3FVRA

Crystal structure of acetyl xylan esterase from bacillus pumilus, monoclinic crystal form i
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
320
structure length
320
Chain Sequence
b'MQLFDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEAEPTLESYDYPVKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDGGIHDIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYYYRGVYLDAVRALEVIQSFPEVDEHRIGVIGGSQGGALAIAAAALSDIPKVVVADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEKAFETLSYFDLINLAGWVKQPTLMAIGLIDKITPPSTVFAAYNHLETDKDLKVYRYFGHEFIPAFQTEKLSFLQKHLLLST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyl xylan esterase
publication title Structural and functional studies of Bacillus pumilus acetyl xylan esterase
rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
total genus 117
structure length 320
sequence length 320
chains with identical sequence B, C, D, E, F, G, H, I, L, M, N
ec nomenclature ec 3.1.1.6: Acetylesterase.
pdb deposition date 2009-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fvrA00
2RHTA 1RP1A 1XZEA 2WU3A 5HCUA 4H35A 3H0CA 2XDWA 3KXPA 2RHWA 3WWCA 3M3DA 3DL4A 1LPMA 3C5VA 3B12A 2WIJA 3NWOA 5CXUA 1JU4A 2WIGA 4AB1A 5J3JA 4OU5A 2J3QA 1P0PA 3AIMA 4FBLA 1H2ZA 1AUOA 1H2WA 5DWDA 4Y2SA 1WHTA 1MNQA 2QZPA 4F0JA 2HU5A 3E4DA 1VOTA 1QOZA 5K3AA 1TKRA 4QEKA 4PO3X 3KDAA 2HA2A 1HDEA 5ALEA 1UK7A 5JD5A 4J0GA 5AI9A 2XE4A 3ILSA 5LIPA 1YB6A 5CT8A 4J0CA 4LXIA 1VXRA 4G1FA 4MWTA 4Q05A 3X3HA 2R11A 1UZAA 3FYTA 1L7QA 3K9BA 3SWWA 3I2FA 3I2HA 2ZJFA 2H7CA 1O6FA 5KWJA 1CRLA 5ALIA 4DYHA 3HJUA 4FLMA 2YASA 1EH5A 1K4YA 3LIPA 1QIJA 2J4FA 2DHEA 1ORWA 2CKMA 3A70A 2WLSA 3T4UA 5FPPA 2LIPA 1W76A 4X71A 4G9GA 1NU8A 5AKZA 2WIFA 4Q3KA 1UK9A 1FFEA 5AIBA 2DQYA 2HADA 3DKRA 3QMMA 3IULA 3R3VA 4Z49A 1SOMA 3STTA 3I2KA 4UBIA 1FFBA 4BC0A 3H1BA 2JGKA 3L1JA 5AM4A 2BAGA 1VLQA 5DNVA 5A6VA 3ESAA 1QTIA 5AI8A 2VJBA 4IQ4A 5EHNA 3VJKA 2WM2A 4B0PA 4H18A 2HA6A 1ZI6A 1ZI8A 4PV7A 3PICA 1ORVA 1EX9A 3WWDA 1CVLA 3WA7A 2CEKA 4KE7A 2ACEA 4AMYA 4QWMA 2B9VA 1BRTA 3H17A 1ETHA 2QMQA 2XLCA 1YS1X 5HF6A 4TPKA 4G5XA 2EDAA 1IZ7A 1FFAA 4LYEA 3H2JA 4G4GA 3IA2A 3I2GA 3PUIA 4G8CA 3V1NA 2HM7A 4BP9A 5CXXA 3D59A 2G5TA 5DTJA 1EDBA 4C89A 4IH1A 3FSGD 4Y9SA 2AXEA 4HRYA 4CG3A 3N0TA 3WYDA 2JBWA 4DM7A 1R3DA 4UUQA 3N2ZB 1TAHA 1BE0A 5E2IA 3GZJA 2OCLA 1N5MA 3GA7A 3BJRA 3JW8A 4G4IA 2RIPA 2RI6A 1CLEA 2EDCA 2Z3WA 1G4HA 2DFPA 3WJ2A 1XQWA 3AZPA 4OPMA 1ZJ5A 1MN6A 3FCYA 3I28A 2ES4A 4EUSA 1LPAB 1IUOA 1AX9A 1OILA 3BF7A 5HF8A 4JUIA 4UHEA 1MT3A 3QH4A 2YXPX 3IB3A 4BRZA 3DDUA 3W2TA 3HEAA 2WILA 5A2GA 1E8NA 4H7FA 3ANSA 2OCKA 1IMJA 2ECFA 4AZ0A 3QPDA 4GXNA 1UWCA 3UUEA 4NZZA 3IIIA 1ZD2P 4H0CA 2PPLA 4A5SA 3WK5A 1GKKA 2HFKA 3G0IA 3D3NA 4FHZA 1AZWA 2BKLA 4A23A 1MX1A 1N1MA 2XQJA 3O9MA 3H04A 4BP8A 4NVRA 1W1IA 2G63A 3FNBA 4U2BA 4IH9A 5JATA 5JARA 4GEGA 1CQWA 4YASA 4X7BA 1XRLA 5HKBA 2EEPA 1O6GA 3IUNA 2WJ4A 4WFJA 1UT6A 4EB0A 1UKBA 1MX9A 2XMZA 3I6MA 4LXGA 1EVEA 2XUGA 5T4EA 2OQVA 3G02A 1CUUA 3A2MA 4E15A 5K3FA 2WTMA 4B7ZA 1CUXA 4UFNA 5AI5A 2PUJA 2GYWA 3M81A 4PW0A 4JYPA 2Q0XA 2VJDA 4TVKA 1J1IA 3STYA 3TGLA 1ACLA 2WG2A 2OPHA 4CIBA 1PV1A 2XQGA 3WZLA 5FP0A 4KAAA 2XMRA 5DNWA 1TCBA 1CUGA 1XZFA 4DNOA 5E4JA 1SC9A 2PSJA 1XZMA 3NGMA 1CUJA 4LKOA 2WFLA 4LXHA 1JT2A 3EQ7A 2O2IA 2GYUA 5AKYA 5FV4A 4OSEA 4DNPA 5JASA 1XZBA 2WJ6A 4ZGBA 4E14A 4X85A 3IVMA 3OOSA 4W1PA 2J3DA 2B20A 5KBYA 4CCWA 4FWBA 1XFDA 3JWEA 4BBZA 2VJAA 3WL7A 2Z5GA 3C6BA 4DSAA 2C58A 3O4HA 1QFSA 3AILA 1XQYA 5FPQA 1XKTA 4F60A 5EFZA 1R1DA 4W9RA 1HQDA 3QITA 5JANA 1WPRA 1JMYA 3I1YA 5FOQA 5FUMA 5AOCA 4BTVA 4CCYB 2XUIA 4BB0A 4J0JA 1VZ3A 4B81A 2VQ6A 2X5XA 2QKYA 4WFKA 4PF1A 5K3BA 1QE3A 4Q3OA 4M0MA 4W1SA 1EDEA 4DMFA 4H7HA 5ALFA 1ZIXA 3D4LA 2XMDA 4OB8A 2X76A 4X94A 4L3WA 4EY6A 1GKLA 4GWLA 2CZQA 4HTAA 3G9TA 3C8DA 4X3CA 4X6UA 2DQZA 3PFCA 3B3QA 5ALJA 2XUFA 1WPXA 3KSRA 2VF2A 2VTVA 1K63A 2Z8XA 4PQEA 5CT9A 1ZICA 4ITVA 2Z8ZA 3CCBA 2HA4A 1GPKA 4V2IA 1LZLA 1HBJA 4EHBA 1JI3A 4U2GA 1YR2A 3UMJA 1QLWA 1U4NA 2PSEA 3PE6A 3WA6A 1B6GA 1T4MA 2PSHA 3H2HA 4ZXFA 3G9UA 2XMGA 4B80A 4UBNA 4L0CA 3G7NA 1YSCA 2W22A 3E3AA 4PNZA 1EB8A 3BIWA 5SYMA 2HRQA 2FUKA 4MJ3A 1BU8A 2IX9A 4QLAA 2I3DA 2PUHA 3EBLA 1VA5A 5ALWA 1WCYA 1CUBA 4N8SA 3IDAA 3F96A 1SCQA 2GBGA 3R3WA 4J0HA 3W04A 2GBCA 4FTWA 2WHPB 1DX4A 2B4KA 2QOEA 5HK9A 1XQVA 4X97A 1PJAA 4H7IA 4CFSA 3F8SA 4X90A 1XZLA 4Y2PA 3YASA 1MPXA 3WK7A 3WWOA 4BYMA 2HIHA 4WCVA 5DYWA 3D0KA 3ZLTA 1JMKC 2WU4A 4Q1VA 3VISA 3QMWA 4QE3A 5C8XA 1X2EA 2HA5A 1ZGCA 4G8DA 4RPCA 5C8ZA 4CG2A 2DCMA 3WWEA 3AINA 1UFOA 4UHBA 4Q3LA 3W05A 4N5HX 4C4ZA 5HQ3A 5FLKA 3DL7A 2ORYA 4BDSA 3DEAA 1AMNA 3IURA 3I6ZA 2FJ0A 5HF9A 1R9MA 4JEIA 1LPBB 2QXTA 5LYYA 2G4LA 2Y1KA 1J2EA 4EY7A 4BVLA 4ZV9A 3DYVA 1CUCA 4EY4A 4UHDA 2XLBA 1BN7A 1YASA 4EY5A 1DWQA 2ZYRA 5AI0A 3O0DA 3T52A 4C87A 3AFIA 1J06A 3R41A 5CRIA 4UFPA 1XRNA 4W1RA 2WFZA 2BFNA 5C8VA 2H7XA 1A8UA 5AKGA 2XQFA 5SYNA 2C0QA 4BCCA 5A7HA 5EHZA 1XZAA 1KU0A 1CEXA 5ALKA 5C7YA 2AJLI 3C43A 1QO9A 5HZGA 2OCIA 2V9ZA 3S2ZA 4B85A 1MX5A 3G0GA 3O95A 5C81A 1LLFA 5IVKA 5ALOA 3BXPA 5JADA 1YB7A 5HF5A 1RWQA 1CUFA 1S8OA 2R8BA 1EK2A 3EQ8A 2C0PA 4BVKA 3STVA 5DYTA 3MVEA 5ESRA 4UBLA 1SCKA 3C6XA 2WHRA 3PFBA 4C88A 3HACA 2Y2UA 5IVDA 4J7AA 1LPNA 4XWGA 5IH7A 1DU4A 4X95A 3WJ1A 3DOIA 3Q8WA 4UBOA 3FYUB 4X6XA 4RE5A 5A71A 4BCDA 4AO8A 5K3DA 4WFIA 3V9AA 2OLEA 2PSDA 2RGUA 5D7BA 4KRXA 2D5LA 1QJ4A 3F98A 2PL5A 3G0CA 1BCSA 1C7JA 3LCRA 4DSZA 2CUTA 2BUBA 4FNGA 5ALZA 1QIGA 3L1HA 2XB6A 1AURA 4OYYA 4BAZA 2QUAA 4PSDA 1EVQA 3AIKA 5JIBA 2XQIA 3EF3A 3G8YA 2ZJ7A 1XZHA 4K5QA 2WTNA 1CFJA 1D07A 3BDVA 1CPYA 3ED1A 1DWPA 1GQRA 4IO0A 4ZI5A 5JZ9A 4QDXA 3FWHA 1JJIA 4UHHA 1MNAA 2Y6VA 3HSSA 2HFJA 1W6RA 1YAHA 3D2BA 4WDRA 2GZRA 5AKHA 3PUHA 6YASA 4J0KA 5FKJA 4CIAA 4U2DA 2WFMA 2WFLB 2Z3ZA 1ACJA 4UHFA 2PM8A 3HRHA 1XQXA 4B0OA 3SX4A 3NUZA 5IVHA 2VAXA 4J0DA 4AX4A 3D7RA 3HLKA 2GBIA 2GYVA 3RKSA 4OB7A 4Q34A 5DTIA 4ZWNA 1NU6A 4E11A 3WK9A 4K6GA 5AK4A 4PSCA 1JJFA 1PFQA 4MWSA 4AMZA 4GI1A 1LBSA 4ARBA 2WHQA 3RLIA 3D2CA 1IZ8A 2JGIA 3DYIA 4OCZA 1AQLA 1WHSA 4Y2QA 5ALXA 5H3HA 1XRQA 5AM2A 1TK3A 3FVTA 1SCIA 3F67A 3GUUA 5A7GA 1DQYA 5JZSA 1RYYA 1A8QA 5AKIA 3AJAA 4JNCA 2VT7A 1U8EA 5CMLA 1MO2A 2QRUA 2XUPA 4UFOA 1CUYA 3O4JA 3H2IA 1DX6A 3EQ9A 3BJMA 1ZD4A 3FLBA 2ZYIA 1MU0A 1DTEA 3E0XA 2XUDA 2VT6A 4IH4A 5D6OA 5T4BA 4UBMA 1EXWA 1YAJA 2B61A 1USWA 2PU5A 1E8MA 4H7KA 3GROA 1DQZA 5CW2A 3AUKA 5A7FA 4H77A 1F0NA 2FX5A 4QLOA 2DHDA 3WL8A 4N8DA 4ETWA 1YS2X 4UPDA 4F5ZA 4FLEA 4LIPD 4OD0A 4C01A 3WL5A 3PF8A 1H22A 5LP1A 3OURA 3A6ZA 4EBBA 2PVSA 3NOXA 5ISMA 2GZSA 1THTA 3Q0TA 5E4TA 5I8PA 4G4JA 2K2QB 3WIOA 3QPCA 1XZGA 3FLAA 5AI4A 1FSSA 4J03A 4AXBA 1AKNA 1YA8A 3IBTA 4OB6A 2OXEA 4Y2JA 4DGQA 4UHCA 5AI6A 3TEJA 1BN6A 1A88A 2PBLA 1A7UA 5CT5A 5I9IA 1VA4A 3O4GA 1QO7A 3R3YA 1ZOIA 2PKYX 5ALTA 1CIJA 1ZIYA 3C87A 1QTRA 1R88A 1IUPA 5ALNA 5FRDA 5T4FA 3WMRA 4HS9A 1JKMA 2I03A 5K3CA 4FBMA 2OG1A 2P8SA 5ALDA 5CTAA 2UZ0A 1DINA 2YYSA 2O2GA 2JEZA 2W6CX 1UOOA 4HXEB 1F0PA 1Y37A 2HDWA 2OGZA 5LZ4A 2WIDA 1GGVA 1WB4A 1ZJ4A 5HFNA 5KREA 2PSFA 2WG0A 2WJ3A 1LBTA 3QM1A 3FVRA 4KE9A 3LLCA 4BZZA 3EIOA 4I3FA 4Y2TA 3FSGA 1EK1A 4FKBA 3R3ZA 4HXFB 3A2LA 3OC0A 1DWOA 2J4CA 3KOOA 3A2NA 1QIHA 1QZ3A 4X92A 1I6WA 2JF0A 2V96A 3ESDA 1N8SA 1H2XA 3VXKA 1Q0RA 5AK5A 3WKAA 3B5EA 2JGJA 1ISPA 3WIBA 4GHWA 4WDQA 5JYCA 1BROA 1ODCA 3QPAA 1GXSA 2HU7A 4QDTA 4BZWA 1EDDA 4OUKX 1R50A 4DNQA 2V97A 5D3KA 4P08A 4B82A 2QT9A 5ALMA 1XRPA 2C7BA 4KACA 5ALYA 4Y2UA 2OAEA 1CUAA 1R9NA 3VKFA 1F6WA 3R0VA 4XX1A 4B83A 4H7JA 4FDMA 3LP5A 3OPMA 4FNMA 3WZMA 5KWIA 2QTBA 4MEAA 3DJYA 2I78A 3V48A 3BIXA 1THGA 4UBJA 5LZ9A 3CN7A 3WK6A 4EA6A 4CI9A 4K6HA 2IIVA 2Y6UA 1NX9A 3MGAA 5LZ2A 4L72A 2HHAA 1TIBA 5AM5A 1Q0ZA 4H7DA 3AZOA 2XI4A 2XUAA 2BGRA 4JH0A 5ALLA 4Y2XA 4QNNA 3ZV7A 4DMCA 4MYDA 4NMWA 5FXMA 4QDOA 1VXOA 4TGLA 3D2AA 3GBSA 1ODTC 2H7YA 4DMHA 4A16A 3FOBA 5LKRA 1EINA 1XZDA 2JGMA 5AP9A 5BWCA 5F4ZA 1YA4A 3ZPXA 3C70A 3LIIA 2QM0A 4MQMA 2BUCA 5JZBA 2QR5A 3RM3A 1W75A 3FLEA 1GQSA 1MJ5A 4X93A 2ROQA 4AQDA 2CB9A 2I3ZA 2FJPA 1E3QA 1E66A 5BOVA 3MUOA 3WL6A 5CH3A 5LZ7A 4NS4A 3STWA 5HK8A 3JYHA 4L9AA 2BJHA 2XUOA 3PF9A 1H23A 1GPLA 5LZ8A 1P0QA 3WKDA 4FOLA 3E1GA 1W52X 4GLBA 4K2AA 4CCYA 1QIIA 4X00A 5EIHA 5FDFA 3OTQA 1IUNA 4YK7A 4HVTA 4MXDA 1UXOA 1EA5A 1P0MA 2XUHA 4QZVA 4XVCA 4F21A 4M0EA 7YASA 2QUBA 1QGED 3WYNA 2O7RA 4AZ3A 4W63A 5AKLA 1VE6A 1XKLA 1DT3A 5AOBA 4XJVA 1ZGBA 3DOHA 4HAIA 4BC1A 1MAHA 5AICA 1JJBA 4BAGA 2H9YA 5AKKA 2AJCA 1LPPA 2E3JA 3W06A 3HZOA 4FMPA 4LHEA 5CURA 4KE6A 4BAUA 3G0DA 2QJRA 4B9AA 1GPNA 1LPOA 3WI7A 5JALA 1CUZA 1UKCA 1WB5A 4MYSA 3U0VA 3QVMA 4I19A 1OCEA 3CXUA 5EHQA 1K5PA 4GECA 3V1KA 1R4ZA 3QYJA 1XRMA 4Y2VA 3SK0A 4S0XA 3QBJA 3BF8A 1UOPA 3VVLA 5DYYA 3UUFA 1Y7IA 5E4YA 2X8BA 5AJHA 2Y2VA 1CV2A 4ARAA 1L7AA 1G42A 1BEZA 3BE8A 2HU8A 2WHPA 3ZI7A 2XMSA 4B9EA 4H7EA 1ZD3A 1XLVA 5EGNA 3C8HA 2H1IA 4FFVA 3P2MA 1X2BA 1F8UA 3WK8A 5ALUA 5D3ZA 1K8QA 1P0IA 3O4IA 1Z68A 2NW6A 5BV7A 1WM1A 2ZSHA 1KU6A 1VJ5A 4BVJA 2XMBA 3HC7A 5K3FB 3WKCA 4IHAA 3C6YA 4B6GA 4DTCA 3DQZA 2CBGA 3F97A 5EI5A 1TCCA 3TRDA 1EI9A 4WY8A 2HRRA 1BEEA 1DT5A 4C6HA 5AOAA 1FFDA 1MAAA 5CH8A 5BWBA 4LYDA 2QXUA 1H2YA 2ZSIA 2VA9A 1CUSA 4KR0A 5I7UA 1OXMA 2BUAA 2WSLA 3PDCA 4O08A 4BTLA 4Y2YA 3BL8A 5ALRA 4CG1A 1B41A 3HXKA 4N5IX 1W4LA 3K6KA 1CUVA 4EY8A 2BGNA 1TCAA 4G9EA 1CUDA 1CUHA 4P93A 2JGLA 4AN0A 3C45A 3PI6A 2C5GA 1ODSA 4QWWA 5AM3A 4U2EA 2WKWA 3O9VA 5EHXA 4PSUA 2OGSA 4RE6A 2HA7A 3H1AA 5JAPA 1HLGA 1JFRA 3H19A 1HPLA 1VE7A 3DD5A 5AM0A 1BCRA 2V98A 1CR6A 3QZUA 3WWPA 4WJLA 5T4HA 1AGYA 4BCBA 4GDMA 4AO7A 1QIMA 1QONA 1X70A 4GBGA 4RNCA 4U2FA 2WUGA 5DLPA 4UBKA 4EZIA 5AKJA 4P9NA 2HA3A 2OQIA 1GZ7A 3VJMA 2VAVA 4U2CA 1VKHA 5CT6A 1HKHA 1J07A 1ZD5A 2ZYHA 5ALGA 5AHXA 3HABA 4BE9A 1E8DA 1HL7A 3OM8A 1GT6A 4KYVA 3VVMA 4MEBA 2JIDA 3G0BA 1CUWA 3BWXA 3WK4A 2IITA 5AK3A 3IUQA 4ROTA 1EB9A 2D0DA 3FYUA 3V1MA 5JAOA 3G9XA 3R3UA 3C6ZA 3ANTA 2QS9A 2HL6A 1QIFA 1T2NA 2PX6A 2YH2A 4Y7DA 3W9BA 4OU4A 2OGTA 2AJ8A 5LKAA 3CCCA 2ZJ6A 5ALPA 1IVYA 2DSNA 1TRHA 2AJDA 3ICWA 2OCGA 2XUKA 3MUNA 4QA9A 4ZRDA 1LPSA 1Q84A 2ACKA 2C5FA 1QIKA 5IVIA 4W1QA 1L7RA 3IUMA 2DHCA 1K6EA 3KWJA 3U1TA 1U2EA 2CMFA 1AC5A 1M33A 4Q82A 3K2IA 1CUEA 4BDTA 2WUEA 1LZKA 1UOQA 1VZ2A 4XIIA 1LGYA 2ZVDA 2AJBA 2G5PA 5K3EA 4BATA 2VEOA 4ZREA 5CBKA 4YX9A 4KEAA 3DKKA 1N5RA 1UK6A 3QMVA 5ALHA 2JEYA 3ESBA 1ZI9A 3ZLVA 2WUFA 3D5EA 1FJ2A 3F9CA 2XT0A 1XLWA 2O2HA 4INZA 2XMCA 4GW3A 4X91A 5AKXA 5CH5A 1CUIA 2BCEA 2XUJA 3FBWA 4OYLA 2DR0A 2VSQA 4M0FA 1FFCA 4B84A 4FLFA 3VJLA 3HYSA 3I1IA 4FFWA 1EHYA 3STXA 1U65A 5ALSA 3ZWQA 1UKAA 3HI4A 4AN1A 1YCDA 2PU7A 2WQZA 3H2GA 5EIEA 3LS2A 4RGYA 1MTZA 2ZYSA 3DCNA 3H18A 5HQ3B 3DNMA 4QDUA 2QVBA 3DS8A 1BS9A 1Q83A 5JD6A 4YPVA 5AM1A 4N8EA 3VDXA 3BDIA 4DIUA 4DNFA 3I2JA 1LNSA 3TJMA 3G9ZA 3S8YA 4P92A 3ZLUA 3V1LA 1JU3A 4K6KA 3R40A 5AH0A 2C4HA 2XQKA 1XZJA 4Y2RA 3L1IA 3R3XA 1G5FA 5ALVA 3I6YA 3W9UA 2VJCA 3KD2A 5A62A 5HKAA 1A8SA 3SC2A 2JGFA 5LZ5A 3AZQA 4D9JA 4QDZA 4G8BA 1E5TA 1TQHA 4J0IA 4WY5A 2QJWA 3FCXA 4C4XA 4J3JA 4ZV7A 4HXGA 3FYUC 3STUA 2CJPA 3RARA 4X6YA 4KE8A 1QIEA 3CN9A 4DMKA 2XMQA 1XRRA 3WKBA 5HFAA 3M83A 3I2IA 4BRSA 2WIKA 5EIAA 3WQHA 1XLUA 3ICVA 2O7VA 2VATA 1XZIA 1WOMA 4DLNA 1QIDA 5ALQA 3RK4A 3M82A 4KAJA 2HA0A 3ESCA 4C4YA 1Y7HA 5AIAA 3KWFA 3DLTA 3H2KA 3WKEA 2WG1A 4HRXA 3AIOA 1XROA 4BE4A 1C4XA 3GELA 5JAUA 3WLAA 4KJXA 5AO9A 1C7IA 1WB6A 5JAHA 3OG9A 2RONA 2ONCA 5JD4A 1CQZA 1UK8A 2XUQA 5LLSA 4E46A 1XZKA 2RAUA 2JGEA 3C5WP 1QFMA 3GFFA 1G66A 5IKXA 5DJ5A 4MQLA 4KRYA 5AK6A 5YASA 1E89A 3IUJA 4AO6A 3FAKA 1XZCA 1SFRA 4I4CA 2GBFA 5AKEA 2OAGA 5CT4A 1KEZA 4JYMA 5K5EA 4KAFA 4HZGA 5DNUA 2WUDA
chains in the Genus database with same CATH superfamily
2RHTA 1RP1A 3Q1KA 1JR6A 2E82A 1O97C 2MSEB 2QTVB 2WYIA 4G1UC 1OXKB 1T9AA 5BN5B 4W7IA 1YUNA 4ND8A 4H35A 5BOSA 1JIKA 1P8JA 3H0CA 4HBGA 3AFMA 3DZ8A 3Q12A 3OHPA 4YAFA 2R6DA 1AVTA 3WWCA 1EFTA 1X7ZB 3MTIA 1JR2A 2ZZKA 1H6CA 1A4IA 2A5GA 3B1ZA 1FQKA 4M53A 4BVAA 3ZWWA 2D4AA 1KJIA 3K0BA 3ICQB 2VK4A 3ADKA 4Y9TA 1UPXA 4OGGA 3TKLA 1J4AA 1Y7LA 2GXAA 1IJKA 3L01A 1C8KA 2VUUA 3DVAB 1SRRA 1UDCA 4MQ6A 1YB5A 4ZEOA 3P9RA 4HUTA 4RNDB 2C92A 2VZ9A 2CXOA 4CQMA 3F5SA 4F3TA 3BBLA 1SHZA 1ZN7A 3WRYC 1HDRA 1SHTX 4U7HA 3SJBA 3TOVA 4E3WA 1QH0A 1HE2A 3AIMA 4FBLA 5EVCA 1H2ZA 1VHLA 1PQWA 2ZWAA 1AUOA 3WSVA 2GT1A 3C1TA 4QSMA 3AX6A 4QPNA 4U7FA 4Y67A 3O1JC 5JSFA 1O95A 3JQ7B 3OUZA 1FZQA 1BVYF 3DDOA 3LQFA 2F2TA 4MWDA 2QPLA 3KLMX 1H2WA 5DWDA 3DBRB 2JI7A 4KWCA 4PVCA 4ZYWA 2DPMA 3BSSA 3R5KA 4I7EA 1P0FA 4Y2SA 2E4WA 2PAAA 3H9UA 4F0JA 1C7FA 2P79A 1PK7A 2QP9X 4UEWA 3CLSD 2IZ0A 3MCUA 4DREA 2BFDA 5IC4A 4Q7LA 4X24A 1TKRA 4QEKA 2HB6A 3M34A 4RM2A 3ET4A 2AX4A 1XEWY 4TL8A 5KCZA 5KQSA 4FXPA 5CVDA 1XL1A 3UT5A 2XX3A 1HDEA 2XVXA 1VBFA 1KC3A 2CFRA 4Q01A 1SQ6A 4J29A 3ZH2A 3UK2A 4ZVQA 3GGGA 3GJ8A 2JLRA 2VRWA 4U63A 1OB5A 2JAUA 5I7RA 1LF5A 3IRUA 3KX2A 1WP9A 5AI9A 4BQFA 4E4TA 5JD5A 2JBAA 5EP4A 2ZE5A 3EG9B 3Q7SA 1SC6A 2XE4A 3G23A 4W5NA 1X94A 4QHSA 5AUPB 4I1PA 4JVMA 5BYAA 4HNSA 4JLJA 2WYUA 5EP1A 3N5CA 2KB0A 1V8DA 3CT6A 4ADSG 1XEFA 2B30A 3L04A 5C3MA 3EHEA 1Z7WA 3H5AA 4Y6PA 2V6IA 2R11A 1JAYA 4V38A 1NG1A 3SIRA 1S6YA 3BH7A 3OFVA 3NBFA 3DUWA 2ZJFA 1EUZA 4BBJA 4RW0A 4BNHA 2R5FA 3VPBA 3PEUA 5GINE 4L9WA 4DDUA 4DB2A 4XQGA 5KWJA 3TIGA 4ZZ2A 1CRLA 4D3SA 2UUOA 5ALIA 1JQ3A 1MABA 4UCXA 5DBFA 2YASA 3NHLA 4QOHA 3RFXA 1BJTA 1QVZA 2Z83A 5KB3A 2Z5FA 5DHTA 1VG8A 4OXQA 3RBXA 2VBFA 3GJQA 4DM3A 2ZJAA 3IHTA 3KR9A 5DULA 5IBPA 2NUAB 5IXYA 2WMDA 1ORWA 3M6IA 4GMKA 1VBMA 1EWYA 2XTJA 3UQYS 3MAGA 1LFAA 1JF8A 4AMGA 1Z88A 4A3SA 2OK8A 1G55A 3A3NA 2IXAA 3BFKA 1TTQB 3A0RB 4INAA 4TLAA 1TE2A 4X1YA 3W7BA 2H65A 1QH8B 3KT8A 1LVHA 2HUNA 1W76A 1UJMA 1SA0A 1UBTS 3CO0S 4X71A 3QYPA 1S3FA 2SKDA 3JQGB 2A33A 4BGUA 3P0IA 1MHPA 5AYVA 1NU8A 1JPNA 3HMKA 1Y8ZA 1XDWA 1UK9A 4DYDA 5CITA 3OMWA 2W37A 5EC8A 4GM4A 1A2KC 1YB4A 4OQYA 5AW9A 5CUQA 3S5UA 1RE0A 3DHYA 4ZARA 5BR8B 4C2AA 2WHXA 4PTLA 4EHAA 3QX3A 1CYEA 3QMMA 3B38A 1QB7A 3LRTA 4MS4A 2DKNA 1OU4A 3LWDA 2OCXA 5IFLA 3Q10A 1L5ZA 4KSBA 4EHDA 1W8DA 4FR2A 4MYHA 3F3KA 4UM7A 4UBIA 2VO1A 3NBXX 3ROGA 4ERXA 3ITDA 3T0FA 2BAGA 2Q6IA 3AEXA 4HEA6 1KF0A 4OQNA 4X8OA 1OTHA 4KU4A 3ZHVA 2EFYA 2VSOA 4GI2A 1GRNA 2RK6A 1QGAA 3G7UA 1GJRA 4DBVO 1QC5A 1QTIA 3FZYA 1E2IA 5B58C 2BN4A 2WSIA 4F93B 5BSKA 3RI3A 5FHRA 3E22A 4ZFNA 4B0PA 3HY4A 3EBOA 1AQ6A 4QGBA 5KQGA 3URKA 4KBYA 2A86A 5FB3A 1C7ZA 1QJCA 4RMGA 3P32A 1DAPA 3JQ9A 1IPFA 2A14A 4JZYA 4JP1A 1A2OA 1IN8A 1ORVA 1LQUA 3MBIA 1U8YA 1EFKA 1SIWA 1FVHA 3PPYA 3LOUA 4E6PA 3V46A 1FYDA 3U6KA 3BICA 1ZVVA 4ZYXA 3C6QA 4S04A 4ZT7A 5TS2A 4BX9A 1CZOA 2ACEA 2AOWA 4R05A 2B9VA 3PCTA 2Z8YM 3PIDA 5JVDF 4XQ9A 3AGPA 2X9NA 4LX8A 4MGHA 1L4MA 1ECCA 1OXSC 2BVNA 2GRJA 4Z9YA 1IXYA 2P78A 1YR6A 4LMBA 3PC3A 5HF6A 2Q5OA 2BBWA 3SFTA 1ICIA 2PMCA 5FTWA 4AJLA 5D85A 3SNKA 5EWMB 4WSOA 2PQMA 2EP7A 3QG5A 2VT2A 3WGMA 1FFAA 3IMEA 3JWJA 1SCUB 1KFBB 4DLWA 4EVRA 2AQ8A 4K6OA 4CF3A 1ZBDA 3QTTA 4RGQA 5ES3A 2HRBA 2IXTA 4M2LA 1JT9A 2ZE6A 3WGKA 2H1LA 1C7RA 2M32A 4O25A 5EXPA 4RF3A 4RKYA 521PA 5AFSA 2HM7A 1Z8FA 4BP9A 3HYLA 3OE7A 2JIPA 3RS3A 3QJ5A 3KE9A 1S01A 3TKYA 1TZBA 2D4HA 2GN0A 2G5TA 5DK6A 3SX0A 1GY8A 4DLXA 3CWCA 4BQEA 1E5LA 1SUPA 1MB3A 5JLJA 3NAMA 5KDDA 3UHOA 4C89A 3D8SA 3W77A 4IH1A 3EEOA 2D7JA 5HTKA 4ZEWA 3TM4A 3QLEA 2X58A 4EVIA 3KPYA 5B53A 3E5HA 2UUCB 2OD7A 3DEJA 4NY1A 4CG3A 4ZGWA 1RJEA 4K8OA 4OHFA 4E2YA 4GR5A 2QXYA 3CW2A 4KC0A 1M8JA 2GK6A 1E1RA 4D6YA 3J7AC 2IEZA 2JBWA 2PRIA 2G88A 3FBTA 4DM7A 5L51A 1X3LA 3VC1A 4ZHQF 1WUHS 3PUVA 1YVRA 4ECAA 1CVIA 3AF4A 3OESA 5E2IA 3RRFA 1BS1A 3ZWVA 4OGFA 2WWHA 1O4VA 5H4GA 1GTZA 3NP9A 3A31A 2X3FA 4RK4A 4EUNA 2NXNA 1YQQA 2C77A 1Q3HA 3CIOA 2GX6A 4WLOA 5HS6A 1V16A 2EDCA 2X3UA 2C2XA 1O95C 4I8DA 3UMGA 3S7ZA 4MR9B 3QVVA 3RQIA 4KMMA 1RAIA 1RVDA 1QHNA 5CM9C 1W4RA 2WY2D 2Q45A 4X60A 4XOUA 1FTYA 5BSRA 1T1EA 3WGHA 3LOPA 1AOXA 4OJQA 3AM4A 4DDMA 5FH9A 5I45A 3BORA 3E9QA 1MN6A 1IEVA 2QY9A 3ASYA 4EUSA 3CH5A 3G3EA 1YJXA 1AX9A 3GZ4A 1R7RA 3H0KA 4FJ1A 1W59A 3FJOA 1G7RA 5KSPA 1CB0A 5HFJA 2YOHA 2VHJA 3DV2A 4YPOA 5IXJA 3IUPA 4D79A 4Y2HA 1CF4A 1FU7A 2EYUA 3ZCVA 1NNLA 1MT3A 3CX6A 4B3BA 1QK5A 1V1MB 2P67A 1IY0A 1KEVA 5E9QA 4K87A 2VDNB 4YJFB 2FEPA 2ZRFA 5DLQC 3W2TA 2HWUA 5CHYA 5J5CA 1SBNE 1KAGA 1ENOA 1QRAA 2WILA 4HB2A 4LOLA 4G0WA 1F2TA 1GCAA 5KSWB 4L74A 3B1XA 5A2GA 3FPJA 4QAJA 3ZCUA 4H7FA 4ABTA 3L7OA 1STOA 4CM4A 3GRUA 2I3BA 3USZA 1RC1A 1LK7A 2OCKA 1IMJA 1Y8QB 2HMVA 3WLFA 4BNTA 5BW8A 3EIEA 3QPDA 4DUGD 2C0CA 1P2BA 1M1NA 2H07A 4N76A 2R6HA 4B71A 5JPIA 2LGJA 1NI4B 4X8LA 5JS7A 1F6BA 1MP0A 3IIIA 3WBJA 4BQRA 3LTNC 3T3OA 2H17A 3K31A 3R3JA 1GKKA 3KBOA 3BA6A 2P9EA 3G0IA 2GO1A 3D3NA 1YDMA 3LPAA 4MGKR 4B87A 6Q21A 4A23A 1FY2A 2PZJA 1MX1A 2CXUA 4ER7A 1R5JA 4D7AA 1TUGA 3G0HA 2M98A 2VPYA 2IUTA 4U9IS 4WZBB 4ZKDA 4K9RA 3COPA 1RZRA 3H04A 4GYKA 4CLDA 2PK3A 3AF1A 3CRZA 1T35A 4NVRA 1B8VA 2G63A 3FNBA 5HDQA 5LA6F 3RT1A 4DIKA 3EGIA 1IBKB 4KFCA 2XF2A 2HBRA 4X7BA 2ODTX 1DO8A 1ZDMA 2HXGA 2LKDA 4ABYA 4BO1A 2CNBA 1N2CA 1UKBA 4DE5A 1F8YA 1OKKA 4A26A 1MX9A 1UADA 1EBBA 3DE7X 3PS9A 3EC1A 5D84A 4RVFA 1NUQA 2FPUA 2GM5A 1VMAA 2VPXA 4XWAA 2A67A 4IXDA 1YZYA 1M1ZA 2B0CA 2XUGA 3WGVA 4DV7B 1T2EA 4DMMA 3VC2A 4IXMA 4JXXA 2OQVA 3GFSA 2RH9B 4MZXA 5AUNB 3A2MA 4UW9A 3HEBA 4E15A 1IN5A 1CR1A 3OD1A 5KKNB 1Q5PA 2YWHA 1XTZA 4JOCA 4NS1A 5I4KA 5K3FA 1EWKA 4JI4B 4B7ZA 4FI3C 4LF7B 2HPHA 1ZJWA 1OHHD 1WDLA 2DWPA 4XLLA 2NU7A 2HXSA 1GNTA 2VDQB 3GEHA 5KNDH 3C0KA 1JG6A 4X61A 4W5RA 3I5YA 2OB1A 2NYRA 1N2XA 3EN0A 3EQ6A 1X6VA 4YJ2F 3VSAA 4EG6A 4ZI2A 2HSGA 3PQ8A 3FNHA 4R2WA 3HB1A 3H9GA 2CK3D 2YJTD 3S6JA 4DLPA 2W90A 2C78A 3HBLA 3MB5A 3RUIA 2JI9A 3HXTA 2DG2A 4YUWA 1K0UA 4L15A 1M34A 4NBNA 4TVKA 4C2TA 4UM5A 5GONF 4X9XA 3DMHA 1SHLA 2BMDA 4L5IA 4GGPA 3VZBA 1J1IA 1ITZA 1NC3A 4OIMA 3KU1A 2WG2A 1GWNA 1FX0B 3K5IA 4MULA 1U0JA 1GT91 1O87A 3TRJA 1GGHA 4B76A 2FW7A 5DHQA 2AG0A 4KYTA 1IMOA 2A78A 3HSYA 3SR3A 3E9CA 1YVPA 2VWQA 5EINA 5DN6D 3AHIA 3JQ9C 1KQFA 3UJ8A 2WA2A 4I4TB 2VI5A 3TTXA 1SQFA 5FP0A 4QTUB 2R0QC 4DIOA 2II6A 5CJ2A 2WPNA 4YV2A 2GILA 2Q4RA 3HEMA 3CH6A 1CUGA 5DNWA 5HIAA 3IBYA 3HBMA 4YRPA 4L02A 3B51X 2Q8QA 2NUTA 4PZDA 3JQDA 4IIVA 3AM3A 1CUJA 3P9KA 3M9XA 1MO4A 3A3YA 4F9TA 1DRUA 4FCCA 3EODA 1DEXA 3VTKA 3UCXA 4IFEA 2A9JA 4D56A 4P22A 1AKWA 1DEKA 1G16A 1NVTA 4K05A 5HS4A 5FTKA 3EQ7A 3UC5A 2QAGB 1I2MA 2GYUA 3F3YA 1U3CA 2Z1NA 4FR0A 4MVJM 4PYKA 2XB8A 3AUYA 3OQBA 4I08A 1DFHA 3R76A 1Z47A 4U39A 1LWOA 5C0OE 1HT1E 1OW3B 4WLNA 5EHIA 1NWHA 3HJNA 4LOKA 4X85A 5KWSA 1MPTA 2ZUBA 5DT9A 3JQCA 4HNRA 3HHPA 2EX0A 3MFYA 2YCBA 2QTGA 1ZH0A 3DOEA 1XFDA 2JLZA 1P2SA 2CMKA 1H3FA 1FSPA 3I73A 1NBMD 3IPRA 5FI1B 4AM8A 4G2TA 1CS4C 4HNUA 3COJA 2Q62A 1IHYA 1TLFA 1X13A 2Z5GA 4DSAA 1L1RA 1XRSB 3QFSA 4P3PA 2CV0A 4UPVA 1U90A 5CB0A 5ICEA 4KWTA 3GNTA 2WAXA 2PGLA 2ZBDA 3FYHA 5CR9A 4Z4CA 2P9CA 3L9XA 2XADA 5IT5A 5F98A 2X0NA 1WVGA 4JEMA 1GPJA 2CFCA 2R1VB 3BB3A 3BGVA 1FTSA 3GYGA 4N03A 3RK1A 4BBAA 4HLQB 3HM9A 2VTBA 4W9RA 1JN0A 3WGJA 4UQOA 4K1LA 4EHNA 1R0RE 3TQQA 5AQEA 1M6EX 3IAUA 3EZ2A 4GLOA 4WBSA 1T3LA 1JMYA 2IV3A 4AY5A 1VIDA 2GPWA 5FOQA 3RVOA 2C3YA 3U60B 2NX2A 4UXIA 3UZUA 1C3OA 4CCYB 3OX1A 2ATIA 3NS7A 1C9DB 4IWNA 1TZJA 1KI8A 1OX5A 4J0JA 1BX0A 4QODA 1JHVA 2D1SA 2NQ2C 1EFAA 2F7SA 3WHIA 1F2UA 4N0QA 2IPNA 2NSHA 2JHCA 2QF7A 2XNCA 2ZI3A 3LPNA 5B36A 1O94D 4E4YA 5LYJB 4G0VA 4ZJUA 4PF1A 2RB4A 1I33A 3FMIA 3EVZA 4QO7A 4IF4A 5CTJA 3KRTA 1SVNA 2OYSA 3ENWA 4LJ5A 1IXZA 2N42A 5F12A 1FFYA 5C35A 1RLUA 2KLBA 3BN3A 4RX1A 3NPAA 4R1SA 3BWYA 4BP3A 4DCTA 5ALFA 3R9KA 7ABPA 4XE5A 5H9WA 5KTRA 2IHUA 1P5ZB 4LF9B 2ZP1A 5DHUA 1NUTA 3D4LA 4AZ3B 1K7YA 4XCVA 1P60A 1RJDA 1ZMTA 4L51A 1ZYUA 1UAGA 5LU8A 4PNPA 3W4KA 3E61A 4OATA 3K1AA 3KDPA 1P33A 1N2HA 2AUMA 3IR7A 3VZSA 5FWYB 1IY9A 2ZU0C 3CUWA 4X6UA 4XD7D 3RODA 3IIMA 4BKOA 2E4XA 4CL3A 1UPTA 3B3QA 4N1AA 5ECYA 4BUJA 5IHPA 2XUFA 4IFTA 4V0MA 3KSRA 1Y5IA 1MZVA 2FUCA 2H0QA 2HY7A 2JH3A 4IR7A 1MXFA 1Z56C 2J6IA 4A73A 5A5GA 5JYEA 2ZUFA 1X15A 2YHIA 1WXWA 4XARA 5CT9A 3O31A 2JCGA 1AKVA 4MJXA 4Z2YA 3NMUF 2W0MA 1N5DA 3KTOA 4L08A 3G17A 2F90A 4BEWA 3I9FA 1L5SA 3AH8A 3TIIA 3GQBA 2D62A 3H5LA 4HZIA 5TEWA 5CXQA 1KMIY 2B3TA 3ZOKA 3QK7A 2I5PO 3EA5A 3FFXA 3B1FA 1YWGO 3AESB 3GRVA 1CNEA 1BHSA 4YRRA 2FQXA 4N40A 4OK3A 1N2JA 5FULA 2DLCX 2BC9A 1GPKA 1KQNA 1T3HA 5EYPA 4BB9A 2HDNB 1QQ6A 4EHBA 1YRYE 3KS9A 4U2GA 1II0A 3B48A 2PXCA 4U8GA 5D6NA 3WYFA 2G0AA 1N0WA 3OUTA 1NRIA 1QLWA 1Q77A 1V7QA 2W4QA 4I8XA 4NE9A 4TZTA 1TF2A 1CG6A 2VYVA 3L5KA 3PE6A 1LVUA 4K8RB 3H2HA 5BRJA 2A9FA 2AQIA 2O3UA 3N05A 1D2MA 1NAHA 2Q6TA 1I3LA 1P45A 3EZFA 1NJ1A 3IQHX 2PZEA 3QW2A 4H6XA 1U9JA 2HLHA 2YJGA 1I7DA 2J41A 3UAYA 4CLRA 2AEJA 2C3OA 3ND8A 3OCUA 4N01A 2Q07A 3NANA 1L4NA 1QYCA 4AYWA 4F9GA 3WNZA 4MR8A 1PFKA 3ND5A 3IPAA 3E3AA 3VOAA 5LMNB 4LZAA 4N41A 1ST2A 1ONPA 1D1PA 1EB8A 3OI7A 5GOZA 1DC3A 2HNAA 1IBCA 3BIWA 3GGOA 5EZQA 3KIPA 1U0RA 1UBRS 1Q16A 2FUKA 1KY2A 5FOVA 1BU8A 4JQSA 3U31A 4NBLA 1OBFO 1MO6A 3G79A 3K30A 4KXXA 4OOFA 4TV9A 3UNXA 4JBYA 5ALWA 4FXOA 3MZ0A 1RVV1 3D6AA 3PNVA 2I7XA 4KZKA 3EGDB 4C5BA 1JPUA 1VKOA 3F96A 1XG5A 1AQJA 1QM5A 3WP1B 1PFYA 2NV0A 1U6IA 3PB3A 2GCPA 1PHRA 4UVIA 1YS6A 2JCSA 2OORA 5BUSA 3H5NA 2F3UA 3MJSA 4ZOQI 3VR2A 3THXB 3W04A 3BMCB 3LCCA 2GBCA 3ZXIA 2F3QA 2QPAA 1YDFA 5TPZA 2ZR7A 2I4LA 4QTXA 3FVWA 4KQ9A 4ZOCA 5C8YA 1T2UA 1YVEI 5F7XA 2CVZA 1DX4A 5LQKA 2B4KA 1ZWKA 3LPMA 1FQWA 3N58A 3DFZA 4IV0A 4R8RA 5T6BA 4LWZA 3SEAA 3UT0A 3M1LA 1E94E 3A6HA 3OPYI 1XQVA 2BRUA 3O03A 3QKRA 4X97A 1Q0LA 1UF9A 2J3LA 2YWEA 4N7JA 5SYAA 3MWJA 1ORIA 2IHZA 3N3AC 3ZWXA 3VO2A 1K27A 1K5GA 1M7HA 4LHXA 5AJXA 1U5CA 4KKXB 3NM6B 3QQPA 4XSHA 1JSLA 1N6IA 3X1KA 2H5EA 2VZLA 4X45A 5T57A 3ZK7A 1NDHA 3OQJA 1PGQA 3ZWDA 2CLOB 1XEXB 3BMNB 3L7YA 5BNZA 3GVIA 3EQ2A 5K0CA 3JD4A 3UKJA 1KJWA 1XZLA 3ZNOA 4BWFB 1MPXA 1ZM3A 4FHGA 4I5IA 4TYQA 3VX4A 1R8QA 1V3QE 2X15A 3IR5A 3WWOA 1EQUA 4F2WA 2GM9A 4DARA 1HYQA 5LPNA 3CJQA 3PEWA 1CYDA 3WIEA 5JROA 1C3EA 2XXAA 3IGFA 4JS0A 3O2NA 4Z9FA 1JMKC 1C4WA 4CF5A 4ZZ0A 3ZKWB 16PKA 4Q1VA 3RWMB 2I1WA 1N9KA 2FSFA 5LQDA 2GXSA 2H1FA 3N7TA 2PH5A 3BPSA 3UV3A 1M0SA 3VISA 1FFXB 4J16A 4YAWA 3GD5A 1VL0A 5FR2A 3G49A 1ZGCA 4DILA 2JA2A 5C8ZA 1GFZA 1YDHA 3PGKA 1FTWA 2DBZA 3M4XA 1C9YA 4K03A 4LCJA 1G8GA 4XASA 1GZSA 2DCMA 4CG2A 1NG9A 1EFLA 3IQGX 4IHJA 4YGYA 3GP8A 4DFDA 4B34A 2P7IA 3UM9A 5JCPA 4P80A 2BR3A 4QOSA 4XFKA 4DQLA 3V8BA 3KYDB 3S1AB 3TOXA 3FPCA 4BX3A 4AJ4A 2AVNA 1SU4A 4JB8A 1Q6YA 3HVRA 1Y0BA 5FLKA 1XA0A 2PDAA 1KMCA 1JDVA 4MW7A 3GI1A 1A96A 1VHDA 3OPNA 4YMWA 5DGTA 2Y8EA 5AWFC 2CV2A 2I54A 4XFDA 5AW7A 4IQFA 2ZRKA 3DMDA 3BE4A 2XZPA 2Q7OE 4BO8A 1HM5A 1R9MA 3RVSA 4LYHA 3M1YA 2SCUA 1MH9A 3LFUA 4AJIA 5JNVA 1LPBB 4JYZA 4E08A 3DVSX 4CTKA 3H5RA 2JDIA 3QNMA 2GRUA 4US0R 4QJ5A 3RNLA 3TDMA 4EY7A 1UQTA 5BMVB 4YJGB 2M6KA 1KDTA 4OL9A 3JAKA 1V26A 1VYVA 4RVGA 4OHPA 4C7XA 3DYVA 3QW4B 4X1IB 2FH5B 2YWBA 2WU0A 4S1PA 5KTTA 1CUCA 3MYRA 3Q2OA 2OFFA 2PKXA 2QMYA 4DEXA 4UHDA 1SUIA 4PZYA 2WF8A 4J1NA 2ZYRA 4WCDA 5AI0A 2XGMA 3NU1A 1OZGA 1OFUA 2B7LA 2LDBA 3T52A 4C87A 4PZZA 4ETMA 3HI6A 1ZY2A 4YRFA 1XSEA 2ZVQX 2B1GA 2FPLA 3AG6A 2V3CC 2J08A 3DE0X 3A4IA 4QXAA 1PGPA 1JFSA 3CNLA 4DCJA 4LW8A 3L8CA 3B8EA 2P0EA 1DKQA 2XYVA 3ZDZB 4W5OA 5EJ7A 1KK1A 3R1IA 3NC1C 4UAVA 4JQYA 4WZAA 5KS2A 5SZHB 4YAUA 5LP6A 4PU0A 2H4HA 3GJ4A 1PWEA 1QRDA 3T0IA 5REQA 2VYQA 1C1DB 2H7XA 3LF1A 1YKFA 5AKGA 3UIEA 4QICA 4AY6A 2H2IA 1QHFA 1VHQA 2CLCX 2FPGA 3LM8A 1E3EA 1AZSC 1Q0HA 1RS0A 1SEVA 4O2AF 4G85A 4CIDA 3IALA 2EV9A 3E7FA 5K8CA 1B14A 1IAVA 3EGXB 3HL4A 4R1MA 5ALKA 5SY9A 1ZM9A 2B8NA 2V7EA 3NRCA 3QVJA 5C7YA 2JIMA 4J9UE 1FVFA 1X14A 4NRDA 1KNQA 4E22A 1Y4DE 3RSQA 3ZE6A 1BFKA 2ZPAA 3CBGA 1AHNA 1RABA 2KBFA 4HQKA 5FF9A 2G83A 3S2ZA 4PYIA 2BISA 4BLUA 4RL6A 3WAKA 3DLIA 4D1YA 5H1YA 3G0GA 2YV2A 3SHQA 2CCJA 1AQIA 3NWEA 4PLFA 1NN3A 4ZHSA 4P3OA 2NZJA 2Z4RA 1L4BA 4UATA 4Q19A 5IVKA 3AB7A 3R0QA 4M0DA 3BWVA 5ALOA 3BXPA 5B7GA 4M1YA 1YB7A 5DOZA 4IXWA 5DV9A 2B21A 4A10A 5CA0A 4R0NA 1F2TB 4D5GA 2GLUA 1RWQA 3LECA 3L4SO 3LYHA 4JC5A 2OBXA 3AMVA 1ESDA 3TW0A 3F73A 2PCLA 1PS0A 4EI9A 4OI1A 2C0PA 4V3CA 3EFHA 2Q1XA 3CNNA 4NZYA 3COYA 3RG8A 2QLLA 4J9VA 3STVA 1Z15A 3AB8A 4ARCA 2A0XA 3FYDA 3MVEA 4NC9A 4DMUB 4DQVA 3ECAA 3AHGA 5ESRA 3LGSA 1V6CA 3N39C 4RTOA 2H18A 2WHRA 2FR1A 2C4UA 3MTAA 1OC4A 1RPJA 1O8BA 3GJZA 4LJAA 4BGEA 2NP6A 1JWBB 2WT8A 2E4UA 2R5WA 3R09A 4H4CA 4M60A 5F73A 4D9CA 1ODIA 4TWBA 4BXOB 1NW5A 1RR6A 1Y6ZA 4J7AA 4XM2A 3S68A 1YZUA 3CJTA 1DU4A 1R0BA 1ULAA 4X95A 3RTGA 2CJYA 2EATA 3WJ1A 2YR0A 4C6TA 4PRLA 3N86A 4IGFA 1T5LA 1Y82A 4BCDA 2AR0A 5CLIA 2GASA 3NDRA 3W2EA 4O4JF 4QBFA 5HUQA 4G5QA 2DLDA 2OLEA 2JRLA 2BLLA 1GADO 1CP3A 1YK1A 2IQIA 1NLUA 2ETXA 2IZOA 1IOLA 2OB2A 2OORC 3FWZA 3VTZA 5HX7A 5B1YA 3MQ4A 1MORA 1ID8A 3K7EA 3OU6A 3HH8A 5ERGB 3F98A 1T9ZA 5J4VA 1VRCA 2GZMA 2YNMC 1T9GS 3R7DA 4O8CA 1I4TD 3G0CA 1BCSA 1WXFA 5ED4A 1P6XA 3LZCA 4MIOA 1LWNA 2BUBA 2XTZA 2YINC 1SWVA 3CTMA 2P4QA 3ND7A 4FNGA 1QIGA 4N49A 3IUSA 2RGWA 2BRUC 3L1HA 2ZUEA 3OE4A 2CHUA 3AIKA 3FFAA 2VZ8A 1GU1A 1LF0A 1OXBB 2XQIA 3H84A 5FCDA 4Z8XA 3AVVA 1PR1A 4LBYA 4ZI7B 2PXAA 2ACWA 4KFTA 5MN5A 4Y0AA 2Y77A 4TL6A 1ZX1A 1IEQA 4RZQA 1PG2A 1SQGA 3K4HA 2BGMA 4H31A 1RYEA 2W2LA 1Y3FE 4LCEA 4E5KA 5BYKA 1IVSA 3ZJTA 3OEHD 1OWPA 2CLHB 1UM8A 2W6MA 1IN4A 1IB6A 4G2NA 2FETA 4L4ZA 4URHA 3VHXA 1ZEJA 2CLDX 1LDGA 3FGZA 3L41A 4G0YA 4HOYA 1ADFA 1RIFA 1TO1E 3KSUA 1J0EA 1QDEA 3MJTA 3NKFA 2ZT6A 1T2AA 5A6SA 4AT1A 4I2NA 3MQFA 4Q4CA 4AJKA 1MNAA 1FVOA 4I9UA 1JHDA 4J16C 3A1VA 1SVSA 2XOEA 3HSSA 4HDRA 4M7PA 1HMYA 3GJSA 4K6FA 4MJ7A 3PXXA 3PEYA 1Q7BA 2FHSA 1Z5PA 2V7QD 4L9RA 4WDRA 5EJAA 3E7PA 5BN4B 1XTVA 1G17A 2BTOA 4I36A 4L4XA 5JMPA 3WZ2A 5ARDA 4JUDX 1EG2A 1UAYA 4Z1MD 3IUYA 3O7WA 3P9QA 3RANA 2M2IA 3HXMA 3EH1A 1RADA 2ISQA 1WCXA 3D9QX 3NGXA 4TSFA 1AGXA 5AJUA 3VKUA 4CIAA 3L0BA 2AUTA 3HUUA 3Q87B 4GFDA 1HR0B 4P4UA 4YRAA 4JJAA 2FK7A 2EIHA 4RJKA 1S96A 1FL9A 2OHVA 2V6BA 3H6GA 4PRZA 4ZK6A 4TKLA 3LVBA 1I2AA 2CWDA 4AP6A 3V7UA 3ENQA 5I47A 2F3PA 3SX4A 4M8KA 4RZSA 4URXR 2IEYA 2G70A 4IGAA 5DGIA 3DH0A 5F9FA 1T1SA 5IVHA 4KV7A 1E2EA 3PBKA 2OQ2A 3LGAA 3B9RA 2P5SA 4YRBA 1TUBB 2GYVA 2H5IA 4WN9A 3SR0A 5EAIA 2QLMA 4Q34A 1T9BA 1GPUA 1YACA 2W83A 2Q4DA 2R62A 5HRUA 1T5BA 1U6JA 4MVCA 5C5IA 1N2ZA 4YGXB 5DSTA 5B1DA 1DJOA 4BGDA 3N8KA 4PSCA 1C30A 1QH9A 4R68A 2F59A 5DX8A 1DAFA 3GMTA 4B74A 3BTSA 2ISSD 4G65A 4B6SA 1YR1A 2P77A 2Z9CA 5IDWA 1J2RA 3URMA 1QYWA 3EMDA 3WLJA 3VSDA 1L7PA 3E58A 4RXUA 5F7JA 3AG5A 3DWGA 4BEJA 4MAAA 5LD2C 2J3JA 3IAHA 4R83A 4DR3B 1NMEA 4YDSA 4ANFA 3RJZA 1AT1A 1I7SB 3D2CA 1ISGA 5IK2A 1XGKA 4JVSB 5H59A 1PJTA 1DCFA 3L1UA 3RC3A 4MB0A 3NYQA 2IP1A 3EXEA 5BNWA 1G19A 5EZ5A 3MERA 5LP6C 1SKYB 4WZ6A 2C9YA 2P30A 3A9RA 3KT0A 4HH0A 1RMTA 4EFNA 1E9SA 1TK2A 1HMPA 2Q5QA 4I6EA 5AM2A 5C52B 1XXHB 5A5EA 2AOTA 3AR2A 3SZ3A 1XMQB 4TT3D 4DRXA 1H2RS 3RVLA 2JLQA 3B36A 4KN9S 2KMLA 3QF4B 2A94A 2RG1A 3WJAA 4IZIA 4K3VA 4WOCA 3X2SA 2CHEA 5KOHA 3P20A 4HAYA 3AJAA 4JNCA 3SS9X 3L8DA 3GFPA 3ML1A 2VPZA 1W35A 3O93A 4JGBA 4J4BA 4JBLA 5CMLA 5GADl 1HA3A 1M67A 3VDMA 4DLYA 2QUIA 4PC2A 1MO2A 2YIMA 2C95A 4W5TA 3WDSA 3HCOA 3OZIA 4KN6A 3H2IA 1DX6A 2YS6A 1Q1AA 3N8HA 3FLBA 2E21A 2YKGA 1FDVA 2XXBA 1DCTA 3GF4A 4HQRA 3L43A 2I71A 3PDJA 3X1WA 5K0GA 3TJZA 3ITNA 3JZAA 4FB4A 3WXMA 2VT6A 1GAQA 3QELA 5D6OA 5T4BA 4F71A 3IIEA 1MOPA 1PJ2A 1Z4KA 5TGTA 4L8FA 1O8CA 3IMCA 1YAJA 2PU5A 1USWA 5G3YA 1LRLA 4FDUA 4H7KA 4PRKA 1EZ4A 2O0KA 5EP2A 2YOGA 3ZI4A 2VK8A 5FHQA 1TF7A 3M4YA 3DYBA 2PIDA 1L5FA 1Z0KA 3JQAD 3SQNA 1EWRA 4PBRA 3LE8A 5BQXA 4DTIA 1ZSNA 3WL8A 2EWMA 4OHMA 4ND1A 2ZEJA 1KDVA 3OAAD 1TL7C 3FTDA 2VRBA 3PFHA 5EMLA 2MSDB 4BQQA 4CM7A 3ROXA 1LI4A 4B8WA 4UPDA 2JFHA 5CDFA 4AU1A 3IPYA 1IWOA 4LIPD 4B6FA 2B98A 4Y1GA 5CEFA 3WL5A 2X22A 3RDPA 4HGZA 2DOKA 5A4IS 1X86B 2YTZA 4BKQA 3H11A 1JRLA 1YR9A 5FQNA 3A6ZA 2BFEB 2PVSA 5EXTA 4HNTA 2X5OA 1QO0A 4KZPA 2C7RA 1P1FA 1CW2B 3ZWBA 1ODJA 4Q93A 2GZSA 2TMKA 1U9YA 4L4YA 4C43A 3T34A 1A5ZA 4JLAA 2GN8A 2BGGA 2J45A 1V9CA 2D59A 5I8PA 2ODBA 4G4JA 3WSTA 1M72A 3UH1A 5F76A 1H8HA 4XDZA 4CLEA 4EFDA 4YRSA 1EWTA 1JI0A 3HJCA 3NW9A 3OM9A 4PZ9A 1KS9A 5AI4A 4EELA 1VL5A 1G8SA 2MT9A 4B3CA 3JQAB 3CGWA 4EG4A 3MWEB 1W8IA 4HMQA 1W2GA 2Z6AA 2ORWA 2Q5JA 4MQFA 4HT3B 3I0NA 2Z9DA 3UWPA 2YNMD 4PLWA 1H5QA 2PRZA 3MWDA 2M9MA 4D0GA 3IBTA 1D7OA 1AXGA 1QE5A 1XVVA 2K4MA 3HADA 3VTAA 4DGQA 4NCHA 4AG6A 2PMWB 1M2HA 3DFKA 1A88A 1RI4A 4TM7A 4B31A 4IKOA 5HTOA 1YMVA 1OFUX 2BTQB 2OESA 3TFOA 1II9A 5I9IA 4KQXA 2EWVA 1VA4A 4DC9A 1QO7A 4GS5A 1HF3A 3R3YA 2PKYX 3RS4A 3GPIA 1CHNA 4LQCA 1IVNA 5D01A 5THKA 3C87A 4G0XA 4BMPB 2HMYB 4CQLA 1N9GB 2HCRA 3V8VA 4GDFA 1JKMA 4K1XA 4UTPA 5A03A 3OO0A 3UV7A 1E9DA 4LK3A 5K3CA 2P65A 3V6LA 1EFUA 1HWYA 4XGQA 4DRZA 4FBMA 1JIIA 4WESB 2W6QA 5CTAA 2UZ0A 1DINA 2E18A 2RHJA 2NMVA 3GRKA 4D46A 2YYSA 2FVYA 2OLKA 3H1FA 1QP0A 2JEZA 4G81A 5KZMB 3ND9A 5HIKA 2CNDA 3DMGA 4MWCA 4P3YA 4KR6A 4FX5A 3DUFB 1Y37A 4UC0A 4C22A 3E5MA 2DPXA 2IYZA 5HJ5A 1FDRA 1ZC3A 4FE7A 3KYJB 2OGZA 2RHLA 3QU7A 1GGVA 1HUQA 4H1VA 4D4IA 1WB4A 2QJOA 4DMGA 5CVCA 4RY2A 1H6DA 5HFNA 3U81A 1XRJA 2VHTA 1LBTA 4MARA 3C7CB 1UH5A 4L4UA 4QQFA 1IXSB 5HJ2A 1WUJS 3QFRA 4HUJA 4OM7A 4LWPA 3AHJA 3BD6A 3TL3A 2Z09A 4D8XA 4R84A 4UULA 2C42A 2J7PA 2XKJE 1YNOA 2F1JA 2X1HA 1M3SA 3KBBA 6ADHA 2ONZA 1IHDA 3C41J 3SEQA 1MG5A 2F9FA 2ZATA 3D6TB 4FKBA 5BSVA 3P94A 4M86A 2W71A 4HDKB 2MMCA 1VJ0A 1ES9A 4LQDA 5A3RA 4XRGA 3A2LA 2FN3A 3ESZA 1AO0A 3EAGA 2J4CA 5L3QA 3KOOA 4ZODA 4YAKA 3MJFA 5CDUA 1NKTA 3A2NA 4IGIA 3C5CA 2C5EA 1RCFA 5JMOA 5LXTB 3TOCA 2NIPA 3LUFA 5AVZA 2V7BA 1R8YA 2FOLA 1XNJA 4LY9A 1HY3A 2P6UA 1B23P 1DCKA 2JHAA 1WZCA 3A14A 2ZITA 4BHTA 4K0KB 1WQ3A 1PR6A 1Q0RA 1ISHA 1L4KA 1FW8A 5AK5A 3ZXXA 4JQZA 2XQVA 2WB2A 2HW8A 3DV9A 3ETEA 2BMVA 2Z2YA 1ISPA 2J9YB 3HDVA 3K5WA 4G97A 1JLLA 2FEKA 5CBPB 1JB9A 2RK4A 3IVXA 1DAGA 1QHHA 1E3TA 3HA3A 4GHWA 1XI2A 4XGIA 3SQOA 5IULC 2JAXA 2O2DA 3ZJ5A 3FNGA 1BROA 5JYCA 4KOAA 4XUEA 1ODCA 2PX0A 3MJCA 3DLPX 4B7CA 2GWHA 4U9UA 4EG8A 3HN2A 3AKCA 3OZWA 3A11A 1PHPA 2KQUA 3NORA 3SYTA 3TNDA 2Q9AA 4GPD1 4BZWA 3BQMB 4W5JA 1MXHA 4AF6A 1JYFA 1R50A 1W5FA 1XA4A 3SXUB 5KNBD 2FMXA 4DNQA 3LO8A 3AVWA 2HNBA 3FF1A 5D3KA 2IIQA 2W2VA 3ETNA 4RH0A 3KUKA 4OHBA 5IYZA 3VAYA 2OYCA 5JNUA 2BGUA 2JCXA 5F3WB 1ZESA 4Y2UA 3KJIA 4BFWA 2BGJA 4NENA 2NO9A 2VUHB 3VKFA 4HDAA 2Q8PA 3IBFA 5EIXA 1R0XA 2GXQA 1ZUIA 1N0HA 1G0OA 3EVNA 4XWKA 1HL3A 2FWAA 3QENA 4NOKA 5BN1A 2JAWA 3RABA 3O21A 4AFNA 3ZZ1A 4P54A 3OEWA 4EW3A 3HXOA 1K2WA 5GVRA 2CD7A 3IAXA 3CT4A 3R5XA 1X1BA 1R6BX 2IEAA 4U6QA 5L4NA 4YRGA 5LD2B 3TG8A 3LP5A 1P74A 1TVKA 3OPMA 2GDZA 1D3AA 4Q18A 4E2XA 2PWBA 5HYVA 5JC8A 5KWIA 2Z2JA 2Q5LA 3RAJA 3OT1B 2J3MA 3OZCA 3G8DA 1I24A 3G2JA 4MEAA 4R8LA 4XH9B 1V48A 5IJAA 3V00A 4LE0A 2PX5A 2VP2A 1ZIOA 4JKIA 1TMKA 3TI7A 3V48A 5DH9A 2PUAA 2ZSJA 3SCZA 3D0RA 1MGPA 3A1EA 3AHEA 4M21A 1ECJA 1LSJA 4MUHA 5REQB 3UB4A 3MMXA 4B09A 1PFGA 1NW7A 4FGJA 1I51A 3X1MA 4Y9UA 2FPGB 1PZXA 2DE0X 1V11A 4HKTA 2Q2QA 2Q8NA 5IH3A 4CI9A 4K6HA 2VTDA 1I6KA 5J2TA 4GVXA 2BCJQ 2HK8A 4LYJA 4M7RA 2FQ1A 3BEDA 2EP5A 1KIMA 4IIGA 3L06A 1RAFA 4YP9A 1BVUA 2GTIA 3A10A 3AI7A 2V7VA 1Z4PX 2F3SA 1E6MA 2OGWA 4Q4AA 2SKEA 1A9YA 3AZOA 3OX2A 4RHCA 3D4PA 4LG1A 2BGRA 4MAMA 1CIPA 4ZEXA 4IDBA 3VA7A 1D6SA 1DIRA 4JI8B 2MCFA 1Y6FA 1ESMA 3ZV7A 3T3NA 2B1QA 4YFVA 3PGJA 1U7ZA 1NVGA 1LX7A 2R7LA 4PYQA 5FXMA 4UARA 1DQSA 5HVNA 4JELA 1O5OA 5IC6A 1HH4A 2OKGA 4W9NA 1J8QA 3N53A 4DMHA 3P0FA 1SCNE 2ATVA 4DPLA 5LKRA 1SOVA 3RJ5A 2JGMA 3MK31 2GHTA 2EQBA 2R8XA 2RHDA 2ZLBA 3WMWA 3S2YA 2OZPA 1OTYA 3GVPA 5BWCA 2PMFA 4G5YA 3NIFB 4ND6A 1BS2A 4G1CA 1WQ1R 3WGUA 4OFZA 4DLSA 1PR9A 3G5AA 3JSXA 3DW1X 4B17A 4DF3A 2Z5LA 3BTOA 1E3WA 3L7DA 4OBEA 2JLAA 1G2IA 2DY1A 2VJMA 4ZQBA 2YYAA 9LDBA 4NXMB 4KH1A 4N7RA 3KAQA 3BG5A 4UCWA 2RI0A 4YJ3A 1XD2B 4FI3F 3CUYA 4Q7EA 1FXWA 2Q0HA 3U7IA 4KCGA 3WC4A 2V4MA 1Z06A 2ID9A 4MQMA 1B2LA 5K8TA 3WYBA 1T4GA 3L0CA 2QR5A 3KJEA 3OY2A 3KUDA 2AC4A 1K08A 1YJ8A 1ZH2A 2I2DA 3BSFA 1BC5A 1XP8A 2NP7A 3AEQA 2HOQA 1SVIA 4YBZA 3NHMA 4P5EA 3GGSA 3K72B 3L18A 5TQ0A 3ZI0A 2N75A 2PX4A 1P17A 3TQFA 3KVNA 2J7KA 1TTHA 2CB9A 4BU0A 4QXOA 2I3ZA 1Z2NX 5AXBA 1E3QA 4MVJD 1E66A 3A6KA 5BOVA 4UTOA 1JVBA 4C07A 1E0KA 5CH3A 4JBNA 1UDXA 3PI7A 4NS4A 1QMPA 1KOJA 4L57A 2QUJA 3PKJA 3ZHCA 2KW5A 2W2XA 4LV6A 5CX1A 2HHHB 4YMTA 3IJ5A 4MWEA 4CE6A 4CMAA 5HQJA 1H4QA 2FP4A 3CV3A 1BCSB 3TKAA 2ZT8A 4ZZ1A 4PG7A 3HKCA 5JWRA 2UXCB 5T8KA 4NDZA 4EMBA 2O8FB 3D2LA 1R4NB 1H2EA 4K2AA 4HFJA 1KMHA 4X00A 2GCOB 3EIHA 2H1SA 3KOZA 3N74A 4EGFA 1LI5A 1V41E 1OROA 2AD5A 3TEFA 3CEPB 1OLUA 1IUNA 2WB4A 4XM1A 3IQWA 4R01A 5SY6A 2WKRA 2ZAOA 2G4CA 1V8OA 2WSSA 1LSSA 1C8BA 3Q3VA 1FUUA 4GSYA 5AXCA 2H0RA 5T67A 4NULA 4QZVA 3CLKA 1UAAA 4O0LA 1L4YA 3U0BA 4CKBA 1Q1EA 4F21A 4YRZA 4IFBA 1G21B 3TM5A 1IJFA 4P34A 1MQAA 4KLCA 4ZCQA 1O96A 1ODFA 3H99A 2J0UB 1P2DA 4L85A 2RKWA 5A6SB 5BMVF 1T8PA 2H57A 3QNWA 4FGWA 1OFVA 4NXNB 2VHCA 3A27A 1JR3D 1XHEA 4CG0A 5BP7A 2RGGA 2CNWA 1HTWA 1X1QA 2PL3A 1P4RA 4GZ5A 4OJNA 5PNTA 4DDKA 4KREA 1LI7A 1Z13A 2ESRA 4IV8A 4ZU1X 3PX7A 3IPLA 1K97A 2CDNA 3ASZA 1QG2A 4LJYA 5FV7A 4OQEA 2BGTA 4GM0A 1FTNA 2Q2OA 5EL0A 3PXGA 5C53B 4MB2A 3HVUA 4RA6A 1ILWA 3WB0A 4A0SA 1IN6A 2K87A 3HKEB 5JXWA 3D7KA 4PEVA 4WK6A 1IYZA 4JI3B 4BAGA 5ARBA 2ETVA 2UVDA 4RKRA 4K2HA 2CGEA 1NMXA 3JATA 1Y98A 4HZUB 2IOHA 1UOEA 3GRZA 2E4VA 3GDWA 3OZAA 2GJKA 3DE2X 1YZHA 3DEKA 1RRVA 1TT5A 3BUSA 3G0DA 1JZQA 1W5AA 1SXHA 2SNIE 3E9RA 4B9AA 3R4CA 3VPSA 1A9QA 2XGOA 3IX7A 4HB0A 3OZ7A 5DBEX 3TRHA 1NC1A 4E2ZA 1CUZA 2FPOA 4F3NA 1FU4A 1UJ5A 4OHKA 4EW6A 4CUJA 4OP2A 1KZHA 1PNOA 1U3TA 2R6AA 4IICA 3ETGA 4IS3A 3CEHA 2IDMA 4DZRA 2KSQA 3WRWA 5DBOA 2SECE 4HEQA 4TN1A 2Q27A 1TCVA 2BEJA 3CXUA 3WGTA 4AJ9A 2H4XA 3L6EA 1QLJA 1K5PA 3QF7A 3SDZA 1G18A 1HURA 1PP4A 1R4ZA 2H48A 1ORTA 2ZWMA 3H87A 3U6BA 1U3GA 3PKZA 1II8B 1VFNA 1QTQA 1G2QA 4PYLA 4CL0A 2RFLA 4Y30A 2ZIGA 4A9AA 1R9JA 4PYRA 4EFMA 4R40A 1QCDA 5F77A 3AC0A 4RQAA 3KZCA 4E1BA 3BF8A 5CEEA 2LD4A 2PJZA 3TJRA 3VJKA 2YOFA 4JD5A 5IT0A 2CFOA 4IRMA 2HSZA 3P0EA 4A2PA 5CB4A 3IQEA 4BFUA 1UJCA 2Q3CA 2ZRNA 3D3WA 4MA5A 3C6KA 5FUXA 3T4PA 3NRJA 5JEDA 5TRTA 3QTLA 4AZ0B 3OKFA 3PQ6A 3CLVA 2OXFA 4HL6A 5INTA 2FFBA 2GPBA 3AEYA 4GX2A 1JXOA 4GO1A 1CV2A 2XWJI 4OHXA 4EABA 3WMFA 4KLRA 4PSAA 3GLHA 6PFKA 5I01A 1BWSA 3R0JA 3BL6A 3GA0A 3BIOA 1LV8A 5KOHB 2XJ4A 3G8BA 3M7IA 5K45A 3EPRA 1BH6A 2AGVA 1VPTA 2QSJA 2NXWA 4J1TA 4JSYA 5KYVA 4LBWA 5MHTA 3R5FA 1J2UA 4CT4B 2ZIWB 5LC1A 1ZL2A 5KMGB 4M9RA 2EFHB 3QVUA 4FZJA 1PQYA 2UVQA 1ZR2A 2IV2X 4AG5A 2XMSA 2GUWA 4NARA 2CJWA 1E77A 1ZD3A 1P3DA 3FFBA 4OA8A 1P80A 4X44A 1YB2A 3BM5A 2ZZNA 1US8A 3W2FA 4JN6B 3PNLA 4WNAB 1XLVA 1M8KA 2DWUA 3C7AA 3KQQA 1PVOA 9LDTA 1X80B 3ETCA 4NDNE 2GA9A 4BIIA 3WGZA 2AFIB 4L4RA 3FGOA 4W9NC 4XQEA 4OQPA 1MJGA 3QBVA 4EG3A 2GZDA 4IIYA 1K8QA 1LW6E 1NWCA 3O4IA 5T3YA 3CKLA 3W90A 3TGPA 2I80A 1WM1A 4F5YA 2PJUA 4M1KA 3RRZA 3CC8A 2ZJ4A 5F2EA 1T25A 3ET5A 5JSQA 5FI0B 5H7XA 4V1CB 3V7FA 2W2TA 3RSHA 3L4KA 3DTYA 5E1OA 2QUZA 1J33A 2QZ9A 3FNIA 4B3GA 4I14A 5TQ2A 2C59A 5K8LA 1RAAA 2Q5FA 2QLFA 5ADWA 4M89A 2VYFA 3NCHA 5TMBA 1HFWA 5HJEA 1JAIA 5B64A 2CBGA 2N0SA 3RADC 2H2GA 3X1XA 5AVQA 2OFXA 1YQDA 3RVQA 3B89A 4IPTA 2I4NA 4MICA 1RM0A 3F97A 2FKNA 4CEHB 2J3HA 1J1UA 4H0FA 3TRDA 1PYGA 2RHMA 3T3MB 3C24A 3W1EA 4FYKA 2R87A 3GUZA 3W3ZB 1BO6A 1RKBA 4TXLA 5JAIA 2D13A 3ZZMA 1Q15A 2HRRA 3B9PA 4Q9HA 1DT5A 1QG6A 4MHTA 4LKRA 2NGRA 2NM0A 3H0EA 4QG7A 4E88A 3QXCA 1A7JA 1M6NA 1E7RA 1JZTA 1KKMA 2A5YB 2DBVO 5CH8A 4X84A 1USKA 1Z0AA 2PIAA 1KPGA 1YHZA 4I81A 1M8FA 5BSWA 3K6SA 3RC8A 1Q57A 4DKJA 5DI3B 3EF1A 1ULUA 4WE3A 3DOFA 3CUSA 4ALKA 1CEEA 1NA5A 2OBLA 1H2YA 4HSEA 3ZHUA 2UAGA 1TM7E 2OGUA 4DCUA 2VA9A 4KO8A 2XUZA 5CFPA 4G67A 1CUSA 4X20B 2Q5EA 4PCVA 1V5FA 4ATNA 4BJ6A 5I7UA 2FX2A 3S1SA 2G71A 2CFTA 1I5OA 4LDNA 4EUEA 4BTLA 4S3MA 2YICA 2RE8A 3BL8A 1K7EB 2K2WA 2JGDB 2XECA 4W5WA 4F6LA 4E03A 3MB8A 4JMPA 3QWFA 3IBGA 4IJUA 4GOND 4RCZA 1VKJA 1DOAA 2JJ1A 1YZNA 2PVPA 3ESRA 3NHBA 2Y27A 4TXMA 5CGQB 4YT8A 3DAOA 3LBIA 5CP8A 1TCAA 4G9EA 1FNDA 1MD9A 2YVAA 3KPUA 4YMIA 2QZJA 4E5DA 2XGJA 2HGZA 3NAGA 2BHNA 2C98A 1ND5A 3D6FA 5FOSA 4JZKA 2OBBA 4R2MA 2JIZD 4EY5A 5KX5B 2WIAA 4MV6A 4RDCA 3C45A 3HDQA 4BLWA 2O0LA 3DM9B 3CGGA 3GLKA 1UEXC 4I0WB 4QWWA 4WBNB 4U2EA 2GPYA 2WKWA 5FBLB 3ONNA 2Y0EA 5EHXA 2OGSA 1VMIA 1GQFA 1K5DA 3IMKA 2HA7A 1NTOA 4RE6A 5A4DA 1TVEA 1ISIA 1EGHA 4J0FA 4M46A 5AW4A 2E5FA 1DMSA 3Q1LA 1NJ5A 3F6EX 4N6OA 1HLGA 1JFRA 3H19A 4OJTA 3U48A 4M9UA 4BNXA 2CT8A 1QRSA 3GFRA 1HPLA 2NPIA 4AUEA 1YS9A 1PDOA 1VE7A 2FE4A 3DD5A 2LBPA 3OPYB 4LGMA 5F9MA 4EGJA 4RM3A 1JYEA 2WU1A 3MRVA 1BCRA 4BNIA 1AIPA 4G23A 4UXJA 1CR6A 3FMVA 1U8XX 3HNPA 4LQLA 4BMZA 1GSOA 1DKNA 1TQ8A 1ZD9A 3QZUA 4EUKA 2B35A 1DX9A 2SHKA 1SG9A 5CCDA 4Q39A 2X1VA 4HH3C 1B3BA 3RIGA 4ZTUB 1IPHA 3P2OA 5T4HA 1AGYA 1J7JA 2Z5VA 2C8VA 4MHOA 2Y1LA 1M9NA 3CE6A 3PVZA 3RAGA 3M70A 4BCBA 1RLMA 4R9SA 4OY3A 3K8YA 1QONA 4AWAA 2DPLA 2O57A 2HV9A 3Q7EA 1B73A 2JA1A 4GBGA 1SVLA 1YBFA 4U2FA 1XU4A 5GP1A 4MS1B 5AKJA 1K7XB 2BP7A 2A9KA 4Q5IA 2OQIA 4TKVA 2XA1A 3UJ6A 5IJWA 3R9XB 1W4AA 4PLGA 1EBFA 4JWKA 4AYXA 3AM1A 3VJMA 1NVAA 2G5GX 2HSEA 4TQGA 4D3YA 4QD3A 4DCGA 2HBZA 5IKPA 1TJYA 1VL2A 3TN7A 1NOJA 1HKHA 3KUXA 3AGQA 2GZ3A 4CT0A 3ZNNA 4QYIB 4WOPA 3VHLB 5ALGA 1S2GA 4LPKA 1JDJA 3JVUA 3QWBA 1EFVA 5DSZA 2UZ1A 3ZVKA 1Q7RA 1KZ1A 2IDJA 2H2DA 3FJ1A 1WV0A 4PX5A 3ZW9A 1GT6A 4X1OA 2G28A 2DJ5A 4J90A 2ZYWX 1E4VA 1MW9X 2Y1CA 4MEBA 3HRKA 2A9VA 1KEUA 3JQBA 4QOIA 4F04A 2H1HA 3IB6A 3GIWA 3L9WA 4U0KA 2B0JA 4QBGB 2FXVA 1BKSB 1PZMA 5CPBA 2QX7A 4JMLA 4H08A 4KR3A 4J3NA 1WLSA 1DQPA 2NU6A 1T5SA 2JH9A 3I05A 3IUQA 5KU1A 3DC2A 1JQKA 3QX7A 5JAOA 1I9GA 3MG9A 3PTLA 3FNEA 4OH7A 3JV7A 5DGHA 3GLFE 2CDRA 3D31A 1FMLA 2J5KA 1EVZA 1VLVA 4I6JA 4NENB 9MHTA 1X7YA 3WB1A 2R4TA 3ANNA 5K6TA 3EUFA 4QFDA 2HL6A 2IK8A 3EVFA 3RV3A 3SXJA 4J1TC 4XJSA 1I80A 1T2NA 2J33A 5CFOA 4EMTA 2YH2A 3GWZA 5I8WA 5DWVA 1X7XA 1X39A 1J8FA 5JSHA 3I3OA 1ULTA 4RTJA 1E4OA 4C0BA 1VJ1A 2P75A 1XQ9A 1DO0A 3KEFA 3KKZA 4OUDB 2F8SA 1Q6ZA 2JCVA 2OGTA 2VP6A 3MLAA 1GPMA 1E3DA 2EXXA 3Q5EA 4LDAA 4B9EA 1VGRA 4JJ8A 2Q1UA 3DE1X 3UMSA 4IFIA 2ZJ6A 4P4TA 2HQRA 2RC6A 1IVYA 3DBLA 5GIOE 1K7FB 1BYUA 4MLPA 5HJ7A 4Q3EA 2R2GA 1KHTA 2OCGA 1OZFA 3FTFA 2VA8A 4HC4A 1YCGA 4M1EA 4Y3UA 4OL0A 5FPHA 3OE1A 5I7FA 2YHBA 4C0HA 4EWLA 5JUWA 3RV4A 4W1QA 4OMCA 1I3NA 2Q99A 1DJPA 2CXPA 1K6EA 3D8HA 1SK8A 3OEYA 4YMUA 3OP1A 1HDGO 1U2EA 1P7YA 2CMFA 3P1JA 1JQJC 3GUVA 4J3FA 4JVOA 3TLMA 2FF7A 1ZA1A 2Y9PB 2IUSA 2IOYA 2QWXA 3C7TA 1FSZA 3K2IA 4RYLA 4UD6A 4UMEA 2IYTA 3UWDA 3VR3A 1O58A 4XJXA 4BDTA 2WUEA 4QT0A 4XR9A 4COOA 1VZ2A 4XIIA 4DCSA 3KHKA 3NI2A 5KO2A 3LFTA 5DHAA 4A82A 4RFVA 1AE1A 4EA9A 4TV9F 2ZVDA 1QZUA 1Z6XA 2AJBA 2GFQA 2NVUA 3A9UA 3O1LA 1Y9ZA 4GIBA 3A6LA 5TV2A 5KSOA 2G5PA 2ZUCA 1AB6A 4RF4A 1RPZA 1NULA 3ZH9B 5FWYA 4NYMR 4FT4A 1AK9A 2GEUA 4ZREA 5A9SB 1SC1A 2QT1A 3AUUA 3L3BA 5SZJA 2D1FA 1AQNA 4II7A 1QG0A 2AMFA 3NDIA 1UC5B 4S05A 2BF7A 3KLPX 2QGFA 4GBED 5C8YF 4D82A 4D9MA 3TD6A 5B30A 3VPXA 3ESBA 5B1SA 5FTJA 3SHVA 5AW3A 5BYJA 1RI2A 3WBFA 4J8PA 1ZI9A 1PJBA 3NWJA 4KFUA 1X7WB 3VU9B 1FJ2A 2NSLA 4MUJA 5B1EA 5FUVA 4PN3A 1XU9A 3F9CA 4P58A 2XT0A 3I9NA 4YJ3B 1XLWA 1Z8HA 1CX9B 3O7MA 3W3AA 4GW3A 4INZA 4HGRA 2E89A 4URWR 5EKTA 5JT1A 4X91A 5AKXA 3LOQA 5CH5A 1E0DA 3K5PA 1WDWB 2AOUA 1OPRA 2PGAA 3AFOA 3HFJA 4RWEA 3L8YA 5LDDC 1BKYA 1WCV1 5LL6P 3U9SA 1AS3A 1ZM2A 4OYLA 1RYHA 4GX0A 4TZ6A 1MRZA 2X41A 3IRVA 5TQ0B 1BXRB 3SYRA 2VSQA 4DA8A 3RROA 5F23A 1KAMA 4M0FA 4NZPA 2QE6A 3RASA 1Z7BA 1F8FA 3M6FA 1KPIA 4ISBA 5DNCA 3VJLA 1F14A 4YAGA 1DIAA 3B1YA 1Z82A 2B2XA 2ORED 1C0IA 2ZUSA 4FFWA 4NV3A 4OBXA 2AG8A 5A02A 2G6TA 2LUOA 3L5OA 3AEUB 1WBBA 4OQXA 5LOVA 4NBWA 3T6KA 4FIZA 5FUQA 2FP4B 3GDGA 1RM5A 2WQZA 4C3VA 1Y4UA 4IHJF 5LIRA 3UATA 2HSDA 4HGPA 4ID9A 4RKWA 4UNNA 1Y48E 4NP6A 5JC1A 2WTAA 2J31A 2ZYSA 3EVGA 3GNLA 3H05A 4O63O 3ZGNA 2JAPA 2AOXA 2ZUDA 3H18A 5I7WA 2QUHA 2ZS9A 3TPFA 3DFFA 2XNDD 4TMWA 2BH9A 4NZOA 3HCDA 1L5HA 2QVBA 4H15A 3V5NA 3HK2A 3DS8A 1YT5A 1SHKA 2NTYC 1U1GA 2YUTA 2Z2XA 2FPWA 3ED5A 4UEKA 4JQCA 5AK0A 2LCQA 4D43A 4YPVA 5HM8A 2OOKA 2ABWA 4IO1A 2F1KA 4ZYTA 4DIMA 2YZ2A 2NNLD 4ENPA 1GPYA 1RI1A 1C2YA 1H4TA 3R77A 3TGWA 4C7MA 4Z7JA 2QRQA 5KHLB 1FXSA 4MKZA 1X38A 4DNFA 4UJ3A 2WD7A 1O77A 2CYAA 2C4MA 1A9PA 1FTQA 2VSNA 4YQEA 3E15A 1P91A 4HNGA 1O96B 2OUKA 3IPXA 2ZT5A 1W44A 3TTWA 5EJEA 4D9KA 1KTIA 2YRFA 1UKVY 1USGA 1XUOA 3S8YA 1I01A 2XDQA 1JU9A 3QUAA 1AV7A 1JU3A 4HO1X 1TJ5A 4IINA 5D1HA 3RSFA 4C0KA 5A4JA 3GT3A 2A6PA 1KZ6A 1EGQA 2O2EA 1E9EA 3WQQA 4L16A 4X64B 1WKCA 2OHJA 3AERB 3IKTA 3JZFA 4A6EA 3DM5A 1G5FA 3RFUA 3B20A 1ZA2A 4IVRA 2ZB8A 3GCZA 3R5SA 4RA6B 3ZEAA 3W9UA 1GSIA 4B6OA 1Q7GA 4C78A 1LX6A 3JAWA 3TLCA 2JCBA 2X4DA 3CLRC 3FF4A 5FTLA 4KQCA 1V6SA 2IU6A 5J1TB 2FRDA 3SZUA 3L4JA 4C7JA 1E69A 4REOA 1Y6QA 2ZRCA 2QYOA 2FZWA 1NDUA 1UEIA 3K32A 1JHPA 2BCGY 3DJFA 2YBDA 3PXDA 4HH1A 3JQBC 5L3SB 1ZJYA 4UOEA 3L7AA 3RU9A 3AW9A 4QDZA 3ZQJA 3CLTD 5BPFA 5LP6F 4TYWA 2R6JA 4I55A 4Q48A 3JD1A 2V8OA 3ITEA 4J0IA 3IOYA 4WY5A 1WCIA 2R7AA 2ZRLA 3AR7A 3FCXA 1F0YA 1NIPA 3P9CA 3R5TA 1WPGA 4GPAA 4J3JA 4KHZA 4U0JA 1KJJA 4HXGA 3R7FA 1N0UA 4KDCA 3UJ7A 1FJGB 4HADA 4UOQA 1Z73A 2WBLC 4KXVA 1RMYA 3CX4A 1K4MA 1MV8A 3PUKA 2VSFA 5AUQA 4DG5A 2YN2A 3IH5A 5IM4A 4B35A 2GN9A 4XCXA 1HX7A 1W19A 3CN9A 2H8KA 1N2EA 2B7BA 2P3QA 1ENPA 2XMQA 3PYXA 4B3RB 1QFYA 3HXLA 1YQEA 1A76A 1QWSA 3M83A 1E1MA 2CNLA 2FB9A 1FVXA 2QTHA 2P4EA 1NXQA 1Z29A 2W5UA 1Z2OX 3C8UA 5GMOA 5FNVA 1VC2A 2R751 3AK4A 4U7TB 4D4KA 2PZKA 3VR4A 2YZKA 1QPZA 1JVSA