3FVEA

Crystal structure of diaminopimelate epimerase mycobacterium tuberculosis dapf
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
290
structure length
283
Chain Sequence
b'HMIFAKGHGTQNDFVLLPDVDAELVLTAARVAALCDRRKGLGADGVLRVTTAGAAQAVGVLDSLPEGVRVTDWYMDYRNADGSAAQMCGNGVRVFAHYLRASGLEVRDEFVVGSLAGPRPVTCHHVEAAYADVSVDMGKANRLGAGEAVFHGLAVDVGNPHLACVDSQLTVDGLAALDVGVSFDGAQFPDGVNVEVLTAPVDGAVWMRVHERGVGETRSCGTGTVAAAVAALAAVGSPTGTLTVHVPGGEVVVTVTDATSFLRGPSVLVARGDLADDWWNAMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diaminopimelate epimerase
publication title Structure of the diaminopimelate epimerase DapF from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
total genus 69
structure length 283
sequence length 290
ec nomenclature ec 5.1.1.7: Diaminopimelate epimerase.
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01678 DAP_epimerase Diaminopimelate epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 3fveA01
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 3fveA02
3G7KA 5H2YA 2H9FA 1YM5A 3FVEA 1W62A 2PW0A 1SDJA 4K8LA 4JCIA 1U1XA 1TM0A 1QYAA 5IWEA 1BWZA 2Q9JA 2Q9HA 4JD7A 4LB0A 3EKMA 1QY9A 3EDNA 4Q2HA 1GQZA 5HA4A 1U1WA 5M47A 4IK0A 1T6KA 1U1VA 4K7XA 1S7JA 4J9WA 4JBDA 5H2GA 1U0KA 4Q60A 1XUBA 2AZPA 4JUUA 3EJXA 2GKEA 1W61A 2PVZA 4K7GB 1XUAA 4J9XA 2GKJA 4DUNA 2OTNA 4IJZA
chains in the Genus database with same CATH superfamily
3FVEA 1I74A 3PTJA 1U1XA 1TM0A 1BWZA 2Q9HA 4LB0A 2QB7A 4PY9A 4IK0A 4OA3A 2KPTA 2EB0A 2YMAA 3IGHX 4JUUA 2LT2A 2H9FA 1YM5A 2ZVFA 3WQZA 2PW0A 2HAWA 4K8LA 2Q9JA 3EKMA 3EDNA 1GQZA 4RPAA 1T6KA 1S7JA 4J9WA 1IR6A 2AZPA 2KW7A 2ZXPA 2QB6A 1W61A 4J9XA 2GKJA 3PW9A 2ENXA 2OTNA 2IW4A 3G7KA 5H2YA 1SDJA 5IWEA 1QYAA 2QB8A 2ZXOA 4LS9A 3PVHA 4K7XA 4JBDA 5H2GA 1WPPA 2MPBA 1XUBA 4GL6A 3EJXA 4LG3A 2GKEA 1K23A 3G98A 4DUNA 4IJZA 1W62A 4JCIA 4JD7A 2ZXRA 1QY9A 1K20A 4Q2HA 5HA4A 1U1WA 1WPMA 5M47A 1U1VA 1U0KA 3ICJA 3W5WA 4Q60A 3DEVA 2PVZA 4K7GB 1XUAA 5ANPA
chains in the Genus database with same CATH topology
3FVEA 1I74A 3PTJA 1U1XA 1TM0A 1BWZA 2Q9HA 4LB0A 2QB7A 4PY9A 4IK0A 4OA3A 2KPTA 2EB0A 2YMAA 3IGHX 4JUUA 2LT2A 2H9FA 1YM5A 2ZVFA 3WQZA 2PW0A 2HAWA 4K8LA 2Q9JA 3EKMA 3EDNA 1GQZA 4RPAA 1T6KA 1S7JA 4J9WA 1IR6A 2AZPA 2KW7A 2ZXPA 2QB6A 1W61A 4J9XA 2GKJA 3PW9A 2ENXA 2OTNA 2IW4A 3G7KA 5H2YA 1SDJA 5IWEA 1QYAA 2QB8A 2ZXOA 4LS9A 3PVHA 4K7XA 4JBDA 5H2GA 1WPPA 2MPBA 1XUBA 4GL6A 3EJXA 4LG3A 2GKEA 1K23A 3G98A 4DUNA 4IJZA 1W62A 4JCIA 4JD7A 2ZXRA 1QY9A 1K20A 4Q2HA 5HA4A 1U1WA 1WPMA 5M47A 1U1VA 1U0KA 3ICJA 3W5WA 4Q60A 3DEVA 2PVZA 4K7GB 1XUAA 5ANPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G7K A;  5H2Y A;  2H9F A;  1YM5 A;  3FVE A;  1W62 A;  2PW0 A;  1SDJ A;  4K8L A;  4JCI A;  1U1X A;  1TM0 A;  1QYA A;  5IWE A;  1BWZ A;  2Q9J A;  2Q9H A;  4JD7 A;  4LB0 A;  3EKM A;  1QY9 A;  3EDN A;  4Q2H A;  1GQZ A;  5HA4 A;  1U1W A;  5M47 A;  4IK0 A;  1T6K A;  1U1V A;  4K7X A;  1S7J A;  4J9W A;  4JBD A;  5H2G A;  1U0K A;  4Q60 A;  1XUB A;  2AZP A;  4JUU A;  3EJX A;  2GKE A;  1W61 A;  2PVZ A;  4K7G B;  1XUA A;  4J9X A;  2GKJ A;  4DUN A;  2OTN A;  4IJZ A; 
#chains in the Genus database with same CATH topology
 3FVE A;  1I74 A;  3PTJ A;  1U1X A;  1TM0 A;  1BWZ A;  2Q9H A;  4LB0 A;  2QB7 A;  4PY9 A;  4IK0 A;  4OA3 A;  2KPT A;  2EB0 A;  2YMA A;  3IGH X;  4JUU A;  2LT2 A;  2H9F A;  1YM5 A;  2ZVF A;  3WQZ A;  2PW0 A;  2HAW A;  4K8L A;  2Q9J A;  3EKM A;  3EDN A;  1GQZ A;  4RPA A;  1T6K A;  1S7J A;  4J9W A;  1IR6 A;  2AZP A;  2KW7 A;  2ZXP A;  2QB6 A;  1W61 A;  4J9X A;  2GKJ A;  3PW9 A;  2ENX A;  2OTN A;  2IW4 A;  3G7K A;  5H2Y A;  1SDJ A;  5IWE A;  1QYA A;  2QB8 A;  2ZXO A;  4LS9 A;  3PVH A;  4K7X A;  4JBD A;  5H2G A;  1WPP A;  2MPB A;  1XUB A;  4GL6 A;  3EJX A;  4LG3 A;  2GKE A;  1K23 A;  3G98 A;  4DUN A;  4IJZ A;  1W62 A;  4JCI A;  4JD7 A;  2ZXR A;  1QY9 A;  1K20 A;  4Q2H A;  5HA4 A;  1U1W A;  1WPM A;  5M47 A;  1U1V A;  1U0K A;  3ICJ A;  3W5W A;  4Q60 A;  3DEV A;  2PVZ A;  4K7G B;  1XUA A;  5ANP A; 
#chains in the Genus database with same CATH homology
 3FVE A;  1I74 A;  3PTJ A;  1U1X A;  1TM0 A;  1BWZ A;  2Q9H A;  4LB0 A;  2QB7 A;  4PY9 A;  4IK0 A;  4OA3 A;  2KPT A;  2EB0 A;  2YMA A;  3IGH X;  4JUU A;  2LT2 A;  2H9F A;  1YM5 A;  2ZVF A;  3WQZ A;  2PW0 A;  2HAW A;  4K8L A;  2Q9J A;  3EKM A;  3EDN A;  1GQZ A;  4RPA A;  1T6K A;  1S7J A;  4J9W A;  1IR6 A;  2AZP A;  2KW7 A;  2ZXP A;  2QB6 A;  1W61 A;  4J9X A;  2GKJ A;  3PW9 A;  2ENX A;  2OTN A;  2IW4 A;  3G7K A;  5H2Y A;  1SDJ A;  5IWE A;  1QYA A;  2QB8 A;  2ZXO A;  4LS9 A;  3PVH A;  4K7X A;  4JBD A;  5H2G A;  1WPP A;  2MPB A;  1XUB A;  4GL6 A;  3EJX A;  4LG3 A;  2GKE A;  1K23 A;  3G98 A;  4DUN A;  4IJZ A;  1W62 A;  4JCI A;  4JD7 A;  2ZXR A;  1QY9 A;  1K20 A;  4Q2H A;  5HA4 A;  1U1W A;  1WPM A;  5M47 A;  1U1V A;  1U0K A;  3ICJ A;  3W5W A;  4Q60 A;  3DEV A;  2PVZ A;  4K7G B;  1XUA A;  5ANP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...