3FVFB

The crystal structure of prostasin complexed with camostat at 1.6 angstroms resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
248
structure length
248
Chain Sequence
ITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPISLPAAQASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNSLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site conformational changes of prostasin provide a new mechanism of protease regulation by divalent cations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Prostasin
total genus 51
structure length 248
sequence length 248
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fvfB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fvfB01
3T25A 2GVFA 1H8DH 4LZ1H 2ZDAH 1GBKA 1EJMA 7GCHG 1LQDB 3SV2H 1BJUA 4A92A 3RLYH 3FZDA 5DK1A 3VB7A 1EB1H 2FI3E 4K1SA 1VCQA 1KLTA 3QZQA 3E1XB 2B5TB 2R3UA 2H9EH 1IOEA 2TGPZ 3RXPA 3RU4E 1E34B 2XRCA 1OP8A 1GJ4H 5FX6A 3TK6A 2GZ7A 1A3EH 2A5KA 3A81A 1HAVA 2PV9B 3RXMA 1XMNB 1G30B 4OS4A 1YF4A 4OS7A 4X1NU 2G52A 3QZRA 1GJDB 5LH8A 1DWEH 3FZZA 1C5ZB 2CV3A 1KLJH 2G4TA 3KQEA 2NU2E 1THRH 2J4IA 1O3PB 1W7GH 3UNSA 3GOVB 2OBOA 2B7DH 3RXDA 2D2DA 2VWNA 3SU1A 3MYWA 3UOUA 4IC5A 3O8DA 8KME2 1T8OA 1ANDA 3AW0A 1UVPA 3LJJA 2CF9H 1GJ6A 4J2YB 1TWXB 1CBWB 1O3KA 2GCTB 5GXPA 3TJUA 1BTXA 4IGDA 1TBRH 3QTVH 1D9IA 4FXGH 1BRCE 4RKOB 4UEHH 2VIWA 2FS8A 2ZECA 2Z94A 1GPZA 1MUEB 2BZ6H 1VITF 2A7JA 3STIA 1AE8H 4ZXYH 4DT7B 2QY0B 3U8OH 3OX7U 1JIMA 1NFXA 3F9HA 3EQ0H 1G2LA 1FY3A 4BTTB 1AKSB 4U2WA 3TH4H 3QDZB 1AUTC 3BEIB 3SJOA 1FN8A 3MOCA 3NZIA 5ABWA 1MAXA 2HLCA 3U98H 1ZMJA 1CT2E 2VVVA 1NU9A 1O34A 3ZZ6A 4AB9A 2BY5X 1NRSH 3GY6A 1SBWA 1VITH 2ZWLH 1A0HB 2ZGJA 3C27B 1K1OA 1P2NA 4A1XA 5LPRA 3MO3A 1H4WA 1CGIE 1HLTH 1TAWA 1NRRH 1GBMA 3V13A 3SJIA 4MNXA 5EXNA 4Y7AA 4BAQB 2ZHEH 1OPHB 3A87A 1ABJH 1LQEA 2H9HA 3PTBA 1T31A 1A46H 3PM3A 3A8CA 3HKIB 1XUKA 4AGJA 1BRAA 1UTNA 3P6ZB 2B0FA 4CH2B 1P2KA 1A7SA 2FYRA 1NO9H 4CRAA 3ZVEA 1O2OA 1D3PB 4Y6DA 3A7YA 1NPMA 1RD3B 4Y79A 1THPB 4DG4A 1O3JA 4K60A 2ASUB 1V2PT 1J9CH 1KYNA 1P2JA 3SUFA 1CHOG 4YOGA 1TA2A 2Z3EA 1MMJN 2BD7A 1LHEH 4WWYA 2VIOA 3LGYA 1QBNA 5CHAB 1MKXH 1P8VC 2P3TB 4XOJA 2OC0A 4YOIA 2JH0D 3M36A 5JB8S 1FY5A 1Q2WA 3PTNA 4INHA 2P95A 4Q7ZA 4MNYA 3RXHA 3Q77A 3D62A 3GCHC 1HAGE 3S7HB 1KSNA 1TPPA 3QN7A 1EAIA 1TBQH 2VIVA 1UK3A 5K7RA 3AAVA 3Q3KA 2AIQA 1DLKB 2ZU5A 1EJAA 1FI8A 3GISB 1O3FA 1O30A 1SGRE 1ORFA 3ZZ4A 4E05H 4D9QA 2W26A 3BTFE 4LOYH 3MNXA 1C2FA 5ETXA 1AFEH 3TGKE 5DP4A 3PLKA 1V2NT 2P59A 1A0JA 1O3HA 2M5TA 1XM1A 2TGTA 3UPEA 1SGQE 2FOBA 2BLOA 4NIXA 2O8WA 3T29A 4O03A 1QB9A 1JOUB 3MNBA 4JZ1A 5F03A 2VH0A 5AF9H 1QNJA 1AWHB 2EI7A 2ZHDA 1K9OE 1OP0A 1PPCE 1HJ9A 3TK9A 1C4V2 3SQEE 1HXFH 4JK6A 5BRRE 3U69H 1GHYH 1QJ7B 2ZHWH 3KGPA 2NU3E 1GI3A 2A7CA 1C5VA 3TJOA 1SGFA 4BXSA 4CRCA 1ZPCA 2P8OB 1BMAA 1J15A 1C2KA 5GPIB 1VZQH 5FHTA 1SHHB 5CHAC 1NM6A 1PYTC 2F3CE 1C2JA 5HXFA 1SR5C 1QR3E 5AFZH 4ZKSU 3L3TA 1TNJA 1W14U 3SGBE 1QBOA 1GJCB 1V2ST 1GHZA 1OSSA 3F9FA 5HGGA 3P70B 1C1SA 1SGCA 1HDTH 1HJAB 4LZ4B 1HBTH 3UUZA 3HKJB 1XVMA 1ZSJA 4BAHB 2BD2A 4HZHA 2A5AA 3RXIA 2GCTC 1DT2A 1G2MA 2ZTZA 4OS2A 1TNLA 3UQVA 1TMUH 5L2ZH 4ABGA 2CHAB 3ZZAA 2GX4A 2BDBA 3GY5A 1J8AA 1C9TA 1P09A 1TGCA 1CO7E 3KIDU 2XXLA 5F6MA 1T8LA 1E0FD 1IQEA 1QRXA 5DP9A 2F83A 1O36A 2ZU1A 2ZG0H 3ENSB 1EP5A 1S83A 4WMEA 1IQGA 5J4SA 3RU4D 5EXMA 1WSSH 3NWUA 3V7TA 4DY7B 1FQ3A 1B7XB 2PUXB 1O3MA 4INLA 3TJNA 1LHGH 4ABAA 4DVAU 1F0RA 1Y5AT 8GCHG 3BV9B 4Y76A 2F9UA 1V2RT 2TIOA 2NU4E 2FDAA 2JETC 3A82A 4BAOB 2Z9JA 1C5RA 1V2LT 5EQRA 1ARBA 1CT0E 1L1JA 2ZIQH 2ZGCA 2BHGA 1TQ7B 2G00A 4CRGA 1GI8B 3SJKA 3ZVCA 1W12U 2TRMA 2V6NA 1SMFE 1GWAA 5AHGH 1TX8A 3SNAA 1UK2A 3UWIA 1EAUA 3KL6A 1O32A 1QCPA 1AQ7A 3BEFB 4KTUA 3ITIA 1MTNC 1DLEA 1TNKA 1P01A 1TPOA 1DUEA 2IJOB 2GTBA 2R3YA 3T26A 2ZNKH 2ZI2H 1Z8JB 2ANKH 1Y3UA 3QTOH 4YESB 9ESTA 1DXWA 1NFWA 4XBBA 1N6XA 1GBFA 2STBE 1VGCC 3DD2H 3B8JA 2AERH 1YM0A 3RXSA 1SLUB 2ODQA 3ELAH 3MHWU 2GP9B 7KMEH 1TPAE 5L2YH 1W10U 2WPMS 1MCTA 1L4ZA 2OTVA 4JK5A 3P8FA 1OP2A 2A4OA 1GHXH 4XBCA 1P10A 3BG4C 5B6OA 1V2WT 1G3EA 1G36A 1O2WA 2AEIH 2ANWA 1O3EA 5E8EH 1GJAB 2ZFFH 1N1LA 4DJZB 1SFIA 1SLXB 1WTHD 1HRTH 3A89A 3QGJA 2P16A 2SGDE 4AB8A 2NU0E 3IG6B 2WPJS 5FPTA 5T3HA 1C5UA 1N6YA 3SN8A 3FP6E 1TPSA 1DVAH 1EZXC 3NXPA 5C20A 4NZQA 3CENA 3SGQE 2G55A 2A5IA 2SNWA 1LVMA 2SGPE 1YLDA 4NFFA 4U01A 8ESTE 1GL1A 2BLVA 3PWBA 1CVWH 1ZGVA 4NA8A 4AN7A 3W95A 4TPIZ 1HCGA 4B1TA 1T4VH 3RU4T 2BXTH 2Q1JA 1C5MD 3P17H 1G3CA 4ISHH 3U1JB 2Z6BD 1H9LB 1GCDA 1BMLA 3O8RA 1SGTA 1O3OA 4J1YA 1O2RA 1QL7A 2Z9IA 4Y71A 2QAAA 1SGPE 2ZDMA 3GY2A 5EQSA 1VITG 4WJG2 4UD9H 1FPCH 3UR6A 1SGDE 2CGAA 2A4RA 1SG8B 1QURH 4X2VA 1ARCA 2B9LA 2Z9LA 3GY7A 1BA8B 4TWWA 1FUJA 1LVOA 1MQ6A 3I77A 2BVSH 1CA0C 1GL0E 2VVUA 3GCTF 5EW2H 4O3TA 1ELCA 1L0ZA 2PUQH 1F7ZA 1O2LA 4ZHAA 1GBIA 1UJ1A 4B75A 4X0WU 3SI4H 2AGEX 1O37A 3MH6A 3HK3B 4ZAEA 3U8RH 2ALVA 1AU8A 4AFSA 1YPEH 2FOHA 3R0FA 1YPKH 3SUEA 4A1VA 1KXEA 1YKTA 3NKKA 1QRZA 4UFDH 5C5NA 1AWFH 1GHAF 2RA3A 1FZZA 3ZZ8A 1SVPA 3RXVA 2SFAA 3QWCH 3VEQB 7ESTE 5JDUB 3UREA 1FIWA 1DSTA 1ESAA 4ZHMU 1C2MA 4XSKU 1O35A 1TONA 4YM9A 2C3SA 4ZMAH 1TMTH 3SJ8A 1QJ1B 3KQBA 1ELEE 4FU8A 1BTZA 3EA8A 4B73A 1AN1E 1E38B 1OWJA 3RMMH 4A6LA 2VIQA 1O2NA 4K5ZA 1D4PB 2J94A 1Y3VA 1QIXB 1MD8A 2SGQE 2G51A 1QQUA 1PPGE 3U8TH 4OGXA 2R0KA 3MH4A 1H9IE 2ZCHP 2P94A 4GCHG 3M7TA 1P57B 1O5DH 3QLPH 1BTHH 1ZJKA 3BTGE 2OC8A 1AFQC 3TITA 2BQ7B 1XXDA 1EZUC 3E3TA 1UMAH 3M3VA 3ZVGA 2BTCE 4SGBE 2C8XB 3UOPA 1GHBG 3LGWA 4AG2A 4BAMB 1ZMNA 4UFFH 2PR3A 2QXGA 1GBJA 1V6DA 4CR5A 1GMDG 4AX9H 1LHDH 2FPZA 4ABEA 1E36B 5A8YA 4E7RG 1TMBH 3BF6H 3TH2H 1MQ5A 4IN1A 2BD3A 1TNHA 5EPYA 3A83A 1AUJA 2OLGA 1MD7A 4X2WA 2FLBH 2W3KA 5A09A 3M3SA 1IQHA 3LGVA 4F49A 1ELFA 4X6MA 4MPUA 2F9OA 4Y8XA 4NCYA 3E0PB 3SUDA 1S6HA 1GGDC 2B8OH 4KKDA 2FZZA 8LPRA 2BOKA 1G32B 3VB3A 1BTWA 4X8VH 2UWPA 1YPLH 2GT7A 3RMNH 1OKXA 1P3CA 2OCVB 1UTJA 3E90B 1MBQA 2FI5E 1N8OC 3FAOA 2J95A 2I6QA 2BM2A 5JBBS 2VINA 5DPAA 1SGIB 3VPKA 1JRSA 4ZH8A 4AORA 4TY7A 5L6NH 2Y6TA 3LDXH 1DM4B 3E8LA 3TNTA 4X6OA 3DT0H 4I8HA 1ZOMA 2FMJA 1C1QA 3SUGA 5E0GA 1IQLA 1ETTH 1KTSB 5F8XA 3RXJA 1V2VT 3M5LA 2GT8A 4FUHA 2GD4B 1A3BH 1CA8B 1MTWA 3LKWA 4PROA 4KTCA 2VIPA 2VJ1A 2A2QH 2HALA 5CMXH 4BAKB 1P05A 2FODA 1S0RA 1A4WH 4BOHA 3ODDA 3EYDA 1QB1A 1WV7H 3GY8A 1C1UH 1QRWA 4A1TA 1TRNA 3PYHA 4I31A 1ZTKA 1GHBF 1UO6A 1H8IH 3VB4A 5FAHA 4ABHA 3E6PH 2V35A 2P3FH 1QHRB 4AFZA 1UTQA 1O3GA 3UFAA 4NWKA 4BTIB 2G5NA 2ZU2A 2ZFTA 3MH5A 1A2CH 2ZHQH 2Z3CA 4Q2KA 1H1BA 4U32A 3CP7A 4DCDA 4WH8A 2BDIA 1C4U2 4E7NA 1F92A 2R2MB 3LH3A 1ZRBA 1A5HA 3RMLH 2HRVA 2R9PA 3W94A 1LHFH 2BVXH 4HTCH 2BD9A 1WTGH 4JZEH 3VGCC 1HV7A 1RRKA 2XWBI 1IQJA 5E2OA 2QC2A 1ZYOA 1A61H 3EA7A 3I78A 4JMYA 1YPHE 4XBDA 1S81A 5DP8A 3T28A 1DSUA 1JWTA 3E16B 4FVDA 1C5PA 1YPHC 1HAZB 1K1LA 2PWXA 1EB2A 2PFEA 1GI0A 4KTSA 5J4QA 1EAXA 1MU6B 1OYTH 2HVXA 1K1JA 3M7QA 1EUFA 4JZIA 1XKAC 2AS9A 2GCHG 5HM9A 2ZFSA 1FY1A 1UHBA 2J34A 2QXHA 1Z8IB 1ANBA 1O3AA 3Q76A 1KY9A 1DX5M 4ISOA 1DPOA 2RDLA 3PLBA 1O2HA 2GCHF 2BD4A 1P02A 1G3BA 4CREA 2QCYA 4GUXA 3TVJB 1Y3XA 3EAJA 3FP8E 1FV9A 1O3BA 3ZZ3A 1C5WB 3LC5A 3LJOA 2ZDVH 2FIRH 2YNBA 3LOXA 2ZZUH 1B0FA 1HAXB 3SU6A 4NIWA 2A32A 1YPGH 1C2GA 1HAYB 5EU8A 3NUMA 4ZROA 1FMGA 1AFQB 5DP5A 2W5EA 2O8UA 1DICA 5GJ4B 1S6FA 1L4DA 1KXDA 1AE5A 3UQOA 1K21H 2JH5D 2XTTB 2XBWA 3U9AH 3BTWE 3LU9B 2PKAB 1ZMLA 3EGKH 2ZFPH 2ZCKP 1HNEE 3B23B 1MTNB 1YBWA 2ZDKA 3WY8A 2FOCA 1VJAU 1YPJH 2ODPA 3BTTE 3RXFA 1N8OB 2EC9H 3L33A 3AVZA 4CRDA 1O2GH 4DURA 3SNDA 3M37A 1T8MA 3MH7A 5C2ZA 1FNIA 4H42U 4K1TA 3A85A 5AVDA 3K65B 5AFYH 2THFB 2ZFQH 2ODYB 1GHAG 2SGFE 3SV8A 2A2XH 4CBOA 1K28D 5E2PA 1GI9B 3FP7E 1TRMA 3GDUA 3GY4A 3A8DA 3F6UH 4ZHLU 3DFLA 2CJIA 1ESBA 1VR1H 1SGFG 2BDYA 3KCGH 2W7SA 4CR9A 2GKVE 1YCPH 5GWZA 2ZF0H 2LNCA 4X1QU 1C1OA 3ZV8A 2H9TH 3A80A 3ATLA 3O8BA 3P8GA 5T6GA 4GLYA 1ANCA 3ZV9A 1CGHA 1GBDA 4UFEH 5DKMA 3FANA 4R0IA 2GZ8A 5IDKA 2XWAA 3S7KB 4F4OC 3SGAE 1P9SA 1BQYA 1RS0A 4B2CA 2WPIS 4MG3A 1HPGA 2G4UA 4DW2U 2PKAA 1O5CB 4NIYA 4ZKRU 1RTKA 2Y5HA 1C4Y2 1SLWB 3ZVFA 4HFPB 1BRUP 1SHYA 4D76A 3ZZCA 2AYWA 1LPKB 3T5FH 4X6NA 1GDQA 1UCYH 4CHAB 1C5NH 1W0ZU 2W3IA 3UTUH 1C1RA 1NY22 2HWLB 3GCTG 5G4BA 1SL3A 2FX6A 3KN2A 2AMDA 2XBYA 1F5RA 4FVBA 3M35A 1QL9A 2C8YB 1V2UT 3MNCA 3A84A 2WUBA 2GDEH 2BY6X 1WYKA 1AHTH 4H4FA 5ESBA 4ZXXH 1ELVA 3BIVH 2UWOA 1OWEA 5C3NA 4NA9H 1A5GH 1ZRKA 1G9IE 3A8BA 1BUIA 3GCHB 6GCHF 3P95A 4I7YH 3V0XA 2YNAA 2ZEBA 1FAXA 2ZGHA 3R3GB 4GPGA 4TY6A 2F9PA 1Y3WA 1AD8H 3BIUH 3PLPA 3TPIZ 3FVFB 4IN2A 3RXEA 1SB1H 5C67A 1TQ0B 2PHBA 2OINA 5C1UA 1TBZH 1CSOE 1MBMA 4JCNA 2C4FH 4ISLA 2F9NA 4KGAA 4NG9H 1ZGIA 2BB4A 4X2XA 2AIPA 2Q6FA 5C1YA 1OWIA 3BG8A 3ZVDA 1F0SA 5EW1H 1P3EA 5LPEA 1F0UA 1ZZZA 4Z6AH 1FONA 1V2TT 2Z7FE 4KELA 1NC6A 2ANMH 2A4QA 1SC8U 6CHAC 1RTLA 2FS9A 2WYJA 3F9EA 2XBXA 4FUJA 1CA0B 1PPBH 1MKWK 1WOFA 1DY9A 4DIIH 4Q7XA 3TU7H 3MO6A 3TH3H 1PPZA 4K69A 2Z9GA 1LKAA 2D8WA 4YOJA 2J2UA 2YOLA 2XYAA 4YT6H 1QL8A 3SJ9A 2H6MA 1O5FH 1DANH 2Y80A 1BBRK 3TNSA 1KDQA 2TPIZ 2ESTE 2DUCA 1RGQA 2ZKSA 5A0BA 1FY8E 2WPKS 4I33A 4A5TS 2H1UA 3F68H 1WQVH 2FM2A 2BDGA 2ILNA 1EX3A 3SHCH 1PQ5A 1GBCA 3PWCA 2BX4A 1WCZA 6GCHG 3ZVAA 4IMZA 1GDUA 2HPQH 1Q3XA 3M5MA 2ZPSA 1NRQH 1UCYE 9LPRA 1JXPA 2FEQH 3K6ZA 1D3QB 1HAVB 2AGIX 3P92A 2QA9E 4XDEA 5HYOA 1FJSA 3GDSA 1MU8B 5JBAS 4I8GA 4CRBA 1KDQB 1IAUA 3PMJA 2XBVA 1OOKB 4U30A 1ZTLA 4D7GA 4IBLH 1Y59T 1UVUH 1G37A 3MTYA 5EG4A 1A1RA 2ZU3A 2BMGB 3ESTA 4BANB 4ABJA 2Z3DA 3PB1E 1X7AC 2FLRH 3OSYA 1FPHH 3SNCA 3PO1B 2CF8H 2TGDA 2RCEA 2WPLS 3PMBB 1IHSH 2BD5A 2QGRA 1OWHA 1TB6H 4X1RU 1QY6A 1KLIH 1Z6JH 1P12E 5FBEA 2P8OC 3MU8A 4Y11E 4AFQA 1C5XB 1S84A 1PPEE 1C1MA 1EPTC 1BB0B 2VWLA 3D65E 4ZKOU 1GJ5H 1O3IA 2BDHA 2PTNA 1NT1A 2FOAA 1LPZB 1ABIH 5FCKA 5CE1A 1QGFA 1TIOA 3S9CA 2AMPA 1TGNA 2A7HA 2UWLA 1EOLA 1ETSH 1SQTA 1UK4A 3TGIE 3RXGA 1C1PA 2PLXA 1GDNA 1KTTB 2BLWA 3TLOA 3VB5A 4O3UA 2BDCA 1C9PA 3EA9A 2QIQA 4JYTA 3MI4A 3SOSA 1Z71A 1SI5H 4FU7A 2P3UB 4THNH 4YLUA 1YYY1 1SFQB 2ZFRH 1W3CA 1HAOH 4B76A 1BJVA 2STAE 1QA0A 3JZ1B 3RXKA 1H9HE 3TIUA 1C1WH 2AH4X 1JIRA 1UCYK 2GV6A 3P8NA 1K1MA 4HI3A 1GG6C 1THSH 1EXFA 2BQ6B 1QA7A 1J17T 1TYNA 3A86A 1LHCH 1BTUA 1MCVA 5DP3A 2FOMB 1O2ZA 3ZZ5A 1C2DA 2FX4A 1OXGA 1S85A 2BLQA 1YCPK 1TRYA 3PMHB 3A8AA 1Z8GA 3KQCA 1F0TA 3VFEA 1GCTC 5K0HA 5DP7A 4SGAE 3RXTA 5LPFA 1TGBA 1BBRE 3LT3A 5HMAA 3ZVBA 5FPSA 2HNTE 1C5OH 3M7UA 4AYVB 1FLEE 3KQDA 3KNXA 1S5SA 3DA9B 2DE9A 2P93A 3DHKH 1GMCG 3ZYDA 1FDPA 2FI4E 2WV4A 2XCNA 3RC5A 1LKBA 3AASA 1HXEH 1C2HA 1FXYA 1HJAC 1FY4A 1O5BB 2Y82A 1O38A 1TA6A 3A7TA 1BDAA 3RC6A 1TOCB 1BITA 1TFXA 2HGTH 2Y5FA 2Y7ZA 4Y8YA 2FOGA 1P04A 1W7XH 5EGMA 1W13U 1K1PA 4GAWA 1O2IA 1ELGA 3TGJE 3CS7A 1P06A 1KXFA 4ABIA 3ATIA 2UUYA 3LPRA 5A0CA 4YT7H 1NN6A 4NSVA 1LMWB 1YC0A 2R2WU 4FUEA 4B74A 2EA3A 3M5NA 5DJ7A 1GVZA 1Z1JA 2ZA5A 3PROA 1EPTA 4B2BA 2SNVA 1ZSLA 1CQQA 4MQAA 1LPGB 1L1NA 2RG3A 1GJ9B 3BTDE 3E0NB 4DGJA 2GV7A 3CS0A 4Y0YE 1UVOA 4YO9A 3SV9A 1ZPBA 3LGTA 3SORA 1FIZA 5FBIA 3U1IB 2ZHFH 2HOBA 1P2OA 4I32A 4UDWH 1RFNA 1NROH 3T2NA 1DXPA 1GJBB 2WV5A 3UR9A 1WQSA 2OBQA 1RXPA 3QGNB 3GY3A 3KF2A 1PPHE 2A0QB 3GCNA 1UVTH 2D1JA 3VXFH 1QJ6B 2V3HH 4MNWA 2ZO3H 3T27A 3BG4B 3I29A 1SOZA 1AI8H 1ZHPA 3S9AA 1GVLA 3HPTB 4D8NA 5F8ZA 1YGCH 1W11U 2QF3A 4WXVA 2WYGA 1HJ8A 2BZAA 3LIWA 3M3TA 4IMQA 2I6SA 1E37B 1KXCA 2J92A 4GSOA 3N7OA 4M7GA 4GVUA 1TGSZ 3ZZDA 3RM0H 1HAPH 1TX6A 1O5GH 1O2KA 1QB6A 4K1EA 2V0BA 4NZLA 4FUCA 1O2JA 2BY8X 2Y81A 3BTKE 4Q80A 5BPEA 4AYYB 3D23A 3H7TA 1C1NA 3EE0B 1UTLM 4TPYA 3SNBA 1P2IA 4JYVH 2JETB 4A7IB 1F5LA 1UTKA 1GBTA 5TCCA 1EASA 1ZJDA 1PFXC 1NU7B 5FX5A 2UUKB 1XUJA 3SZNA 1V2KT 2Q6DA 1CU1A 1AB9B 2GZ9A 1XUIA 3C1KA 1SQOA 2PW8H 1V3XA 1EZQA 2BY9X 2PSXA 4VGCB 1C1VH 1GI5A 1Z7KA 1AZ8A 1ZHMA 3LC3A 1Z6EA 4WMDA 1DFPA 1V2QT 3RM2H 4CH8B 3RMOH 1NFUA 2GDDA 3SV7A 1U6QA 2PKSC 1CGJE 1EP6A 1PQ7A 1BTPA 2WUCA 4MNVA 1ZLRA 5GDSH 5IYTA 1Y3YA 1O2XA 1C5LH 1GI2A 1IHTH 3GYLB 3A7VA 3RDZA 4MPWA 2BX3A 1BOQA 2SGAA 4X8TH 5FXLA 3RXOA 2Z9KA 1KXAA 2ZTXA 4E06H 4Q7YA 4FUBA 2R0LA 1LVBA 2QXJA 2BQWB 2PKSB 2BY7X 3SI3H 2F9BH 5T6FA 4R8TB 2G8TA 3SU2A 1WUNH 2HNTF 5A8ZA 2A1DB 3ZZBA 2ZPQA 1GI7B 5EOKA 4AZ2B 4ZUHA 2OC1A 2K1QA 4X8SH 3H5CB 4ISNA 1QBVH 1AGJA 1QTFA 2LPRA 1LDTT 2GGVB 2XW9A 1TOMH 1BTYA 1SGEE 6ESTA 2FTLE 4X1PU 1O2YA 2SGEE 2EEKA 3RXUA 2G81E 1CHOF 3E91A 5HM2A 1W0YH 4D9RA 2ZC9H 5C1XA 2G5VA 1GHVH 1TALA 1GI6A 1VJ9U 1GBEA 1SLVB 4FUIA 4AFUA 3MNSA 4NGAH 4AOQA 5I46H 2O9QA 3BN9A 2FYQA 3OY6U 2FWWA 1RJXB 2OD3B 4WF8A 3VB6A 5ESTE 3SBKA 1O5AB 2FXRA 3M5OA 2WINI 3RXBA 4B2AA 2Y5GA 1O39A 4KP0A 5T6DA 2ZP0H 2C93B 4LXBH 4H6TA 4X2YA 3OYPA 1SSXA 2EI8A 2QV1A 1IQKA 1DUAA 1BCUH 2BXUH 1OX1A 1Y5BT 2AFQB 5E0JA 1A5IA 2XC5A 4HGCA 4VGCC 1CBWC 1K1NA 4I8JA 1E35B 1AB9C 1GBLA 3SU3A 5H4IB 3V3MA 1HIAA 2Q6GA 1AY6H 1XXFA 1ELDE 1KIGH 3BTQE 3SU0A 1O3LA 3RXLA 1GI1A 1MKWH 3QX5H 4NIVA 1P2MA 3QK1A 5SGAE 1O2UA 1D3TB 3AW1A 1O0DH 1P11E 2O8MA 3PO1C 1C2IA 1B0EA 7LPRA 1M9UA 2HPPH 1PPFE 1O2TA 1BIOA 2J9NA 3O8CA 4CBNA 2UUFB 1K22H 3QO6A 3BEUA 2BOHB 1EAWA 4NA7A 6LPRA 1TNIA 3MWIU 5C5OA 3K9XB 1LVYA 1ACBE 4IS5A 1UHBB 4UFGH 1WU1A 1RTFB 2XC4A 3LONA 2WPHS 1A0LA 4YTAA 1XKBC 4BTUB 5EPNA 1CHGA 1GBBA 1NFYA 2F91A 4MTBA 2ZDNA 1EQ9A 1OWDA 1ANEA 1BMMH 5I25A 5JYIA 1XVOA 3UNQA 1C5YB 1T7CA 3ATMA 1AO5A 1OS8A 3URCA 3BTME 1DOJA 3SNEA 1AIXH 1GBAA 1RIWC 3ATWA 1ZTJA 6CHAB 1DWBH 4MVNA 3HK6B 4FUDA 4CHAC 1HIAB 5GCHG 1NESE 4WY3A 3OU0A 1EATA 5DGJA 3G01A 1C5SA 1ESTA 3GYMA 1NRNH 3MFJA 2H5CA 4ESTE 1ZR0A 3RUOA 1BHXF 2HNTC 3JZ2B 1GJ8B 2FO9A 1BT7A 4MLFB 1W2KH 2AMQA 1GHWH 1PYTD 4BXWA 1SGNE 3PMAB 1BMNH 4X6PA 2QYIA 4FUFA 4FU9A 5A0AE 1AVWA 4TYDA 4JYUH 3LGUA 1QQ4A 1ZHRA 3B9FH 1P03A 3VGCB 2ZDLA 2NU1E 1V2OT 2J38A 2QF0A 2ZCLP 3VXEH 3NK8A 2BDAA 2AGGX 1SPJA 2JH6D 3M61U 2UUJB 2IN2A 4CRFA 1L2EA 1O2VA 8GCHF 1FAKH 2FOFA 2TGAA 3ODFA 4ISIH 3GICB 2GMTB 3RXRA 5EXLA 4ABBA 4GCHF 4NSYA 3RXCA 1JRTA 4Y0ZE 1J16A 4XFQA 5L30H 5LGOA 2A4GA 2A31A 2FESH 5FCRA 1WBGB 3ATKA 5A8XA 3TK5A 1YP9A 1CE5A 1O3CA 1SQAA 2ZTYA 1DE7H 4Z0KA 2VIDA 1VCPA 1JBUH 4DIHH 2D26C 5TCAA 2Y7XA 5DO4H 1TLDA 4GHQA 1QFKH 2OUAA 1O3DA 1GI4A 1NRPH 1MTSA 4IW4E 3LGIA 5DP6A 1D3DB 1HYLA 1EPTB 3SQHE 1NTPA 5A2MH 1OYQA 4RKJB 1ZSKA 1S0QA 4WH6A 1T8NA 2BD8A 1P2QA 4K3JA 2XC0A 1WAYB 5JBCS 4X8UH 5FPYA 2H5DA 2ALPA 4YLQH 2VU8E 4I8LA 5TJXA 1G3DA 5EODA 3TJVA 3IITA 4MPVA 3T62A 1HUTH 3HGNA 3DUXH 1MTUA 1P9UA 3BTHE 1C5QA 1O3NA 4LK4A 5E0HA 1D6RA 2IPHA 3MU4A 2F9VA 1IQMA 3OY5U 1GVKB 2PGQB 3OTJE 4H6SB 3LH1A 1IQFA 2CXVA 1JMOH 1P0SH 4O9VA 1HFDA 3GCOA 2CN0H 2PTCE 3GDVA 2VWMA 4NWLA 2CHAC 3D49H 1K1IA 3S0NA 2VGCC 1O33A 2FP7B 4FUGA 3NCLA 5JPMH 1YCPM 1MKXK 3SW2B 2VH6A 2IOTA 2OP9A 1F2SE 2FOEA 3HGPA 4IC6A 1D6WA 4INKA 4ASHA 1J14A 3RLWH 3UIRA 1TGTA 3Q3XA 1ELTA 4DOQA 4OS6A 2C8WB 2OC7A 3UY9A 2TBSA 1T32A 2V3OH 1IQIA 1DITH 3IWMA 2O8TA 1SOTA 1PJPA 1HGTH 1KXBA 1DDJA 1MZDA 3KHVA 3S9BA 3KEEA 2GMTC 3NPSA 1BRBE 1O2MA 1Q31A 1AKSA 5PTPA 2BYAX 3MU5A 3H7OA 3QUMP 2C90B 4Y8ZA 3EDXB 3BTEE 1T4UH 4TWYA 3V12A 1AMHA 1LO6A 3A7WA 3ZZ9A 2ZPRA 1VCWA 3HATH 2KAIB 3L6PA 5GIBA 1F5KU 1GBHA 4RN6A 2OQUA 1S82A 4MPXA 3URDA 4OS5A 4K8BA 1XUGA 1Z8RA 2ZU4A 1ID5H 3A7ZA 1HAHH 1YPMH 1MAYA 4WXIA 1XUFA 3DFJA 2EI6A 1AZZA 1GMDF 3A7XA 1UTPA 2C8ZB 3SO3A 4GHTA 5EQQA 1DWDH 1ETRH 4JZFH 1TNGA 1O2SA 1W8BH 1INCA 4NFEA 2XNIA 2ULLA 1O5EH 1MTVA 4D7FA 1V2JT 2ZGXH 1TE0A 4Y10E 1C2LA 1ZPZA 4UE7H 3SU4A 1C5TA 1HAIH 1HB0B 3ZZ7A 1YLCA 1TABE 1DY8A 4UONA 3RP2A 1L1GA 3MU1A 2KAIA 3SV6A 1XUHA 2ANYA 4ZKNU 1NS3A 1AVXA 2DE8A 2XCFA 2OQ5A 2RA0A 1BZXE 4Y7BA 2NWNA 1C1TA 1EJNA 4AGKA 4YZUA 3A88A 3P8OA 1GCTB 3RXQA 1O2QA 4I8KA 1B5GH 4JZDH 2W7UA 4ABFA 5JBTA 1Y8TA 3STJA 3SU5A 2CMYA 1AVGH 1EOJA 3ZYEA 2QN5T 4AG1A 4RSPA 3AAUA 1GMCF 5GCHF 1DS2E 1ELAA 4OS1A 4OGYA 2PSYA 1K2I1 1OWKA 1GMHG 2QXIA 1MH0A 4B71A 1Z1IA 1UTOA 2A45B 2ZQ1A 1O2PA 1IQNA 2VNTA 1MZAA 1GGDB 1GJ7B 2H2ZA 1UTMA 3UWJH 3BSQA 1FN6A 1NZQH 1GMHF 2BVRH 3K2UA 1EKBB 3K6YA 1UVSH 1RIWB 3RXAA 3MMGA 1XX9A 3UNRA 1DWCH 4BNRA 4MDSA 1V2MT 1PQAA 1Y5UT 4WMFA 7GCHF 2FTMA 2OXSA 2VVCA 3F9GA 1BBRH 4ABDA 2PGBB 5F8TA 1LCYA 1PQ8A 4QT8C 3MO9A 2O8LA 1BHXB 1LTOA 4O97A 1GG6B 3S69A 4K2YA 2ZQ2A 2ZGBH 4WVPE 3PV4A 4X1SU 2VWOA 3SHAH 1EZSC 1SGYE 3Q00A 3FFGA 3MU0A 1VGCB 1ELBA 3Q3YA 1CT4E 4XE4A 3RC4A 2VB0A 5DG6A 5JB9S 4K8YA 1C2EA 1O31A 1TX7A 2VGCB 2JKHA 3F1SB
chains in the Genus database with same CATH superfamily
3T25A 2GVFA 1H8DH 4LZ1H 2ZDAH 1GBKA 1EJMA 7GCHG 1LQDB 3ZIAD 3SV2H 1BJUA 4A92A 3RLYH 3FZDA 5DK1A 3VB7A 1EB1H 2FI3E 4K1SA 1VCQA 1KLTA 3QZQA 3WW7A 3E1XB 2B5TB 2R3UA 2H9EH 1IOEA 2TGPZ 3RXPA 3RU4E 1E34B 2XRCA 1OP8A 1GJ4H 5FX6A 3TK6A 2GZ7A 1A3EH 2A5KA 3A81A 1HAVA 2PV9B 3AK5A 3RXMA 1XMNB 1G30B 4OS4A 1YF4A 4OS7A 4X1NU 2G52A 3QZRA 1GJDB 5LH8A 1DWEH 3FZZA 1C5ZB 2CV3A 1KLJH 2G4TA 3KQEA 2NU2E 1THRH 2J4IA 1O3PB 1W7GH 3UNSA 3GOVB 2OBOA 2B7DH 3RXDA 2D2DA 2VWNA 3SU1A 1H8HD 3MYWA 3UOUA 3NRLA 4IC5A 3O8DA 8KME2 1T8OA 1ANDA 3AW0A 1UVPA 3LJJA 2CF9H 1GJ6A 4J2YB 1TWXB 1CBWB 3EE7A 1O3KA 2GCTB 5GXPA 3TJUA 1BTXA 4IGDA 1TBRH 3QTVH 1D9IA 4FXGH 1BRCE 4RKOB 4UEHH 2VIWA 2FS8A 2ZECA 2Z94A 1GPZA 4B6EA 1MUEB 2BZ6H 1VITF 2A7JA 3STIA 1AE8H 4ZXYH 4DT7B 2QY0B 3U8OH 3OX7U 2RFKC 1JIMA 1NFXA 3F9HA 3EQ0H 1G2LA 1FY3A 4BTTB 1AKSB 4U2WA 3TH4H 3QDZB 1AUTC 3BEIB 1WDIA 3SJOA 1FN8A 3MOCA 3NZIA 5ABWA 1MAXA 2HLCA 3U98H 1ZMJA 1CT2E 2VVVA 1NU9A 1O34A 3ZZ6A 4AB9A 2BY5X 1NRSH 3GY6A 1SBWA 1VITH 2ZWLH 1A0HB 2ZGJA 3C27B 1K1OA 1P2NA 4A1XA 3UAIC 5LPRA 3MO3A 1H4WA 1QZ8A 1CGIE 1HLTH 1TAWA 1NRRH 1GBMA 3V13A 3SJIA 4MNXA 5EXNA 4Y7AA 4BAQB 2ZHEH 1OPHB 3A87A 1ABJH 1LQEA 2H9HA 3PTBA 1T31A 1A46H 3PM3A 3A8CA 3HKIB 1XUKA 4AGJA 1BRAA 1EFRD 1UTNA 3P6ZB 2WZQA 2B0FA 4CH2B 1P2KA 1A7SA 2FYRA 1NO9H 4CRAA 3ZVEA 1O2OA 1D3PB 4Y6DA 3A7YA 1NPMA 1RD3B 4Y79A 1THPB 4DG4A 1O3JA 4K60A 2ASUB 1V2PT 1J9CH 1KYNA 1P2JA 3SUFA 1CHOG 4YOGA 1TA2A 2Z3EA 1MMJN 2BD7A 1LHEH 4WWYA 2VIOA 3LGYA 1QBNA 5CHAB 1MKXH 1P8VC 2P3TB 4XOJA 2OC0A 4YOIA 2JH0D 2LELA 3M36A 5JB8S 1FY5A 1Q2WA 3PTNA 4INHA 2P95A 4Q7ZA 4MNYA 2YMSC 3RXHA 3Q77A 3D62A 3GCHC 1HAGE 3S7HB 1KSNA 1TPPA 3QN7A 1EAIA 1TBQH 2VIVA 1UK3A 5K7RA 3AAVA 3Q3KA 2AIQA 1DLKB 2ZU5A 3FKSD 1EJAA 1FI8A 3N99A 3GISB 1O3FA 1O30A 1SGRE 1ORFA 3GS9A 3ZZ4A 4E05H 4D9QA 2W26A 3BTFE 4LOYH 3MNXA 1C2FA 5ETXA 1AFEH 3TGKE 5DP4A 3PLKA 1V2NT 2P59A 1A0JA 1O3HA 2M5TA 1XM1A 2L6OA 2TGTA 3UPEA 1SGQE 2FOBA 2BLOA 3PV2A 4NIXA 2O8WA 3T29A 4O03A 1QB9A 1JOUB 3MNBA 4JZ1A 3F2HA 5F03A 2VH0A 5AF9H 1QNJA 1AWHB 2EI7A 2ZHDA 1K9OE 1OP0A 1PPCE 4M9FA 1HJ9A 3TK9A 1C4V2 3SQEE 1HXFH 4JK6A 5BRRE 3U69H 1GHYH 1QJ7B 2ZHWH 3KGPA 2NU3E 1GI3A 2A7CA 1C5VA 3TJOA 1SGFA 4BXSA 4CRCA 1ZPCA 2P8OB 1BMAA 2KCOA 1J15A 1C2KA 5GPIB 1VZQH 5FHTA 5DN6D 1SHHB 5CHAC 1NM6A 1PYTC 2F3CE 1C2JA 5HXFA 1SR5C 1QR3E 5AFZH 4ZKSU 3L3TA 1TNJA 1W14U 3SGBE 1QBOA 1GJCB 1V2ST 1GHZA 1OSSA 5KEDA 3F9FA 5HGGA 3P70B 1C1SA 1SGCA 1HDTH 2JJ2D 1HJAB 4LZ4B 5DSFA 1HBTH 3UUZA 3HKJB 1XVMA 1ZSJA 4BAHB 2BD2A 4HZHA 2A5AA 3RXIA 2GCTC 1DT2A 1G2MA 2ZTZA 4OS2A 1TNLA 3UQVA 1TMUH 5L2ZH 4ABGA 2CHAB 3ZZAA 2GX4A 2BDBA 3GY5A 1J8AA 1NBME 1UW7A 1C9TA 1P09A 1TGCA 1CO7E 3KIDU 2XXLA 5F6MA 1T8LA 1E0FD 1IQEA 1QRXA 5DP9A 2F83A 1O36A 2ZU1A 2ZG0H 3ENSB 1EP5A 1S83A 4WMEA 1IQGA 5J4SA 3RU4D 5EXMA 1WSSH 3PRDA 3NWUA 3V7TA 4DY7B 2VBCA 1FQ3A 1B7XB 2PUXB 1O3MA 4INLA 3TJNA 1LHGH 4ABAA 4DVAU 1F0RA 1Y5AT 8GCHG 3BV9B 4Y76A 2F9UA 1V2RT 2TIOA 2NU4E 2FDAA 2JETC 3A82A 4BAOB 2Z9JA 1C5RA 1V2LT 5EQRA 1ARBA 1CT0E 1L1JA 2ZIQH 2ZGCA 2BHGA 1TQ7B 2G00A 4CRGA 1GI8B 3SJKA 3W1EA 3ZVCA 1W12U 2TRMA 2V6NA 1SMFE 1GWAA 5AHGH 1TX8A 3SNAA 1UK2A 3UWIA 1EAUA 3KL6A 1O32A 1QCPA 1AQ7A 1S6LA 3BEFB 4KTUA 3ITIA 1MTNC 1DLEA 1TNKA 1P01A 1TPOA 1DUEA 4Q63A 2IJOB 2GTBA 2R3YA 3T26A 2ZNKH 2ZI2H 1Z8JB 2ANKH 1Y3UA 3QTOH 4YESB 9ESTA 1DXWA 1NFWA 4XBBA 1N6XA 1GBFA 2STBE 1VGCC 3DD2H 3B8JA 2AERH 1YM0A 3DSOA 3RXSA 1SLUB 2ODQA 3ELAH 3MHWU 2GP9B 7KMEH 1TPAE 5L2YH 1W10U 2WPMS 1MCTA 2KR7A 1L4ZA 2OTVA 4JK5A 2KCAA 3P8FA 1OP2A 2A4OA 1GHXH 4XBCA 1P10A 3BG4C 5B6OA 3VG8A 1V2WT 1G3EA 1G36A 1O2WA 1VKYA 2AEIH 2ANWA 4AC9A 1O3EA 2CK3D 5E8EH 1GJAB 2ZFFH 1N1LA 4DJZB 1SFIA 1SLXB 1WTHD 1HRTH 3A89A 3QGJA 2P16A 2SGDE 4AB8A 2NU0E 3IG6B 2WPJS 5FPTA 5T3HA 1FX0B 1C5UA 1N6YA 3SN8A 3FP6E 1TPSA 1DVAH 1EZXC 3NXPA 5C20A 4NZQA 3CENA 3SGQE 3F2GA 2G55A 2A5IA 2SNWA 1LVMA 2SGPE 1YLDA 4NFFA 4U01A 8ESTE 1GL1A 2BLVA 3PWBA 1CVWH 1ZGVA 4NA8A 4AN7A 3W95A 4TPIZ 1HCGA 4B1TA 1T4VH 3RU4T 2Q1JA 2BXTH 1C5MD 3P17H 1G3CA 4ISHH 2QE7D 2Z6BD 3U1JB 1H9LB 1GCDA 1BMLA 3O8RA 1SGTA 1O3OA 4J1YA 1O2RA 1SQRA 1QL7A 2Z9IA 4Y71A 2QAAA 1SGPE 2ZDMA 3GY2A 5EQSA 1VITG 4WJG2 4UD9H 1FPCH 3UR6A 1SGDE 2CGAA 2A4RA 1SG8B 1QURH 4X2VA 1ARCA 2B9LA 2Z9LA 3GY7A 1BA8B 4TWWA 1FUJA 1LVOA 3OEED 1MQ6A 3I77A 2BVSH 1CA0C 1GL0E 2QF5A 2VVUA 3GCTF 5EW2H 4O3TA 1ELCA 2W6ID 2WV9A 1L0ZA 2PUQH 1F7ZA 1O2LA 4ZHAA 1GBIA 1UJ1A 4B75A 3F0PA 4X0WU 3SI4H 2AGEX 1O37A 3MH6A 3HK3B 4ZAEA 3U8RH 2ALVA 1AU8A 4AFSA 1YPEH 2FOHA 3R0FA 1YPKH 3SUEA 4A1VA 1KXEA 1YKTA 2KZ4A 3NKKA 2L74A 1QRZA 4UFDH 5C5NA 1AWFH 1GHAF 2RA3A 1FZZA 3ZZ8A 1SVPA 3RXVA 2SFAA 3QWCH 3VEQB 7ESTE 5JDUB 3UREA 1FIWA 1DSTA 3OEHD 1ESAA 4ZHMU 1C2MA 4XSKU 1O35A 2K8IA 1TONA 4YM9A 2C3SA 4ZMAH 1TMTH 3SJ8A 1QJ1B 3KQBA 1ELEE 4FU8A 1BTZA 3EA8A 4B73A 1AN1E 1E38B 1OWJA 3RMMH 4A6LA 2VIQA 1O2NA 4K5ZA 1D4PB 2J94A 1Y3VA 1QIXB 1MD8A 2SGQE 2G51A 2HVYB 1QQUA 1PPGE 3U8TH 4OGXA 2R0KA 3MH4A 1H9IE 2ZCHP 2P94A 4GCHG 3M7TA 1P57B 1O5DH 3QLPH 1BTHH 1ZJKA 3BTGE 2OC8A 1AFQC 3F3BA 3TITA 2BQ7B 1XXDA 1EZUC 3E3TA 1UMAH 3M3VA 3ZVGA 2BTCE 4SGBE 2C8XB 3UOPA 1GHBG 3LGWA 3MQKC 4AG2A 3PV5A 4BAMB 1ZMNA 5F53A 2J98B 4UFFH 2PR3A 2QXGA 1GBJA 1V6DA 2KM0A 4CR5A 1GMDG 4AX9H 1LHDH 2FPZA 4ABEA 1E36B 5A8YA 4E7RG 1TMBH 3BF6H 3TH2H 1MQ5A 4IN1A 2BD3A 1TNHA 5EPYA 3A83A 1AUJA 2OLGA 1MD7A 4X2WA 2FLBH 2W3KA 5A09A 3M3SA 1IQHA 3LGVA 4F49A 1ELFA 4X6MA 4MPUA 2F9OA 4Y8XA 4NCYA 3E0PB 3SUDA 1S6HA 1GGDC 2B8OH 4KKDA 2FZZA 8LPRA 2BOKA 1G32B 3VB3A 1BTWA 3KQ5A 2UWPA 4X8VH 1YPLH 2GT7A 3RMNH 1OKXA 1P3CA 2OCVB 1UTJA 3E90B 1MBQA 2FI5E 1N8OC 3FAOA 2J95A 2I6QA 2BM2A 2XOKD 5JBBS 2VINA 5DPAA 1SGIB 3VPKA 1JRSA 4ZH8A 4AORA 4TY7A 5L6NH 2Y6TA 3LDXH 1DM4B 3E8LA 3TNTA 4X6OA 3DT0H 4I8HA 1ZOMA 2FMJA 1C1QA 3SUGA 5E0GA 1IQLA 1ETTH 1KTSB 5F8XA 3RXJA 1V2VT 3M5LA 2GT8A 4RT1A 2K0QA 4FUHA 2GD4B 1A3BH 1CA8B 1MTWA 3LKWA 4PROA 3PRBA 4KTCA 2VIPA 2VJ1A 2A2QH 2HALA 5CMXH 4BAKB 1P05A 2FODA 1S0RA 1A4WH 4BOHA 3ODDA 3EYDA 1QB1A 1WV7H 3GY8A 1C1UH 1QRWA 4A1TA 1TRNA 3PYHA 4I31A 1ZTKA 1GHBF 1UO6A 1H8IH 3VB4A 5FAHA 4ABHA 3E6PH 2V35A 2P3FH 1QHRB 4AFZA 1UTQA 1O3GA 3UFAA 4NWKA 4BTIB 3KYFA 2G5NA 2ZU2A 2ZFTA 3MH5A 1A2CH 2ZHQH 1W0KD 2Z3CA 4Q2KA 1H1BA 4U32A 3CP7A 4DCDA 4WH8A 2BDIA 1C4U2 4E7NA 1F92A 2EY4C 2R2MB 3LH3A 1ZRBA 1A5HA 3RMLH 2HRVA 2R9PA 3W94A 1LHFH 2BVXH 4HTCH 2BD9A 1WTGH 4JZEH 3VGCC 1HV7A 1RRKA 2XWBI 1IQJA 5E2OA 2QC2A 2WSSD 1ZYOA 1A61H 3EA7A 3I78A 4JMYA 1YPHE 4XBDA 1S81A 5DP8A 3T28A 1DSUA 1JWTA 3E16B 4FVDA 1C5PA 1YPHC 1HAZB 1K1LA 2PWXA 1EB2A 2PFEA 1GI0A 4KTSA 5J4QA 1EAXA 1MU6B 1OYTH 2HVXA 1K1JA 3M7QA 1EUFA 4JZIA 1XKAC 2AS9A 2GCHG 5HM9A 2ZFSA 1FY1A 1UHBA 2J34A 2QXHA 1Z8IB 1ANBA 1O3AA 3Q76A 1KY9A 1DX5M 4ISOA 1DPOA 2RDLA 3PLBA 1O2HA 2GCHF 2BD4A 1P02A 1G3BA 4CREA 2QCYA 4GUXA 2JDID 3TVJB 1Y3XA 3EAJA 3FP8E 1FV9A 1O3BA 3ZZ3A 1C5WB 3LC5A 3LJOA 2ZDVH 2FIRH 2YNBA 3LOXA 2ZZUH 1B0FA 1HAXB 3SU6A 4NIWA 4B6FA 2A32A 1YPGH 1C2GA 1HAYB 4XRNA 5EU8A 3NUMA 4ZROA 1FMGA 1AFQB 3F2FA 5DP5A 2W5EA 2O8UA 1DICA 5GJ4B 1S6FA 5C17A 1L4DA 1KXDA 1AE5A 3UQOA 1K21H 2JH5D 2XTTB 2XBWA 3U9AH 3BTWE 2EQNA 3LU9B 2PKAB 1ZMLA 3EGKH 2ZFPH 2ZCKP 1HNEE 3B23B 1MTNB 1YBWA 2ZDKA 3WY8A 2FOCA 1VJAU 3N7EA 1YPJH 2ODPA 3BTTE 3RXFA 1N8OB 2EC9H 3L33A 3AVZA 4CRDA 1O2GH 4DURA 3SNDA 3M37A 1T8MA 4TSFD 3MH7A 5C2ZA 1FNIA 4H42U 4K1TA 3A85A 5AVDA 3K65B 5AFYH 2THFB 2ZFQH 2ODYB 1GHAG 2SGFE 3SV8A 2A2XH 3FN8A 1K28D 4CBOA 5E2PA 1GI9B 3FP7E 1TRMA 3GDUA 3GY4A 3A8DA 3F6UH 4ZHLU 3DFLA 2CJIA 1ESBA 1VR1H 1SGFG 2BDYA 2KCPA 3KCGH 2W7SA 4CR9A 2GKVE 1YCPH 5GWZA 2ZF0H 2LNCA 4X1QU 1C1OA 3ZV8A 2H9TH 3A80A 3ATLA 3O8BA 3P8GA 5T6GA 4GLYA 1ANCA 3ZV9A 1CGHA 1GBDA 4UFEH 5DKMA 3FANA 4R0IA 2GZ8A 5IDKA 2XWAA 3S7KB 4F4OC 3SGAE 1P9SA 1BQYA 1RS0A 4B2CA 2WPIS 4MG3A 5KECA 1HPGA 2G4UA 4DW2U 1YY3A 2PKAA 1O5CB 4NIYA 4ZKRU 1RTKA 2YMSD 2Y5HA 1C4Y2 1SLWB 3ZVFA 4HFPB 1BRUP 1SHYA 4D76A 3ZZCA 2AYWA 1LPKB 3T5FH 4F48B 4X6NA 1GDQA 1UCYH 4CHAB 1C5NH 1W0ZU 2W3IA 4TT3D 3UTUH 1C1RA 1NY22 2HWLB 3GCTG 5G4BA 1SL3A 2FX6A 3KN2A 2AMDA 2XBYA 1F5RA 4FVBA 3M35A 1QL9A 2C8YB 1V2UT 3MNCA 3A84A 2WUBA 2GDEH 2BY6X 1WYKA 1AHTH 4H4FA 5ESBA 4ZXXH 1ELVA 3BIVH 2UWOA 1OWEA 5C3NA 4NA9H 1A5GH 1ZRKA 1G9IE 3A8BA 1E79D 1BUIA 3GCHB 6GCHF 3P95A 4I7YH 3V0XA 2YNAA 2ZEBA 1FAXA 2ZGHA 3R3GB 4GPGA 4TY6A 2F9PA 1Y3WA 1AD8H 3BIUH 3PLPA 3TPIZ 3FVFB 4IN2A 3RXEA 1SB1H 5C67A 1TQ0B 2PHBA 4Z1MD 2OINA 5C1UA 1TBZH 1CSOE 1MBMA 4JCNA 2C4FH 4ISLA 2F9NA 4KGAA 4NG9H 1ZGIA 2BB4A 3H09A 2AIPA 2Q6FA 4X2XA 5C1YA 1OWIA 3BG8A 3ZVDA 1F0SA 5EW1H 1P3EA 5LPEA 1F0UA 1ZZZA 4Z6AH 1FONA 1V2TT 2Z7FE 4KELA 1NC6A 2ANMH 2A4QA 1SC8U 6CHAC 1RTLA 2FS9A 2WYJA 3F9EA 2XBXA 2W6JD 4FUJA 3SZEA 1CA0B 1PPBH 1MKWK 1WOFA 1DY9A 4DIIH 4Q7XA 2WPDD 3TU7H 3MO6A 3TH3H 1PPZA 4K69A 2Z9GA 1LKAA 2D8WA 4YOJA 2J2UA 2YOLA 2XYAA 4YT6H 1QL8A 3SJ9A 2H6MA 1O5FH 1DANH 2Y80A 1BBRK 3TNSA 1K0HA 1KDQA 2TPIZ 2ESTE 2DUCA 1RGQA 2ZKSA 1SKYE 5A0BA 1FY8E 2WPKS 4I33A 4A5TS 2H1UA 4RT0A 5EJ1A 3F68H 1WQVH 2FM2A 2BDGA 2ILNA 1EX3A 3SHCH 1PQ5A 1GBCA 3PWCA 2BX4A 1WCZA 6GCHG 3ZVAA 4IMZA 2KCYA 1GDUA 2HPQH 5GNDA 1Q3XA 3M5MA 2ZPSA 1NRQH 1UCYE 9LPRA 1JXPA 2FEQH 3K6ZA 1D3QB 1HAVB 2AGIX 3P92A 2QA9E 4XDEA 5HYOA 1FJSA 3GDSA 1MU8B 5JBAS 4I8GA 4CRBA 1KDQB 1IAUA 3PMJA 2XBVA 1OOKB 4U30A 1ZTLA 4D7GA 4IBLH 1Y59T 1UVUH 2XNDD 1G37A 3MTYA 5EG4A 1A1RA 2ZU3A 1YLNA 2BMGB 3ESTA 4BANB 4ABJA 2Z3DA 3PB1E 1X7AC 2FLRH 3OSYA 1FPHH 3SNCA 3PO1B 2CF8H 2TGDA 2RCEA 2WPLS 3PMBB 1IHSH 5C0UA 2BD5A 2QGRA 3OE7D 1OWHA 1TB6H 4X1RU 1QY6A 1KLIH 1Z6JH 1P12E 5FBEA 2P8OC 4ACAA 3MU8A 4Y11E 4AFQA 1C5XB 1S84A 1PPEE 1C1MA 1EPTC 1BB0B 2VWLA 3D65E 4ZKOU 1WXRA 1GJ5H 1O3IA 2BDHA 2PTNA 1NT1A 2FOAA 1LPZB 1ABIH 5FCKA 5CE1A 1QGFA 1TIOA 3S9CA 2AMPA 1TGNA 2A7HA 2UWLA 1EOLA 1ETSH 1SQTA 1UK4A 4OM9A 3RXGA 3TGIE 1C1PA 2PLXA 2J98A 1GDNA 1KTTB 2BLWA 3TLOA 3VB5A 4O3UA 2BDCA 1C9PA 4I86A 3EA9A 2QIQA 4JYTA 3MI4A 3SOSA 1Z71A 1SI5H 4FU7A 2P3UB 4THNH 4YLUA 1YYY1 1SFQB 2ZFRH 1W3CA 1HAOH 4B76A 1BJVA 2STAE 1QA0A 3JZ1B 3RXKA 1H9HE 3TIUA 1C1WH 2AH4X 1JIRA 1UCYK 2GV6A 3P8NA 1K1MA 4HI3A 1GG6C 1THSH 1EXFA 2BQ6B 1QA7A 1J17T 1TYNA 3A86A 1LHCH 1BTUA 1MCVA 1W0JD 5DP3A 2FOMB 1O2ZA 3ZZ5A 1C2DA 2FX4A 1OXGA 1S85A 2BLQA 1YCPK 1TRYA 3PMHB 3A8AA 1Z8GA 3KQCA 1F0TA 3VFEA 1GCTC 5K0HA 5DP7A 4SGAE 3RXTA 5LPFA 1TGBA 1BBRE 3LT3A 5HMAA 3ZVBA 5FPSA 2HNTE 1C5OH 3N7DA 3M7UA 4AYVB 1FLEE 3KQDA 3KNXA 1S5SA 3DA9B 1MABB 2DE9A 2P93A 3DHKH 1GMCG 3ZYDA 1FDPA 2FI4E 2WV4A 2XCNA 3RC5A 1LKBA 3AASA 1HXEH 1C2HA 1FXYA 1HJAC 1FY4A 1O5BB 2Y82A 1O38A 1TA6A 3A7TA 1BDAA 3RC6A 1TOCB 1BITA 1TFXA 2HGTH 2Y5FA 2Y7ZA 4Y8YA 2FOGA 1P04A 1W7XH 5EGMA 1W13U 1K1PA 4GAWA 1O2IA 5C0TA 1ELGA 3TGJE 2AHME 3CS7A 1P06A 1KXFA 4ABIA 3ATIA 2UUYA 3LPRA 5A0CA 4YT7H 1NN6A 4NSVA 1LMWB 1YC0A 2R2WU 4FUEA 4B74A 2EA3A 3M5NA 5DJ7A 1GVZA 1Z1JA 2ZA5A 3PROA 1EPTA 4B2BA 2SNVA 1ZSLA 1CQQA 4MQAA 1LPGB 1L1NA 2RG3A 1GJ9B 3BTDE 3E0NB 4DGJA 2GV7A 3CS0A 5KGOA 4Y0YE 1UVOA 4YO9A 3SV9A 1ZPBA 3LGTA 3SORA 1FIZA 5FBIA 3U1IB 2ZHFH 2HOBA 1P2OA 4I32A 4UDWH 1RFNA 1NROH 3T2NA 1DXPA 1GJBB 2WV5A 3UR9A 1WQSA 2OBQA 1RXPA 3QGNB 3GY3A 5C94A 3KF2A 1PPHE 2A0QB 3GCNA 1UVTH 2D1JA 3VXFH 1QJ6B 2V3HH 4MNWA 2ZO3H 3T27A 3BG4B 3I29A 4ASUD 1SOZA 1AI8H 4RI0A 1ZHPA 3S9AA 1GVLA 3HPTB 4D8NA 5F8ZA 1YGCH 1W11U 2QF3A 4WXVA 2WYGA 1HJ8A 2BZAA 3LIWA 3M3TA 4IMQA 2I6SA 1E37B 1KXCA 2J92A 2M2AA 4GSOA 5CHBA 3N7OA 4M7GA 3SYJA 4GVUA 2V3MA 1TGSZ 3ZZDA 3RM0H 1HAPH 1TX6A 1O5GH 1O2KA 1QB6A 4K1EA 2V0BA 2HLDD 5HIZA 3F0OA 4XD7D 4NZLA 4FUCA 1O2JA 2BY8X 2Y81A 3BTKE 4Q80A 5BPEA 4AYYB 1YWUA 3D23A 3H7TA 1C1NA 3EE0B 1UTLM 4TPYA 3OTPA 3SNBA 1P2IA 4JYVH 2JETB 4A7IB 1F5LA 1UTKA 1GBTA 5TCCA 1EASA 1ZJDA 1PFXC 1NU7B 5FX5A 2UUKB 1XUJA 5B6LA 3SZNA 1V2KT 2Q6DA 1CU1A 1AB9B 2GZ9A 1XUIA 3C1KA 1SQOA 2PW8H 1V3XA 1EZQA 2BY9X 2PSXA 4VGCB 1C1VH 1GI5A 1Z7KA 1AZ8A 3FO8D 1ZHMA 3LC3A 1Z6EA 4WMDA 1DFPA 1V2QT 3RM2H 4CH8B 3RMOH 1NFUA 2GDDA 3SV7A 1U6QA 2PKSC 4F55A 1CGJE 1EP6A 1PQ7A 3U28C 1BTPA 3UB0A 2WUCA 4MNVA 1ZLRA 5GDSH 5IYTA 4P02A 1Y3YA 1O2XA 1C5LH 1GI2A 1IHTH 3GYLB 3A7VA 3RDZA 4MPWA 2BX3A 1BOQA 2SGAA 4X8TH 5FXLA 3RXOA 2Z9KA 1KXAA 2ZTXA 4E06H 4Q7YA 4FUBA 2R0LA 1LVBA 2QXJA 2BQWB 2F43B 2PKSB 2BY7X 3SI3H 2F9BH 5T6FA 4R8TB 4FETA 2G8TA 3SU2A 1WUNH 2HNTF 5A8ZA 2A1DB 3ZZBA 2ZPQA 1GI7B 5EOKA 4AZ2B 4ZUHA 2OC1A 2K1QA 4X8SH 3H5CB 4ISNA 1QBVH 1AGJA 1QTFA 1E1QD 2LPRA 1LDTT 2GGVB 2XW9A 1TOMH 1BTYA 1SGEE 6ESTA 2FTLE 4X1PU 1O2YA 2SGEE 2EEKA 3RXUA 2G81E 1CHOF 3E91A 5HM2A 1W0YH 3KYGA 4D9RA 2ZC9H 5C1XA 2GJGA 2G5VA 1GHVH 1TALA 1GI6A 1VJ9U 1GBEA 1SLVB 4FUIA 3DCLA 3FOAA 4AFUA 3MNSA 4NGAH 4Q4LA 4AOQA 5I46H 2O9QA 3BN9A 2FYQA 3OY6U 2FWWA 2IPQX 1RJXB 2OD3B 4WF8A 3VB6A 5ESTE 3SBKA 2V7QD 1O5AB 2FXRA 3M5OA 2WINI 3RXBA 4B2AA 2Y5GA 1O39A 4KP0A 5T6DA 1H8ED 2ZP0H 2C93B 4LXBH 4H6TA 4X2YA 3OYPA 1SSXA 2EI8A 2QV1A 1IQKA 1DUAA 1BCUH 2BXUH 1OX1A 1Y5BT 2AFQB 5E0JA 1A5IA 2XC5A 4HGCA 4VGCC 1CBWC 1K1NA 4I8JA 1E35B 1AB9C 1GBLA 3SU3A 5H4IB 3V3MA 1HIAA 2Q6GA 1AY6H 1XXFA 1ELDE 1KIGH 3BTQE 3SU0A 1O3LA 3RXLA 1GI1A 2JJ1D 1MKWH 3QX5H 4NIVA 1P2MA 5FL7D 3QK1A 5SGAE 1O2UA 1D3TB 3AW1A 1O0DH 1P11E 2O8MA 3PO1C 1C2IA 1B0EA 7LPRA 1M9UA 2HPPH 1PPFE 1O2TA 1BIOA 2J9NA 3O8CA 4CBNA 2UUFB 1K22H 3QO6A 3BEUA 2BOHB 1EAWA 4NA7A 6LPRA 1TNIA 3MWIU 5C5OA 3K9XB 1LVYA 1ACBE 4IS5A 1UHBB 2KX4A 4UFGH 1WU1A 1RTFB 2XC4A 3LONA 2WPHS 1BMFD 1A0LA 4YTAA 1XKBC 4BTUB 5EPNA 1CHGA 1GBBA 1NFYA 2F91A 4MTBA 4DT4A 2ZDNA 1EQ9A 1OWDA 1ANEA 1BMMH 5I25A 5JYIA 1XVOA 3UNQA 1C5YB 1T7CA 3ATMA 1AO5A 3DSGA 1OS8A 3URCA 3BTME 1DOJA 2QF4A 3SNEA 1AIXH 1GBAA 1RIWC 3ATWA 1ZTJA 6CHAB 1DWBH 4MVNA 3HK6B 4FUDA 4CHAC 1HIAB 5GCHG 1NESE 4WY3A 3OU0A 1EATA 5DGJA 3G01A 1C5SA 1ESTA 3GYMA 1NRNH 3MFJA 2H5CA 4ESTE 1ZR0A 3RUOA 1BHXF 2HNTC 3JZ2B 1GJ8B 2FO9A 1BT7A 5HKKD 4MLFB 1W2KH 4ZCNA 2AMQA 1GHWH 1PYTD 4BXWA 1SGNE 3PMAB 1BMNH 4X6PA 2QYIA 1COWD 4FUFA 4FU9A 5A0AE 1AVWA 4TYDA 4JYUH 3LGUA 1QQ4A 1ZHRA 3B9FH 1P03A 3VGCB 2ZDLA 2NU1E 1V2OT 2IJD1 2J38A 2QF0A 2ZCLP 3VXEH 3NK8A 2BDAA 2AGGX 1SPJA 2JH6D 3M61U 2UUJB 2IN2A 4P00A 4CRFA 1L2EA 1O2VA 8GCHF 1FAKH 2FOFA 2TGAA 3ODFA 4ISIH 3GICB 2GMTB 3RXRA 5EXLA 5EJLA 4ABBA 4GCHF 4NSYA 3RXCA 1JRTA 4Y0ZE 1J16A 4XFQA 1KMHB 5L30H 5LGOA 2A4GA 2A31A 2FESH 2J5UA 5FCRA 1WBGB 3ATKA 5A8XA 3TK5A 1YP9A 1CE5A 1O3CA 1SQAA 2ZTYA 1DE7H 4Z0KA 2VIDA 1VCPA 1JBUH 4DIHH 3WWBA 2D26C 5TCAA 2Y7XA 5DO4H 1TLDA 4GHQA 1QFKH 5T1VA 2OUAA 1O3DA 1GI4A 1NRPH 1MTSA 4IW4E 3LGIA 5DP6A 1D3DB 1HYLA 1OHHD 1EPTB 3SQHE 1NTPA 5A2MH 1OYQA 4RKJB 1ZSKA 1S0QA 4WH6A 5CDFE 1T8NA 2BD8A 1P2QA 4K3JA 2XC0A 1WAYB 2OK5A 5JBCS 4X8UH 5FPYA 5HIYA 2H5DA 2ALPA 4YLQH 2VU8E 4I8LA 5TJXA 1G3DA 5EODA 3TJVA 3IITA 4MPVA 3T62A 1HUTH 3HGNA 3DUXH 1MTUA 1P9UA 3BTHE 1C5QA 1O3NA 4LK4A 5E0HA 1D6RA 2IPHA 3MU4A 2F9VA 1IQMA 3OY5U 1GVKB 2PGQB 3OTJE 4H6SB 3LH1A 1IQFA 2CXVA 1JMOH 1P0SH 4O9VA 1HFDA 3GCOA 2CN0H 2PTCE 3GDVA 2VWMA 2YMSB 4NWLA 2CHAC 3OFND 3D49H 1K1IA 3S0NA 1O33A 2VGCC 2FP7B 4FUGA 3NCLA 5JPMH 1YCPM 1MKXK 3SW2B 2KFWA 2VH6A 2IOTA 2OP9A 1F2SE 2FOEA 3HGPA 4IC6A 1D6WA 4INKA 4ASHA 1J14A 3RLWH 3UIRA 1TGTA 3Q3XA 1ELTA 4DOQA 4OS6A 2C8WB 2OC7A 3UY9A 2TBSA 1T32A 2V3OH 1IQIA 1DITH 3IWMA 2O8TA 1SOTA 1PJPA 1HGTH 1KXBA 1DDJA 1MZDA 3KHVA 3S9BA 3KEEA 2GMTC 3NPSA 1BRBE 1O2MA 1Q31A 1AKSA 5PTPA 2BYAX 3MU5A 3H7OA 3QUMP 2C90B 4Y8ZA 3EDXB 2F4LA 3BTEE 1T4UH 4TWYA 3V12A 1AMHA 1LO6A 3A7WA 3ZZ9A 2ZPRA 1VCWA 2WHXA 3HATH 2KAIB 4ACBA 3L6PA 5GIBA 1F5KU 1GBHA 4RN6A 2OQUA 1S82A 4MPXA 3URDA 4OS5A 4K8BA 1XUGA 1Z8RA 2ZU4A 1ID5H 3A7ZA 1HAHH 1YPMH 1MAYA 4WXIA 5IK2D 2LP6A 1XUFA 3DFJA 2EI6A 1AZZA 1GMDF 3A7XA 1UTPA 2C8ZB 2J97A 3SO3A 4GHTA 5EQQA 1DWDH 1ETRH 4JZFH 1TNGA 1O2SA 1W8BH 1INCA 4NFEA 2XNIA 2ULLA 1O5EH 1MTVA 4D7FA 1V2JT 2ZGXH 1TE0A 4Y10E 1C2LA 1ZPZA 4UE7H 3SU4A 1C5TA 1HAIH 1HB0B 3ZZ7A 1YLCA 1TABE 1DY8A 3DSPA 4UONA 3RP2A 3WWFA 1L1GA 3MU1A 2KAIA 3SV6A 1XUHA 2ANYA 4ZKNU 1NS3A 1AVXA 2DE8A 2XCFA 2OQ5A 2RA0A 1BZXE 4Y7BA 2NWNA 1C1TA 1EJNA 4AGKA 4YZUA 3A88A 3P8OA 1GCTB 3RXQA 1O2QA 4I8KA 4FOUC 1B5GH 4JZDH 2W7UA 4ABFA 5JBTA 1Y8TA 3STJA 3SU5A 4HG6A 2CMYA 1AVGH 1EOJA 3ZYEA 2QN5T 4AG1A 4RSPA 3AAUA 1GMCF 1NBMD 3OAAD 5GCHF 1DS2E 1ELAA 4OS1A 4OGYA 2PP6A 2PSYA 1K2I1 1OWKA 1GMHG 2QXIA 1MH0A 4B71A 1Z1IA 1UTOA 2A45B 2ZQ1A 1O2PA 5EIYA 1IQNA 2VNTA 1MZAA 2JIZD 5EJZA 1GGDB 1GJ7B 2H2ZA 1UTMA 3UWJH 3BSQA 1FN6A 1NZQH 1GMHF 2BVRH 3K2UA 1EKBB 3K6YA 1UVSH 1RIWB 3RXAA 3MMGA 2RDEA 1XX9A 3UNRA 1DWCH 4BNRA 3CNRA 4MDSA 1V2MT 1PQAA 1Y5UT 4WMFA 7GCHF 2FTMA 2OXSA 2VVCA 3F9GA 1BBRH 4ABDA 2PGBB 5F8TA 1LCYA 4YXWD 1PQ8A 4QT8C 3MO9A 2O8LA 1BHXB 1LTOA 4O97A 1GG6B 3S69A 4K2YA 2ZQ2A 2ZGBH 4WVPE 3PV4A 4X1SU 2VWOA 3SHAH 1EZSC 1SGYE 3Q00A 3FFGA 3MU0A 1VGCB 1ELBA 3Q3YA 1CT4E 4XE4A 3RC4A 2VB0A 5DG6A 1E1RD 5JB9S 4K8YA 1C2EA 1O31A 1TX7A 2VGCB 2JKHA 3F1SB
chains in the Genus database with same CATH topology
3T25A 2GVFA 1H8DH 4LZ1H 2ZDAH 1GBKA 1EJMA 7GCHG 1LQDB 3SV2H 1BJUA 4A92A 3RLYH 3FZDA 5DK1A 3VB7A 1EB1H 2FI3E 4K1SA 1VCQA 1KLTA 3QZQA 3E1XB 2B5TB 2R3UA 2H9EH 1IOEA 2TGPZ 3RXPA 3RU4E 1E34B 2XRCA 1OP8A 1GJ4H 5FX6A 3TK6A 2GZ7A 1A3EH 2A5KA 3A81A 1HAVA 2PV9B 3RXMA 1XMNB 1G30B 4OS4A 1YF4A 4OS7A 4X1NU 2G52A 3QZRA 1GJDB 5LH8A 1DWEH 3FZZA 1C5ZB 2CV3A 1KLJH 2G4TA 3KQEA 2NU2E 1THRH 2J4IA 1O3PB 1W7GH 3UNSA 3GOVB 2OBOA 2B7DH 3RXDA 2D2DA 2VWNA 3SU1A 3MYWA 3UOUA 4IC5A 3O8DA 8KME2 1T8OA 1ANDA 3AW0A 1UVPA 3LJJA 2CF9H 1GJ6A 4J2YB 1TWXB 1CBWB 1O3KA 2GCTB 5GXPA 3TJUA 1BTXA 4IGDA 1TBRH 3QTVH 1D9IA 4FXGH 1BRCE 4RKOB 4UEHH 2VIWA 2FS8A 2ZECA 2Z94A 1GPZA 1MUEB 2BZ6H 1VITF 2A7JA 3STIA 1AE8H 4ZXYH 4DT7B 2QY0B 3U8OH 3OX7U 1JIMA 1NFXA 3F9HA 3EQ0H 1G2LA 1FY3A 4BTTB 1AKSB 4U2WA 3TH4H 3QDZB 1AUTC 3BEIB 3SJOA 1FN8A 3MOCA 3NZIA 5ABWA 1MAXA 2HLCA 3U98H 1ZMJA 1CT2E 2VVVA 1NU9A 1O34A 3ZZ6A 4AB9A 2BY5X 1NRSH 3GY6A 1SBWA 1VITH 2ZWLH 1A0HB 2ZGJA 3C27B 1K1OA 1P2NA 4A1XA 5LPRA 3MO3A 1H4WA 1CGIE 1HLTH 1TAWA 1NRRH 1GBMA 3V13A 3SJIA 4MNXA 5EXNA 4Y7AA 4BAQB 2ZHEH 1OPHB 3A87A 1ABJH 1LQEA 2H9HA 3PTBA 1T31A 1A46H 3PM3A 3A8CA 3HKIB 1XUKA 4AGJA 1BRAA 1UTNA 3P6ZB 2B0FA 4CH2B 1P2KA 1A7SA 2FYRA 1NO9H 4CRAA 3ZVEA 1O2OA 1D3PB 4Y6DA 3A7YA 1NPMA 1RD3B 4Y79A 1THPB 4DG4A 1O3JA 4K60A 2ASUB 1V2PT 1J9CH 1KYNA 1P2JA 3SUFA 1CHOG 4YOGA 1TA2A 2Z3EA 1MMJN 2BD7A 1LHEH 4WWYA 2VIOA 3LGYA 1QBNA 5CHAB 1MKXH 1P8VC 2P3TB 4XOJA 2OC0A 4YOIA 2JH0D 3M36A 5JB8S 1FY5A 1Q2WA 3PTNA 4INHA 2P95A 4Q7ZA 4MNYA 3RXHA 3Q77A 3D62A 3GCHC 1HAGE 3S7HB 1KSNA 1TPPA 3QN7A 1EAIA 1TBQH 2VIVA 1UK3A 5K7RA 3AAVA 3Q3KA 2AIQA 1DLKB 2ZU5A 1EJAA 1FI8A 3GISB 1O3FA 1O30A 1SGRE 1ORFA 3ZZ4A 4E05H 4D9QA 2W26A 3BTFE 4LOYH 3MNXA 1C2FA 5ETXA 1AFEH 3TGKE 5DP4A 3PLKA 1V2NT 2P59A 1A0JA 1O3HA 2M5TA 1XM1A 2TGTA 3UPEA 1SGQE 2FOBA 2BLOA 4NIXA 2O8WA 3T29A 4O03A 1QB9A 1JOUB 3MNBA 4JZ1A 5F03A 2VH0A 5AF9H 1QNJA 1AWHB 2EI7A 2ZHDA 1K9OE 1OP0A 1PPCE 1HJ9A 3TK9A 1C4V2 3SQEE 1HXFH 4JK6A 5BRRE 3U69H 1GHYH 1QJ7B 2ZHWH 3KGPA 2NU3E 1GI3A 2A7CA 1C5VA 3TJOA 1SGFA 4BXSA 4CRCA 1ZPCA 2P8OB 1BMAA 1J15A 1C2KA 5GPIB 1VZQH 5FHTA 1SHHB 5CHAC 1NM6A 1PYTC 2F3CE 1C2JA 5HXFA 1SR5C 1QR3E 5AFZH 4ZKSU 3L3TA 1TNJA 1W14U 3SGBE 1QBOA 1GJCB 1V2ST 1GHZA 1OSSA 3F9FA 5HGGA 3P70B 1C1SA 1SGCA 1HDTH 1HJAB 4LZ4B 1HBTH 3UUZA 3HKJB 1XVMA 1ZSJA 4BAHB 2BD2A 4HZHA 2A5AA 3RXIA 2GCTC 1DT2A 1G2MA 2ZTZA 4OS2A 1TNLA 3UQVA 1TMUH 5L2ZH 4ABGA 2CHAB 3ZZAA 2GX4A 2BDBA 3GY5A 1J8AA 1C9TA 1P09A 1TGCA 1CO7E 3KIDU 2XXLA 5F6MA 1T8LA 1E0FD 1IQEA 1QRXA 5DP9A 2F83A 1O36A 2ZU1A 2ZG0H 3ENSB 1EP5A 1S83A 4WMEA 1IQGA 5J4SA 3RU4D 5EXMA 1WSSH 3NWUA 3V7TA 4DY7B 1FQ3A 1B7XB 2PUXB 1O3MA 4INLA 3TJNA 1LHGH 4ABAA 4DVAU 1F0RA 1Y5AT 8GCHG 3BV9B 4Y76A 2F9UA 1V2RT 2TIOA 2NU4E 2FDAA 2JETC 3A82A 4BAOB 2Z9JA 1C5RA 1V2LT 5EQRA 1ARBA 1CT0E 1L1JA 2ZIQH 2ZGCA 2BHGA 1TQ7B 2G00A 4CRGA 1GI8B 3SJKA 3ZVCA 1W12U 2TRMA 2V6NA 1SMFE 1GWAA 5AHGH 1TX8A 3SNAA 1UK2A 3UWIA 1EAUA 3KL6A 1O32A 1QCPA 1AQ7A 3BEFB 4KTUA 3ITIA 1MTNC 1DLEA 1TNKA 1P01A 1TPOA 1DUEA 2IJOB 2GTBA 2R3YA 3T26A 2ZNKH 2ZI2H 1Z8JB 2ANKH 1Y3UA 3QTOH 4YESB 9ESTA 1DXWA 1NFWA 4XBBA 1N6XA 1GBFA 2STBE 1VGCC 3DD2H 3B8JA 2AERH 1YM0A 3RXSA 1SLUB 2ODQA 3ELAH 3MHWU 2GP9B 7KMEH 1TPAE 5L2YH 1W10U 2WPMS 1MCTA 1L4ZA 2OTVA 4JK5A 3P8FA 1OP2A 2A4OA 1GHXH 4XBCA 1P10A 3BG4C 5B6OA 1V2WT 1G3EA 1G36A 1O2WA 2AEIH 2ANWA 1O3EA 5E8EH 1GJAB 2ZFFH 1N1LA 4DJZB 1SFIA 1SLXB 1WTHD 1HRTH 3A89A 3QGJA 2P16A 2SGDE 4AB8A 2NU0E 3IG6B 2WPJS 5FPTA 5T3HA 1C5UA 1N6YA 3SN8A 3FP6E 1TPSA 1DVAH 1EZXC 3NXPA 5C20A 4NZQA 3CENA 3SGQE 2G55A 2A5IA 2SNWA 1LVMA 2SGPE 1YLDA 4NFFA 4U01A 8ESTE 1GL1A 2BLVA 3PWBA 1CVWH 1ZGVA 4NA8A 4AN7A 3W95A 4TPIZ 1HCGA 4B1TA 1T4VH 3RU4T 2BXTH 2Q1JA 1C5MD 3P17H 1G3CA 4ISHH 3U1JB 2Z6BD 1H9LB 1GCDA 1BMLA 3O8RA 1SGTA 1O3OA 4J1YA 1O2RA 1QL7A 2Z9IA 4Y71A 2QAAA 1SGPE 2ZDMA 3GY2A 5EQSA 1VITG 4WJG2 4UD9H 1FPCH 3UR6A 1SGDE 2CGAA 2A4RA 1SG8B 1QURH 4X2VA 1ARCA 2B9LA 2Z9LA 3GY7A 1BA8B 4TWWA 1FUJA 1LVOA 1MQ6A 3I77A 2BVSH 1CA0C 1GL0E 2VVUA 3GCTF 5EW2H 4O3TA 1ELCA 1L0ZA 2PUQH 1F7ZA 1O2LA 4ZHAA 1GBIA 1UJ1A 4B75A 4X0WU 3SI4H 2AGEX 1O37A 3MH6A 3HK3B 4ZAEA 3U8RH 2ALVA 1AU8A 4AFSA 1YPEH 2FOHA 3R0FA 1YPKH 3SUEA 4A1VA 1KXEA 1YKTA 3NKKA 1QRZA 4UFDH 5C5NA 1AWFH 1GHAF 2RA3A 1FZZA 3ZZ8A 1SVPA 3RXVA 2SFAA 3QWCH 3VEQB 7ESTE 5JDUB 3UREA 1FIWA 1DSTA 1ESAA 4ZHMU 1C2MA 4XSKU 1O35A 1TONA 4YM9A 2C3SA 4ZMAH 1TMTH 3SJ8A 1QJ1B 3KQBA 1ELEE 4FU8A 1BTZA 3EA8A 4B73A 1AN1E 1E38B 1OWJA 3RMMH 4A6LA 2VIQA 1O2NA 4K5ZA 1D4PB 2J94A 1Y3VA 1QIXB 1MD8A 2SGQE 2G51A 1QQUA 1PPGE 3U8TH 4OGXA 2R0KA 3MH4A 1H9IE 2ZCHP 2P94A 4GCHG 3M7TA 1P57B 1O5DH 3QLPH 1BTHH 1ZJKA 3BTGE 2OC8A 1AFQC 3TITA 2BQ7B 1XXDA 1EZUC 3E3TA 1UMAH 3M3VA 3ZVGA 2BTCE 4SGBE 2C8XB 3UOPA 1GHBG 3LGWA 4AG2A 4BAMB 1ZMNA 4UFFH 2PR3A 2QXGA 1GBJA 1V6DA 4CR5A 1GMDG 4AX9H 1LHDH 2FPZA 4ABEA 1E36B 5A8YA 4E7RG 1TMBH 3BF6H 3TH2H 1MQ5A 4IN1A 2BD3A 1TNHA 5EPYA 3A83A 1AUJA 2OLGA 1MD7A 4X2WA 2FLBH 2W3KA 5A09A 3M3SA 1IQHA 3LGVA 4F49A 1ELFA 4X6MA 4MPUA 2F9OA 4Y8XA 4NCYA 3E0PB 3SUDA 1S6HA 1GGDC 2B8OH 4KKDA 2FZZA 8LPRA 2BOKA 1G32B 3VB3A 1BTWA 4X8VH 2UWPA 1YPLH 2GT7A 3RMNH 1OKXA 1P3CA 2OCVB 1UTJA 3E90B 1MBQA 2FI5E 1N8OC 3FAOA 2J95A 2I6QA 2BM2A 5JBBS 2VINA 5DPAA 1SGIB 3VPKA 1JRSA 4ZH8A 4AORA 4TY7A 5L6NH 2Y6TA 3LDXH 1DM4B 3E8LA 3TNTA 4X6OA 3DT0H 4I8HA 1ZOMA 2FMJA 1C1QA 3SUGA 5E0GA 1IQLA 1ETTH 1KTSB 5F8XA 3RXJA 1V2VT 3M5LA 2GT8A 4FUHA 2GD4B 1A3BH 1CA8B 1MTWA 3LKWA 4PROA 4KTCA 2VIPA 2VJ1A 2A2QH 2HALA 5CMXH 4BAKB 1P05A 2FODA 1S0RA 1A4WH 4BOHA 3ODDA 3EYDA 1QB1A 1WV7H 3GY8A 1C1UH 1QRWA 4A1TA 1TRNA 3PYHA 4I31A 1ZTKA 1GHBF 1UO6A 1H8IH 3VB4A 5FAHA 4ABHA 3E6PH 2V35A 2P3FH 1QHRB 4AFZA 1UTQA 1O3GA 3UFAA 4NWKA 4BTIB 2G5NA 2ZU2A 2ZFTA 3MH5A 1A2CH 2ZHQH 2Z3CA 4Q2KA 1H1BA 4U32A 3CP7A 4DCDA 4WH8A 2BDIA 1C4U2 4E7NA 1F92A 2R2MB 3LH3A 1ZRBA 1A5HA 3RMLH 2HRVA 2R9PA 3W94A 1LHFH 2BVXH 4HTCH 2BD9A 1WTGH 4JZEH 3VGCC 1HV7A 1RRKA 2XWBI 1IQJA 5E2OA 2QC2A 1ZYOA 1A61H 3EA7A 3I78A 4JMYA 1YPHE 4XBDA 1S81A 5DP8A 3T28A 1DSUA 1JWTA 3E16B 4FVDA 1C5PA 1YPHC 1HAZB 1K1LA 2PWXA 1EB2A 2PFEA 1GI0A 4KTSA 5J4QA 1EAXA 1MU6B 1OYTH 2HVXA 1K1JA 3M7QA 1EUFA 4JZIA 1XKAC 2AS9A 2GCHG 5HM9A 2ZFSA 1FY1A 1UHBA 2J34A 2QXHA 1Z8IB 1ANBA 1O3AA 3Q76A 1KY9A 1DX5M 4ISOA 1DPOA 2RDLA 3PLBA 1O2HA 2GCHF 2BD4A 1P02A 1G3BA 4CREA 2QCYA 4GUXA 3TVJB 1Y3XA 3EAJA 3FP8E 1FV9A 1O3BA 3ZZ3A 1C5WB 3LC5A 3LJOA 2ZDVH 2FIRH 2YNBA 3LOXA 2ZZUH 1B0FA 1HAXB 3SU6A 4NIWA 2A32A 1YPGH 1C2GA 1HAYB 5EU8A 3NUMA 4ZROA 1FMGA 1AFQB 5DP5A 2W5EA 2O8UA 1DICA 5GJ4B 1S6FA 1L4DA 1KXDA 1AE5A 3UQOA 1K21H 2JH5D 2XTTB 2XBWA 3U9AH 3BTWE 3LU9B 2PKAB 1ZMLA 3EGKH 2ZFPH 2ZCKP 1HNEE 3B23B 1MTNB 1YBWA 2ZDKA 3WY8A 2FOCA 1VJAU 1YPJH 2ODPA 3BTTE 3RXFA 1N8OB 2EC9H 3L33A 3AVZA 4CRDA 1O2GH 4DURA 3SNDA 3M37A 1T8MA 3MH7A 5C2ZA 1FNIA 4H42U 4K1TA 3A85A 5AVDA 3K65B 5AFYH 2THFB 2ZFQH 2ODYB 1GHAG 2SGFE 3SV8A 2A2XH 4CBOA 1K28D 5E2PA 1GI9B 3FP7E 1TRMA 3GDUA 3GY4A 3A8DA 3F6UH 4ZHLU 3DFLA 2CJIA 1ESBA 1VR1H 1SGFG 2BDYA 3KCGH 2W7SA 4CR9A 2GKVE 1YCPH 5GWZA 2ZF0H 2LNCA 4X1QU 1C1OA 3ZV8A 2H9TH 3A80A 3ATLA 3O8BA 3P8GA 5T6GA 4GLYA 1ANCA 3ZV9A 1CGHA 1GBDA 4UFEH 5DKMA 3FANA 4R0IA 2GZ8A 5IDKA 2XWAA 3S7KB 4F4OC 3SGAE 1P9SA 1BQYA 1RS0A 4B2CA 2WPIS 4MG3A 1HPGA 2G4UA 4DW2U 2PKAA 1O5CB 4NIYA 4ZKRU 1RTKA 2Y5HA 1C4Y2 1SLWB 3ZVFA 4HFPB 1BRUP 1SHYA 4D76A 3ZZCA 2AYWA 1LPKB 3T5FH 4X6NA 1GDQA 1UCYH 4CHAB 1C5NH 1W0ZU 2W3IA 3UTUH 1C1RA 1NY22 2HWLB 3GCTG 5G4BA 1SL3A 2FX6A 3KN2A 2AMDA 2XBYA 1F5RA 4FVBA 3M35A 1QL9A 2C8YB 1V2UT 3MNCA 3A84A 2WUBA 2GDEH 2BY6X 1WYKA 1AHTH 4H4FA 5ESBA 4ZXXH 1ELVA 3BIVH 2UWOA 1OWEA 5C3NA 4NA9H 1A5GH 1ZRKA 1G9IE 3A8BA 1BUIA 3GCHB 6GCHF 3P95A 4I7YH 3V0XA 2YNAA 2ZEBA 1FAXA 2ZGHA 3R3GB 4GPGA 4TY6A 2F9PA 1Y3WA 1AD8H 3BIUH 3PLPA 3TPIZ 3FVFB 4IN2A 3RXEA 1SB1H 5C67A 1TQ0B 2PHBA 2OINA 5C1UA 1TBZH 1CSOE 1MBMA 4JCNA 2C4FH 4ISLA 2F9NA 4KGAA 4NG9H 1ZGIA 2BB4A 4X2XA 2AIPA 2Q6FA 5C1Y