3FVFB

The crystal structure of prostasin complexed with camostat at 1.6 angstroms resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
248
structure length
248
Chain Sequence
ITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPISLPAAQASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNSLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostasin
publication title Active site conformational changes of prostasin provide a new mechanism of protease regulation by divalent cations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 51
structure length 248
sequence length 248
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fvfB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fvfB01
5A0CA 1SOZA 1MBMA 2F9VA 1ORFA 1TQ0B 1TGCA 2OBQA 2D26C 1N8OC 4GLYA 2FYQA 3LGYA 1OWEA 1SG8B 3ZVCA 4A92A 2G5NA 1P02A 1HAIH 1CA8B 1PPHE 1EAUA 3MH7A 4XSKU 3H7OA 4MG3A 1GJDB 3TGIE 3LC5A 1ZGVA 2AGEX 1VCPA 3ZVFA 4BANB 1P9SA 1HAZB 4ZKRU 4DIIH 2C90B 1Z8JB 1BTZA 1WUNH 3O8BA 1P2JA 1A5GH 1GMDF 3L3TA 1BMAA 2AS9A 3TNSA 2Y7ZA 1ZPZA 4Y76A 3FP8E 4UE7H 3SNCA 2SFAA 3DFJA 5L30H 6ESTA 2BDBA 2H5DA 3OYPA 1HXEH 4ZHLU 3L33A 1HXFH 5GPIB 3R3GB 5CMXH 1C2HA 4AORA 1HAOH 4FUDA 4NSVA 4CH2B 1BTUA 2Z6BD 3GISB 4LK4A 1GHXH 3SW2B 2Y80A 1QGFA 2BDCA 2HNTE 3HK6B 3KF2A 4ISLA 2A32A 3BIUH 3TGKE 2ZCHP 2HPPH 1ZPCA 4AYYB 3MO9A 3A83A 1UTJA 4X6OA 1BTPA 1FY8E 3ZZ9A 1DY8A 4E7RG 1GI0A 4BAQB 1T32A 4MTBA 1XVOA 3ZVEA 3RC4A 5GIBA 2P94A 1NRPH 3SU0A 2BDGA 1O5FH 1DUAA 4JK5A 3SV8A 3DT0H 2FPZA 4AB8A 2QIQA 1HJ8A 1EAWA 1G37A 1DLEA 1C5LH 1QBOA 2GTBA 3AVZA 4HTCH 1FY4A 3F9FA 4LXBH 1UMAH 2XCNA 1UVOA 3L6PA 3GICB 2PW8H 3QZQA 3V13A 1GBLA 1B5GH 1FY5A 1DANH 3AASA 3LJOA 1Y3UA 3AW0A 1SI5H 3Q00A 1BTHH 3E16B 1QJ1B 1C1PA 2AGGX 1HAHH 1KLTA 1L1JA 3UY9A 2CMYA 2R2MB 3S7HB 1BTWA 3M3SA 3S7KB 5J4SA 1V2RT 3KCGH 3LC3A 4KGAA 1C5VA 4Y0ZE 1HV7A 1J15A 5C1XA 3VB5A 5EXMA 3UNSA 1FNIA 1OYQA 4BAOB 2FI3E 1HJAC 1HNEE 1DE7H 1ARCA 1J16A 3A88A 1GHAG 5GDSH 4ZXYH 1ZSLA 3DHKH 4U01A 5C2ZA 1C2EA 4LZ4B 4CR9A 1Y59T 1EP6A 2FI5E 1FV9A 3SV7A 2BXTH 1GJ7B 1J17T 3GCHC 2ILNA 3MI4A 1AKSA 1OXGA 2BLWA 4RKOB 1ZMLA 3QTVH 3SGBE 2PWXA 1YKTA 2C3SA 5A8YA 2ZFQH 1F5RA 3GY4A 2FS9A 2SGEE 1TPSA 1P01A 5PTPA 1D3DB 2A45B 1EB1H 8GCHF 1SLXB 1W11U 5F03A 4JCNA 3URDA 1DS2E 1FLEE 2BLOA 4NA8A 1YGCH 1ZJDA 2G8TA 3LDXH 3B23B 4K2YA 1DWEH 2DE8A 3LGTA 2BX3A 2EEKA 2EA3A 1SB1H 1HAXB 3LJJA 4ISHH 4U32A 2VH6A 3LGVA 4CBOA 3EAJA 3KN2A 2PR3A 4AFQA 1IQIA 4YM9A 1KY9A 1K1JA 2QV1A 3DA9B 2G00A 2AIQA 1MU6B 1K21H 3T5FH 4FUGA 1VCWA 1GI2A 3SU2A 1K1OA 1Z1JA 2ZDAH 2VWNA 9ESTA 2V6NA 1EXFA 3SU3A 1UTOA 1T7CA 4HGCA 2PTNA 1Q2WA 3BTFE 2A4RA 2BD4A 2VIQA 2FZZA 1ZR0A 1ABIH 1P10A 1DVAH 1QTFA 2WV5A 3GY8A 2Y6TA 2DE9A 1ELBA 2W7SA 2WPMS 3M5MA 2ZDNA 3GY7A 1TWXB 4ABDA 1O2YA 1UTMA 1MTUA 1OOKB 4J2YB 1BA8B 2ZDLA 3D62A 2FTLE 4K3JA 2QXGA 3LONA 3T62A 1KXCA 1E37B 1UCYK 2IN2A 4OS4A 3TVJB 3IITA 3DUXH 4YOGA 3FAOA 1P11E 1MQ6A 1P09A 1IHSH 1ARBA 3GY3A 3SU1A 1HFDA 3W94A 1RIWC 4NIXA 2ZGXH 1S82A 1BCUH 3IWMA 1TAWA 4MNWA 1BOQA 2G4TA 3UWJH 5EODA 3BTKE 2ESTE 2ZNKH 2R3YA 1AZ8A 2A7JA 1P06A 1G3BA 3RXTA 3RXQA 2QN5T 3TK6A 1TRNA 1AE5A 1QRXA 2FWWA 7GCHG 1O3BA 1QY6A 4CRGA 1NTPA 2PHBA 2ZWLH 3OY5U 4H4FA 2VGCB 2CJIA 2A4GA 3GCTG 4CH8B 2UUFB 3GY5A 3RXRA 3M35A 1Y8TA 4WF8A 4ABJA 2QF0A 2IOTA 1EUFA 4GCHG 5LPEA 4B1TA 3TPIZ 3Q3YA 1RFNA 3QO6A 1L1GA 3I77A 4Y0YE 4JZIA 3A7XA 4MNXA 3Q77A 4DCDA 1TBZH 4Q80A 3UQOA 1C5WB 3FP7E 1AB9C 3KQBA 3UWIA 1Z71A 2SGDE 5TCCA 4WMFA 1GBFA 7LPRA 4FUFA 3RXBA 3PO1C 4NA7A 1S0QA 5AFYH 2P8OC 1PFXC 2QXJA 4B73A 3RU4D 4AGJA 1ETSH 1D3PB 1ACBE 1VITG 4ZROA 1U6QA 1TFXA 1EJAA 4INLA 2BMGB 4NWKA 1A5IA 5GCHF 1ANEA 1GMHG 2XC4A 3PMJA 1RTKA 1ANCA 1UVPA 4Z0KA 3G01A 1SGCA 2HWLB 3RXLA 3SUFA 1FIWA 1KIGH 1HAPH 1WBGB 4CRBA 2R9PA 1Z8IB 1KDQB 1P12E 2HGTH 3K2UA 1YPLH 1UTKA 3DD2H 3RXOA 3Q3XA 2LNCA 2J34A 1SLVB 1UVUH 1M9UA 4D7FA 2HRVA 2ZCKP 1QRZA 3GYMA 1GI4A 1P05A 5E2OA 2BYAX 4B71A 3RXMA 3SU4A 1NT1A 4XOJA 3GOVB 2ZU2A 4INKA 1JWTA 1V6DA 1AD8H 1BIOA 1BQYA 3TJVA 1OPHB 1AHTH 3ZVBA 1GJ8B 4XBCA 2G52A 1ZTLA 4AB9A 1OKXA 3A8BA 1PQAA 1UHBB 5LGOA 1C1TA 3QN7A 4O3UA 1YCPK 1UCYE 3F9EA 4THNH 3BV9B 1DICA 1NC6A 2O8MA 2QF3A 5EXNA 1O2KA 4ZUHA 1EX3A 1NRSH 2CF9H 3NKKA 4TPIZ 1MH0A 2ZKSA 1RJXB 2GZ7A 1Y5AT 1K1MA 1ZHMA 4NIWA 2BDHA 1Y5BT 1DLKB 2AMPA 1YC0A 2AGIX 2GDDA 5C1UA 3URCA 4ABGA 4BAHB 1TNHA 3ENSB 4JK6A 2GV6A 4ZKOU 2TPIZ 4GVUA 3GYLB 4X8SH 3A86A 3K6YA 1LVOA 1ZOMA 1KXEA 2ZHFH 2P95A 3MYWA 3NPSA 4WMEA 1TOCB 2TGDA 3SNDA 4ABAA 3UNRA 3RLWH 3UOUA 1Z6EA 5ESTE 1IQEA 1O3CA 1TA6A 2GCTB 3SHCH 3P70B 1AE8H 2OTVA 3SV9A 2XBXA 1C5NH 4A1XA 1YPJH 1D9IA 1BMLA 2Z94A 5BRRE 1LQEA 3M7TA 3M5LA 5E2PA 3SQEE 3RXCA 3LPRA 2BD3A 4VGCC 4BTIB 1ELFA 1VZQH 1W3CA 4I31A 4FVDA 3SV6A 4K1SA 3MNBA 1GMDG 1BT7A 2P93A 1SR5C 1C9PA 3AW1A 3RXSA 1LKAA 1GBEA 3U1IB 1O33A 3GDUA 2BVSH 4UFEH 2FOAA 1GL1A 1AUTC 3HKIB 4TYDA 4CHAB 2B7DH 1A7SA 4OS1A 1A46H 5EU8A 2UUKB 2UWOA 1HLTH 1LHCH 2TIOA 1IQJA 2ZTYA 2A1DB 4MPXA 1DPOA 4D76A 3NZIA 3SHAH 1A3BH 1C1RA 2PKSC 4ABHA 1JXPA 1W7XH 2VVCA 1YBWA 3B9FH 1AY6H 1O5GH 2C93B 2A31A 3F1SB 4YOIA 2GD4B 2XC0A 2G5VA 1AMHA 3MO6A 1DXWA 2V0BA 1F0RA 3S0NA 5DPAA 1AZZA 4TY7A 2ZU5A 2FI4E 2ZDVH 1P2MA 2CGAA 4CRCA 1WTGH 1DWCH 1TONA 2BM2A 1A61H 3RXEA 1CE5A 4Y79A 2VIVA 1JBUH 4ISNA 4YLQH 2VVVA 6CHAC 7ESTE 2C8YB 3BTQE 5DP6A 1NRQH 2Z9GA 1MCTA 1O2IA 3SNAA 4XFQA 1FY1A 1V2QT 4MPUA 3BSQA 1G2LA 1KLJH 2ZC9H 3FP6E 4ASHA 1UTLM 5EXLA 2G4UA 3MH4A 1MQ5A 3ZZ8A 2FOMB 3E8LA 4FUIA 2R0LA 3EDXB 3A84A 5JDUB 5ABWA 4K60A 4Y8YA 1GGDB 4WJG2 3M36A 4X8VH 1TX6A 2B8OH 1BMMH 2GMTC 1MD7A 3JZ1B 3MWIU 1DSTA 4NZQA 2ZU3A 4ABIA 3O8CA 2ZHWH 2THFB 5HM9A 4ZMAH 3BIVH 4ESTE 1VJ9U 1O38A 2ZFSA 1OYTH 2V3OH 1A2CH 1QB6A 2QXHA 1O3LA 1O30A 1HRTH 2R0KA 2FLBH 2XBYA 4K8BA 2BY9X 5DJ7A 1T8OA 3UREA 4B2CA 1IOEA 2YNAA 1G9IE 3RM0H 1C1UH 1CHOF 3KEEA 1A5HA 4WXIA 3SU5A 3PMHB 1SGFA 2FLRH 5A8ZA 2AFQB 2EC9H 3VXFH 3ZZ6A 2RDLA 2XW9A 3SI3H 1AN1E 1W7GH 1HYLA 3M7UA 3BEFB 4A1TA 5LPFA 1UJ1A 4KELA 4WH6A 1C5OH 2JH5D 2WPLS 1GI1A 1P9UA 3P8GA 1DOJA 1B7XB 1FXYA 4ZHAA 3SV2H 3P8NA 2XNIA 1TE0A 2LPRA 1IQLA 1W0YH 1O2JA 1Z8GA 3BF6H 2JH0D 4UFGH 2PFEA 1TIOA 4GAWA 5FPYA 1PPEE 1AVGH 4DGJA 1C2KA 1GCTC 1L4ZA 3P8FA 8ESTE 4IBLH 2NWNA 1SQAA 1GHZA 1PPFE 3WY8A 4ABFA 1S83A 2IJOB 3IG6B 1T8LA 4TY6A 4F49A 1E36B 1MTVA 3T29A 3LU9B 1BJVA 4B75A 1T8NA 4SGAE 2C8XB 1UK3A 1V2NT 4BTTB 2FM2A 4FU7A 1SGRE 2FS8A 3EE0B 4KTCA 1G3EA 1HAVB 1ZHRA 5C5NA 2ANKH 1HJ9A 3TK9A 3ZVGA 1HBTH 1JMOH 5AF9H 1F5KU 2ZDMA 5DP7A 4FU8A 4X1SU 1C5MD 1F5LA 1EOLA 2OQUA 3M3VA 1OS8A 4BXWA 1GI3A 1ZZZA 1P2IA 1CBWB 4AX9H 2PSYA 1ESAA 5FXLA 3RDZA 2EI8A 1BBRH 4YT6H 1SLUB 2GVFA 1PYTC 2OLGA 2YOLA 1W0ZU 1FI8A 1W10U 4Q7XA 1HIAB 1V2VT 1MKXH 3C27B 3PYHA 5E0HA 4NG9H 3H5CB 1XKBC 3SJOA 1BRAA 1CA0C 5LPRA 1O3IA 1GI9B 4A5TS 1KTSB 4NIVA 2NU2E 2P59A 2WUBA 4NCYA 1F0UA 1P2OA 1PYTD 1H8IH 2SGFE 4PROA 4AG2A 5DK1A 1BRCE 5C20A 4GHTA 3PMAB 4Y11E 1GBHA 5JBAS 4INHA 2BY8X 5DO4H 1BITA 2BDIA 3TJOA 1P3EA 1JIMA 2OBOA 1MAXA 1UTNA 2BQWB 3S9CA 1CGIE 2UWPA 3MNXA 3M7QA 4IN1A 1QBNA 5BPEA 1VGCC 1O3DA 1G36A 1CGHA 4X1RU 3VB3A 5FHTA 1GI6A 1F0TA 2BB4A 1GI7B 3HPTB 1AVXA 5HGGA 2ZGCA 4GUXA 2VVUA 4X2YA 1D3QB 1E34B 1TLDA 4JYVH 3SI4H 3RM2H 3Q76A 4X6NA 2FTMA 3SOSA 2FEQH 4O9VA 4X1PU 1A0JA 1XUIA 2GZ9A 4NFFA 3SGQE 5GCHG 1KSNA 2JETB 1RTFB 4NZLA 2VWLA 2D1JA 3MMGA 5HM2A 2ASUB 3SJ9A 1T8MA 2Z9JA 2XYAA 1QL8A 2AMDA 3F68H 5CHAC 1A1RA 1C5XB 1NO9H 3SUGA 4UD9H 2VB0A 3S69A 4H42U 1CQQA 1QB1A 1O0DH 1E0FD 4X6PA 3I29A 2A7HA 4X0WU 1IQMA 3E0NB 2C8ZB 4OS7A 2WV4A 5DP4A 3LGUA 2WPIS 1NY22 3ATKA 1HUTH 1LKBA 2F9UA 1AU8A 3RMNH 3UR6A 1BTXA 2F9BH 1CU1A 2FX4A 1K1PA 3RMMH 1GCDA 1XXFA 1AFQB 1TRMA 1FAXA 1MKWH 3P17H 3V12A 3LT3A 3RXAA 3E0PB 2RCEA 5EQRA 2BXUH 1S85A 3NXPA 5GWZA 1K1LA 3F9HA 1GVLA 2W26A 1O2XA 2XWBI 3UUZA 2ZEBA 5JBBS 1D6RA 1WAYB 1AO5A 1C2GA 2ZGBH 4ZHMU 3UR9A 1DY9A 1KDQA 2VJ1A 2RA0A 2BQ6B 1GHWH 4YO9A 1B0FA 4D9RA 2FESH 2VWMA 3UTUH 1SGDE 1V2TT 1LQDB 2Y5GA 2VIOA 1XUFA 1P2QA 1TABE 5AFZH 3KQEA 1FY3A 5T6GA 1O3MA 1FZZA 2FOCA 2STAE 3ATMA 3RU4E 1GBBA 2ALPA 1VJAU 1C4Y2 4Y7BA 2ZF0H 5C67A 3A82A 1H9IE 1Y3XA 1MTNB 3N7OA 1W12U 1EPTB 1TMUH 5DG6A 1WQVH 4A6LA 2ZFTA 3E1XB 1DWBH 1V2MT 1MMJN 4D8NA 2CHAB 1SHYA 3QWCH 1UHBA 2F9PA 1O2HA 3AAUA 3UFAA 1NESE 1XKAC 3RUOA 1RD3B 3HKJB 1J14A 4SGBE 1OP0A 1SGYE 4MPVA 1TPAE 1LVBA 3A8AA 2JKHA 2ZU4A 1K22H 4TPYA 1C2MA 3NCLA 3V3MA 5L2ZH 2SNWA 6LPRA 1SL3A 5EG4A 4FUEA 1GHBF 2CXVA 3ZZ7A 1P8VC 2JH6D 1H9HE 1C4U2 1AWHB 1GI8B 6GCHF 1DITH 1VR1H 2VH0A 1ELCA 1YLCA 5F8ZA 4E7NA 2V35A 1C5ZB 2UWLA 2FODA 3GY6A 1SFIA 3PB1E 1C2JA 3ZZAA 3BTDE 4MQAA 3ZVDA 1GPZA 2KAIB 3RU4T 1SGIB 1WCZA 2BZAA 1ELTA 1FUJA 1V2WT 2QY0B 1Y3YA 1FN8A 1E38B 4Y8ZA 4K1EA 2HNTF 1K1IA 1TMBH 2ZFRH 2Z9IA 1ZSJA 1PPBH 2J38A 2VIPA 1O2RA 3ZZBA 3RP2A 1FDPA 3BN9A 3P6ZB 1ZHPA 2XWAA 3VB6A 4DOQA 2G55A 1DUEA 1QQUA 4NIYA 1C5UA 4J1YA 1GBDA 1RXPA 1Z8RA 1ELEE 3P8OA 4DW2U 1W8BH 1DWDH 5J4QA 3EYDA 1MZAA 2GP9B 3VGCB 1QB9A 1C2DA 3QUMP 2A5AA 3SNBA 1SGFG 4KTUA 1SFQB 1OSSA 4JZ1A 1P57B 1C1NA 2BY5X 1S5SA 2Z3EA 2WYGA 3LH1A 1MTWA 1QHRB 1LPGB 4KTSA 4I8GA 5ETXA 3VXEH 1QR3E 3MFJA 1GBCA 1EZXC 1V2PT 2GGVB 3U8TH 4NA9H 2NU4E 4BNRA 2STBE 4Y71A 5LH8A 3A7YA 4X1QU 2Y82A 5HXFA 2B0FA 1CT0E 1H4WA 1DFPA 4KP0A 4BAMB 5GXPA 4K8YA 1O2ZA 1MAYA 2Z7FE 2IPHA 5A0BA 1J8AA 2H1UA 2ANYA 1QL9A 3C1KA 2P3FH 1C1QA 2RA3A 1IAUA 1XUHA 3TJNA 1ELVA 1KXAA 3BTEE 1NROH 1P04A 4E06H 4D7GA 1GJCB 1EASA 1C1VH 1V2ST 2FIRH 9LPRA 1G32B 1CHOG 2Y5HA 1JOUB 4DURA 2OC7A 1O3EA 2ULLA 2XBVA 1YPHE 2F9NA 1O3AA 1V3XA 4O3TA 3OSYA 4DG4A 4Q7ZA 1F2SE 2BQ7B 4IS5A 5JBCS 4AOQA 3R0FA 5FPSA 3T27A 2FOHA 4MNVA 1LVMA 1O2WA 1T4UH 1TRYA 3TH3H 2GZ8A 2VIDA 1NRRH 3ODFA 3PV4A 4NFEA 3SUDA 3BTWE 1LCYA 1TGBA 5TCAA 4U2WA 1XX9A 1ZSKA 1BUIA 2QCYA 1PQ8A 2QA9E 1EATA 4BXSA 2NU1E 1GBIA 2FOGA 4FU9A 5E0JA 2AIPA 1EJNA 2ZG0H 2SGAA 4K5ZA 3OU0A 3HK3B 2BY7X 2ZHQH 1BZXE 1XUKA 1ESBA 2FXRA 7GCHF 1O2GH 1SGPE 1SGNE 1O39A 4I7YH 1F7ZA 1UTPA 3HATH 3LGIA 1UVTH 2H9TH 5E0GA 1YPHC 2QAAA 1SOTA 1CHGA 3SGAE 4IC5A 1V2UT 4CRFA 1AIXH 2PKAB 4GCHF 1FIZA 1O35A 2XRCA 2W3KA 1P2KA 1Z6JH 4AFUA 1AI8H 2ZECA 5DP9A 1RTLA 2VGCC 1A0HB 2R2WU 3VFEA 3LH3A 1K2I1 1TNLA 1WQSA 5CE1A 1PQ7A 4MDSA 3SORA 4CREA 1DSUA 1QA0A 5JB9S 1Y5UT 4B74A 4CRDA 3U69H 2NU3E 5DP3A 5A8XA 2ZFPH 3PWBA 1T4VH 2OCVB 4H6TA 5E8EH 5FBIA 5T6FA 1IQFA 4X2VA 4O97A 2ZTXA 4FUJA 4FXGH 5T3HA 1MD8A 2B5TB 2A2XH 1TGTA 2WPHS 4K1TA 4AGKA 1P03A 2F9OA 2BLQA 2PUXB 1HJAB 3TNTA 1UCYH 4BOHA 2M5TA 2PUQH 3RXUA 3ZYEA 4ABBA 2Q1JA 2GT8A 3QGNB 1GDQA 3TH2H 2ODQA 3A8CA 1N1LA 3ZZ3A 1NFYA 4HZHA 3BTME 1CSOE 2FP7B 1TNGA 2EI6A 1NFWA 1UK4A 1HAVA 5F8TA 1BDAA 1FN6A 1LPKB 5L6NH 3GCHB 4FUBA 1W14U 1PPZA 1BBRE 3SZNA 1G3CA 1TB6H 2WPKS 1XMNB 4ZXXH 1G3DA 1JRTA 3GDVA 1AUJA 4XBBA 1GBJA 3TJUA 1H1BA 1AWFH 1HGTH 4XBDA 1QCPA 3RC5A 3P95A 3UPEA 1OP2A 1GBMA 1ZJKA 4OS2A 2SGPE 3T26A 1BTYA 2F91A 3E91A 1IQHA 1ELDE 1OP8A 3ZZDA 1GBTA 1THSH 1V2KT 4RN6A 2ZGHA 1HIAA 3E3TA 1ESTA 1OWKA 2H9HA 4F4OC 1TALA 2BD8A 1O3JA 1P2NA 2BOKA 3A8DA 8GCHG 4ZAEA 1SQTA 5GJ4B 4DT7B 1NU7B 1BRUP 1O36A 1C5YB 4QT8C 1GDUA 2P16A 2CN0H 2GCHF 1IQNA 2H2ZA 3P92A 1BHXF 3PMBB 2ZCLP 3RMOH 1IQGA 4UONA 5JYIA 4ABEA 4RSPA 5C3NA 4ZKSU 1O2PA 4X2XA 3M5OA 1O2VA 1LHGH 2XBWA 1O5EH 2A0QB 3RXHA 1LPZB 1AVWA 2ZU1A 2ZFFH 1O5DH 2BZ6H 1ZYOA 3QX5H 1GI5A 1O3FA 3EQ0H 2VNTA 3V0XA 2B9LA 1BB0B 1N6YA 2F3CE 1QJ7B 4B76A 4Y7AA 1GJBB 1NM6A 1HAYB 4A7IB 2YNBA 2Z3CA 1OWDA 3FANA 3UQVA 3A7VA 2F83A 1C4V2 1QL7A 1C2IA 1E35B 2ZO3H 4KKDA 3RLYH 3RXDA 1ZLRA 2J92A 3U8OH 1EOJA 3UOPA 2ZPSA 2GCTC 5DKMA 2OINA 3A80A 2ZPRA 3RC6A 1UK2A 3MU4A 5FX5A 1O3HA 2BLVA 1RIWB 3A85A 2H5CA 2TBSA 2FO9A 5I46H 1C5SA 1W2KH 2WYJA 3PM3A 1AFEH 1MU8B 3S9BA 1SSXA 2P3UB 2WPJS 4OS6A 1BJUA 5B6OA 3PTBA 2Y81A 1PJPA 3K9XB 4WMDA 5DP8A 2GT7A 1TX8A 2Q6FA 3E6PH 1EKBB 1QQ4A 1YCPH 1SLWB 2XCFA 1V2OT 5FPTA 1PPGE 1SPJA 3SN8A 4CHAC 2QGRA 5JBTA 1MCVA 1UTQA 1IQKA 3U8RH 3NUMA 1TA2A 1ELGA 3V7TA 2OP9A 3O8DA 2HALA 1EZQA 2Q6DA 3QLPH 2ZA5A 3OX7U 4CBNA 3ATLA 1NU9A 2TGTA 5HYOA 1LHDH 1H8DH 5G4BA 1HB0B 1HDTH 1WOFA 3GDSA 3MOCA 1O32A 2BD5A 1D3TB 1DM4B 1SGTA 1RS0A 3ELAH 1AB9B 2TRMA 1TNIA 4I32A 3MU0A 2QXIA 1TNKA 3PTNA 5H4IB 1GHBG 2HNTC 2VIWA 3A7ZA 1DX5M 3PO1B 3BEIB 2P8OB 1OWJA 1SC8U 3VB4A 1TYNA 5EPNA 1EAIA 1QIXB 4GSOA 1C2FA 3D65E 6GCHG 3ODDA 1T31A 1LO6A 3OY6U 2ZP0H 1NFXA 3Q3KA 4I33A 1FAKH 4H6SB 2HVXA 3ATIA 1TOMH 2FDAA 5C1YA 3EGKH 2GKVE 2GX4A 1YCPM 1EJMA 4WH8A 5FBEA 4B2AA 2ODPA 3MU8A 1EPTA 1GWAA 3TLOA 1DDJA 3FZZA 1GMCF 1CVWH 1YF4A 2BDAA 2ANWA 3RXGA 1MTSA 1KXBA 1LHEH 2NU0E 1O37A 1JRSA 5DGJA 2K1QA 3NK8A 4MPWA 1GJ6A 1L1NA 4HI3A 3UNQA 3SBKA 1O2OA 1GGDC 1WSSH 1YYY1 4UEHH 4JZDH 2QC2A 1BHXB 2HOBA 1YP9A 2BVRH 4OGXA 1SMFE 4JZEH 4CRAA 2XTTB 1F0SA 1H9LB 1QJ6B 2R3UA 2ZIQH 5A2MH 1HPGA 3RXKA 2BY6X 3K6ZA 2Z9KA 4LOYH 1NN6A 1O3NA 2BX4A 1ZPBA 2PTCE 4CR5A 4DJZB 5I25A 1O5AB 1Z1IA 2KAIA 1C1OA 3MH5A 2ZZUH 1X7AC 5FCRA 1LHFH 1TX7A 1FMGA 3LKWA 3F6UH 4Q2KA 3PLPA 1N6XA 1GHYH 1GBKA 2Z3DA 3EA9A 5EPYA 3MHWU 4IMQA 3VPKA 1O34A 2PV9B 1KYNA 4Z6AH 2FYRA 1S84A 5EGMA 1Q31A 3CS7A 2GV7A 5DP5A 3DFLA 1THPB 3ZZCA 2J2UA 5A09A 1PPCE 4Y6DA 7KMEH 2ZI2H 3EA8A 3HGNA 1K9OE 4XDEA 1GVKB 1C2LA 2J95A 4AYVB 2AERH 3SJIA 2WUCA 3KL6A 4VGCB 4AFZA 3H7TA 2ZTZA 1CT2E 1C5QA 4Y8XA 4MLFB 2AMQA 3O8RA 4GHQA 2C8WB 4IGDA 1ETRH 1FJSA 1Y3VA 3SJ8A 1EP5A 4MNYA 1V2JT 1J9CH 2ODYB 2A2QH 1ZMNA 3BEUA 3KNXA 1TMTH 1GJ9B 2OC0A 3MU5A 1VCQA 4LZ1H 3BG4B 1IHTH 4DVAU 4UFDH 2A5IA 3SO3A 2BTCE 5EW1H 1GBAA 4X8TH 3CP7A 4TWYA 1Y3WA 3TGJE 2I6SA 3BTTE 4X2WA 3BTGE 3GCNA 1CGJE 2AH4X 4FUHA 3JZ2B 1WU1A 3PROA 3A7TA 1GG6B 3U1JB 1O2MA 5JPMH 1AKSB 1GJ5H 3KIDU 2PKSB 3ESTA 4I8LA 1D6WA 4XE4A 1GJ4H 3CENA 1ZTJA 3E90B 1INCA 4RKJB 1F92A 2PLXA 1K1NA 2W7UA 1CBWC 1YPMH 2C4FH 3MU1A 1EB2A 3OTJE 1TPOA 4JZFH 1UVSH 2UUYA 3HGPA 4OS5A 4AN7A 1MBQA 3SUEA 2XXLA 4FVBA 3TK5A 1SGQE 4TWWA 3PWCA 5EQQA 4DY7B 4IMZA 3U9AH 1O3PB 5K7RA 2AYWA 1CT4E 3PLKA 4FUCA 6CHAB 1O5CB 1QURH 3T28A 4A1VA 1GHAF 3RXIA 3S9AA 1ZTKA 3RXJA 4ISIH 2BD9A 2TGAA 2Z9LA 1QA7A 1TBQH 5FX6A 4NSYA 2Y5FA 3AAVA 1FQ3A 3SJKA 3FZDA 3NWUA 3KHVA 1GJAB 2BHGA 1CO7E 2D2DA 2Q6GA 2A7CA 5IDKA 1BMNH 1O2SA 1NRNH 1LTOA 3QK1A 1A3EH 4X6MA 2XC5A 4WWYA 2SNVA 2I6QA 2FMJA 2FOEA 1B0EA 1HCGA 2GMTB 2OXSA 4X8UH 1MZDA 5AVDA 2PKAA 5FCKA 2CF8H 1WV7H 3VB7A 2PGQB 4I8KA 3GCOA 3K65B 2JETC 3VEQB 2PGBB 5IYTA 4UDWH 1G30B 1QBVH 2V3HH 1OX1A 3F9GA 4YESB 3TH4H 1VITH 1GL0E 8LPRA 1PQ5A 4UFFH 4ISOA 4OGYA 1ANDA 4AZ2B 2J94A 1QFKH 3EA7A 2VWOA 4R0IA 2J4IA 2ZHDA 2OQ5A 3ZZ5A 1G2MA 3UIRA 1SVPA 4X1NU 3QZRA 5F8XA 4B2BA 3RXPA 3LGWA 1N8OB 2FX6A 1TQ7B 1WTHD 2QYIA 4I8JA 1YPGH 1ZMJA 1SGEE 1P3CA 3QDZB 3LOXA 4IC6A 1L4DA 4M7GA 1YPEH 1BBRK 1QNJA 5SGAE 3KQDA 1MKXK 1RGQA 4WXVA 2O8TA 1Z7KA 1KLIH 2O8WA 1THRH 2H6MA 4IN2A 1ZRKA 3QGJA 1ZGIA 2GCHG 4NWLA 1AFQC 1YPKH 3LIWA 2W3IA 1C5PA 1K28D 3GY2A 1XVMA 3ZYDA 1GCTB 3ATWA 3ZZ4A 4YOJA 3U98H 2O8LA 3TITA 1KXFA 5FAHA 1L2EA 3ZVAA 4I8HA 1L0ZA 3A87A 3RXFA 5F6MA 3MNSA 1EQ9A 2AEIH 1OWHA 1Q3XA 1FPCH 3CS0A 4O03A 1P0SH 4HFPB 1O5BB 4AFSA 2ZHEH 4JMYA 3KQCA 3BTHE 1NZQH 1O2UA 4YZUA 5L2YH 2RG3A 1XUGA 4JYTA 3D49H 1XUJA 2J9NA 1S6HA 3GCTF 3SU6A 4BAKB 1ELAA 3TIUA 1O2LA 1C5TA 2D8WA 2HPQH 2Y7XA 4WY3A 1GVZA 3B8JA 1S6FA 2CV3A 1TGNA 1MTNC 1SQOA 2HLCA 1EPTC 1AQ7A 2GDEH 3TU7H 1ZRBA 1BRBE 1YLDA 1LDTT 1NS3A 2ZPQA 2ZQ2A 1LVYA 1C9TA 1TBRH 2SGQE 4D9QA 2CHAC 1GDNA 3BG4C 5ESBA 1SBWA 3M3TA 2BD2A 3T2NA 3MH6A 1WYKA 1CA0B 4MVNA 4JYUH 2DUCA 2ANMH 3M61U 1RRKA 1GG6C 1XXDA 5HMAA 1TPPA 1GHVH 2OC8A 3T25A 2OD3B 3SNEA 1TNJA 3FFGA 2WINI 1ETTH 1QRWA 1O2NA 2P3TB 4DIHH 1D4PB 1VITF 2A5KA 8KME2 1O3KA 3RMLH 1A4WH 2UUJB 2ZQ1A 1ABJH 1MUEB 1AGJA 1SHHB 1GMHF 3BG8A 1YM0A 3ITIA 1O2TA 1FONA 3A7WA 1W13U 5EOKA 5C5OA 3SQHE 1VGCB 3QTOH 5TJXA 3MNCA 1A0LA 4YT7H 2OC1A 3MTYA 1NFUA 3FVFB 3KGPA 1O2QA 2G51A 2FOFA 1V2LT 1MKWK 1FPHH 5EQSA 3MO3A 4Q7YA 4NGAH 3ZV8A 2W5EA 2BD7A 1HAGE 3A89A 3M5NA 1XM1A 4GPGA 2EI7A 3PLBA 4ZH8A 4WVPE 2VU8E 3STJA 1LMWB 5T6DA 2A4QA 1KXDA 5A0AE 2A4OA 2ZGJA 4E05H 1OWIA 1DXPA 1S81A 5JB8S 1JIRA 1NPMA 4ZKNU 3VGCC 1ANBA 2G81E 1UO6A 2BVXH 5EW2H 1C5RA 2ZDKA 5CHAB 1EZSC 4IW4E 5AHGH 1O3OA 4BTUB 1GMCG 3W95A 2BDYA 3RXVA 1S0RA 2H9EH 3D23A 4Y10E 2FOBA 1KTTB 1EZUC 2O9QA 4YLUA 3I78A 1TGSZ 4K69A 3A81A 3STIA 1O31A 2O8UA 3M37A 1EAXA 2OUAA 4R8TB 3ZV9A 1ID5H 1O3GA 5K0HA 1DT2A 2TGPZ 4YTAA 4AG1A 2VINA 2PSXA 1C1WH 4U30A 1C1SA 1C1MA 2BOHB 2ALVA
chains in the Genus database with same CATH superfamily
5A0CA 1SOZA 1MBMA 2F9VA 1ORFA 1TQ0B 1TGCA 2OBQA 2D26C 1N8OC 4GLYA 2FYQA 3LGYA 1OWEA 1SG8B 3ZVCA 4A92A 2G5NA 1P02A 1HAIH 1CA8B 1PPHE 1EAUA 3MH7A 4XSKU 3H7OA 4MG3A 1GJDB 3TGIE 3LC5A 1ZGVA 2AGEX 1VCPA 3ZVFA 4BANB 1P9SA 1HAZB 4ZKRU 4DIIH 2C90B 1Z8JB 1BTZA 1WUNH 3O8BA 1P2JA 1A5GH 1GMDF 3L3TA 1BMAA 2AS9A 3TNSA 2Y7ZA 1ZPZA 4Y76A 3FP8E 4UE7H 3SNCA 2SFAA 3DFJA 5L30H 6ESTA 2BDBA 2H5DA 3OYPA 1HXEH 4ZHLU 3L33A 1HXFH 5GPIB 3R3GB 5CMXH 1C2HA 4AORA 1HAOH 4FUDA 2KR7A 4NSVA 4CH2B 1BTUA 2Z6BD 5F53A 3GISB 4LK4A 1GHXH 3SW2B 2EY4C 2Y80A 1QGFA 2BDCA 2HNTE 3HK6B 3KF2A 4ISLA 2A32A 3BIUH 3TGKE 2ZCHP 2HPPH 1ZPCA 4AYYB 5EIYA 3MO9A 3A83A 1UTJA 4X6OA 1BTPA 1FY8E 3ZZ9A 1DY8A 4E7RG 1GI0A 4BAQB 1T32A 4MTBA 1XVOA 3ZVEA 3RC4A 5GIBA 2P94A 1NRPH 3SU0A 2BDGA 1O5FH 1DUAA 4I86A 4JK5A 3SV8A 3DT0H 2FPZA 5HIZA 5IK2D 4AB8A 2QIQA 1HJ8A 1EAWA 1G37A 1DLEA 1C5LH 1QBOA 2GTBA 3AVZA 4HTCH 1FY4A 3F9FA 4LXBH 1UMAH 2XCNA 1UVOA 3L6PA 2EQNA 2PW8H 3GICB 3QZQA 3V13A 1GBLA 1B5GH 1FY5A 1DANH 3AASA 3LJOA 1Y3UA 3AW0A 1SI5H 3Q00A 1BTHH 3E16B 1QJ1B 2XNDD 1C1PA 2AGGX 1HAHH 1KLTA 1L1JA 3UY9A 4FETA 2CMYA 2R2MB 3S7HB 1BTWA 3M3SA 3S7KB 5J4SA 1V2RT 3KCGH 3LC3A 4KGAA 1C5VA 3DCLA 1HV7A 1J15A 4Y0ZE 5C1XA 3VB5A 5EXMA 3UNSA 1FNIA 1OYQA 4BAOB 2FI3E 1HJAC 1HNEE 5C0TA 1DE7H 1ARCA 1J16A 3A88A 1GHAG 5GDSH 4ZXYH 1ZSLA 3DHKH 4U01A 5C2ZA 1C2EA 4LZ4B 4CR9A 1Y59T 1EP6A 1YY3A 2FI5E 1FV9A 3SV7A 1FX0B 2BXTH 1GJ7B 1J17T 3GCHC 2ILNA 3MI4A 1AKSA 1OXGA 2BLWA 4RKOB 1ZMLA 3QTVH 3SGBE 4ZCNA 2PWXA 1YKTA 2C3SA 5A8YA 2ZFQH 1F5RA 3GY4A 2FS9A 2SGEE 1TPSA 1P01A 5PTPA 1D3DB 2A45B 1EB1H 8GCHF 1SLXB 3OEHD 1W11U 5F03A 4JCNA 3URDA 1DS2E 1FLEE 2BLOA 4NA8A 1YGCH 1ZJDA 2G8TA 3LDXH 3F2GA 3B23B 4K2YA 1DWEH 2DE8A 3LGTA 2BX3A 2EEKA 2EA3A 1SB1H 1HAXB 3LJJA 4ISHH 4U32A 2VH6A 3LGVA 4CBOA 3EAJA 3KN2A 2PR3A 4AFQA 1IQIA 4YM9A 1KY9A 1K1JA 2QV1A 3DA9B 2G00A 2AIQA 1MU6B 1K21H 3T5FH 4FUGA 1VCWA 1GI2A 3SU2A 1K1OA 1Z1JA 2ZDAH 2VWNA 5GNDA 3SZEA 9ESTA 2V6NA 1EXFA 3SU3A 1UTOA 1T7CA 4HGCA 2PTNA 1Q2WA 3BTFE 2A4RA 2BD4A 2VIQA 2FZZA 1ZR0A 1ABIH 1P10A 1DVAH 1QTFA 2WV5A 3GY8A 2Y6TA 2DE9A 1ELBA 2W7SA 2WPMS 3M5MA 2ZDNA 3GY7A 1TWXB 4ABDA 1O2YA 1UTMA 1MTUA 1OOKB 4J2YB 1BA8B 2ZDLA 3D62A 2FTLE 4K3JA 2QXGA 3LONA 3T62A 1KXCA 1E37B 1UCYK 2IN2A 4OS4A 3TVJB 3IITA 3DUXH 4YOGA 3FAOA 1P11E 1MQ6A 1P09A 1IHSH 1ARBA 4YXWD 3GY3A 3SU1A 1HFDA 3W94A 1RIWC 4NIXA 2ZGXH 1S82A 1BCUH 3IWMA 1K0HA 2KZ4A 1TAWA 4MNWA 1BOQA 2G4TA 3UWJH 5EODA 3BTKE 2ESTE 2ZNKH 2R3YA 1AZ8A 2A7JA 1P06A 1G3BA 3RXTA 3RXQA 2QN5T 3TK6A 1TRNA 1AE5A 1QRXA 2FWWA 7GCHG 1O3BA 1QY6A 4CRGA 1NTPA 2PHBA 2ZWLH 3OY5U 4H4FA 2VGCB 3DSGA 2CJIA 2A4GA 3GCTG 4CH8B 2UUFB 3GY5A 3RXRA 4XRNA 3M35A 1Y8TA 4WF8A 4ABJA 2QF0A 2IOTA 1EUFA 4GCHG 5LPEA 4B1TA 3TPIZ 3Q3YA 1RFNA 3QO6A 1L1GA 3I77A 4Y0YE 4JZIA 3A7XA 4MNXA 3Q77A 4DCDA 2WSSD 1TBZH 4Q80A 3UQOA 1C5WB 2GJGA 3FP7E 1AB9C 3KQBA 3UWIA 1Z71A 2SGDE 5TCCA 4WMFA 2IJD1 1GBFA 7LPRA 4FUFA 3RXBA 3PO1C 4NA7A 1S0QA 5AFYH 2P8OC 1PFXC 2QXJA 4B73A 3RU4D 4AGJA 1ETSH 1D3PB 1ACBE 1VITG 5KECA 4ZROA 1U6QA 1TFXA 1EJAA 4INLA 2BMGB 4NWKA 3UAIC 1A5IA 5GCHF 1ANEA 2KCYA 1GMHG 2XC4A 3PMJA 1RTKA 1ANCA 1UVPA 4Z0KA 3G01A 1SGCA 2HWLB 3RXLA 3SUFA 1FIWA 1KIGH 1HAPH 1WBGB 4CRBA 2R9PA 1Z8IB 1KDQB 1P12E 1KMHB 2HGTH 3K2UA 1YPLH 1UTKA 3DD2H 3RXOA 3Q3XA 2LNCA 2J34A 1SLVB 3OE7D 1UVUH 1M9UA 4D7FA 2HRVA 2ZCKP 1QRZA 3GYMA 1GI4A 1P05A 5E2OA 2BYAX 4B71A 3RXMA 3SU4A 1NT1A 4XOJA 3GOVB 2ZU2A 1NBME 4INKA 1JWTA 1V6DA 1AD8H 1BIOA 1BQYA 1H8ED 3TJVA 1OPHB 1AHTH 3U28C 3ZVBA 1GJ8B 4XBCA 2G52A 1ZTLA 4AB9A 1OKXA 3A8BA 1PQAA 1UHBB 5LGOA 1C1TA 3QN7A 4O3UA 1YCPK 1UCYE 3F9EA 4THNH 3BV9B 1DICA 1NC6A 2O8MA 2QF3A 5EXNA 1O2KA 4ZUHA 1EX3A 1NRSH 2CF9H 3NKKA 4TPIZ 2QF4A 1MH0A 2ZKSA 1RJXB 2GZ7A 4RI0A 1Y5AT 1K1MA 1ZHMA 4XD7D 4NIWA 2BDHA 1Y5BT 1DLKB 2AMPA 1YC0A 2AGIX 2GDDA 3F3BA 3URCA 4ABGA 4BAHB 5C1UA 1TNHA 3ENSB 4JK6A 2GV6A 4ZKOU 2TPIZ 4GVUA 2PP6A 3GYLB 4X8SH 3A86A 3K6YA 1LVOA 1ZOMA 1KXEA 2ZHFH 2P95A 3MYWA 3NPSA 4WMEA 1TOCB 2TGDA 3SNDA 4ABAA 3UNRA 3RLWH 3UOUA 1Z6EA 5ESTE 1IQEA 1NBMD 1O3CA 1TA6A 2GCTB 3SHCH 3P70B 1AE8H 2OTVA 3SV9A 2XBXA 1C5NH 2J5UA 4A1XA 1YPJH 4P00A 1D9IA 1BMLA 2Z94A 5BRRE 1LQEA 3M7TA 3M5LA 5E2PA 3SQEE 3RXCA 3LPRA 2BD3A 4VGCC 4BTIB 1ELFA 1VZQH 1W3CA 4I31A 4FVDA 3SV6A 4K1SA 3MNBA 1GMDG 1BT7A 2P93A 1SR5C 1C9PA 3AW1A 3RXSA 1LKAA 1GBEA 3U1IB 1O33A 3GDUA 2BVSH 4UFEH 2FOAA 1GL1A 1AUTC 3HKIB 4TYDA 4CHAB 2B7DH 1A7SA 4OS1A 1A46H 5EU8A 2UUKB 2UWOA 1HLTH 1LHCH 2TIOA 1IQJA 2ZTYA 2QE7D 2A1DB 3WW7A 2KCPA 4MPXA 1DPOA 4D76A 3NZIA 3SHAH 1A3BH 1C1RA 2PKSC 4ABHA 1JXPA 3EE7A 1W7XH 2VVCA 5C17A 1YBWA 3B9FH 1AY6H 1O5GH 2C93B 2A31A 3F1SB 4YOIA 2GD4B 3KYGA 2XC0A 2G5VA 1AMHA 3MO6A 1DXWA 2V0BA 1F0RA 3S0NA 5DPAA 1AZZA 4TY7A 2ZU5A 2FI4E 2ZDVH 1P2MA 2CGAA 4CRCA 4P02A 1WTGH 1DWCH 1TONA 2BM2A 1A61H 3RXEA 1CE5A 4Y79A 2VIVA 1JBUH 4ISNA 4YLQH 2VVVA 6CHAC 1EFRD 7ESTE 2C8YB 3BTQE 5DP6A 1NRQH 2Z9GA 1MCTA 1O2IA 3SNAA 4XFQA 1FY1A 1V2QT 4MPUA 3BSQA 1G2LA 1KLJH 2ZC9H 3FP6E 4ASHA 4TSFD 4M9FA 1UTLM 2WHXA 5EXLA 2G4UA 3MH4A 1MQ5A 3ZZ8A 2FOMB 3E8LA 4FUIA 2R0LA 3EDXB 3A84A 5JDUB 5ABWA 4K60A 4Y8YA 1GGDB 4WJG2 3M36A 4X8VH 1TX6A 2B8OH 1BMMH 2GMTC 1MD7A 3JZ1B 3MWIU 1DSTA 4NZQA 2ZU3A 4ABIA 3O8CA 2ZHWH 2THFB 5HM9A 4ZMAH 3BIVH 4ESTE 1VJ9U 1O38A 2ZFSA 1OYTH 2V3OH 1A2CH 1QB6A 2QXHA 1O3LA 1O30A 1HRTH 2R0KA 2FLBH 2XBYA 4K8BA 2BY9X 2V7QD 5DJ7A 1T8OA 3UREA 4B2CA 1IOEA 2YNAA 1G9IE 2JJ2D 3RM0H 1C1UH 1CHOF 3KEEA 1A5HA 4WXIA 3SU5A 3PMHB 1SGFA 2FLRH 5A8ZA 2AFQB 4ACAA 2EC9H 3VXFH 3ZZ6A 2RDLA 2XW9A 3SI3H 1AN1E 1W7GH 1HYLA 3M7UA 3BEFB 4A1TA 5LPFA 1UJ1A 4KELA 4WH6A 1C5OH 2JH5D 2WPLS 1GI1A 1P9UA 3P8GA 1DOJA 1B7XB 2YMSB 1FXYA 2RDEA 4ZHAA 3SV2H 3P8NA 2XNIA 1TE0A 2LPRA 1IQLA 1W0YH 1O2JA 1Z8GA 3BF6H 2AHME 2JH0D 4UFGH 2PFEA 1TIOA 4GAWA 5FPYA 1PPEE 1AVGH 4DGJA 1C2KA 1GCTC 1L4ZA 3P8FA 8ESTE 4IBLH 2NWNA 1SQAA 3W1EA 1GHZA 1PPFE 3WY8A 4ABFA 1S83A 2IJOB 3IG6B 1T8LA 4TY6A 4F49A 1E36B 1MTVA 3T29A 3LU9B 1BJVA 4B75A 3FOAA 1T8NA 4SGAE 2KCOA 2C8XB 1UK3A 1V2NT 4BTTB 2FM2A 4FU7A 1SGRE 2FS8A 3EE0B 4KTCA 1G3EA 1HAVB 3FO8D 1ZHRA 5C5NA 2ANKH 1HJ9A 3TK9A 3ZVGA 2IPQX 1HBTH 1JMOH 5AF9H 1F5KU 2ZDMA 5DP7A 4FU8A 4X1SU 1C5MD 1F5LA 1EOLA 2OQUA 3M3VA 1OS8A 4BXWA 1GI3A 1ZZZA 1P2IA 1CBWB 4AX9H 2PSYA 1ESAA 5FXLA 3RDZA 2EI8A 3AK5A 1BBRH 4YT6H 1SLUB 2GVFA 1PYTC 2OLGA 2YOLA 1W0ZU 1FI8A 1W10U 4Q7XA 1HIAB 1V2VT 1MKXH 3C27B 3PYHA 5E0HA 3PRDA 4NG9H 3H5CB 1XKBC 3SJOA 1BRAA 1CA0C 5LPRA 1O3IA 4RT0A 1GI9B 4A5TS 1KTSB 4NIVA 2NU2E 2P59A 2WUBA 4NCYA 1F0UA 5T1VA 1P2OA 1PYTD 1E1RD 1H8IH 2SGFE 4PROA 4AG2A 5DK1A 1BRCE 5C20A 4GHTA 3PMAB 4Y11E 1GBHA 5JBAS 4INHA 2BY8X 5DO4H 1BITA 2BDIA 3TJOA 1P3EA 1JIMA 4B6FA 2OBOA 4DT4A 1MAXA 1UTNA 2BQWB 3S9CA 1CGIE 2UWPA 3MNXA 5KGOA 3M7QA 4IN1A 1QBNA 5BPEA 1VGCC 1O3DA 1G36A 1CGHA 4X1RU 3VB3A 5FHTA 1GI6A 1F0TA 2BB4A 1GI7B 3HPTB 1AVXA 5HGGA 3NRLA 2ZGCA 4GUXA 2VVUA 4X2YA 1D3QB 1E34B 1TLDA 4JYVH 3SI4H 3RM2H 3Q76A 4X6NA 2FTMA 2KM0A 3SOSA 2FEQH 4O9VA 4X1PU 1A0JA 1XUIA 2GZ9A 4NFFA 3SGQE 5GCHG 1KSNA 2JETB 1RTFB 4NZLA 2VWLA 2D1JA 3MMGA 5HM2A 3FN8A 4ASUD 2ASUB 3SJ9A 1T8MA 2Z9JA 2XYAA 1QL8A 2AMDA 3F68H 5CHAC 1A1RA 1C5XB 1NO9H 3SUGA 4UD9H 2VB0A 3S69A 4H42U 1CQQA 1QB1A 1O0DH 1E0FD 4X6PA 3I29A 2A7HA 4X0WU 1IQMA 3E0NB 2C8ZB 4OS7A 2WV4A 5DP4A 3LGUA 5EJ1A 2WPIS 1NY22 3ATKA 1HUTH 1LKBA 2F9UA 1AU8A 3RMNH 3UR6A 5HKKD 1BTXA 2F9BH 2FX4A 1CU1A 1K1PA 1BMFD 3RMMH 1GCDA 1XXFA 1AFQB 1TRMA 1FAXA 1MKWH 3P17H 3PV5A 3V12A 3LT3A 3RXAA 2F4LA 3E0PB 2RCEA 5EQRA 2BXUH 1S85A 3NXPA 5GWZA 1K1LA 3F9HA 1GVLA 2W26A 1O2XA 2XWBI 3UUZA 2ZEBA 5JBBS 1D6RA 1WAYB 2M2AA 1AO5A 1C2GA 2ZGBH 4ZHMU 3UR9A 2YMSC 1DY9A 1KDQA 2VJ1A 2RA0A 2BQ6B 1GHWH 4YO9A 1B0FA 4D9RA 2FESH 2VWMA 3UTUH 1SGDE 1V2TT 1LQDB 2Y5GA 2VIOA 1XUFA 4TT3D 1P2QA 1TABE 5AFZH 3KQEA 1FY3A 5T6GA 4AC9A 1O3MA 1FZZA 2FOCA 2STAE 1YLNA 3ATMA 3RU4E 1GBBA 2ALPA 1VJAU 1C4Y2 4Y7BA 2ZF0H 5C67A 3A82A 1H9IE 1Y3XA 1MTNB 3N7OA 1W12U 1EPTB 1TMUH 5DG6A 1WQVH 4A6LA 2ZFTA 3E1XB 1DWBH 1V2MT 1MMJN 4D8NA 2CHAB 1SHYA 3QWCH 1UHBA 2F9PA 1O2HA 3AAUA 3UFAA 2WV9A 1NESE 1XKAC 3RUOA 1RD3B 3HKJB 1J14A 4SGBE 1OP0A 1SGYE 4MPVA 1TPAE 1LVBA 3A8AA 2JKHA 2ZU4A 1K22H 4TPYA 5EJZA 1C2MA 3NCLA 3V3MA 5L2ZH 2SNWA 6LPRA 1SL3A 5EG4A 4FUEA 1GHBF 2CXVA 3ZZ7A 1P8VC 2JH6D 1H9HE 1C4U2 1AWHB 1GI8B 1QZ8A 6GCHF 1DITH 1VR1H 2VH0A 1ELCA 1YLCA 5F8ZA 4E7NA 2V35A 1C5ZB 2UWLA 2FODA 3GY6A 1SFIA 3PB1E 1C2JA 3ZZAA 3BTDE 4MQAA 3ZVDA 1GPZA 2KAIB 3RU4T 1SGIB 1WCZA 2BZAA 1ELTA 1FUJA 1V2WT 2QY0B 1Y3YA 1FN8A 1E38B 4Y8ZA 4K1EA 2HNTF 1K1IA 1TMBH 2ZFRH 2Z9IA 1ZSJA 1PPBH 2J38A 2VIPA 1O2RA 3ZZBA 3RP2A 1FDPA 3BN9A 3P6ZB 1ZHPA 2XWAA 3VB6A 4DOQA 2G55A 1DUEA 1QQUA 4NIYA 1C5UA 4J1YA 5DSFA 3H09A 1GBDA 1RXPA 1Z8RA 1ELEE 2V3MA 3P8OA 4DW2U 1W8BH 1DWDH 5J4QA 3EYDA 1MZAA 1H8HD 2GP9B 3VGCB 5CDFE 1QB9A 1C2DA 3QUMP 2A5AA 3SNBA 1SGFG 4KTUA 1SFQB 1OSSA 4JZ1A 1P57B 1C1NA 2BY5X 1S5SA 2Z3EA 2WYGA 3LH1A 1MTWA 1QHRB 1LPGB 4KTSA 4I8GA 5ETXA 3VXEH 1QR3E 3MFJA 1GBCA 5C0UA 1EZXC 1V2PT 2GGVB 3U8TH 4NA9H 1E79D 2NU4E 4BNRA 2STBE 4Y71A 5LH8A 3A7YA 4X1QU 2Y82A 5HXFA 2B0FA 1CT0E 1H4WA 1DFPA 4KP0A 4BAMB 5GXPA 4K8YA 1O2ZA 1MAYA 2Z7FE 2IPHA 5A0BA 1J8AA 2H1UA 2ANYA 1QL9A 3C1KA 2P3FH 1C1QA 2RA3A 1IAUA 1XUHA 3TJNA 1ELVA 1KXAA 3BTEE 1NROH 1P04A 4E06H 4D7GA 3KYFA 1GJCB 1EASA 1C1VH 1V2ST 2FIRH 2J98B 9LPRA 1G32B 1CHOG 2Y5HA 1JOUB 4DURA 2OC7A 1O3EA 2OK5A 2ULLA 2KFWA 2XBVA 1YPHE 2F9NA 1O3AA 1V3XA 4O3TA 3OSYA 4DG4A 4Q7ZA 1F2SE 2BQ7B 4IS5A 5JBCS 4AOQA 3R0FA 5FPSA 3T27A 2FOHA 4MNVA 1LVMA 1O2WA 1T4UH 1TRYA 3TH3H 2GZ8A 2VIDA 1NRRH 3ODFA 3PV4A 5EJLA 4NFEA 3SUDA 3BTWE 1LCYA 1TGBA 5TCAA 4U2WA 1XX9A 1ZSKA 1BUIA 2QCYA 1PQ8A 2QA9E 1EATA 4BXSA 2NU1E 1GBIA 2FOGA 4FU9A 5E0JA 2AIPA 1EJNA 2ZG0H 2SGAA 3ZIAD 4K5ZA 3OU0A 3HK3B 2BY7X 2ZHQH 1BZXE 1XUKA 1ESBA 2FXRA 7GCHF 1O2GH 1SGPE 1SGNE 1O39A 4I7YH 1SKYE 1F7ZA 1UTPA 3HATH 3LGIA 1UVTH 2H9TH 5E0GA 1YPHC 2QAAA 1SOTA 2CK3D 1CHGA 1MABB 4IC5A 3SGAE 2HVYB 1V2UT 4CRFA 1AIXH 2PKAB 4GCHF 1FIZA 1O35A 2XRCA 2L6OA 2W3KA 1P2KA 1Z6JH 4AFUA 1AI8H 2ZECA 5DP9A 1RTLA 2VGCC 1A0HB 2R2WU 3VFEA 3LH3A 1K2I1 1TNLA 1WQSA 3VG8A 5CE1A 4Q63A 1PQ7A 4MDSA 3SORA 4CREA 1DSUA 1QA0A 2XOKD 5JB9S 1Y5UT 4B74A 4CRDA 3U69H 2NU3E 5DP3A 5A8XA 2ZFPH 3PWBA 1T4VH 2OCVB 4H6TA 5E8EH 5FBIA 5T6FA 1IQFA 4X2VA 4O97A 2ZTXA 4FUJA 4FXGH 5T3HA 1MD8A 2B5TB 2A2XH 1TGTA 2WPHS 4K1TA 4AGKA 5CHBA 1P03A 2F9OA 2BLQA 2LP6A 2PUXB 1HJAB 3TNTA 1UCYH 4BOHA 2M5TA 2PUQH 3RXUA 3ZYEA 4ABBA 2Q1JA 2F43B 3OAAD 2GT8A 3QGNB 1GDQA 3TH2H 2ODQA 3A8CA 1N1LA 3ZZ3A 1NFYA 4HZHA 3BTME 1CSOE 2FP7B 1TNGA 2EI6A 1NFWA 1UK4A 1HAVA 5F8TA 1BDAA 1FN6A 1LPKB 5L6NH 3GCHB 1SQRA 4FUBA 1W14U 1PPZA 1BBRE 3SZNA 1G3CA 1TB6H 2WPKS 2W6JD 3FKSD 1XMNB 4ZXXH 4ACBA 1G3DA 1JRTA 3GDVA 1AUJA 4XBBA 1GBJA 3TJUA 1H1BA 1AWFH 1HGTH 4XBDA 1QCPA 3RC5A 3P95A 3UPEA 1OP2A 1GBMA 1ZJKA 4OS2A 2SGPE 3T26A 1BTYA 2F91A 3E91A 1IQHA 1ELDE 1OP8A 3ZZDA 1GBTA 1THSH 1V2KT 4RN6A 2ZGHA 1HIAA 3E3TA 1ESTA 4B6EA 1OWKA 2H9HA 4F4OC 1TALA 2BD8A 3GS9A 1O3JA 1P2NA 2BOKA 3A8DA 8GCHG 4ZAEA 1SQTA 5GJ4B 4DT7B 1NU7B 1BRUP 1O36A 4Z1MD 1C5YB 4QT8C 2L74A 1GDUA 2P16A 2CN0H 2GCHF 1IQNA 2H2ZA 3P92A 1BHXF 3PMBB 2ZCLP 3RMOH 1IQGA 4UONA 5JYIA 4ABEA 4RSPA 5C3NA 4ZKSU 1O2PA 4X2XA 2VBCA 3M5OA 5DN6D 1O2VA 1LHGH 2XBWA 1O5EH 2A0QB 3RXHA 1LPZB 1AVWA 2ZU1A 2ZFFH 1O5DH 2BZ6H 1ZYOA 3QX5H 1GI5A 1O3FA 3EQ0H 2VNTA 3V0XA 2B9LA 1BB0B 1N6YA 2F3CE 1QJ7B 4B76A 4Y7AA 1GJBB 1NM6A 1HAYB 2KCAA 4A7IB 1W0KD 5FL7D 2YNBA 2Z3CA 1OWDA 3FANA 3UQVA 3A7VA 2F83A 1C4V2 1QL7A 1C2IA 1E35B 2ZO3H 4KKDA 3RLYH 3RXDA 1ZLRA 2J92A 3U8OH 1EOJA 3UOPA 2ZPSA 2GCTC 5DKMA 3F0OA 2OINA 3A80A 2ZPRA 3RC6A 3MQKC 1UK2A 3MU4A 5FX5A 1O3HA 2BLVA 1RIWB 3A85A 2H5CA 2TBSA 2FO9A 5I46H 1C5SA 1W2KH 2WYJA 3PM3A 1AFEH 1MU8B 3S9BA 1SSXA 2P3UB 2WPJS 4OS6A 1BJUA 5B6OA 3PTBA 2Y81A 1PJPA 3K9XB 4WMDA 5DP8A 2GT7A 1TX8A 2Q6FA 3E6PH 1EKBB 2HLDD 1QQ4A 1YCPH 1SLWB 2XCFA 1V2OT 5FPTA 2LELA 1PPGE 1SPJA 3SN8A 4CHAC 2QGRA 5JBTA 1MCVA 1UTQA 1IQKA 3U8RH 3NUMA 1TA2A 1ELGA 3V7TA 2OP9A 3O8DA 2HALA 1EZQA 2Q6DA 3QLPH 2ZA5A 3OX7U 4CBNA 4HG6A 3ATLA 1NU9A 2TGTA 5HYOA 1LHDH 1H8DH 5G4BA 1HB0B 1HDTH 1WOFA 3GDSA 3MOCA 1O32A 2BD5A 1D3TB 1DM4B 1SGTA 1RS0A 3ELAH 1AB9B 3UB0A 1S6LA 2TRMA 3DSPA 1TNIA 3N99A 4I32A 3MU0A 2QXIA 1TNKA 3PTNA 5H4IB 1GHBG 2HNTC 2VIWA 3A7ZA 1DX5M 3PO1B 3BEIB 2P8OB 1OWJA 1SC8U 3VB4A 1TYNA 5EPNA 1EAIA 1QIXB 4GSOA 1C2FA 3D65E 6GCHG 3ODDA 1T31A 1LO6A 3OY6U 2ZP0H 1NFXA 2QF5A 3Q3KA 4I33A 1FAKH 4H6SB 2HVXA 3ATIA 1TOMH 2FDAA 5C1YA 3EGKH 2GKVE 2GX4A 1YCPM 1EJMA 4WH8A 5FBEA 4B2AA 2ODPA 3MU8A 1EPTA 1GWAA 3TLOA 1DDJA 3FZZA 1GMCF 1CVWH 1YF4A 2BDAA 2ANWA 3F0PA 4Q4LA 3RXGA 1MTSA 1KXBA 1LHEH 1O37A 1JRSA 2NU0E 5DGJA 2K1QA 3NK8A 4MPWA 1GJ6A 1L1NA 4HI3A 3UNQA 3SBKA 1O2OA 1GGDC 1WSSH 1YYY1 4UEHH 4JZDH 2QC2A 2KX4A 1BHXB 3F2HA 3PRBA 2HOBA 1YP9A 2BVRH 4OGXA 1SMFE 2W6ID 4JZEH 4CRAA 2XTTB 1F0SA 1H9LB 1QJ6B 2R3UA 2ZIQH 5A2MH 2JJ1D 1HPGA 3RXKA 2BY6X 3K6ZA 2Z9KA 4LOYH 1NN6A 2JDID 1O3NA 2BX4A 1ZPBA 2PTCE 4CR5A 4DJZB 5I25A 1O5AB 1Z1IA 2KAIA 1C1OA 3MH5A 2ZZUH 1X7AC 5FCRA 1LHFH 1TX7A 2WZQA 1FMGA 3LKWA 3F6UH 4Q2KA 3PLPA 1N6XA 1GHYH 1GBKA 2Z3DA 2WPDD 5B6LA 3EA9A 5EPYA 3MHWU 4IMQA 3VPKA 1O34A 2PV9B 1KYNA 4Z6AH 2RFKC 2FYRA 1S84A 5EGMA 1Q31A 3CS7A 2GV7A 5DP5A 3DFLA 1THPB 3ZZCA 2J2UA 1UW7A 5A09A 1PPCE 4Y6DA 7KMEH 2ZI2H 3EA8A 3HGNA 1K9OE 4XDEA 1GVKB 1C2LA 2J95A 4AYVB 3OEED 5KEDA 2AERH 3SJIA 2WUCA 3KL6A 2YMSD 4VGCB 4AFZA 3H7TA 2ZTZA 1CT2E 1C5QA 4Y8XA 4MLFB 2AMQA 3O8RA 4GHQA 2C8WB 4IGDA 1ETRH 1FJSA 1Y3VA 3SJ8A 1EP5A 4MNYA 1V2JT 1J9CH 2ODYB 2A2QH 1ZMNA 3BEUA 3KNXA 1TMTH 1GJ9B 2OC0A 3MU5A 1VCQA 4LZ1H 3BG4B 1IHTH 4DVAU 3OTPA 4UFDH 2A5IA 3SO3A 2BTCE 5EW1H 1GBAA 4X8TH 3CP7A 4TWYA 1Y3WA 3TGJE 2I6SA 3BTTE 4X2WA 3BTGE 3GCNA 1CGJE 2AH4X 4FUHA 3JZ2B 1WU1A 2J97A 3PROA 3A7TA 1GG6B 3U1JB 1O2MA 5JPMH 1AKSB 1W0JD 1GJ5H 3KIDU 2PKSB 3ESTA 4I8LA 1D6WA 4XE4A 1GJ4H 3CENA 1ZTJA 3E90B 1INCA 4RKJB 2JIZD 1F92A 2PLXA 1K1NA 2W7UA 1CBWC 1YPMH 2C4FH 3MU1A 1EB2A 3OTJE 1TPOA 5C94A 4JZFH 1UVSH 2UUYA 3HGPA 2J98A 4OS5A 4AN7A 1MBQA 3SUEA 4OM9A 2XXLA 4FVBA 3TK5A 1SGQE 4TWWA 3PWCA 5EQQA 4DY7B 4IMZA 3U9AH 1O3PB 5K7RA 2AYWA 1CT4E 3PLKA 4FUCA 6CHAB 1O5CB 1QURH 3T28A 3CNRA 4A1VA 1GHAF 3RXIA 3S9AA 1ZTKA 3RXJA 4ISIH 2BD9A 2TGAA 2Z9LA 1QA7A 1TBQH 5FX6A 4NSYA 2Y5FA 3AAVA 1FQ3A 3SJKA 3WWBA 3FZDA 3NWUA 3KHVA 1GJAB 2BHGA 1CO7E 2D2DA 2Q6GA 2A7CA 5IDKA 1BMNH 1O2SA 1NRNH 1LTOA 3QK1A 1A3EH 4X6MA 2XC5A 4WWYA 2SNVA 2I6QA 2FMJA 2FOEA 1B0EA 1HCGA 2GMTB 2OXSA 4X8UH 1MZDA 5AVDA 2PKAA 5FCKA 2CF8H 1WV7H 3VB7A 2PGQB 5HIYA 4I8KA 3GCOA 3K65B 2JETC 3VEQB 2PGBB 5IYTA 4UDWH 1G30B 1QBVH 2V3HH 1OX1A 3F9GA 4YESB 3TH4H 1VITH 1E1QD 1GL0E 8LPRA 1PQ5A 4UFFH 4ISOA 4OGYA 1ANDA 4AZ2B 2J94A 1QFKH 3EA7A 2VWOA 4R0IA 2J4IA 2ZHDA 2OQ5A 3ZZ5A 1G2MA 3UIRA 1SVPA 4X1NU 3QZRA 5F8XA 4B2BA 3RXPA 3LGWA 1N8OB 2FX6A 1TQ7B 1WTHD 2QYIA 4I8JA 1YPGH 1ZMJA 1SGEE 1P3CA 3QDZB 3LOXA 4IC6A 1L4DA 4M7GA 1YPEH 1BBRK 1QNJA 5SGAE 3KQDA 1MKXK 1RGQA 4WXVA 2O8TA 1Z7KA 1KLIH 2O8WA 1THRH 2H6MA 4IN2A 1ZRKA 3QGJA 1ZGIA 2GCHG 4NWLA 1AFQC 1YPKH 3LIWA 2W3IA 1C5PA 1K28D 4RT1A 3GY2A 1XVMA 3ZYDA 1GCTB 3ATWA 3ZZ4A 4YOJA 3U98H 2O8LA 3TITA 1KXFA 5FAHA 1L2EA 3ZVAA 4F48B 4I8HA 1L0ZA 3A87A 3RXFA 5F6MA 3MNSA 1WXRA 3N7DA 1EQ9A 2AEIH 1OWHA 1Q3XA 1FPCH 3CS0A 4O03A 1P0SH 4HFPB 1O5BB 4AFSA 2ZHEH 4JMYA 3KQCA 3BTHE 1NZQH 1O2UA 4YZUA 3SYJA 1OHHD 2RG3A 5L2YH 1XUGA 4JYTA 3D49H 3OFND 1XUJA 2J9NA 1S6HA 3GCTF 3SU6A 4BAKB 1ELAA 3TIUA 1O2LA 1C5TA 2D8WA 2HPQH 2Y7XA 4WY3A 3WWFA 1GVZA 3B8JA 1S6FA 2CV3A 1TGNA 1MTNC 1SQOA 2HLCA 1EPTC 1AQ7A 2GDEH 3TU7H 1ZRBA 1BRBE 1YLDA 1LDTT 1NS3A 2ZPQA 2ZQ2A 1LVYA 1C9TA 1TBRH 2SGQE 4D9QA 2CHAC 1GDNA 3BG4C 5ESBA 1SBWA 2K0QA 3M3TA 2BD2A 3T2NA 3MH6A 1WYKA 1CA0B 4MVNA 4JYUH 2DUCA 2ANMH 3M61U 1RRKA 1GG6C 3PV2A 1XXDA 5HMAA 1TPPA 1GHVH 2OC8A 3T25A 2OD3B 3SNEA 1TNJA 3FFGA 2WINI 1ETTH 1QRWA 1O2NA 2P3TB 4DIHH 1D4PB 1VITF 2A5KA 8KME2 1O3KA 3RMLH 1A4WH 2UUJB 2ZQ1A 1ABJH 1MUEB 1AGJA 1SHHB 1GMHF 3BG8A 1YM0A 3ITIA 1O2TA 1FONA 3A7WA 1W13U 5EOKA 5C5OA 3SQHE 1VGCB 3QTOH 5TJXA 3MNCA 1A0LA 4YT7H 2OC1A 3MTYA 1NFUA 3FVFB 3KGPA 1O2QA 2G51A 2FOFA 1V2LT 1MKWK 1WDIA 1FPHH 5EQSA 3MO3A 4Q7YA 3DSOA 4NGAH 3ZV8A 2W5EA 2BD7A 1HAGE 3A89A 3M5NA 4FOUC 1XM1A 4GPGA 2EI7A 3PLBA 4ZH8A 4WVPE 2VU8E 3N7EA 3STJA 1LMWB 5T6DA 2A4QA 1KXDA 5A0AE 2A4OA 2ZGJA 4E05H 1OWIA 1DXPA 1S81A 5JB8S 1JIRA 1NPMA 4ZKNU 3F2FA 2K8IA 1YWUA 3VGCC 1ANBA 2G81E 1UO6A 4F55A 2BVXH 5EW2H 1C5RA 1COWD 2ZDKA 5CHAB 1EZSC 4IW4E 5AHGH 1O3OA 4BTUB 1GMCG 3W95A 2BDYA 3RXVA 3KQ5A 1S0RA 2H9EH 3D23A 1VKYA 4Y10E 2FOBA 1KTTB 1EZUC 2O9QA 4YLUA 3I78A 1TGSZ 4K69A 3A81A 3STIA 1O31A 2O8UA 3M37A 1EAXA 2OUAA 4R8TB 3ZV9A 1ID5H 1O3GA 5K0HA 1DT2A 2TGPZ 4YTAA 4AG1A 2VINA 2PSXA 1C1WH 4U30A 1C1SA 1C1MA 2BOHB 2ALVA
chains in the Genus database with same CATH topology
5A0CA 1SOZA 1MBMA 2F9VA 1ORFA 1TQ0B 1TGCA 2OBQA 2D26C 1N8OC 4GLYA 2FYQA 3LGYA 1OWEA 1SG8B 3ZVCA 4A92A 2G5NA 1P02A 1HAIH 1CA8B 1PPHE 1EAUA 3MH7A 4XSKU 3H7OA 4MG3A 1GJDB 3TGIE 3LC5A 1ZGVA 2AGEX 1VCPA 3ZVFA 4BANB 1P9SA 1HAZB 4ZKRU 4DIIH 2C90B 1Z8JB 1BTZA 1WUNH 3O8BA 1P2JA 1A5GH 1GMDF 3L3TA 1BMAA 2AS9A 3TNSA 2Y7ZA 1ZPZA 4Y76A 3FP8E 4UE7H 3SNCA 2SFAA 3DFJA 5L30H 6ESTA 2BDBA 2H5DA 3OYPA 1HXEH 4ZHLU 3L33A 1HXFH 5GPIB 3R3GB 5CMXH 1C2HA 4AORA 1HAOH 4FUDA 4NSVA 4CH2B 1BTUA 2Z6BD 3GISB 4LK4A 1GHXH 3SW2B 2Y80A 1QGFA 2BDCA 2HNTE 3HK6B 3KF2A 4ISLA 2A32A 3BIUH 3TGKE 2ZCHP 2HPPH 1ZPCA 4AYYB 3MO9A 3A83A 1UTJA 4X6OA 1BTPA 1FY8E 3ZZ9A 1DY8A 4E7RG 1GI0A 4BAQB 1T32A 4MTBA 1XVOA 3ZVEA 3RC4A 5GIBA 2P94A 1NRPH 3SU0A 2BDGA 1O5FH 1DUAA 4JK5A 3SV8A 3DT0H 2FPZA 4AB8A 2QIQA 1HJ8A 1EAWA 1G37A 1DLEA 1C5LH 1QBOA 2GTBA 3AVZA 4HTCH 1FY4A 3F9FA 4LXBH 1UMAH 2XCNA 1UVOA 3L6PA 3GICB 2PW8H 3QZQA 3V13A 1GBLA 1B5GH 1FY5A 1DANH 3AASA 3LJOA 1Y3UA 3AW0A 1SI5H 3Q00A 1BTHH 3E16B 1QJ1B 1C1PA 2AGGX 1HAHH 1KLTA 1L1JA 3UY9A 2CMYA 2R2MB 3S7HB 1BTWA 3M3SA 3S7KB 5J4SA 1V2RT 3KCGH 3LC3A 4KGAA 1C5VA 4Y0ZE 1HV7A 1J15A 5C1XA 3VB5A 5EXMA 3UNSA 1FNIA 1OYQA 4BAOB 2FI3E 1HJAC 1HNEE 1DE7H 1ARCA 1J16A 3A88A 1GHAG 5GDSH 4ZXYH 1ZSLA 3DHKH 4U01A 5C2ZA 1C2EA 4LZ4B 4CR9A 1Y59T 1EP6A 2FI5E 1FV9A 3SV7A 2BXTH 1GJ7B 1J17T 3GCHC 2ILNA 3MI4A 1AKSA 1OXGA 2BLWA 4RKOB 1ZMLA 3QTVH 3SGBE 2PWXA 1YKTA 2C3SA 5A8YA 2ZFQH 1F5RA 3GY4A 2FS9A 2SGEE 1TPSA 1P01A 5PTPA 1D3DB 2A45B 1EB1H 8GCHF 1SLXB 1W11U 5F03A 4JCNA 3URDA 1DS2E 1FLEE 2BLOA 4NA8A 1YGCH 1ZJDA 2G8TA 3LDXH 3B23B 4K2YA 1DWEH 2DE8A 3LGTA 2BX3A 2EEKA 2EA3A 1SB1H 1HAXB 3LJJA 4ISHH 4U32A 2VH6A 3LGVA 4CBOA 3EAJA 3KN2A 2PR3A 4AFQA 1IQIA 4YM9A 1KY9A 1K1JA 2QV1A 3DA9B 2G00A 2AIQA 1MU6B 1K21H 3T5FH 4FUGA 1VCWA 1GI2A 3SU2A 1K1OA 1Z1JA 2ZDAH 2VWNA 9ESTA 2V6NA 1EXFA 3SU3A 1UTOA 1T7CA 4HGCA 2PTNA 1Q2WA 3BTFE 2A4RA 2BD4A 2VIQA 2FZZA 1ZR0A 1ABIH 1P10A 1DVAH 1QTFA 2WV5A 3GY8A 2Y6TA 2DE9A 1ELBA 2W7SA 2WPMS 3M5MA 2ZDNA 3GY7A 1TWXB 4ABDA 1O2YA 1UTMA 1MTUA 1OOKB 4J2YB 1BA8B 2ZDLA 3D62A 2FTLE 4K3JA 2QXGA 3LONA 3T62A 1KXCA 1E37B 1UCYK 2IN2A 4OS4A 3TVJB 3IITA 3DUXH 4YOGA 3FAOA 1P11E 1MQ6A 1P09A 1IHSH 1ARBA 3GY3A 3SU1A 1HFDA 3W94A 1RIWC 4NIXA 2ZGXH 1S82A 1BCUH 3IWMA 1TAWA 4MNWA 1BOQA 2G4TA 3UWJH 5EODA 3BTKE 2ESTE 2ZNKH 2R3YA 1AZ8A 2A7JA 1P06A 1G3BA 3RXTA 3RXQA 2QN5T 3TK6A 1TRNA 1AE5A 1QRXA 2FWWA 7GCHG 1O3BA 1QY6A 4CRGA 1NTPA 2PHBA 2ZWLH 3OY5U 4H4FA 2VGCB 2CJIA 2A4GA 3GCTG 4CH8B 2UUFB 3GY5A 3RXRA 3M35A 1Y8TA 4WF8A 4ABJA 2QF0A 2IOTA 1EUFA 4GCHG 5LPEA 4B1TA 3TPIZ 3Q3YA 1RFNA 3QO6A 1L1GA 3I77A 4Y0YE 4JZIA 3A7XA 4MNXA 3Q77A 4DCDA 1TBZH 4Q80A 3UQOA 1C5WB 3FP7E 1AB9C 3KQBA 3UWIA 1Z71A 2SGDE 5TCCA 4WMFA 1GBFA 7LPRA 4FUFA 3RXBA 3PO1C 4NA7A 1S0QA 5AFYH 2P8OC 1PFXC 2QXJA 4B73A 3RU4D 4AGJA 1ETSH 1D3PB 1ACBE 1VITG 4ZROA 1U6QA 1TFXA 1EJAA 4INLA 2BMGB 4NWKA 1A5IA 5GCHF 1ANEA 1GMHG 2XC4A 3PMJA 1RTKA 1ANCA 1UVPA 4Z0KA 3G01A 1SGCA 2HWLB 3RXLA 3SUFA 1FIWA 1KIGH 1HAPH 1WBGB 4CRBA 2R9PA 1Z8IB 1KDQB 1P12E 2HGTH 3K2UA 1YPLH 1UTKA 3DD2H 3RXOA 3Q3XA 2LNCA 2J34A 1SLVB 1UVUH 1M9UA 4D7FA 2HRVA 2ZCKP 1QRZA 3GYMA 1GI4A 1P05A 5E2OA 2BYAX 4B71A 3RXMA 3SU4A 1NT1A 4XOJA 3GOVB 2ZU2A 4INKA 1JWTA 1V6DA 1AD8H 1BIOA 1BQYA 3TJVA 1OPHB 1AHTH 3ZVBA 1GJ8B 4XBCA 2G52A 1ZTLA 4AB9A 1OKXA 3A8BA 1PQAA 1UHBB 5LGOA 1C1TA 3QN7A 4O3UA 1YCPK 1UCYE 3F9EA 4THNH 3BV9B 1DICA 1NC6A 2O8MA 2QF3A 5EXNA 1O2KA 4ZUHA 1EX3A 1NRSH 2CF9H 3NKKA 4TPIZ 1MH0A 2ZKSA 1RJXB 2GZ7A 1Y5AT 1K1MA 1ZHMA 4NIWA 2BDHA 1Y5BT 1DLKB 2AMPA 1YC0A 2AGIX 2GDDA 5C1UA 3URCA 4ABGA 4BAHB 1TNHA 3ENSB 4JK6A 2GV6A 4ZKOU 2TPIZ 4GVUA 3GYLB 4X8SH 3A86A 3K6YA 1LVOA 1ZOMA 1KXEA 2ZHFH 2P95A 3MYWA 3NPSA 4WMEA 1TOCB 2TGDA 3SNDA 4ABAA 3UNRA 3RLWH 3UOUA 1Z6EA 5ESTE 1IQEA 1O3CA 1TA6A 2GCTB 3SHCH 3P70B 1AE8H 2OTVA 3SV9A 2XBXA 1C5NH 4A1XA 1YPJH 1D9IA 1BMLA 2Z94A 5BRRE 1LQEA 3M7TA 3M5LA 5E2PA 3SQEE 3RXCA 3LPRA 2BD3A 4VGCC 4BTIB 1ELFA 1VZQH 1W3CA 4I31A 4FVDA 3SV6A 4K1SA 3MNBA 1GMDG 1BT7A 2P93A 1SR5C 1C9PA 3AW1A 3RXSA 1LKAA 1GBEA 3U1IB 1O33A 3GDUA 2BVSH 4UFEH 2FOAA 1GL1A 1AUTC 3HKIB 4TYDA 4CHAB 2B7DH 1A7SA 4OS1A 1A46H 5EU8A 2UUKB 2UWOA 1HLTH 1LHCH 2TIOA 1IQJA 2ZTYA 2A1DB 4MPXA 1DPOA 4D76A 3NZIA 3SHAH 1A3BH 1C1RA 2PKSC 4ABHA 1JXPA 1W7XH 2VVCA 1YBWA 3B9FH 1AY6H 1O5GH 2C93B 2A31A 3F1SB 4YOIA 2GD4B 2XC0A 2G5VA 1AMHA 3MO6A 1DXWA 2V0BA 1F0RA 3S0NA 5DPAA 1AZZA 4TY7A 2ZU5A 2FI4E 2ZDVH 1P2MA 2CGAA 4CRCA 1WTGH 1DWCH 1TONA 2BM2A 1A61H 3RXEA 1CE5A 4Y79A 2VIVA 1JBUH 4ISNA 4YLQH 2VVVA 6CHAC 7ESTE 2C8YB 3BTQE 5DP6A 1NRQH 2Z9GA 1MCTA 1O2IA 3SNAA 4XFQA 1FY1A 1V2QT 4MPUA 3BSQA 1G2LA 1KLJH 2ZC9H 3FP6E 4ASHA 1UTLM 5EXLA 2G4UA 3MH4A 1MQ5A 3ZZ8A 2FOMB 3E8LA 4FUIA 2R0LA 3EDXB 3A84A 5JDUB 5ABWA 4K60A 4Y8YA 1GGDB 4WJG2 3M36A 4X8VH 1TX6A 2B8OH 1BMMH 2GMTC 1MD7A 3JZ1B 3MWIU 1DSTA 4NZQA 2ZU3A 4ABIA 3O8CA 2ZHWH 2THFB 5HM9A 4ZMAH 3BIVH 4ESTE 1VJ9U 1O38A 2ZFSA 1OYTH 2V3OH 1A2CH 1QB6A 2QXHA 1O3LA 1O30A 1HRTH 2R0KA 2FLBH 2XBYA 4K8BA 2BY9X 5DJ7A 1T8OA 3UREA 4B2CA 1IOEA 2YNAA 1G9IE 3RM0H 1C1UH 1CHOF 3KEEA 1A5HA 4WXIA 3SU5A 3PMHB 1SGFA 2FLRH 5A8ZA 2AFQB 2EC9H 3VXFH 3ZZ6A 2RDLA 2XW9A 3SI3H 1AN1E 1W7GH 1HYLA 3M7UA 3BEFB 4A1TA 5LPFA 1UJ1A 4KELA 4WH6A 1C5OH 2JH5D 2WPLS 1GI1A 1P9UA 3P8GA 1DOJA 1B7XB 1FXYA 4ZHAA 3SV2H 3P8NA 2XNIA 1TE0A 2LPRA 1IQLA 1W0YH 1O2JA 1Z8GA 3BF6H 2JH0D 4UFGH 2PFEA 1TIOA 4GAWA 5FPYA 1PPEE 1AVGH 4DGJA 1C2KA 1GCTC 1L4ZA 3P8FA 8ESTE 4IBLH 2NWNA 1SQAA 1GHZA 1PPFE 3WY8A 4ABFA 1S83A 2IJOB 3IG6B 1T8LA 4TY6A 4F49A 1E36B 1MTVA 3T29A 3LU9B 1BJVA 4B75A 1T8NA 4SGAE 2C8XB 1UK3A 1V2NT 4BTTB 2FM2A 4FU7A 1SGRE 2FS8A 3EE0B 4KTCA 1G3EA 1HAVB 1ZHRA 5C5NA 2ANKH 1HJ9A 3TK9A 3ZVGA 1HBTH 1JMOH 5AF9H 1F5KU 2ZDMA 5DP7A 4FU8A 4X1SU 1C5MD 1F5LA 1EOLA 2OQUA 3M3VA 1OS8A 4BXWA 1GI3A 1ZZZA 1P2IA 1CBWB 4AX9H 2PSYA 1ESAA 5FXLA 3RDZA 2EI8A 1BBRH 4YT6H 1SLUB 2GVFA 1PYTC 2OLGA 2YOLA 1W0ZU 1FI8A 1W10U 4Q7XA 1HIAB 1V2VT 1MKXH 3C27B 3PYHA 5E0HA 4NG9H 3H5CB 1XKBC 3SJOA 1BRAA 1CA0C 5LPRA 1O3IA 1GI9B 4A5TS 1KTSB 4NIVA 2NU2E 2P59A 2WUBA 4NCYA 1F0UA 1P2OA 1PYTD 1H8IH 2SGFE 4PROA 4AG2A 5DK1A 1BRCE 5C20A 4GHTA 3PMAB 4Y11E 1GBHA 5JBAS 4INHA 2BY8X 5DO4H 1BITA 2BDIA 3TJOA 1P3EA 1JIMA 2OBOA 1MAXA 1UTNA 2BQWB 3S9CA 1CGIE 2UWPA 3MNXA 3M7QA 4IN1A 1QBNA 5BPEA 1VGCC 1O3DA 1G36A 1CGHA 4X1RU 3VB3A 5FHTA 1GI6A 1F0TA 2BB4A 1GI7B 3HPTB 1AVXA 5HGGA 2ZGCA 4GUXA 2VVUA 4X2YA 1D3QB 1E34B 1TLDA 4JYVH 3SI4H 3RM2H 3Q76A 4X6NA 2FTMA 3SOSA 2FEQH 4O9VA 4X1PU 1A0JA 1XUIA 2GZ9A 4NFFA 3SGQE 5GCHG 1KSNA 2JETB 1RTFB 4NZLA 2VWLA 2D1JA 3MMGA 5HM2A 2ASUB 3SJ9A 1T8MA 2Z9JA 2XYAA 1QL8A 2AMDA 3F68H 5CHAC 1A1RA 1C5XB 1NO9H 3SUGA 4UD9H 2VB0A 3S69A 4H42U 1CQQA 1QB1A 1O0DH 1E0FD 4X6PA 3I29A 2A7HA 4X0WU 1IQMA 3E0NB 2C8ZB 4OS7A 2WV4A 5DP4A 3LGUA 2WPIS 1NY22 3ATKA 1HUTH 1LKBA 2F9UA 1AU8A 3RMNH 3UR6A 1BTXA 2F9BH 1CU1A 2FX4A 1K1PA 3RMMH 1GCDA 1XXFA 1AFQB 1TRMA 1FAXA 1MKWH 3P17H 3V12A 3LT3A 3RXAA 3E0PB 2RCEA 5EQRA 2BXUH 1S85A 3NXPA 5GWZA 1K1LA 3F9HA 1GVLA 2W26A 1O2XA 2XWBI 3UUZA 2ZEBA 5JBBS 1D6RA 1WAYB 1AO5A 1C2GA 2ZGBH 4ZHMU 3UR9A 1DY9A 1KDQA 2VJ1A 2RA0A 2BQ6B 1GHWH 4YO9A 1B0FA 4D9RA 2FESH 2VWMA 3UTUH 1SGDE 1V2TT 1LQDB 2Y5GA 2VIOA 1XUFA 1P2QA 1TABE 5AFZH 3KQEA 1FY3A 5T6GA 1O3MA 1FZZA 2FOCA 2STAE 3ATMA 3RU4E 1GBBA 2ALPA 1VJAU 1C4Y2 4Y7BA 2ZF0H 5C67A 3A82A 1H9IE 1Y3XA 1MTNB 3N7OA 1W12U 1EPTB 1TMUH 5DG6A 1WQVH 4A6LA 2ZFTA 3E1XB 1DWBH 1V2MT 1MMJN 4D8NA 2CHAB 1SHYA 3QWCH 1UHBA 2F9PA 1O2HA 3AAUA 3UFAA 1NESE 1XKAC 3RUOA 1RD3B 3HKJB 1J14A 4SGBE 1OP0A 1SGYE 4MPVA 1TPAE 1LVBA 3A8AA 2JKHA 2ZU4A 1K22H 4TPYA 1C2MA 3NCLA 3V3MA 5L2ZH 2SNWA 6LPRA 1SL3A 5EG4A 4FUEA 1GHBF 2CXVA 3ZZ7A 1P8VC 2JH6D 1H9HE 1C4U2 1AWHB 1GI8B 6GCHF 1DITH 1VR1H 2VH0A 1ELCA 1YLCA 5F8ZA 4E7NA 2V35A 1C5ZB 2UWLA 2FODA 3GY6A 1SFIA 3PB1E 1C2JA 3ZZAA 3BTDE 4MQAA 3ZVDA 1GPZA 2KAIB 3RU4T 1SGIB 1WCZA 2BZAA 1ELTA 1FUJA 1V2WT 2QY0B 1Y3YA 1FN8A 1E38B 4Y8ZA 4K1EA 2HNTF