 4HKLA 4QQLA 3ZO0B 2X53S 4O9GA 1QXRA 4OUSA 4PJYA 1UCXA 5JSRA 2GH8A 5E88A 2X5IC 2VSAA 1OFSA 5ACA2 1AXZA 2GC3A 4RQPC 4QGLA 4PBOA 1XG6A 1ASJ1 3IBMA 4LO5B 3THTA 3PTYA 4YM0A 1AL23