3FVRA

Crystal structure of acetyl xylan esterase from bacillus pumilus, monoclinic crystal form i
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
320
structure length
320
Chain Sequence
MQLFDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEAEPTLESYDYPVKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDGGIHDIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYYYRGVYLDAVRALEVIQSFPEVDEHRIGVIGGSQGGALAIAAAALSDIPKVVVADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEKAFETLSYFDLINLAGWVKQPTLMAIGLIDKITPPSTVFAAYNHLETDKDLKVYRYFGHEFIPAFQTEKLSFLQKHLLLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyl xylan esterase
publication title Structural and functional studies of Bacillus pumilus acetyl xylan esterase
rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
total genus 117
structure length 320
sequence length 320
chains with identical sequence B, C, D, E, F, G, H, I, L, M, N
ec nomenclature ec 3.1.1.6: Acetylesterase.
pdb deposition date 2009-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fvrA00
5EGNA 2B20A 3A70A 2I3DA 1GQSA 1ZI9A 2PSDA 4FLEA 4BRSA 4U2GA 5DNVA 5ALWA 4F60A 1G5FA 1TCBA 1UKCA 2XMZA 5JZ9A 3DNMA 4NMWA 1QFSA 2DHCA 5T4FA 4BB0A 3PUHA 2JGIA 1VA4A 3C43A 3I6YA 5SYMA 5K5EA 3BJRA 5AJHA 2HL6A 3W05A 1JKMA 3HEAA 4UHHA 1SC9A 5AKGA 1UK7A 3CN9A 1HQDA 1AMNA 1F8UA 2OGSA 3WKBA 1XRNA 4Q3OA 3DJYA 4DLNA 4CI9A 3O9VA 3FYUB 1NX9A 1X2EA 4K6KA 3D4LA 1X70A 3C45A 2RGUA 3E4DA 5EHZA 1VOTA 5LZ2A 2ZJFA 4LYDA 5ALGA 4N8EA 5JADA 2DSNA 3WK8A 4ARAA 3WIOA 4A16A 1EHYA 4ZV9A 4J0IA 1FFBA 1CUFA 1XQYA 1CQWA 5CH3A 5JYCA 1LBTA 5AK3A 1IMJA 2DQYA 3RK4A 1CEXA 3CXUA 1H23A 3DEAA 4DNPA 3K6KA 4S0XA 4V2IA 3E0XA 5AOCA 2OCKA 1ODSA 1CIJA 1EH5A 3M81A 2E3JA 1R4ZA 2Z8XA 2GYUA 1YA4A 4DYHA 1IVYA 5FP0A 1XLUA 5EFZA 1QFMA 4AX4A 3OM8A 3GROA 3MGAA 5JANA 1OILA 1WPXA 3KOOA 3AIKA 1LBSA 3AZPA 3I28A 2WG1A 1YR2A 4LYEA 2WIJA 2WU4A 4IHAA 4RNCA 2HADA 1C7JA 1Q0ZA 3AFIA 3W9UA 1QE3A 5CH5A 4N5HX 2AJDA 3QPCA 4PNZA 1ORWA 3I2FA 1TIBA 3EQ7A 4HRYA 1XQVA 2XMQA 3PFBA 5DJ5A 1X2BA 2XUPA 2HM7A 3SX4A 1W76A 1EX9A 2QXTA 3OG9A 3O95A 3AZOA 4H7KA 3C6BA 1G42A 2BAGA 3S2ZA 3FCXA 3MUNA 3GA7A 2HHAA 3Q8WA 1MTZA 3G0IA 5JZSA 5CRIA 5AKLA 5IVHA 4OCZA 3KWJA 2QUBA 4EUSA 5ALSA 1H22A 2EDAA 5A7FA 5C8XA 2GBFA 4MJ3A 3C8DA 4WY8A 1TCCA 5JZBA 3ED1A 4PSCA 3FLAA 1EDBA 1NU8A 2XQIA 4U2FA 1XFDA 2VATA 3W04A 3AZQA 4UFPA 2G5PA 2XMRA 1FFCA 4X90A 5KREA 4UHDA 1CUGA 3STTA 3QMWA 4AMZA 1MPXA 2PSFA 4G4IA 1ODTC 4Y2QA 3PICA 1CUEA 1JMKC 4UFOA 3EQ9A 4CIAA 2WHPA 2WIGA 5ALMA 5DLPA 4B82A 1BCRA 4G4GA 1EDEA 2BUBA 2OQIA 5K3CA 2GBCA 2ZJ7A 3IUQA 2PVSA 1EB8A 5DNUA 2HA2A 4BC0A 1XKLA 1LZKA 4GDMA 4I4CA 1OXMA 2PM8A 3WIBA 4L0CA 3ANSA 5D6OA 5AI5A 1MN6A 4F5ZA 4B7ZA 3AIOA 3JYHA 2Z5GA 2JEYA 3I2KA 2PBLA 4FHZA 1XZMA 1XKTA 5JALA 1GXSA 2HU8A 5KBYA 3QM1A 4UBNA 3WYDA 1VXOA 1FJ2A 3NOXA 2Y2UA 3FVTA 5ALOA 5ALXA 1FSSA 3WK9A 1HPLA 4LHEA 4AO7A 2OAGA 2WIDA 1LPPA 2JGFA 1LPMA 4TGLA 4J7AA 3BIXA 3SK0A 4KAAA 3WK7A 2XLCA 4I19A 1CRLA 3W06A 3G0DA 1QIKA 1CR6A 3FYTA 4QZVA 1JT2A 4J0CA 1XZBA 3F98A 2YH2A 1VA5A 4DMHA 3IULA 1AQLA 1ZD3A 4K6GA 1B41A 1E8MA 3UMJA 2OGTA 5IKXA 3FYUA 5DYTA 3RLIA 2DFPA 4EY5A 4YPVA 3F97A 4HXGA 1DT5A 4MEAA 5AM1A 3PFCA 1XZIA 5AP9A 3WMRA 4L72A 2H7CA 3HLKA 5LKRA 4H7HA 3MVEA 2XMSA 5AI9A 4CIBA 1A88A 3QZUA 4KRYA 2RHTA 2WLSA 5JAOA 3ZLTA 4XX1A 2BCEA 1ZIYA 5AKZA 1JU3A 2O2IA 2XI4A 1H2WA 2C5GA 3DYIA 3P2MA 3M83A 4YASA 5AKJA 1C4XA 4PSUA 5EIEA 2Y6UA 2Y1KA 3D7RA 3WWDA 4HRXA 3L1IA 1MX1A 1XRPA 1P0QA 1QONA 3FLEA 3WYNA 4AN0A 4L9AA 5AIAA 1L7RA 4OPMA 5HKAA 5K3EA 4X91A 1U8EA 5IVKA 4BCCA 1E3QA 4H7DA 5D3KA 5E4YA 5JD4A 4H7IA 1CUXA 5ALIA 2VAVA 4Y2TA 1VE6A 1ZOIA 4X85A 1ETHA 1LPNA 5EHQA 3AIMA 3V1NA 3ESBA 4LXGA 1WOMA 1DQZA 1P0IA 5K3FA 3ANTA 4QDTA 4YX9A 5T4HA 3QVMA 2Y6VA 1E66A 3H2HA 5ALYA 3FYUC 4B80A 5CT5A 4FNGA 1N5RA 1A8UA 2XQFA 2O7VA 4H0CA 1R88A 5BWCA 1GPNA 2P8SA 3V1KA 3HJUA 3D3NA 2H9YA 2WHQA 3D2AA 4FFVA 5LP1A 3BIWA 2ECFA 3DKKA 4C87A 4DMCA 5E4TA 2V97A 2UZ0A 4OU5A 4UBKA 1DTEA 5JAUA 1UWCA 4LIPD 4UHCA 4BATA 5D7BA 3W9BA 4QNNA 1K5PA 1THGA 2D5LA 4GWLA 3QBJA 2FJPA 2ZVDA 3FSGA 4BAZA 5JATA 2BGRA 5HF6A 4H35A 1ZD2P 1ZI8A 1CPYA 4BVJA 2OGZA 3QMVA 5ALDA 1LZLA 3WZMA 3QPAA 4ZRDA 4G9GA 3LP5A 4GEGA 4Q3KA 5A62A 2XMBA 3I2JA 3BDVA 3D2BA 1XZLA 3TJMA 3WA7A 2VTVA 3DOIA 4J03A 2G5TA 5AM4A 4UBJA 4MYSA 1TQHA 2JGMA 2CEKA 3WWCA 5CMLA 1MX9A 3R3VA 5T4BA 2R8BA 4AMYA 3EBLA 2RONA 3PI6A 5FXMA 2XE4A 4X7BA 3I1IA 4TPKA 2VT7A 4KEAA 4U2CA 4BYMA 4RE5A 4O08A 2XUGA 6YASA 1LPBB 5A7HA 3M82A 4J0DA 2WUGA 3FCYA 4Q82A 5DTIA 2WG2A 2JF0A 4MWTA 3C70A 4X92A 3WK5A 2ZYSA 3WWPA 2BFNA 3ESAA 4L3WA 1YA8A 1LPSA 2AJ8A 4ITVA 3R40A 4KYVA 5C81A 5ALNA 5A7GA 1TCAA 2AJLI 2PPLA 1Q84A 4JNCA 1JJBA 3DOHA 2HFJA 3N2ZB 4XVCA 3B12A 5ALEA 2QR5A 4KAJA 1F6WA 4QA9A 4CCWA 5AKYA 3FWHA 1G66A 3WA6A 3IA2A 1JU4A 1E8NA 2C7BA 3TEJA 4IQ4A 1F0PA 3JWEA 4MEBA 1MT3A 1TAHA 1ZICA 2QMQA 3SWWA 4INZA 3Q0TA 4Y2SA 3WL6A 1UK8A 3DQZA 1MU0A 5HKBA 3STUA 5AOBA 4PQEA 4C4ZA 3N0TA 1O6FA 3GUUA 1SCQA 5HF8A 2VJAA 2I03A 4X3CA 2GYWA 3C8HA 3QPDA 2W6CX 3G9TA 3YASA 5C7YA 1VXRA 5HQ3A 1L7QA 1CUSA 1YB7A 5AI4A 4Y7DA 3ZLUA 1G4HA 2WFLB 1J07A 1SCIA 3AINA 3H1AA 3VJLA 4MQMA 1J1IA 3JW8A 1UXOA 3LCRA 1F0NA 1QIIA 2JGLA 3HSSA 2WUEA 2G4LA 4G9EA 5AK5A 1Y7IA 1QIDA 3ZPXA 3A2LA 5JD6A 1IUOA 4AN1A 4B0PA 3VISA 4BE9A 2H7YA 4QDOA 2PL5A 1H2XA 1ZD4A 3BXPA 1RYYA 2C0QA 2HA4A 4J0KA 1XZGA 3DD5A 5ALUA 2VJDA 1CUAA 1QIMA 5LIPA 5LZ7A 3ZLVA 3KD2A 1Q0RA 3BF7A 1DWQA 3O4GA 2AJCA 3ICVA 1O6GA 4FTWA 4MQLA 3GELA 1HL7A 4BVKA 2I3ZA 3IUJA 3WL5A 2QS9A 3NUZA 5FRDA 1ACLA 3STWA 4AZ3A 1MNQA 3WL8A 2X8BA 1WHTA 1EXWA 1MAAA 4J3JA 5HCUA 4HZGA 5ALFA 4U2DA 4DNQA 1W4LA 4PF1A 5K3BA 4Q34A 3T4UA 4BDSA 4NS4A 1K8QA 3H17A 4QE3A 2OPHA 4FLFA 2CKMA 4G8CA 1FFDA 2XUDA 2X5XA 5SYNA 3BJMA 2XMGA 2O2GA 3A2NA 1I6WA 1OCEA 1ZI6A 4M0FA 3OURA 2ONCA 1MO2A 1AGYA 4UBLA 5AKKA 4RGYA 5AM2A 3F8SA 4CCYA 4I3FA 5JARA 5ISMA 3QH4A 4ZREA 1VLQA 1QIFA 2XLBA 4XWGA 4X00A 3ZWQA 2VJBA 2CJPA 5CXXA 5AM3A 4UHFA 1GPLA 5AKHA 1R3DA 4GHWA 3I6ZA 3LLCA 3H04A 2WUDA 4C88A 1CUHA 4UFNA 5BV7A 4EHBA 4QDUA 2JGKA 3R41A 1QOZA 4UHBA 5ALTA 4ROTA 3QMMA 1IZ7A 4CG3A 1K4YA 3IURA 5JAHA 1BCSA 1CUUA 2EDCA 4J0GA 2FX5A 3H2KA 1VE7A 1AC5A 4BE4A 1CUCA 2XUOA 4BDTA 1CQZA 3I2HA 3C5WP 4TVKA 3UUEA 4OB7A 2BKLA 3HYSA 4B83A 1BN6A 3H2GA 4W1PA 3I1YA 5C8VA 3MUOA 5KWJA 5E4JA 1DQYA 1EINA 4MWSA 3WWOA 4KJXA 3WL7A 1EK1A 1UKAA 3IUMA 4IH1A 2GZRA 3PDCA 5AHXA 1EK2A 4E14A 4H7JA 5LKAA 1JJFA 4GW3A 1A7UA 3DS8A 1HKHA 2ZSHA 2QJRA 4KAFA 2G63A 3NWOA 4B85A 3FAKA 5DYYA 3TRDA 1QIHA 1A8QA 3ILSA 1SOMA 1T2NA 3AUKA 4AXBA 1VKHA 4FOLA 2HA0A 1MJ5A 3FBWA 4WY5A 1USWA 4OU4A 4KR0A 2O7RA 4B84A 2HA5A 1CUIA 5AH0A 4CFSA 3LIIA 5ALZA 1YS1X 1QZ3A 3ESDA 2HFKA 2J4CA 1WHSA 4K6HA 2DHEA 1DWPA 4X6YA 3SC2A 5T4EA 3ZV7A 4LXIA 5I8PA 2XQKA 5LZ8A 3F67A 4DTCA 4OB6A 4EY4A 1DINA 3EF3A 3H1BA 1WB4A 5I9IA 1WB5A 4K5QA 2Q0XA 5I7UA 4BAGA 4W1RA 2PUJA 3I6MA 3R3WA 5AM5A 3WQHA 1CLEA 4WJLA 5ALRA 1QO7A 1W6RA 4Z49A 5ALHA 5JASA 3FLBA 2XQJA 4Y2RA 3STVA 4PV7A 2JIDA 1UZAA 3HABA 2CUTA 1E89A 3KDAA 3G9XA 2DR0A 3OOSA 1U65A 5ALKA 5E2IA 1ODCA 2HRQA 1YASA 1CUJA 5LYYA 4CG2A 1JJIA 5ALLA 1BRTA 4WDQA 4JUIA 2WG0A 4PO3X 1CUYA 5ALPA 5ALJA 4B81A 3QITA 3QYJA 3PF9A 4E46A 2QM0A 4QEKA 3V1MA 2V9ZA 4HTAA 4OB8A 1TRHA 2Z3WA 5AI8A 1XZCA 1YAJA 4G4JA 3FNBA 3U0VA 1BEEA 1M33A 1LNSA 1N5MA 4A5SA 4X97A 1QIJA 4M0MA 4IO0A 3BDIA 4W63A 5EIHA 4P9NA 3TGLA 3ZI7A 2IITA 3C5VA 2WFMA 4X71A 5AK4A 1EA5A 5DWDA 4X95A 1QTRA 2WIKA 1N1MA 4N8DA 2ZJ6A 1Y37A 2VA9A 2WM2A 5CTAA 5HFAA 2OCIA 4UHEA 5HK9A 1AZWA 2PSHA 3R0VA 4ZV7A 1BROA 1W1IA 4FKBA 4OSEA 2ROQA 4FFWA 1BE0A 5HFNA 1Z68A 2O2HA 1XRLA 2H7XA 3B3QA 2LIPA 4KE8A 1QIEA 5J3JA 4W9RA 2X76A 1NU6A 3KXPA 2WKWA 1J06A 1DWOA 4FDMA 3IB3A 2WQZA 5FPQA 4CG1A 1UOOA 3DCNA 3IVMA 1CUDA 5CH8A 3L1HA 4DIUA 3G0BA 1VZ3A 4B9EA 1U4NA 4UUQA 4DMKA 1XZKA 2GBIA 4BRZA 3R3UA 4HVTA 5D3ZA 4ZGBA 2Z3ZA 3H0CA 5K3AA 2J4FA 2OXEA 4P92A 1XZJA 4GECA 4IH4A 3R3ZA 5AKXA 3WJ2A 5A6VA 3PE6A 5KWIA 4ARBA 1SFRA 2WJ6A 2BUAA 3HI4A 5AKIA 2IX9A 4QDXA 2HA3A 5EHNA 2ZYHA 1UOPA 4GI1A 4ZXFA 5BWBA 4F21A 2WJ4A 4P08A 5AK6A 4LKOA 3C6YA 4WFIA 5FKJA 4JH0A 2YYSA 1FFEA 1VZ2A 1TKRA 3WKDA 1JI3A 1L7AA 3O4HA 5ALQA 2C4HA 3IUNA 4RE6A 3VKFA 4J0HA 2RI6A 5AICA 2ACKA 4F0JA 2PKYX 4MYDA 2HIHA 1FFAA 3NGMA 4KE9A 4ZWNA 4B0OA 3WLAA 3A2MA 2XUAA 5DNWA 4BZWA 3D2CA 2XUKA 2XUQA 3OTQA 1GPKA 3DYVA 4N5IX 3T52A 1PJAA 1VJ5A 2PU7A 3IBTA 4Y2UA 4PW0A 4GBGA 2JEZA 3WWEA 4H18A 4BP9A 2DCMA 5IVDA 1KU6A 3VXKA 2OAEA 2BUCA 1GKKA 5IH7A 3PF8A 2YXPX 5HF5A 3HXKA 5CBKA 4DGQA 4BCDA 1CUZA 3I2IA 1YAHA 1EVEA 1D07A 1K63A 3DDUA 3IDAA 4W1QA 5K3DA 4FNMA 4B9AA 3ESCA 1P0MA 1QO9A 1H2YA 3G9ZA 2CMFA 4X94A 4BC1A 2OG1A 3C6XA 5HZGA 1CV2A 2K2QB 2WHRA 4EY6A 4QLAA 3M3DA 3ICWA 4GXNA 2FUKA 4Q3LA 4W1SA 2HA6A 2V98A 1QTIA 1YS2X 3C6ZA 3LS2A 4G8BA 2WSLA 2ACEA 4U2EA 1EB9A 2VAXA 4Y2XA 3C87A 4ETWA 3BL8A 3BWXA 1XLVA 1XQWA 5DYWA 3LIPA 3VVLA 2HU7A 3EQ8A 2CB9A 5ESRA 2GBGA 1R1DA 1XZFA 4FBMA 5DTJA 3GBSA 4XIIA 2Z8ZA 2EEPA 1XRRA 3VDXA 4UPDA 4H7EA 3CCCA 3WK6A 1EVQA 4EBBA 4WDRA 1WCYA 5FDFA 2QUAA 2GYVA 1N8SA 3V1LA 2QXUA 3GFFA 4Y2VA 3S8YA 5K3FB 3FOBA 3EIOA 1IUNA 1C7IA 4X6UA 3WK4A 4G1FA 4NVRA 5EHXA 1UK6A 1PV1A 1J2EA 2XUFA 2CZQA 1GGVA 5CT4A 3V9AA 2XDWA 5AO9A 3G0CA 1IZ8A 1ORVA 2XMCA 4QDZA 4BBZA 3G0GA 1ZGBA 3D59A 3WI7A 4OYYA 4DMFA 2B4KA 2B61A 3HZOA 5F4ZA 1BU8A 4PSDA 4WFKA 4E15A 2ZSIA 1GZ7A 1YSCA 5CT8A 5H3HA 1MX5A 3DLTA 4BZZA 1MNAA 1Y7HA 2HU5A 1ZGCA 2B9VA 2PSEA 5FUMA 1AKNA 2PX6A 5CURA 1KU0A 2C5FA 1QIGA 2QOEA 1XRMA 1ZD5A 5JAPA 1CUWA 4FBLA 2OQVA 4Y2YA 5EIAA 4E11A 4DNFA 2WILA 3D0KA 2JGEA 5ALVA 4EY8A 3BE8A 4AB1A 4XJVA 1UT6A 4IH9A 4KE6A 1UFOA 2VT6A 2HA7A 5EI5A 3KSRA 4DSZA 5A2GA 1HLGA 2HDWA 3E3AA 1ZJ5A 3VVMA 2WFZA 2ORYA 1W52X 2BJHA 4GLBA 2QT9A 3RKSA 1HDEA 4Q1VA 3G02A 4JYPA 2W22A 2WUFA 1K6EA 1YB6A 7YASA 3VJKA 2C58A 4J0JA 1B6GA 5A71A 1U2EA 2IIVA 1UK9A 5CT6A 2WFLA 1EDDA 2XUJA 1CVLA 3B5EA 4KE7A 5AOAA 4C6HA 2DHDA 4JYMA 1DX6A 2D0DA 5CXUA 5LZ9A 2PSJA 4AZ0A 5LZ5A 1LPAB 4FMPA 2R11A 3CCBA 1XZAA 2XQGA 4KACA 1WPRA 3STYA 1DX4A 3W2TA 1JFRA 4ZI5A 1ZJ4A 3F96A 3D5EA 3H18A 1HBJA 3I2GA 4FWBA 2WTNA 2BGNA 4G5XA 4Q05A 4HXFB 3DL4A 2VQ6A 4H7FA 1R9NA 1XZHA 3K2IA 1R50A 2NW6A 3HACA 4B6GA 4G8DA 5FPPA 5CT9A 2QVBA 5CW2A 3STXA 4QWMA 2ES4A 1AX9A 4BCBA 4WFJA 1DT3A 5FOQA 5JD5A 3AJAA 3RM3A 1W75A 1E5TA 1THTA 4QLOA 2RHWA 5HQ3B 4WCVA 3WKEA 3R3XA 5AM0A 2PUHA 3G8YA 1QGED 5AI6A 4HS9A 5JIBA 4BVLA 4C01A 2XT0A 2V96A 4OYLA 1RWQA 3WKCA 1IUPA 3HC7A 3H2IA 1S8OA 3FSGD 3H19A 2J3QA 1AUOA 4H77A 1TK3A 1XLWA 1QJ4A 2VEOA 3WKAA 1AURA 2RAUA 3O4JA 3PUIA 4EA6A 3A6ZA 2WTMA 1DU4A 3L1JA 4C4YA 2OLEA 4N8SA 2VF2A 4BP8A 5YASA 3X3HA 4KRXA 4QWWA 4DM7A 4FLMA 4C89A 1CUBA 1LPOA 4BAUA 5AIBA 2QTBA 4DNOA 2Y2VA 1LLFA 2JGJA 3DKRA 3O0DA 3CN7A 4HAIA 3E1GA 4UBIA 4A23A 4HXEB 5C8ZA 4K2AA 4YK7A 1ZIXA 2QKYA 1WM1A 4EB0A 1T4MA 3F9CA 5HF9A 5HK8A 1SCKA 3VJMA 1GQRA 2XB6A 3WJ1A 3H2JA 4RPCA 4DSAA 2VJCA 1GKLA 1CUVA 1YCDA 2QZPA 1WB6A 4AO6A 1RP1A 4EY7A 3G7NA 1QLWA 2ZYRA 3OPMA 4Y2PA 4X93A 3GZJA 3V48A 4LXHA 5LLSA 1XRQA 5IVIA 2ZYIA 4NZZA 4JEIA 3WZLA 2I78A 2CBGA 5AKEA 1BN7A 1XQXA 1XROA 2AJBA 4C4XA 3KWFA 2XMDA 1BS9A 3O4IA 3AILA 5LZ4A 4CCYB 2QJWA 2WJ3A 3K9BA 1E8DA 2HRRA 2J3DA 5BOVA 1H2ZA 1LGYA 3U1TA 4UBOA 4AO8A 4P93A 3OC0A 2XUHA 4BTLA 4EZIA 1XZDA 3O9MA 1UKBA 1XZEA 4OUKX 2DQZA 5AI0A 4Y9SA 1ACJA 2FJ0A 3HRHA 3IIIA 4Y2JA 2WHPB 2C0PA 1Q83A 3R3YA 4OD0A 4UBMA 1EI9A 1BEZA 1CFJA 3G9UA 2PU5A 2AXEA 2VSQA 5FLKA 1ISPA 4U2BA 1P0PA 1MAHA 2GZSA 2YASA 1UOQA 4M0EA 2QRUA 1KEZA 2RIPA 1PFQA 2JBWA 5FV4A 2OCLA 3RARA 2OCGA 2XUIA 3FVRA 3DL7A 4MXDA 2WU3A 1A8SA 4BTVA 1GT6A 4D9JA 2WIFA 1JMYA 4AQDA 1R9MA 2H1IA 4X6XA 3BF8A 3UUFA
chains in the Genus database with same CATH superfamily
3PXGA 1RFGE 5HIJA 5BNWA 5JSKA 3BICA 3HK2A 1N9GB 3SEAA 2PSDA 2AIRA 2RG1A 2H16A 4FLEA 1PHPA 1NVAA 1WEHA 3JQAB 4B3XA 2QVXX 3DE4X 1BHQ1 4LWQA 1OU4A 2IPLA 2JI7A 5DNVA 3TM5A 1GZVA 2FP4A 1G5FA 1PR9A 2IBMA 4GVXA 1UKCA 5FORA 1Z6AA 1XO1A 2Y93A 5EL0A 1U9CA 3H8VA 1G20B 3TLMA 3AOEC 1DBVO 1OBCA 2BPOA 1W47A 4JBNA 1STOA 4I0WB 1X15A 4FZ3A 4IVRA 2W6MA 1GLNA 2YRFA 4MKZA 2P3SA 4PN7A 3RUAA 5LJIA 3IERA 3ZZ0A 1DNPA 3RHSA 9LDBA 1P8JA 1T0BA 1H85A 1MVNA 4JMLA 3CNEA 2Z0MA 4HLUC 5AJHA 2WVJA 2HL6A 2H4YA 1EDZA 3H9GA 4O4LA 1JKMA 2C1EA 4C5CA 4DJAA 2AQ8A 4LYGA 4F97A 3NJRA 3VNSA 6REQA 2QN7A 3RDPA 1DJMA 1BIFA 4KUHA 1F8UA 4G01B 4QGHA 3OLWA 1LCIA 2PGOA 1WBDA 1Q0TA 4EX7A 4R6WA 2BFMA 4ZT5A 1SURA 2AQIA 3DJYA 4LVOA 4MUHA 2C7OA 2F4VB 3TKLA 4RDXA 1ZVVA 2Q4OA 1FCJA 1YC5A 3E23A 3FYUB 2KI5A 3V8RA 4KQKA 1L7EA 2ALJA 3BG5A 4R3UC 5ELMA 1LTKA 1QS0B 4P31A 4QYXA 2V6JA 4X0EA 2RGUA 4QQKA 5HQJA 2IYQA 4ZMSA 1ILWA 4K1LA 3ZWDA 3ONWA 4NAUA 3JQCA 2B82A 2KM1A 1XNJA 1PG2A 5FJJA 3DWFA 3EIEA 1RWKA 2AR7A 4G09A 2RGWA 1M2HA 1NDQA 3AF6A 2WI8A 3DV0B 2I6SA 2FSGA 1QE0A 4TXJA 5HOEA 4FYKA 3KPJA 4BMOB 3WMFA 3OT1B 3GD5A 2LVBA 4J2OA 3G23A 1GVHA 2W6IA 4O6VA 4OFBA 4ARAA 2QMEA 3THXB 4B4DA 4JI6B 1PTJA 3R5SA 3JCZA 3BCRA 4GGOA 2QRQA 2VKQA 1RACA 5C35A 3T7TA 1XQYA 2GZ2A 3GIWA 5IYZB 4Z3OA 3GVIA 4DV2B 1PK7A 2C2XA 4ND7A 4ZRNA 5JI3E 1LBTA 3U37A 1MC5A 4OVKA 1AU9A 4LKRA 2ZJ2A 2R7LA 4EI2A 5AK3A 1IMJA 3C24A 2NPFA 2DFNA 5F52A 1QNLA 1GUYA 4JBLA 4JVSB 1T24A 3RK4A 3U44B 4JLOA 3MXOA 3NIWA 1UINA 1NBAA 4ZT2A 1MJGM 3UW3A 4H0FA 2C07A 3A1VA 1ZH0A 4RWEA 3FZNA 3DFKA 4ZAFA 2O2SA 3IAM6 4MR7B 1L7MA 4E6PA 3JWHA 2DKOA 4G67A 5H68A 3R76A 1D2RA 4DNPA 3AEYA 2BEUB 3T7DA 1V25A 5JFGA 4S0XA 4I5IA 2EWVA 3M81A 4RTQA 4N9WA 4RMIA 2FPPB 4YRBA 1N75A 1R4ZA 4N3NA 3QXGA 2ZSAA 2WE8A 3LWBA 3AUUA 1V4BA 2KBEA 4WZZA 4DYHA 1ZQ9A 4BKRA 1W46A 5E6RA 3G2MA 1Q1AA 5AJUA 2ZE6A 2XWBF 1H4QA 3LPMA 4PINA 5GJVC 1PQYA 1IY8A 2GH1A 3OM8A 3MGAA 5JANA 1DV2A 1N2CB 1C2TA 3DXFA 1I7QB 4N6GA 1Z35A 2CMGA 5JSUA 2ETXA 3KOOA 1MQSA 3RQIA 2ZE7A 4HDQB 2WG1A 2WPNA 5M5BA 4X1IB 4HH3C 4AY3A 4DG5A 3K2BA 5LOVB 3TIFA 2WNHA 3U4MA 5C8YF 3FWZA 2RH4A 4RNCA 3KU1A 3T61A 4UE2A 4IXTA 1G3UA 1YHYA 1ZC4A 1UEIA 4OHXA 1ENYA 1Y1RA 3TTWA 3C2QA 5CH5A 2GEFA 1ISFA 4MVJH 5L9AA 3QPCA 1JI0A 2C92A 1EUCB 2RH5A 1TIBA 4ALJA 5A9RA 5P21A 1YVRA 1EWKA 2H65A 3EQ7A 1JG3A 1G5PA 3QPVA 4GO1A 4MKIA 1LS6A 2CL6X 2Q1SA 3S81A 1XQVA 1WQ1R 4HRAA 2B9EA 2KX7A 1X2BA 3ZWYA 3O94A 3G2JA 4N7JA 5SZIA 4MV6A 3SZLA 2HM7A 1LSSA 2I3AA 2F1OA 1U2ZA 1RSZA 2IYVA 2PR7A 2VZEA 4XYMA 3SX4A 1C3EA 1TM7E 5F78A 1D2HA 1R18A 1W76A 2G6BA 5K0ZA 3BMNB 4MVJP 4LBZA 2I9KA 3GZTB 1R5OA 3MCUA 4H4EA 5LXTB 1WF6A 2NU8B 3O95A 3LC2O 4W5TA 1D4AA 1T0IA 1VKJA 2AXQA 2VZ9A 2FPUA 2VWHA 2YV4A 4M9QA 2QZJA 4Z4FA 2HWKA 3LBNA 2GCNA 4YDSA 3FCXA 4GKVA 2VWPA 3GA7A 4Q3NA 2JLAA 2PRZA 3P4YA 2ZBUA 3G0IA 2IZZA 3L41A 3B8HA 4KUGA 5CRIA 3W3ZB 2ONYA 4JQYA 3ZDXB 1GO2A 3CT4A 2QUBA 2JFPA 1K5GA 1L2TA 2IYXA 3LO5A 4EUSA 2H2FA 3PC4A 3WWEA 1FSGA 1N0IA 2NO0A 2EDAA 5A7FA 1CK4A 2QGFA 2CGEA 1NY6A 3EODA 4RV5A 3ND9A 3X2FA 1QF7A 5C8XA 1QCYA 2FUG6 2CLSA 2BEJA 3C8DA 2I1WA 4LOKA 1TCCA 1B1CA 3UMVA 3RGWS 2AXPA 2P2YA 1FP4A 2X3FA 1VBKA 2GJSA 5ADHA 3JQAD 4ZAYA 4PG5A 3GLIE 3TMAA 1MOZA 3EH2A 2QSZA 3FLAA 3KPWA 2O1WA 3K0AB 3UA4A 4YAWA 4AJIA 5UKDA 1MR3F 1A3CA 1C4OA 3HVKA 5FBVB 1NR5A 2KLBA 2EP5A 4QTYA 5EJ5A 3TQFA 1N9ZA 1XFDA 3LY8A 2VP3A 1R4MA 1ZAKA 2G80A 2XRMA 3W04A 2Q46A 1MQAA 2YV1A 3UVEA 3MGGA 3PPYA 5A0TA 2OBBA 1XSEA 2X58A 4X7MA 2G5PA 1HTBA 1FFCA 4OAQA 3OZTA 1U3FA 4QECA 4LYAA 4MRSA 1KJYA 3ESYA 2PZAA 2H4XA 4EOGA 1XTSA 3OZGA 1K06A 1YGYA 2W6ZA 3GFGA 4MS1B 4UHDA 1NUSA 4HDCA 1LTHR 3QMWA 1KBOA 4I81A 1K97A 4DDVA 2PSFA 2QRLA 5CK5A 4C7KA 1ZGGA 2X86A 1EFLA 2KHZA 1JKXA 1EU1A 4J7CA 4L22A 4BO4A 1KWKA 1JMKC 1GZ3A 4ZVUA 3CISA 4L3OA 4RVUA 4CIAA 1ZHOA 1SIOA 1C7ZA 5ALMA 2HGSA 2W90A 3GDOA 5DLPA 2DPXA 1DE0A 4DCMA 1LI7A 4G4GA 5LL6P 3DXXA 3L6BA 3FHOA 3UN1A 4Z4IA 2D1RA 1H9CA 4DJTA 2K87A 2W2OA 3JQPA 4QM6A 1CRWG 5TVGA 1KK3A 2GBCA 2ZJ7A 4HJXA 4PYNA 2KMLA 3IUQA 4GYWA 4IOKA 4BKPA 2AKYA 1FDIA 5JSQA 5ICSA 3EHEA 1AGXA 2J9FA 2GN1A 2GXUA 3KM0A 3P9RA 5CU7A 5HE8A 3RUDA 4F71A 3TLJA 3BOSA 3FDZB 1RQ7A 4CIXA 4R2MA 3K30A 2O0KA 3ZUGA 2EHDA 5E0OA 3CUVA 1OXMA 4AJHA 3KEQA 4NY1A 2EJTA 3I01A 2GHIA 3PC8A 2Q2OA 4BMXA 3OE5A 1E7YA 4EHLA 2J5BA 1Y7PA 3ANSA 3LF1A 3B1KA 1BVUA 1RWNA 2B98A 3IXMA 4JC0A 4RM3A 4B44A 4LZOA 1IQRA 1E63A 4PLHA 4D9FA 2G4CA 1YZLA 3IO5A 3I2KA 4YJ3A 2AOTA 1W0JD 3GMIA 5CIWA 1DIHA 4F45A 1RC1A 3E0QA 4MB2A 2YJNA 3AFHA 2Y1XA 3D0OA 4CCSA 3LOUA 4GG1A 1OFVA 3HVIA 4OHWA 3PQ8A 3QM1A 1FTNA 3JZFA 3WYDA 1ZM7A 5DRTA 1FQOA 1NOJA 4UEJA 1Y3CE 5A0FA 5ALOA 4EA7A 3W5IA 4I55B 2GM5A 1FSSA 1JUDA 1HPLA 2AFHB 2H4ZA 4LJ6A 4JUFA 4WGFA 3L1UA 4IJUA 1J99A 1PHRA 3DNPA 1XVVA 1THZA 3BSYA 2J7KA 3TSCA 2AEEA 1P4HA 2F1RA 2OK7A 4P2BA 3CLKA 4BRWA 3GJ7A 1JJVA 4BFWA 3OJFA 2HCJB 3KLBA 4OL9A 3URMA 2FEPA 4F2GA 1O9BA 4QJ4A 1YOVA 3ITEA 3VSCA 3ZNPA 5KSYA 2QD2A 2E1PA 3E2PA 2CFCA 4LJYA 2GHRA 3A6KA 4NJMB 3TJRA 2WV7A 1KP9A 4J7AA 4TGLA 3SZ3A 4GDFA 4JI2B 3SK0A 1K27A 1O95D 1ZC3A 2EX0A 4MV7A 1DG1G 4R1QA 3VGPA 2ATVA 4AKIA 1NN3A 3BS4A 1I01A 3CH5A 3BGDA 3FTNA 1GTZA 4EHDA 3ELWA 1Q3KA 1U7OA 2PQ0A 1TC2A 4ZVKA 3AEXA 1ELOA 2PXCA 3R7SA 2WWIA 5GQSA 1HDRA 5IDYA 4QZVA 5J5VA 1M2VA 5L95A 4B45A 2I6TA 4F2PA 4U6QA 2F62A 1ZN2A 1Z2AA 2F67A 3B78A 4IIHA 2X2FA 5EJIA 4AS1A 5LN1A 1ML3A 1V1MA 2XZDA 1T5TA 3FVVA 2O3SA 5E1BA 3EXG2 1DXHA 1F48A 3IMGA 3MTIA 4MV1A 3S70A 4CYMA 3DGFC 4MITA 1OZAA 3OE1A 5TT0A 2RB5A 2XCLA 3ER8A 2IYNA 1ZD3A 3ZDEA 4PIMA 1UC4B 2VP9A 3UMJA 2GPWA 4EEZA 2LIVA 1G20E 1Y3IA 4FP9A 2MIIA 4OQEA 4ZO8A 4URVR 4DLZA 4EY5A 5KVAA 1FBTA 1I7SB 4YPVA 4M86A 1SXJA 3MQ4A 4Q9HA 3ZTYA 4V0LA 1JQKA 4KXNA 4ADSG 3LI2A 5AM1A 3VZQA 2CLLB 1XZIA 2Z2IA 3ZGYA 4ZZ0A 5JXIA 2W0MA 2WHXA 1KDZA 5A06A 2H7VA 2WTBA 5E2AA 5FWDA 2GEVA 2H7CA 1V0JA 3HJRA 2BFBB 2OLJA 3OP1A 4RCZA 3L6UA 4RCYA 4D98A 3L07A 2ZI4A 3CQ9A 5DOVA 4MWGA 3R7WB 3B6IA 2YOHA 3L04A 2ZRLA 3NCTA 1SKQA 1XPJA 3KYCA 4V0SA 4D41A 8ADHA 5JT1A 1G18A 5LQCA 1H4TA 3GRZA 3PC3A 5U4QA 3CZPA 3WLPA 3HXQA 3DUWA 2CVPA 4KRYA 2WLSA 5JAOA 4IJVA 2BCEA 2DSTA 4HFJA 3Q85A 1CDZA 1G7TA 4CTNA 4MWCA 2OBLA 4F91B 3EULA 2K2WA 1WL8A 3MJDA 2C5GA 4LY3A 1JAZA 4H9GA 4M2LA 4OQNA 5IXYA 3AVQA 3LX5A 4JDPA 2FWPA 3M83A 4D9KA 2PZBA 1KXJA 5AKJA 3U7FB 2BFDA 4C7BA 3ROZA 5EIEA 2Y6UA 3ZWXA 3D7RA 3G2PA 1T3SA 5EJ6A 2CL7X 3CZQA 1E5XA 1O89A 2XYHA 4HRXA 3G89A 2C95A 3ELDA 5BYKA 1Q6ZA 2J67A 3CRNA 3EXAA 3F73A 1MX1A 2XRZA 1CQPA 1JE0A 2IEZA 2NQ2C 1QONA 1L5GB 1IN6A 1L4HA 4A1OA 4DLBA 2NU9A 4AN0A 4F2DA 2ZJ0A 5HMMA 2WJVA 3GLUA 3HB4X 5AIAA 2G71A 3RBAA 4OPMA 5DX0A 2ATEA 4CEHA 4F56A 5EY5B 1IQ0A 1SXGA 4HYYA 4X91A 3V4FA 2QRJA 5HKAA 5K3EA 5AW3A 5KX5A 2OCXA 4FFRA 2X13A 1J0CA 5C4IA 1EJ2A 1MORA 4EPRA 4RTOA 4DDTA 2E4ZA 4G41A 4YCAA 5D3KA 3TK1A 4CGYA 1QB8A 2QORA 5HYVA 2J9XB 1OXTA 2NTNA 4H7IA 4BKMA 4BQIA 5JD4A 3AVTA 3EJ6A 1EAMA 1EVIA 3Q5GA 4FGKA 4PHCA 2JIMA 5ALIA 4OKSA 1FK8A 2Z9CA 4X85A 5LQJA 1ETHA 1L5OA 1XDZA 1O7JA 1UDAA 2AV6A 1ZOLA 5HG0A 1ODKA 4KDFA 4M37A 4BN5A 5CA1F 2XF2A 5I3CA 4LXGA 3WAGA 2X0RA 4F5DA 2W4MA 3BKWA 4DZZA 4ARIA 1AY0A 1UXGA 1WOMA 1NYTA 2PCLA 1ZSVA 5K3FA 1OLXB 1N2XA 2AH5A 3M1YA 5FUBA 5JRZA 4NU8X 4HLCA 4KQ1A 4QDTA 1T0JB 2OHOA 5L3SB 1LSUA 3GLFB 5HKKA 4GZ6A 1PD1A 1DEXA 1XC7A 4UTVA 2D4AA 1PN3A 3G2NA 2Q3LA 3JYQA 1Q17A 1N2CE 4TYNA 1QPZA 1H5UA 3M6LA 2QK4A 4EECA 2ERCA 3KKLA 1YO6A 3LT0A 5ALYA 2O06A 2G09A 5CTJA 3O03A 1IFXA 3H8WA 2QU8A 4DLWA 4BX3A 2PH1A 2G1PA 3CB2A 4MV9A 4WZBB 1L0BA 1ZMXA 1SXJC 2DJ5A 2DTDA 2OGUA 2EFGA 1RJ9B 3ONFA 3H05A 3QWIA 4MW9A 2NV0A 3O3NB 1YRBA 5B57C 1UH5A 5BSGA 2ZSJA 1X9HA 3BA1A 2FR8A 1T8YA 4C2TA 4U7PB 1CJCA 4HMQA 3RG8A 3TOCA 1D2AA 2P8SA 4V2UA 3NYRA 1C80A 1M1NB 4NG4A 3OF5A 2NUAA 2R751 3K32A 4TTQA 4Z6KA 1W9HA 1C8VB 4JEHA 5KC8A 5LIRA 1VIYA 5JQGB 3NYWA 3IVXA 2C8LA 2ECFA 3DKKA 4PY2A 1VRVA 3EXIA 3VDQA 3BK7A 4XGRA 2GTIA 1XALA 5E4TA 2VP5A 2O8DA 3P32A 1WIWA 3OZAA 5DHAA 2A78A 3D02A 3M2TA 3B3GA 3G8AA 2Z43A 1Z5UA 3BK1A 3H87A 1U2DC 3KKEA 4J0QA 2BFPA 4KIGA 1OFGA 5DT2A 3WY9A 5K1ZA 5I9NA 1BWSA 4V39A 4MCHA 3RF6A 3W9BA 2IUYA 1THGA 4R8SA 2AOXA 5LA6B 2DQSA 2F1HA 1T1IA 2Q7DA 7REQB 1H9AA 1Q74A 3N5CA 4I5GA 5HEKA 2F9MA 1YE8A 1MO4A 3FF4A 4G0VA 1NXXA 3FSGA 3O26A 4DLXA 4KN8A 3KHUA 4I7EA 1SVLA 4ZQEA 4B76A 4HT3B 2VJOA 3UV6A 2PG3A 3WV4A 2QUJA 3HBMA 3OEED 3P9IA 4MIEA 4BTEA 3DO6A 2XQVA 4P84A 4UW9A 5BRJA 1KO5A 4CU5A 1NI4A 2ECOA 3UJBA 4BNUA 1T3GA 1AK1A 1ZIOA 1NY5A 2XT9A 3P26A 3ZHYA 1U7HA 3E7FA 1XL1A 5DB4A 1UBEA 3H1FA 1U0GA 4W9NC 3QPAA 3RHTA 3OU6A 3TDKA 1PYDA 1VI5A 4LE0A 3RV4A 1DO0A 1GP2A 1K7FB 4HI0E 2JVKA 3QSYA 4I6JA 2Y99A 1L4GA 2FUNB 5TNXA 3IIMA 3KO8A 4HEHA 4IFEA 4LOLA 4B3MB 1XZQA 3A4NA 3AEKA 1QYWA 3BXGA 2GNAA 1W87A 3C1UA 3LP5A 4GEGA 4NABA 4E6EA 5CPFA 5BR7A 1M2KA 3OQNA 1RXIA 4TLBA 2BTQA 1E5LA 4D3SA 2XMBA 2EKPA 4FQ5A 2NTEA 3I2JA 3ZGOA 2GCPA 3WRWA 3BDVA 2OHHA 3G5TA 4MW5A 2Y9PB 5IP5A 2Y1GA 1NLUA 1MAUA 1YBFA 3SS9X 1JDPA 1MB0A 1IZYA 2SCUA 1POXA 4IJKA 1P6XA 5EMNA 1ES9A 1T8TA 5AM4A 2C9ZA 2WF7A 3ZV3A 1GNPA 1M1UA 1MFPA 4KR6A 2ENUA 3LUHA 3PB3A 3PNYA 3RS3A 4R2XA 1TQ2A 1IULA 4RZ3A 4WMLA 2NO5A 2ZR0A 4L76A 3UGTA 1IN8A 2R8EA 3VTFA 4CMGA 5DKFA 4OK5A 5TQJA 1L5HB 4LRWA 3O4RA 2YWXA 1T1EA 1AKEA 2EERA 4NYIR 4N54A 1J6UA 3EBLA 5BPHA 2RONA 4JYZA 3FFBA 1EZZA 4Z7JA 1O94D 4KR3A 1IPEA 2BH2A 1DCFA 5HHTA 1K3FA 2GVNA 1U0TA 3WRXC 1UODA 1VPTA 1S01A 2IDZA 3SM9A 2B83A 3EPPA 5EQDA 4TQGA 2EF0A 4CKBA 1BMFD 3IC5A 2VT7A 3BEOA 1HYBA 3QX9A 2YNMA 4XM0A 1XVLA 4BYMA 3WGUA 3TBHA 3O90A 2CDAA 4O08A 2GOYA 3KJNA 4G5RA 2XUGA 6YASA 1G8MA 2OL4A 2W6JD 5A7HA 4D1YA 3FSEA 5HMLA 4ZCMA 3RHZA 4YYZA 2WUGA 4EGSA 1QYXA 3FCYA 4RM2A 2ZUWA 4QXAA 2WG2A 4DCVA 1H0HA 4PG6A 2ZTSA 3DEFA 3WLQA 4MWTA 4X92A 3K0KA 2W6OA 1QYVA 2XYGA 2FCRA 5ICGA 2FPKA 1T9AA 3PFKA 4L3WA 1KC3A 2WJZB 5AVKA 5LD2B 5BW6B 1SUWA 3G59A 3IAXA 1W29A 1W96A 1HYGA 3RE1A 3V2GA 4ZIRA 1TM3E 4KV7A 3AKCA 3RUCA 3UJCA 1TCAA 1DOZA 2GN0A 2GPYA 2VYND 4H7PA 4DXAA 3ZHCA 2B8NA 1T6BY 3B7PA 3GH3A 3HGMA 1Q84A 4JNCA 3UV7A 4BFCA 1YRWA 4DSNA 1N2IA 1XEWX 1J5PA 4M7RA 4BO7A 5HRAA 1ZH2A 1TMGE 2GKGA 4GS5A 4LRTB 5AJTA 5TQ2A 4KXYA 1KKMA 3UWOA 5ALEA 1X7HA 2WIBA 3NG1A 4QA9A 3Q4GA 1QRSA 1RI1A 1KC1A 4BMCA 2PKWA 2I91A 4IDDA 1FIUA 3QEMB 3R3SA 3N6VA 1ST3A 5DW0A 1EXMA 4F6RA 3WB9A 2C7VA 3IE0A 4QEZA 2WA1A 3PQ7A 2A3RA 3LOQA 5D51S 5CT5A 2XGMA 3WA6A 3ND6A 4RQAA 2DY0A 1Q15A 2GAFA 4XVQA 3ZGNA 3CH7A 1AQYA 1D2CA 2NG1A 4GBMA 3ME5A 4DEXA 1JU4A 2HSJA 3SI7A 1P9WA 2GTHA 1SBIA 3E61A 3TEJA 4IQ4A 3UXMA 2LP4Y 3GV0A 3JWEA 3KQPA 1CFZA 1XAIA 2WJHA 1VRCA 1MT3A 1HNNA 3R77A 1AV6A 3FETA 2EGGA 1T9BA 4K9MA 1GUBA 3OFJA 3GRAA 1DI0A 1R6VA 1MFZA 2C2HA 3GUCA 3Q0TA 2JFXA 5EWMB 3S6JA 3SD7A 2Q4EA 2Y1FA 4F4FA 3EAFA 1H9BA 2HY7A 3H2ZA 4HDNA 4P36A 3H5AA 1NF9A 3PX2A 4B6FA 2FGJA 4EAQA 2R97A 3V1YA 5GVRA 4EKGA 1Z0KA 2ZRHA 2O8BA 1DIBA 2IYYA 3MCZA 2BGIA 2BISA 4JP2A 4ZKEA 2X4LA 4RABA 1SCQA 5HF8A 3FPSA 4BLRA 3D4NA 5CXSA 4A4DA 4LXXA 5E3JA 1IIBA 2ZM5A 3PITA 2UYQA 2ORWA 2ODQA 3WGTA 1MIHA 3R24A 2YTZA 3C8HA 4G5QA 3PNOA 4PIPA 3YASA 5C7YA 4QUDA 4N0EA 2OK8A 3VZPA 5SYAA 2JLZA 4OQ4A 1RTTA 4F93B 3FPFA 4J3NA 2RHGB 2I2DA 2G0TA 3C0KA 4KLAA 4DBVO 2JANA 2A59A 5DV9A 2NT4A 4BFVA 2WFLB 2OILA 2ZJZA 1V3TA 3EZYA 2XF8A 5ECYA 3QOXA 4GPBA 4NF2A 4S2EA 2QF7A 5BT8A 3ULKA 3CZRA 4OQZA 3WE7A 2H1VA 4BV9A 2N75A 5A4IS 3RHFA 4LJAA 5EJ2A 1A95A 4PXSA 4Z1MD 4AZ0B 1A9XB 1O9HA 1I5EA 1K92A 1YDMA 2W71A 1M6YA 3QTLA 4J29A 1RZRA 4G5FA 1P7CA 1Z0IA 1XTIA 2JI9A 1DCKA 1KIMA 2RSLA 2JJYA 2X0DA 1NF3A 4C22A 4URXR 1DJNA 4IBOA 3U7RA 3UPDA 3VZBA 3AUJB 4L4SA 1EYZA 2BLNA 2RHCA 4PC1A 3HJTA 1ABFA 1NRWA 3I45A 3AKZA 1KI8A 3T5GA 2H07A 4ZICA 3GPDG 3HBNA 1H6BA 1OIWA 5EIXA 1QH1B 4B7CA 4P5PA 5KNCH 4KFUA 2XGJA 5AW0A 1B93A 5EKDA 2CB0A 5AK5A 1Y7IA 5KZMB 4OXQA 1IM8A 5EKUA 3TKYA 3I5AA 5KKCA 4D0NA 1QHXA 2W98A 4KITB 4MUEA 2G8NA 4F04A 4B0PA 4PAMA 3ZXIA 3VO2A 1MZVA 1J39A 3F7MA 4JBWA 5M2QA 3C8ZA 2YOFA 4KYIB 2VEDA 4DIEA 4MCIA 4C07A 5BMVA 4UKDA 3ZXSA 3PIDA 1H2XA 4OBXA 4KPEC 4KFCA 1P2SA 3HDYA 4Q21A 5TQ0A 3T06B 4G65A 3GT0A 4N39A 4US1R 3NHMA 3FGNA 3A04A 1KFBB 5JRJA 4R0MA 2IPXA 4J4HA 2QX8A 5LBUA 2PUAA 3IRVA 4TKVB 2EW1A 3G2LA 2GCOB 2IYRA 1VG1A 3F6SA 3SM3A 1I7DA 3VPAA 3KHSA 3A4IA 3KWLA 1UMDA 5ALUA 1ZL2A 2VJDA 1MP0A 2PK3A 2HOQA 4TRNA 1ECFA 3N76A 1Z12A 4C78A 3Q0IA 1II0A 1SB9A 1FS5A 2FSFA 1U9YA 2ZULA 1WDWB 4ESVA 1JG4A 3CPHA 5TARA 4WLNA 4EJSB 1G8JA 1YE3A 3ICEA 3BQMB 1EXNA 4CT4B 2APJA 3HZRA 3PT9A 1DZ3A 2AJCA 2B30A 4B35A 4ZMRA 3ICVA 4UDNA 4RPKA 1KHTA 2WKPA 2IEGA 1CYDA 3HXPA 3I6QA 4I4TB 5KQLA 2CCKA 1O6GA 2GBPA 2YDYA 5LYJA 2CLIB 3DE3X 2GN4A 1NA5A 2OCAA 4DY6A 5FEUA 2WSSD 1HL7A 3B5JA 4L0MA 1WXFA 2OSVA 3VKVA 3EG5A 1LLQA 1APBA 2IXTA 1UAYA 1I94B 2CF6A 2RI0A 3T7KA 3NUZA 2HHHB 5FRDA 3RVLA 1G7CA 1ACLA 4C7JA 5JCOC 1QZUA 2IFTA 3ADPA 2BGKA 1G6HA 1MNQA 1H2HA 3A6DA 1X13A 3AP1A 3Q7IA 4G36A 4FJ2A 4E1AA 1GQQA 3QRWA 2LDXA 1U9ZA 1VPEA 1V7CA 2WMDA 1ECJA 4PF1A 3DHNA 4MROA 4HUTA 1Q11A 3DBHA 1V11B 1KVTA 3H3XA 3IV7A 4K9QA 4NS4A 4BDSA 4Z7OB 2H48A 1GGFA 2HN9A 3H17A 4LSWA 2AKEA 2NP7A 5LQDA 1X74A 4R0NA 5KYXA 3IOEA 4K9SA 1GV1A 3QNUA 4G8CA 1CD5A 2OPHA 3ZBUA 4YAKA 2XBMA 3I0ZA 1N6RA 1V5EA 3VZCA 2IWRA 2OXTA 3A9UA 5CIQA 1OOEA 3S2YA 3RADC 1GGKA 3QHPA 1NE7A 2ZTVA 3A2NA 3LWNA 5AVWA 3VKUA 1ZCZA 3Q5EA 1Z29A 4LHWA 4UZSA 1CHNA 3EVBA 3T12A 4PS0A 2HCBA 3PRKE 4UJ3A 3RYHA 4YMSA 4LAFA 2X2EA 1TVEA 4IILA 4RHXA 1MO2A 3M0EA 3NTUA 3ZKWB 5L45A 4DOMA 1Q44A 4DHEA 2Z9DA 2ABWA 4AZTA 1KFJB 1AGYA 4UBLA 3CRVA 4Y2GA 1CW2B 4RUKA 3HSKA 3F8SA 4B4WA 2HDOA 2IZ6A 3QH4A 5FI0B 2XNCA 4AZWA 1U2RA 3COSA 5KSOA 3HJCA 5JC8A 1E6EA 2YW2A 4FOTA 1A1VA 1T1SA 1DADA 2W7TA 3W7BA 1RWVA 3AM4A 2JLYA 2XLBA 4X00A 4P35A 3ZWQA 3EVZA 4CHGA 3OPNA 4JDUA 1N36B 3E1SA 1VGVA 3I2YX 1SN7A 2Q2VA 2RE8A 5AKHA 4A03A 4ER6A 1R3DA 1J1UA 2BR5A 2ILVA 3HZHA 1XCGB 2A0YA 4NONA 5BR1A 3RO7A 4HGNA 4PYRA 4KXFB 3MCVA 4G1EB 3CPJB 3NC0C 2W0SA 1OTHA 3GJ5A 1BTOA 3DWEX 1WD7A 2JLRA 3O2SB 3SBOA 1G16A 1VJ0A 2Y0EA 1BS1A 3D4BA 3GYBA 1Y81A 2E1RA 4TUYA 2YZMA 4UFNA 3VPFA 5GOZA 1F2TB 2CBZA 1GL3A 1P39A 2AFIB 4QDUA 1VLZA 1Z7GA 3D6FA 5JQWA 3H97A 2ZI9A 1R2QA 4EB3A 2DPLA 2Z4TA 2IUFA 1WNTA 2YXLA 3M49A 3R41A 5TR9A 5FADA 3QENA 1GRRA 4X7PA 2LGJA 3AFOA 1H65A 1KY4A 1NUQA 3N8GA 4I1RA 1HYHA 4KJZA 2ZU0C 4H1UA 1WZEA 4DR1B 3DKIA 4XDZA 4IZIA 1H1DA 2FK7A 4NENA 4TN5A 4CG3A 4QT4A 4DA4A 2WUWE 4B79A 3I09A 2FPMA 2A92A 2HC9A 1SG9A 2VHZA 5J59A 3OPYA 4LXYA 3A9CA 1U81A 5JAHA 3RNLA 4DFDA 1QCZA 2VDKB 4P6VF 4BVBA 4EGFA 1SUFA 4G56A 2XTZA 4UMDA 3Q88A 4DAEA 5FPKA 3R2JA 1PQWA 4MWEA 5KQRA 4KXMA 3CUTA 4MRRA 4RLFA 3INGA 1UL1X 1Z06A 1NV8A 1Z6ZA 3NBUA 3NWJA 2VT3A 1CEEA 2JLSA 3H2KA 2WWFA 1AC5A 1HTWA 4BE4A 5IRCD 1OSNA 4P4LA 4Q4HB 1JIIA 3VHXA 1DTWB 4OMUA 1OXKB 3MMNA 4ENPA 4PE5B 1DG9A 3M1AA 1BO6A 1SUBA 1KJZA 3A1WA 1SIUA 1MO3A 3FPKA 4PYLA 4IDOA 5L3ZA 4OB7A 4AWAA 1MAVA 2BKLA 3BA6A 1XMXA 2I29A 3WRVA 3HFSA 3Q1KA 1FUIA 1WW2A 4R1MA 1ZN8A 1G7SA 5F7ZA 1BN6A 2AVNA 1X0XA 4ZYXA 4GMDA 4UVHA 3OC6A 3RVBA 4HDSA 2ECPA 3LHSA 1CY1A 1QHYA 3KJQA 3MUOA 2VT2A 4OV6B 4BMYA 4F9GA 5FWXB 4KBYA 1TD9A 2VHVA 4MS4B 1C9YA 4GKJB 1SHTX 5DXFA 4AYXA 1DQRA 4BHTA 5IPFA 4FXPA 1EK1A 1GSAA 2NSYA 3C3DA 4QJ5A 5IAJA 4U7TB 4MPTA 1GSIA 1SUDA 3PTZA 2HPVA 7MHTA 3IUMA 2D7DA 4CEJB 4HX9A 1A8HA 1ZWKA 3JAKA 4IH1A 4R05A 3V80A 3RC7A 4C05A 4EYSA 1JHUA 4E14A 4G0XA 5IS2A 2CW5A 4MA4A 3G5LA 2FEWB 4HDKA 4DMUB 3H0KA 5DF1A 1KJQA 5C5EA 1FP7A 5EWLB 1MO5A 3VR3D 3VV3A 5JBQA 2J30A 1A7UA 4NK5A 3BMQA 1EG2A 2FWNA 2XTJA 2H11A 4QASA 3WGQA 4YUVA 3P1JA 3GJYA 4QARA 4G1VA 5BOSB 5C5CA 2ANBA 3UAWA 3AESB 1NQXA 4PFQA 1EUQA 2RHDA 3ELYA 1I14A 1W8DA 3GNQA 4O2AF 4G89A 1P9LA 1XJ0A 3R7NA 3U3XA 1HR0B 1OB5A 3DW1X 4JLUA 1D3AA 2HK7A 3DNFA 1ZGHA 3FAKA 1QIHA 1FMTA 3I9OA 1A8QA 1NP6A 1U1FA 1S4QA 2GF9A 4Q9DA 3V6MA 1GUFA 3H5VA 3LT4A 4HSGA 1EGHA 3WFIA 2NV6A 1JHVA 2Y67A 4R81A 2RGEA 3B51X 2B36A 2NXJA 3IGFA 3EGXB 1NVXQ 2G83A 1KDYA 4Y6LA 4BO1A 1JVBA 3DLCA 2F1KA 4YCJA 2QRMA 3OTWA 1NF2A 4WUVA 5AMXA 2VUUA 5T41A 1Z9BA 3K4QA 2NV2B 5T67A 3U80A 4GF5A 4O1HA 2VXYA 3BGVA 4J4TA 4Q9NA 3CSSA 1QGUA 1V8DA 3N2KA 3Q15C 4CFYA 2D6FA 1JXMA 4RF4A 3HWWA 4H6XA 4DC0A 2P9YA 3NI2A 3S8EA 1CUIA 1PR6A 1IJEA 4KXQA 3CR7A 1QSGA 3LIIA 6LDHA 1SC6A 5ALZA 1XCJA 3UG7A 3QWHA 4OXIA 1YUBA 4I2VA 1T25A 4RMJA 4C0SA 1JGTA 2QROA 3B82A 5CVVA 4CMKA 5I7OA 1OYYA 3U6BA 5G1NA 4FD2A 3GLHA 1QZ3A 5TC4A 3VGJA 2A3NA 2HFKA 2J4CA 4YMHA 3KBOA 4LF7B 1KBQA 1Z15A 3QY0A 4NAVA 1A2BA 1WV1A 4PZUA 2H54A 1SUAA 3WLHA 1XUOA 1P73A 2Z04A 5HSGA 1DWPA 2J7PD 3SC2A 2MSNA 3IA7A 5E2BA 2B8WA 3LYLA 4IZHA 4U0KA 1DPGA 2NVUA 4ZP1A 5CD1A 3F90A 5LZ8A 4MW6A 2DWOA 3FIUA 1AE1A 3V34A 2ZCVA 2JCGA 4F11A 1V9CA 4EY4A 5JRDS 3H1BA 4ZU1X 1BMQA 1V41E 2FP4B 4RDIA 1JFVA 4ZO9A 3VR4H 3VPDA 2Z2ZA 4E22A 3CVXA 5I7UA 1VKZA 3R5FA 4HWTA 4JLDA 2ZBEA 3NC1C 1V7ZA 4P7FA 4P8RA 4EW3A 5DIZA 1TAGA 4D6XA 1NBMD 2EGHA 5DLEA 1GPH1 2HRZA 1TYAE 4BV8A 3IO3A 3UAGA 3QYFA 2HJ9A 4CMCA 3U7IA 2IYZA 3KAJA 3RFXA 3UC9A 2BMAA 4HQOA 3M6WA 4ZFNA 1IJKA 1LJLA 1QO7A 3IBSA 3PUZA 4O4LB 1Y8QA 2A1UA 1Z4NA 3PYXA 2JH9A 1NIPA 1XDWA 4CGZA 2OAQ1 3NAMA 1JECA 3O8OA 2A94A 2WZDA 3FLBA 3NPAA 4R3WA 4X8OA 2GF2A 4HB4A 4ALIA 1HC7A 1SVKA 2M6KA 2J6HA 3GR6A 1RRCA 4XB6B 2PKQO 4PV7A 1ZJYA 3A10A 3BQ9A 1J7JA 1RP7A 5EAIA 2C4WA 2W11A 2BDEA 4EPWA 1ZGZA 3EEOA 2J31A 4OI0A 4OUDA 5HIIA 3OWXA 2VDOB 1QG4A 1GUDA 4JA2A 3IAEA 4DMLA 4JI0B 5IC6A 3HABA 1Y1SA 1OY1A 5G2OA 1M6VA 4FWIB 3ZJ4A 5HCNA 2J9RA 3ZW8A 1W5TA 2EF1A 3FDIA 3X1JA 3F5SA 5IHPA 5GADl 1DC8A 2CHVA 4R8VA 5JFTA 2PX0A 3OOSA 1HETA 1XZNA 1V47A 4PPNA 1FTQA 5ALKA 1RM3A 1U11A 2J32A 3MD9A 3PHLA 3KTOA 1XMIA 1D6SA 5CVCA 4V1CI 4MTCA 4OGFA 1AXRA 4K2HA 5FIUA 4DR5B 1RHMA 2FG7C 3VHRA 2D59A 5I8WA 3JQ6A 5LYYA 2NT3A 2ODTX 1YA6A 3TN7A 1JJIA 2OV6A 4GT1A 3HJGA 1PJCA 3EBPA 2WK1A 5ALLA 4K9KA 5AHWA 2E4WA 3HNOA 5G0SA 2OEPA 3X1XA 4EF4A 2IHBA 3GEMA 1ZM3A 2RIRA 2W8BA 3KQHA 1XK7A 2RGAA 4TS3A 1OLSB 1ZUD1 4KUEA 4WN3A 1SVIA 1F7UA 4ROSA 1E94E 4HDRA 5ALJA 2FOLA 3D3QA 3QYJA 3IIKA 5KTRA 5AD1A 3IOCA 2P2LA 2R7KA 2JD1A 2ISQA 1W0KD 2QM0A 3C6KA 1VKNA 3VR1A 2QM3A 3UWSA 3ICQB 3V1MA 4PTZA 4QPPA 5BPFA 1J8MF 2B0CA 3ITNA 1DP4A 1TRHA 5IJZA 2ID4A 4IIBA 1Y5MA 2EG9A 2FRXA 3FI9A 1XZCA 2I7TA 4GL2A 4G4JA 1YT5A 2UVDA 4OHVA 1ICEA 4DG9A 4XWOA 1VL0A 1DEOA 1E7WA 1T4DA 1KJ9A 1TAQA 1TYEB 3Q2IA 3FZEA 4DF3A 4IGKA 2XR1A 1XN1A 2O3TA 3FUCA 4DABA 3PQ3A 1LNSA 3AKDA 2OECA 3BJEA 4M0MA 3RU9A 3V2HA 4O8CA 1UJ4A 4EMSA 3QIVA 4Q1CA 4R0VA 1NJ5A 4N49A 4YJ2F 2DLNA 3AP2A 2IDKA 4P9NA 4GSLA 3C3JA 3ZI7A 4BWGA 3QEKA 2WFMA 4X71A 1SC1A 2ZOSA 1LDMA 2EWMA 2C2KA 5TMPA 4HBZA 1HGXA 1N6HA 2HMWA 1C7RA 2GR9A 3FN4A 1ZRMA 3IEPA 4X95A 1QTRA 2WIKA 1YZYA 4GUDA 1L7VC 1N9KA 2CNWA 1EIZA 1XJQA 1N2EA 2ZJ6A 1YCHA 3PGA1 1HQKA 2QI9F 4HATA 1VLJA 5JMPA 4DG8A 3FHTA 2R62A 1HDYA 2QNRA 3BH7A 3KKQA 1C8LA 1NBOA 1FZTA 1GTMA 1VPDA 2N46A 3CVJA 4QELA 1YTUA 4TTAA 1NBME 4HWOA 1LNQA 1Z6XA 2OCIA 1KI9A 1QZZA 3BE6A 3SIXA 3T5CA 4L7QA 2FQXA 3M8KA 2A0UA 2GILA 1L7BA 4UHEA 1JNYA 1PTKA 2R2GA 4MWDA 2BEVA 4RY8A 1PUJA 4TTTS 4KNYA 1RCTE 1EWYA 3A3NA 3ZY4A 5BVGA 3KE9A 2BHNA 1KY5A 3JD4A 3PHGA 4ZRMA 4HEJA 4KQFA 1NURA 4FFWA 221PA 5IG2A 1IN7A 1JN0A 2YS6A 1KEWA 2JIOA 3DZDA 5HFNA 3VNQA 2UZ1A 2VSXA 1Z68A 3K1YA 4NICA 1AKYA 1CR4A 2AFIE 3HUFA 3ZE7A 3R75A 3ZOZA 2H7XA 1G8PA 1DRUA 3FCUB 3HYNA 1A8PA 2O4UX 2GN8A 2RHOA 1MQ8B 2VK1A 4IHQA 4R2JA 3FTEA 3MK31 2FSVA 3P7MA 1MHPA 2X76A 4TM8A 3C7AA 2R6DA 3QVVA 5TRTA 5EXDA 3HU1A 3CURA 3UANA 5CEEA 2YVQA 2IU6A 4P82A 5KI6A 1FP4B 1U8ZA 1P72A 4AYTA 4EIWA 2AF3C 5SYNA 1A9OA 2CLCX 1Z0ZA 4TWAA 3IB3A 3MJFA 4E5DA 2VPPA 3RS9A 1JR6A 3V4VB 5AJXA 3FPJA 4CG1A 1NYQA 2HDHA 2QTTA 3LPAA 3P5BA 3ETNA 3I3SR 4ICIA 1R4MB 4L5JA 4UUOA 2VNJA 1UOOA 3T54A 2AOUA 3MYRA 3PD1A 4MUGA 2FFJA 4PLPA 5L4NA 1SKMA 1NVTA 3IQZA 3IVMA 4B09A 5ITSA 3GJRA 4UEWA 3F4BA 2J85A 3ZHVA 1JQ5A 2VXBA 4DRYA 1IAQA 4KYUA 2OBYA 1L7DA 3ENVA 4RSHA 4BBAA 4DIUA 1ZNYA 2GFQA 2HHLA 5CD9A 1NPYA 1JYSA 1L4KA 1U4NA 2BEWA 4LDZA 3CWZA 3SJUA 2NSJA 4BRZA 2B4YA 3R3UA 3KSDO 4Q7LA 3TEFA 3QFTA 4O02B 4F1KA 2MMGA 2X15A 1E18A 3K2QA 3ISVA 4MVJI 5F9MA 1PLLA 1Y89A 4M9UA 4ZGBA 5B4VA 3I62A 3OTGA 3KFVA 1UMCA 4XWKA 2CJFA 2OXEA 2I0FA 1BVYF 2MYPA 4GECA 4LY0A 5HGXA 1WPQA 1WU8A 4KO3S 1XK6A 2ZPAA 5C4MA 1WXGA 1X86B 3KZCA 3WQQA 1VMIA 4PGGA 1GHTA 1N5IA 2BDTA 2X8JA 1M75A 5CVTA 3K0EA 1FRNA 2J9FB 1SFRA 3A32A 5BRNA 2BUAA 4NR0A 3V6LA 5CFPA 3X1MA 3FZGA 5ER6A 2HA3A 2ZB2A 3QUSA 4NCBA 2A7XA 4P80A 4B48A 2R1UA 1Z2PX 3HDGA 4ZXFA 1TEHA 4OHOA 5BWBA 3BORA 4QOFA 2XTNA 4B3BA 1EK6A 1BEUB 1ZY2A 3ZOKA 3ZVKA 2W6ID 5F2OA 4UCWA 4WLUA 2XECA 1U1CA 3MJCA 1V7QA 3ZHRA 4Y1EA 2E0IA 2NVWA 4YJ3B 2AOTB 4WECA 1MD9A 1NQTA 1L7AA 4KQ6A 1ZW1A 4JI4B 4C2UA 1QG6A 2H1CA 1FDWA 2JIQA 3ABZA 3P19A 3VKFA 4CKYA 1KMCA 4A6XA 4U7WA 3HA2A 2I2WA 4H4DA 4RIFA 4LTNA 2C2WA 2QTFA 1Q6YA 4NFYA 4PHFA 1XWWA 2BKVA 1FFYA 1FFAA 2V7EA 4UMEA 4Q3AA 1RYFA 3QKRA 5C53B 1OAOC 4NOJA 4ABYA 1NLMA 5TMBA 4Z4GA 1HFKA 2VO1A 4Z53A 4JJ8A 1UFVA 3LHDA 4O1IA 3OKAA 1N78A 3PT5A 1CIVA 1T3LA 3SYMA 3FE2A 3A2MA 4YLGA 5H4GA 4C0JA 1L5VA 1W44A 1YOVB 4JJFA 4BZWA 4HLNA 2FSVC 2FSPA 4URHA 5EUCA 1WLYA 2QLMA 1UZUA 2RGNA 4NMMA 2ZIAA 3NPMA 2C54A 2ZITA 3KZNA 3ZDFA 5KSPA 1GAWA 2J5RA 5G0TA 2Y3IA 5BQXA 2VDVE 3QE4A 1VJ5A 1WMEA 1WP9A 4HTFA 4JFAA 1FRFS 4M9RA 3VX4A 3WBFA 3W5AA 4Y2UA 5AXCA 3B3FA 4ZCSA 4GBGA 1CJTC 4Z86A 5EMMA 1XKXA 2JEZA 3QBDA 4UATA 3TTUA 1P7ZA 3PWTA 5B1YA 2B0JA 2JFNA 3HCOA 4L08A 4BPRA 1M2VB 2XB8A 3G7SA 2BUCA 4XGQA 1Y3DE 3VXKA 4W5OA 1X8LA 4Z0PA 3RBVA 1GYQA 5IH7A 3H2SA 3IT2A 3LX4A 4LF4B 1TM2A 1NLYA 1V1MB 4KL8S 3R3HA 1SBYA 3HXKA 1ND5A 1B6SA 3LK7A 4GPZA 2V3CC 4BCDA 4X60A 4JYCA 4DQXA 2J9ZB 2XE7A 4UXHA 5CA1A 2Z6UA 5KYUA 1CUZA 1HKUA 3ZIDA 1HORA 3ZY6A 5HP4A 2XKKA 4NH0A 2ZYVX 3HNPA 3AHGA 4RTRA 2IDJA 4TTJA 4ASUA 1KI4A 3CW2A 4CIDA 2CVZA 2LTAA 1FVFA 1K63A 3TUJC 4JXKA 4W1QA 1QAOA 2O5EA 1DAPA 3DONA 1Y1PA 1ONPA 3KKKA 4CF7A 4B9AA 4IEEA 3ESCA 3KFXA 1R0KA 1SXJB 4IIUA 3OZIA 5DMHA 2O5CA 2IYEA 5LDHA 5K0SA 2RGRA 5B2ZA 2CMFA 1A69A 1DUVG 2QMYA 5CK4A 2Z6VA 4RIGA 1FB5A 5C7LO 4GBJA 2Y4NA 3IBYA 1RHUA 5DH9A 4AJLA 4KQMA 2C7RA 2I8AA 3NHKA 4OOFA 5KYGA 4EG3A 3C6XA 5HZGA 4MW2A 1I9CA 3N2IA 5DM2A 2QVCA 3BSFA 4HOYA 4IFIA 3KYCB 3R9IA 1RAAA 3WDKA 3ASVA 3ZCQA 1AGNA 1CJSA 1NBHA 4LZPA 3UICA 4JSYA 3ZHUA 1QX3A 4OQQA 2PS9A 3UHOA 3QV2A 4MB6A 3OOHA 1YH3A 3F2VA 2H59A 3GT4A 1DCMA 2A4MA 5AUQA 3T94A 4GKAA 2JD2A 3DAYA 4DILA 5C1PA 4B8WA 4F9TA 2QTMA 1W5BA 2V98A 4QNRA 3VM6A 4XIFA 1AUPA 4D80A 3NDJA 2BFDB 2W2MA 2YWJA 2EJBA 3KDPA 3A3OA 3LY9A 4GRAA 1GAEO 4LCBA 1RJWA 4QBTA 4U2EA 3A7DA 1RWPA 2A5FA 1RWWA 3GK3A 3F78A 1P0FA 4JLJA 4JC8A 4ZT4A 1XLVA 3PLNA 1GNTA 4QQNA 3W6ZA 4DC1A 4G1MB 5DYWA 3ORHA 1TCVA 2HJGA 1ZPDA 2NU9B 3EQ8A 2CB9A 1IY0A 2RBGA 3WYBA 421PA 5ESRA 4OBWA 5DOZA 1QCDA 4Y6QA 3KXIA 5BWMA 3NAZA 4CEHB 4AICA 2P9EA 3BN3A 1MJHA 4M1SA 3CX7A 4FBMA 2FETA 5KS2A 1NLFA 1GZ5A 3U1VA 5KX5B 4BLOA 3ACBA 3RC3A 4HO1X 1NMEA 4XIIA 4YT2A 2IT1A 4ACAA 1OTYA 1Q1NA 4Y1FA 1XRRA 2B4TO 4NK4A 4QRHA 2FB9A 1XJCA 4UPDA 1ORDA 1PS0A 3ROQA 1E5QA 3I64A 3LXMA 2ZUSA 3L6OO 3CCCA 4IICA 5JSHA 3T5TA 2WP8J 1QHGA 4Y67A 4B73A 4JLBA 3JV7A 1QQ7A 4EBBA 1VMEA 2OD9A 3JYLA 4YMLA 3OU7A 4WDRA 4UDXX 4OHBA 5DLDA 1WCYA 3HU5A 4PXAA 2GYVA 4EK9A 1QFXA 3E9CA 3V1LA 3N3BC 1M76A 3GFFA 4LV8B 3OIVA 3TYXA 2ZJYA 2G0NA 2JH3A 5K3FB 4M9SA 1VFPA 3ZZ1A 1XKQA 2QQEA 4AWBA 2CYAA 4BV3A 3D4IA 1TM1E 2AS0A 3SZGA 2XE6A 3GLFA 2O0LA 3NXSA 4B5LA 1VDMA 1UP7A 2CSUA 1FYDA 1GWNA 3CKKA 4JL5A 4LEIA 1FTYA 4X6UA 2WWWA 3A6GA 1CR1A 4NVRA 4O0MA 5DBOA 5FD8A 3OX4A 3BJZA 5EEGA 2OZVA 3AWIA 3LECA 4HWGA 3TCNA 3PIRA 3ND7A 3ORSA 1PV1A 3LW7A 4IZ6A 4WASA 1H05A 2P6MA 4LZZA 4WKPA 2IU0A 1J2EA 2ZT6A 3KELA 4QNMA 5BSWA 4FWTA 3Q8MA 3NYQA 3RRBA 1V16A 2IOHA 1HDCA 3H3JA 2XUFA 4FDTA 4NHEA 3WQSB 3T9EA 4I4IA 4EVRA 2IY7A 3AR8A 2MSDB 4U7HA 2ESRA 2F9FA 1LLUA 4DWWA 4IEFB 5CT4A 1LK0A 4NCKA 3AV3A 3ZN2A 2ZETA 3P0RA 3BZWA 4BO0A 1E1KA 4NDAA 1D2GA 1FZQA 4JOBA 4ONEA 2MSKA 3O2QB 5AO9A 1ORVA 4Y9TA 1TOAA 3U3JA 1GKIA 2NUAB 2J5KA 1ZCBA 1LBQA 4JVLA 2B2NA 5BSUA 5IASA 2WMOB 1ZGBA 1SCUA 3OHPA 4RVGA 4CLRA 4O4IF 3MF4A 2N9UA 2GRAA 2XEDA 3EXIB 3W8EA 2NP6A 4XLTA 2G3YA 3B6ZA 1QKJA 5IJAA 3VYUB 4EA8A 2O8DB 1KYZA 2GPAA 3Q2KA 3NKVA 4E7PA 5IWCA 3HCPA 3G8DA 1I1HA 1E3IA 4B3FX 2WWVD 2YMLA 2JFQA 4Q1FA 4A3SA 2CNLA 3L4BC 1U7XA 4KKVA 4OLFA 3LHKA 3F6CA 2IPOA 4Q4JB 1XYYA 2G70A 4BECA 3WYEA 1J49A 1JVSA 3FPAA 4JU9A 3ESZA 4MUIA 3ZEAA 4E15A 1DMRA 3I01M 1QFYA 4DV6B 2CXUA 4LECA 5E9QA 1E99A 4M9ZA 4HHEA 1T5BA 1UZMA 2PN1A 2CVQA 2J0UA 5CT8A 4HRVA 3LZCA 2FPGA 1BD4A 1L4EA 2DU8A 2PL3A 2XZPA 2W2NA 1FX0A 3CLUD 1G1AA 2ZRNA 2JBAA 3PU6A 5H3HA 3DMTC 3VH4A 4EMUA 2O4CA 2Z2YA 4V0RA 1XZ8A 1P4RA 1HUQA 1NI4B 3QXJA 5B64A 3N7TA 2WHYA 3QPBA 2HU5A 2ZT8A 5I7SA 2XXAA 1LRJA 2BM0A 1KSHA 1SOVA 1TTQB 1Y1TA 3LCUA 1XNHA 1P29A 3PR3A 3C6QA 6GPBA 5CHEA 3TS1A 2P9ZA 1KU0A 2V03A 2VDRB 4ZOCA 4BB9A 3KB6A 4QUEA 4WHMA 3RS5A 3AL0C 3NM4A 3VR5H 2BGWA 1W34A 4CV2A 3FMFA 1MLDA 3P2EA 2JAHA 4HXYA 4J49A 1AOXA 4E21A 1RBZA 4DAOA 3V5NA 1KI7A 2BTQB 1YDFA 1CUWA 2O0MA 1T8RA 1EMDA 2X14A 4MGKR 2WINI 4Y2YA 4H6WA 5AJVB 1NXSA 3KPVA 1SXJD 1KZYC 4B2IA 5EJEA 4HZIA 2SCUB 3NO4A 4GRIA 2QV7A 5DBEX 5B6PA 2ZROA 5EXSA 1HT1E 3TE6A 4Z99A 5ALVA 5CXQA 4KFSA 2JLWA 4F5EA 1OWLA 3P9KA 4JD5A 4GM0A 3TMYA 3BE8A 1ADBA 1V43A 4DLKA 2FTKE 4AB1A 4JEUA 1VPWA 3FDFA 4XJVA 3PNSA 4RXMA 1UT6A 3GG9A 4EZBA 4M76B 1UZNA 1SAYA 1VE5A 2AG0A 4PZLA 5DEIA 4PBTA 1WPGA 2DH6A 5LPNA 2O3QA 4MHTA 3F0TA 1ND6A 4GGPA 1OAAA 2OXIA 3K73O 1DEHA 2V1XA 2OHVA 2R3SA 3IHTA 4GXRA 4ZC1A 1TGVA 4DJJA 1N1EA 2GA9A 2O2JA 2WMNB 4CKBB 2HDWA 4W4TA 4CODB 1YJQA 3IOMA 3OCUA 1NM5A 1W52X 1Z88A 3PFNA 4DB4A 3G17A 5EC8A 3CRW1 1HDEA 1Q14A 1SHLA 2FKNA 3EX7C 1Z74A 1RQRA 1A2OA 4JYPA 3T99A 4E88A 4YA6A 1QPGA 3VYVA 3KU4A 1K6EA 2Y05A 3ZXYA 4Y1GA 5KJFA 3TAXA 1N5OX 1YB6A 2FZVA 2FNAA 4PAQA 2C58A 1FDSA 3WAKA 1H6CA 3F7OA 3H4MA 1F1JA 2BY4A 2I1QA 5EHIA 5A71A 3SN6A 2BI8A 4Q7QA 5BUSA 4H2DA 1PV4A 4AUNA 2CWDA 2J5QA 5FWNA 2ZPUA 2IIVA 3R4VA 1UK9A 1XVTA 5A4JA 1CB7A 3GJ4A 2HREA 1E3WA 4BNVA 1CHDA 1EFTA 4WX2B 5CFRA 4ZIRB 3LBHA 3NASA 4FMCB 4ZARA 3A6FA 4KE7A 1AS0A 3CC8A 1KQNA 1C9NA 3F6BX 4V38A 5FBKA 1PYGA 2C61A 2D3WA 1GAJA 2GRJA 2ZIXA 3FUWA 4IM7A 1EE2A 4I3HA 3TZCA 2HGZA 5CXUA 5DK4A 3WNQA 5LZ9A 1Y9EA 5DHTA 1WP4A 2I7VA 1GTG1 3DJFA 2ZB4A 1BDBA 3GRYA 4S1TA 4XH9B 5KNBA 3RJ5A 4NCAA 3AEZA 5E95A 2FMTA 2BJWA 2R8RA 4NNPA 3GL9A 2WQ6A 2I4IA 2J8ZA 4F6RB 1YZFA 3GW8A 1YK0A 3BFVA 1AQUA 1JFRA 3BFJA 3BZUA 2Q3EA 2W70A 4ZI5A 4OI4A 3NC4A 3RYFA 5CDYA 4R1TA 3SLKA 1E77A 1CY7A 4AF8A 1FU7A 3IQDB 1NVUQ 3F96A 3D5EA 3I6BA 1W5AA 3H18A 3MQFA 4RAOA 5SZKB 1BMTA 1JH8A 1KKLA 1JVNA 5FYDA 5HKKD 4GQAA 5KPDA 4DC9A 1MBZA 1M9NA 4QBIA 2WTNA 3AONB 1Y7TA 4Z9YA 3RS4A 2EKZA 3DL4A 4QXQA 4DLRA 4BQQA 3RSZA 3OCJA 2RGYA 2FPLA 1YI1A 3T9FA 4YCBA 3WP1B 3K2IA 2B2XA 1R50A 4CHTA 1C8BA 1LI5A 3OQJA 5D84A 3L0SA 5FPPA 2P2DA 4HDNB 2WMYA 4DBLC 2BMEA 2XYVA 5G0UA 5CW2A 4P98A 3TSZA 5DX8A 4MICA 1NW4A 3RIXA 2ARKA 5H0IA 4U9IS 3U9LA 1ECBA 4BO6A 4YRLA 4NBNA 4KQ2A 1ZZEA 2VUIB 2GXQA 4G26A 5ICCA 4GYYA 4BWVA 1Z34A 4CM3A 1MEJA 1ZO8A 3L7CA 3GLRA 2R6FA 4HGPA 4ZQCB 4EFNA 1YZKA 5KNLA 5HTKA 2OV3A 3DM9B 1FVOA 1UJMA 4AS2A 4NESA 3WB0A 5IZCA 2FVYA 2Q9UA 4QLOA 4K6FA 3X1DA 4ENWA 2G7MC 2WT4A 3LVFO 2JZCA 3OQBA 5A5GA 3JYNA 3OLVA 4CWAA 2VWQA 4Q03A 2VF8A 3G0HA 3VNAA 5AM0A 2ZQ5A 2Q3DA 4IUCS 2J4DA 1DV1A 3MNFA 3MRXA 4PX5A 1E96A 3S2UA 4BNZA 4ZYZA 5AI6A 4HS9A 4JQOA 3CJTA 4HNSA 1YQXA 2JFWA 2V7QA 1SY7A 3F46A 2V96A 1BAPA 4K46A 2FW0A 2G9UA 3CB4A 2GZ1A 4GEKA 1HMYA 4MTLA 4D56A 4YLEA 1EX6A 3BSWA 4NJOA 1Y6JA 3B9BA 3FSGD 4FCCA 2Z4RA 5IJ9A 1JLLA 4YS6A 3CONA 1Y3HA 5ESDA 3PC7A 2TYSB 4QT0A 4N5MA 5BY2A 4JR1A 2P6NA 4EYEA 2QGNA 4ZZIA 1XLWA 3O1JC 2OFWA 4N41A 4GI3A 3RWBA 4FB5A 4NTZA 4BGDA 2QW1A 4GMFA 3AB8A 3AI7A 4KK3A 1KEKA 4F3TA 4NECA 1MC1A 1N2SA 3AK4A 2LZ0A 1CJMA 5LUBA 3AW9A 3IPYA 1PT5A 5CR9A 1TT7A 4EA6A 1K86A 3I9JA 4V02A 4IPTA 2FQ1A 3UKDA 1XEXB 2WTMA 3ID6C 4M88A 3SQMA 4D4MA 1Q7RA 3DWIA 2VHTA 4BO8A 1K68A 2Z6QA 1OLOA 1Y63A 2OLEA 1Y1LA 1B1AA 1YFKA 1O6CA 1V45E 3BWEA 3MGKA 3ZDDA 1Z5GA 3KXKA 3JS5A 1R8JA 4LOAA 4WW0A 3WB2A 5BMVB 3GGCA 2F1JA 1EHIA 1Z13A 2J45A 3DDCA 4KI0A 2I6QA 4ZPXA 5G4LA 5TQ0B 4BAUA 2BKUA 2DAPA 3CLRC 3EFOA 1YRYE 4DNOA 4M8LA 2VHEA 1RAEA 2JGJA 2Y2VA 3PRYA 3VZRA 3W1VA 4W8GA 1L5KA 4PWZA 1YR9A 4R16A 5KHAA 5MN4A 3NXKA 4E51A 1UMDB 1KS9A 1T91A 3DE0X 3TRJA 4IRMA 2Q2WA 4OJMX 5MN6A 1DXYA 2WYIA 2HJRA 2P40A 3ZZNA 4BNGA 4D3DA 3L43A 2A1TR 4WJKB 4PYKA 3OZEA 3N7UA 3A37A 4EB0A 1FUYB 1CB0A 4RLSA 3BYZA 1I4WA 2NSHA 3OIFA 2NTYC 4H3SA 1Z2EA 5LP6A 1SCKA 2L19A 4F4DA 2YNMD 5LYJB 4LGYA 2XB6A 1QYDA 2DPHA 2J0QA 2OWEA 3VPSA 4EWLA 4KXVA 4MP8A 1B2RA 1F60A 4DW8A 5IFLA 3I05A 3FI0A 1EFCA 1NULA 2C4VA 5E9AA 5JJLA 3H5LA 1YCDA 1KJJA 4EHFA 1NX6A 2QZPA 4ETIA 2Q1UA 5F7OA 1WB6A 1H42A 5T8KC 3IYLW 7GPBA 4AO6A 1PFGA 4DDKA 4N82A 2NUPA 3EPHA 4G5GA 2GK7A 1QXSA 2GWRA 3DV9A 3G7NA 3K2EA 5GONF 3DBHB 2CUNA 3ZBPA 2ZR8A 3GVXA 2SKDA 3LRPA 4Y2PA 3R5HA 3IAS1 2QN6A 4RELA 4BZQA 1QR2A 1XGKA 5IMBA 3P9YA 2E6UX 4RACA 5LLSA 4RYDA 5KYXB 4W7HA 4AM8A 2C4KA 4RMGA 3M1LA 3Q87B 3LT5A 2ZSDA 4DDMA 1GLGA 4ZAXA 1YJ5A 4UAJA 4CN9A 1ZVMA 3ZDAA 3HE3A 1KORA 3K70C 3A3KA 2Q27A 4NHOA 1U4SA 1Z5VA 5E6SA 2YJ5A 5PNTA 2VP0A 4ZCTA 2J09A 3R0XA 3OIWA 3SF8A 1U2SA 1DXOA 3JY6A 4JUAA 4TYMA 3RYHB 3EYAA 1SVSA 3IFSA 3OLYA 5C3UA 5M29A 2YHSA 1PWHA 5A05A 5CVDA 1Z7BA 1BGVA 1R0RE 4DV3B 3PGMA 1OH6A 1J0AA 1N7IA 2P0YA 4CETA 3W5HA 3OZRA 5F23A 1L7XA 2FRVA 4WOCA 4CL0A 1NYLA 3KV3O 3CUKA 4FX2A 4GOOD 3FGOA 1E8DA 2H1WA 4A8JC 1IN5A 2J3DA 1Z0SA 1P0CA 3KCNA 1P4GA 1PWZA 2BRUC 2IEAA 3C7KA 3ONEA 4YCCA 2C59A 1LGYA 4AI6A 4WKGA 1DO8A 3D2LA 3M6VA 1HLFA 5L51A 1OV6A 4IMIB 1PF7E 3NWBA 4BTLA 1QUEA 4KGVA 3GBVA 4AG6A 5DLQC 2WF9A 3WIUA 1N7HA 3SQOA 1IOLA 1AMOA 2ID9A 3HB0A 1QAQA 4CG0A 5KJ6A 1U2TA 3SR4A 1W59A 4W5RA 3JQDA 3TFQA 3ZK9A 1VL5A 3ZY5A 5ECDA 4FBGA 2HMAA