3FVRA

Crystal structure of acetyl xylan esterase from bacillus pumilus, monoclinic crystal form i
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
320
structure length
320
Chain Sequence
b'MQLFDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEAEPTLESYDYPVKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDGGIHDIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYYYRGVYLDAVRALEVIQSFPEVDEHRIGVIGGSQGGALAIAAAALSDIPKVVVADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEKAFETLSYFDLINLAGWVKQPTLMAIGLIDKITPPSTVFAAYNHLETDKDLKVYRYFGHEFIPAFQTEKLSFLQKHLLLST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyl xylan esterase
molecule tags Hydrolase
source organism Bacillus pumilus
publication title Structural and functional studies of Bacillus pumilus acetyl xylan esterase
rcsb
total genus 117
structure length 320
sequence length 320
chains with identical sequence B, C, D, E, F, G, H, I, L, M, N
ec nomenclature ec 3.1.1.6: Acetylesterase.
pdb deposition date 2009-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fvrA00
1Q0RA 4X97A 2GYVA 1K5PA 3CCCA 3KSRA 1J06A 4PSDA 1CVLA 5A62A 1BCRA 3BF7A 4OUKX 3STVA 4CCWA 3D2BA 4W1RA 5ALXA 4BTVA 5C81A 5ALEA 4KE8A 4EY8A 1FSSA 1P0PA 4KR0A 5A2GA 3WZLA 4DMKA 4TVKA 4MEBA 1HQDA 4QDUA 2WJ3A 4G8CA 4YX9A 1C7IA 4GECA 5EHNA 2QUBA 3A2MA 5JANA 1IVYA 4KAAA 4BVLA 4UBNA 3G9XA 4U2CA 5AM0A 4X95A 1RYYA 1LPNA 4ARAA 3G0CA 2WFZA 5AK6A 3SX4A 3IVMA 2XUOA 4RNCA 1UWCA 5A6VA 3MVEA 4MQLA 1L7AA 1XQVA 2WIKA 4W1PA 1JJBA 1N8SA 1C4XA 3ICVA 1UKAA 2YASA 2CEKA 4Z49A 3ZI7A 2OCIA 3DEAA 4IQ4A 2H7YA 4LXGA 2HL6A 1SFRA 1F0PA 1YAJA 1QFMA 1QIHA 1CUVA 4MYDA 1AQLA 2OPHA 4A23A 3W06A 4B0PA 4UHDA 4I3FA 2GZSA 3G0DA 1P0IA 4BE4A 1NU8A 2G5PA 1MX1A 2HA7A 1CUCA 1F0NA 3I6MA 5C7YA 5ISMA 1WB5A 3W9BA 2C5FA 4FHZA 5ALFA 4DNQA 3M82A 1VXOA 4C87A 4MWTA 4EUSA 2RHWA 3QITA 1DQYA 4J0GA 5FV4A 2WKWA 5AM4A 5JYCA 2JGIA 3IULA 1C7JA 5D3KA 1N5RA 3JW8A 3H17A 3PUHA 5AKXA 5LZ7A 4ROTA 4KRXA 3O0DA 2OCKA 2G5TA 1Q0ZA 2EEPA 4QE3A 3FAKA 1TKRA 2WIFA 5A7GA 2Z8ZA 4ZWNA 4FLEA 2Y2UA 4RE6A 4KE7A 1WCYA 3ZLVA 2WU3A 5D6OA 4OYYA 1PJAA 2Y2VA 5ALDA 5AI9A 4HS9A 3ESCA 3VVMA 3G7NA 1LNSA 3FVTA 2FJ0A 2O7VA 3IA2A 3STTA 3TEJA 2ECFA 4F21A 4DTCA 4JNCA 5EIHA 4JYMA 3DLTA 5F4ZA 3T4UA 2JGJA 5FP0A 1UXOA 1BE0A 3E0XA 1THGA 3WYDA 2I3DA 4UHHA 4FKBA 2AXEA 1TK3A 4BAZA 3WL5A 3F96A 4S0XA 3I6ZA 1CLEA 2D5LA 1P0QA 3C6YA 3IBTA 4XJVA 3LCRA 3C5VA 2B4KA 1DWOA 5AI5A 4WFIA 2O7RA 1G66A 5CH8A 1ODCA 1H2YA 3E3AA 2PU5A 3JWEA 5LIPA 4MYSA 3DL7A 1YB6A 4AZ3A 2BCEA 5ALUA 3BIXA 3HEAA 2CMFA 2GYUA 2BGNA 1R4ZA 1WB4A 1L7QA 3UUEA 3WWPA 3HJUA 1XRPA 4G9EA 5HF9A 3FSGA 2HA2A 1JFRA 5ALRA 1EK1A 3AJAA 2C5GA 2ZYRA 2AJ8A 3H2KA 4D9JA 3VJKA 5AKJA 2RI6A 3I2GA 5CTAA 5BWBA 1FFEA 2VJBA 2WHRA 3NGMA 2C0QA 5EIEA 3A2LA 3KWFA 4X6YA 4W1SA 1X2EA 5KWIA 1XZEA 3AILA 4AQDA 1QIKA 2QZPA 2PSFA 2XQGA 3I1IA 1UK8A 3WK9A 3R41A 4OD0A 3M81A 2QM0A 1YR2A 2GBGA 5AJHA 4Y2QA 4G8BA 4WY8A 1CUDA 1RP1A 1SOMA 3VDXA 2PX6A 2Z8XA 4QWMA 4B85A 1QTIA 5AI4A 2WG2A 2WUDA 2Z3WA 3RARA 1TCCA 1XZIA 1KU0A 4AX4A 1N5MA 1HDEA 1DT5A 1CUHA 3KDAA 1ACJA 4H77A 2GBCA 4X6XA 3G9TA 4OSEA 4X3CA 1A8QA 3PF9A 3G9UA 4B6GA 4BC0A 2XMZA 5E4TA 4KE9A 3D7RA 4K6HA 2HA5A 2DHDA 4UHFA 4EY6A 5CT4A 2VTVA 2XMDA 4X94A 2XMCA 4UBLA 1UT6A 4X91A 3F8SA 4GEGA 5JAHA 2RGUA 2QJRA 3C43A 2XMSA 2CB9A 3KWJA 4U2GA 1SCKA 3I2KA 1QGED 3WJ2A 3I2HA 3SK0A 4HRYA 3NUZA 2PM8A 1XZKA 2XUJA 2ZSIA 5DNVA 4Q3KA 3EIOA 4FFWA 4J0IA 1H2ZA 4H0CA 1MAAA 5AIBA 2PUHA 1TAHA 1XLUA 4O08A 1EHYA 1USWA 1QIMA 3BXPA 1VXRA 3HZOA 5DTJA 2WQZA 5ALYA 4DSZA 1J1IA 5BV7A 5AM5A 3C70A 1LPAB 5DJ5A 1IZ8A 1CUJA 1DWQA 2V97A 1CEXA 1JT2A 4G4JA 1BN6A 4FWBA 1VZ2A 2JEYA 4WJLA 2WUFA 3H04A 4PNZA 4ZGBA 3FLEA 1VA4A 2GBIA 4J3JA 3O9MA 2VJAA 5E4YA 1QJ4A 4C4ZA 3H1AA 5T4HA 4H7JA 3O9VA 2OG1A 1L7RA 1XZGA 3M83A 4EY7A 4AMYA 4BCBA 3S2ZA 2WIJA 4DM7A 2WJ6A 4QLAA 2HHAA 3C45A 2ROQA 2WUGA 1XQYA 4M0EA 3PF8A 4Y2UA 3QMWA 1QTRA 2H1IA 3S8YA 1ZOIA 5ALZA 5AI0A 2XMQA 1Y7HA 5AKLA 4WDRA 1OCEA 4P08A 3O4GA 3DQZA 5E4JA 2WLSA 5LZ5A 4P9NA 3DS8A 2VEOA 3F9CA 5K3DA 4DSAA 2WTMA 3WK7A 2C0PA 1W52X 3G9ZA 4DGQA 4N8SA 5FRDA 4EB0A 5JALA 4BAUA 3N2ZB 3BJMA 1ODSA 3DOHA 4BAGA 4BVJA 5EHQA 2B61A 2AJLI 2GBFA 2YXPX 4DIUA 1UFOA 5DNUA 3TRDA 2BFNA 4BB0A 3FYUB 4BYMA 3ESAA 3D2CA 3G0IA 4NS4A 1ZGBA 1J07A 4GWLA 2HADA 1ZIXA 4IH1A 4G4GA 2QRUA 1EINA 3B12A 3QVMA 5LLSA 2AJBA 4MEAA 3DD5A 4CIAA 3CN7A 4KRYA 2LIPA 5FLKA 3I28A 2BUAA 1ZI9A 2WG0A 3ZLTA 2J3QA 5JD6A 3IUMA 2WFLB 3WMRA 2Y1KA 2WFMA 2XQFA 4GI1A 4QDZA 2BUCA 2XQIA 1NX9A 5IKXA 3DYIA 1ZI6A 1OXMA 4RGYA 3GELA 1E3QA 2OQVA 4XX1A 2BGRA 2V98A 4UHCA 5AIAA 5AKHA 3WL6A 3AIKA 4E14A 2WTNA 2XE4A 3WZMA 3TGLA 1U4NA 2HA6A 4KAJA 4ZI5A 1CUXA 4Q1VA 3D4LA 4Q82A 5CXUA 1GPLA 3D5EA 3HC7A 1GKLA 1KU6A 3H2HA 1LPOA 1ZI8A 5DWDA 3M3DA 2OAGA 2CUTA 1K8QA 5K3EA 2PUJA 2CJPA 4L72A 5AKKA 4Q34A 3PDCA 4GXNA 4A16A 2VA9A 3P2MA 2OQIA 2GZRA 4C88A 4AB1A 3DDUA 4RPCA 1Y37A 2D0DA 4ARBA 5JZSA 1W75A 3D2AA 4H7IA 2WILA 1XKLA 3QM1A 1MN6A 4J7AA 2HA3A 5AKEA 2RHTA 1A8UA 3NOXA 4CCYB 4LYDA 1FFBA 3VKFA 1IZ7A 3BJRA 2HA0A 1QIFA 4DMHA 5T4FA 1K63A 2XDWA 4NZZA 3UUFA 3ESDA 2WUEA 3VVLA 3O95A 3IUNA 5FPQA 1H2WA 4Y2TA 4B83A 1MO2A 1WHTA 4N5HX 3IB3A 1CQWA 3LP5A 3BE8A 2HM7A 5ALVA 3C5WP 3ZPXA 1AMNA 1VOTA 1XZAA 1HKHA 2WG1A 4W9RA 2C7BA 1F6WA 4QNNA 4B9AA 3IDAA 1XQWA 2RIPA 2IITA 3G0BA 1A8SA 1H2XA 2G63A 4X90A 3VISA 5IVDA 1X2BA 2XUKA 1CUYA 2OAEA 4PO3X 5EGNA 5AM1A 2XMRA 3A70A 5CURA 1E5TA 4OYLA 2XQKA 2QXTA 1CUGA 1QIJA 2VAVA 5AI8A 4PW0A 1BROA 3F97A 4PV7A 3E1GA 3WA6A 2FJPA 2V96A 1UKBA 1EH5A 5LZ2A 4QDTA 3L1JA 4FLMA 4AO8A 2R8BA 1VJ5A 2HU8A 4H35A 4Y7DA 1LPPA 4U2EA 1CUEA 4RE5A 1O6GA 4AXBA 2ZYHA 3VXKA 4Y2VA 1OILA 4FLFA 1JKMA 2YH2A 1ZD2P 4B7ZA 1AX9A 4UBIA 4Q05A 1NU6A 2H7XA 3WWOA 1LZKA 4GW3A 4BCCA 3H2JA 4LHEA 4UPDA 1GGVA 1H22A 1XZFA 2RONA 1JU3A 2WIDA 1ZGCA 2ZJ7A 1XRNA 3R0VA 5IH7A 3GROA 2X76A 2QUAA 4CG2A 5JD5A 1VKHA 3WKDA 3WWEA 2QJWA 3JYHA 4PF1A 3ESBA 1S8OA 3ILSA 3FVRA 1SCQA 3C8DA 4K5QA 4FBMA 3W05A 5AO9A 2AJCA 4KJXA 3DKKA 4B84A 1X70A 4UUQA 4KEAA 2EDAA 5CH5A 3WIOA 5ALMA 3R3VA 4Y2RA 2DQZA 1TIBA 1DINA 5HCUA 3T52A 2OGTA 5DTIA 5IVKA 5JAPA 3HSSA 2X5XA 3N0TA 4KYVA 3IUJA 3W04A 5LZ8A 2C4HA 2BAGA 3RLIA 1XZJA 5LZ4A 1XLWA 2WSLA 3GBSA 4UFPA 1CQZA 4HXEB 5JADA 2Y6UA 5AK5A 3I2IA 2QOEA 4H7FA 3HACA 5HK8A 5K3FB 1LGYA 1LBSA 1U8EA 5AHXA 3KOOA 2ES4A 1CR6A 4U2BA 4XIIA 2CKMA 4ZRDA 1P0MA 3D0KA 1W6RA 3Q8WA 1DWPA 4UFOA 5AI6A 1R9NA 1HL7A 4TPKA 1JJIA 1LLFA 1K4YA 2I3ZA 1ZJ4A 3O4IA 2WJ4A 5D7BA 2XI4A 1UOQA 3R3ZA 1E8MA 2QT9A 4EHBA 3FNBA 1QFSA 1THTA 2RAUA 4JYPA 2ONCA 3DL4A 2HDWA 5D3ZA 1MAHA 2HFJA 1FFDA 3SC2A 3ZWQA 5ALNA 1W4LA 1R1DA 5ALTA 2P8SA 4H7KA 2PVSA 1MPXA 2XMGA 1UOPA 4G9GA 3WI7A 1AGYA 2O2HA 3C6BA 4G1FA 5CT8A 2JGKA 3OURA 3FCYA 5FDFA 2XB6A 4EA6A 4FNMA 2ZYSA 1SC9A 1SCIA 5YASA 1IUPA 2JGFA 4BP9A 3LIPA 3QPCA 4X00A 3WIBA 3MUOA 2JBWA 4BDSA 2OLEA 1MNAA 4UBKA 3Q0TA 5DYYA 1EVEA 2ACKA 4X93A 5CBKA 1GXSA 1ZD3A 5HFAA 5JATA 2XUIA 3LLCA 1YS1X 4BC1A 5AM2A 2R11A 5HQ3B 4EY5A 4XVCA 1N1MA 5LKAA 1E8DA 4CCYA 2PL5A 2DQYA 4X7BA 2IX9A 5EHXA 1MTZA 4KACA 3BIWA 5ALKA 1QIGA 3WK6A 4F0JA 1LBTA 3G0GA 5C8XA 3B3QA 1HBJA 4N8EA 2WU4A 3QZUA 1CIJA 3CN9A 3B5EA 3FBWA 4F60A 4DNFA 5JAUA 3WK4A 4UHBA 4P93A 3EQ9A 4LXIA 1PFQA 3GFFA 3BDIA 3KD2A 1UZAA 1DU4A 1CPYA 3ZLUA 5JZ9A 1T4MA 1XZMA 2VF2A 1VA5A 2JF0A 1QIEA 2O2IA 1MNQA 1ZICA 5EHZA 4BP8A 2I78A 2OXEA 4HAIA 1UOOA 1XZBA 2UZ0A 3H1BA 2VQ6A 2ZJ6A 1ORVA 2DCMA 4H18A 2HFKA 2BJHA 3U1TA 4E15A 1DX6A 5ALPA 4FMPA 2VJDA 1VLQA 2E3JA 2YYSA 1ZD5A 3MUNA 3WWCA 3R40A 1R88A 2XUFA 5BWCA 5FOQA 4UFNA 4BZWA 4LKOA 4J0CA 3OG9A 1WPXA 2QKYA 2WM2A 3F98A 5ALLA 5A71A 2B20A 3PICA 4W1QA 5AK4A 4Q3OA 1E8NA 1YA4A 3EBLA 4CIBA 2HIHA 5H3HA 1JJFA 5AP9A 4JUIA 2W6CX 1XFDA 1LPSA 3ICWA 2C58A 1IMJA 3R3WA 2IIVA 3FYUA 2HRRA 2HA4A 2QS9A 2XLCA 3E4DA 5LZ9A 4K6GA 4QZVA 3V48A 5CT9A 1J2EA 3AZQA 3OC0A 1D07A 3UMJA 3ED1A 1W1IA 2PSHA 5ALIA 2VAXA 4OU5A 2BKLA 5KBYA 4FOLA 3EQ8A 2Y6VA 2I03A 5T4EA 1QIDA 4X71A 4ZREA 2JGMA 4MWSA 4FDMA 4CI9A 4J0HA 1VE6A 5AKYA 5ALJA 3PFCA 3WA7A 3MGAA 4Q3LA 1AZWA 3RM3A 3R3XA 3I6YA 3FCXA 5ESRA 3A2NA 5AK3A 4TGLA 4PSUA 5HKBA 1LPBB 3AIMA 1F8UA 4BE9A 1WOMA 3W2TA 1W76A 3WK8A 3V1NA 4CG1A 2QVBA 3AFIA 4DMCA 1UK7A 5K3BA 5CXXA 4INZA 5I8PA 3LIIA 4QLOA 4AO6A 1BCSA 4L0CA 3GA7A 3V1LA 4GHWA 4NMWA 2PSDA 5HFNA 1EI9A 3VJLA 2V9ZA 1B6GA 1LZLA 1WPRA 3FLBA 1XZLA 2QMQA 1T2NA 1EB8A 4G8DA 5FUMA 2JEZA 1QZ3A 3ZV7A 3QPDA 4B82A 5HK9A 3C8HA 5JZBA 3L1HA 3WJ1A 5K5EA 1UKCA 1A88A 5FKJA 5EFZA 1DX4A 2HU5A 1ETHA 3K6KA 1IUNA 1CUUA 3HI4A 1PV1A 3EF3A 3HLKA 1R3DA 3V9AA 4AMZA 2CZQA 4ZXFA 5EI5A 3AIOA 3O4JA 1M33A 5ALSA 3QPAA 1EK2A 4CFSA 2WHPA 1EXWA 4FFVA 4C89A 4B0OA 3L1IA 2VATA 3DCNA 1GT6A 2JGLA 4QWWA 2ACEA 5C8VA 3OM8A 3WKBA 5EIAA 1GPKA 4E11A 1QE3A 2HU7A 3GUUA 1GQRA 1XROA 4OB7A 3WKAA 3D59A 3BDVA 4KAFA 4X92A 4I4CA 5CT6A 1VZ3A 4YASA 5JIBA 1ZJ5A 2B9VA 4ETWA 4V2IA 5KREA 3WKCA 2Q0XA 2XUQA 3QMVA 1GZ7A 2K2QB 3FYUC 1CUIA 3WYNA 1MX9A 1CUZA 4G5XA 1TQHA 4C01A 4EZIA 3HRHA 3I2JA 5JARA 4C4XA 5LYYA 5AOAA 5CW2A 4UBMA 4DNPA 4LYEA 1BN7A 3HABA 4IO0A 3BL8A 1B41A 1BU8A 2OCLA 4OB6A 4WY5A 4EBBA 4NVRA 5DNWA 2XT0A 2AJDA 5K3FA 1G5FA 5A7HA 3C6ZA 1XZHA 1AKNA 2VJCA 3ANSA 1HPLA 5BOVA 1MJ5A 5AOCA 4OPMA 1VE7A 4MJ3A 1ISPA 3HXKA 5I7UA 1G42A 3V1KA 2PU7A 1U2EA 3H18A 4Y2PA 1JU4A 3WWDA 5IVIA 4ZV7A 1ORWA 2XUAA 4BBZA 1Q83A 3RK4A 5AKZA 1EDEA 1CV2A 1GQSA 5LP1A 5AOBA 4X85A 2VT6A 4C6HA 3WKEA 1ZIYA 4F5ZA 2VT7A 4Y2JA 4AN0A 4QDOA 1I6WA 4MQMA 5HF5A 5JAOA 2O2GA 4BATA 3H0CA 3FWHA 2PSJA 3R3YA 1MT3A 4H7HA 1U65A 5DYTA 1ODTC 1XLVA 1Q84A 4J0JA 4HTAA 2ZSHA 1CUAA 4U2DA 5J3JA 1HLGA 1TCAA 1YCDA 2EDCA 1GPNA 4B81A 1CUBA 3WL7A 3G8YA 3ANTA 3IURA 3DKRA 2OCGA 1BRTA 2W22A 4PSCA 1QLWA 1TRHA 4GLBA 2VSQA 4WFKA 5K3CA 5SYNA 1Z68A 3NWOA 4Y9SA 5HF6A 1UK9A 4Y2SA 1QO9A 4BRZA 5HQ3A 4YK7A 4P92A 1EA5A 1WHSA 1XRLA 4GBGA 1E89A 1AC5A 1IUOA 5AICA 1MX5A 5DYWA 2XMBA 5AKGA 1GKKA 5HF8A 1AURA 1YSCA 2FUKA 4K2AA 2PBLA 2ZYIA 3DOIA 3EQ7A 5CT5A 4M0FA 1DQZA 2XUDA 3DNMA 1H23A 3BF8A 1QOZA 1LPMA 3WQHA 3PI6A 2JIDA 1QONA 3KXPA 4BRSA 1QO7A 5E2IA 1ACLA 2ORYA 3C87A 4OU4A 5HKAA 4Y2YA 2GYWA 4QEKA 3QBJA 4J0KA 3FLAA 3WLAA 4HZGA 2FX5A 3K9BA 4IHAA 3YASA 3AZOA 4CG3A 3C6XA 4QDXA 2CBGA 3HYSA 4IH4A 2XUGA 4H7EA 3WL8A 1CRLA 3H2IA 1XRQA 4ITVA 4HXGA 4LIPD 4JH0A 3STXA 4OB8A 5FXMA 4MXDA 1RWQA 4PQEA 1YS2X 1Y7IA 4FNGA 3PFBA 2DR0A 7YASA 3G02A 4WCVA 1UK6A 4ZV9A 4XWGA 3I2FA 4DLNA 5AH0A 5DLPA 2DFPA 2Z3ZA 2ZJFA 4GDMA 3I1YA 5SYMA 3STWA 1E66A 4QA9A 1XRRA 1DTEA 3CCBA 5KWJA 2DHEA 1WB6A 4B9EA 3PUIA 2QR5A 1EB9A 5K3AA 4E46A 3A6ZA 2G4LA 2PSEA 3SWWA 1YA8A 2ZVDA 4EY4A 4DYHA 3OPMA 4W63A 2X8BA 3K2IA 4FTWA 1A7UA 3STYA 4Y2XA 1R50A 2XUPA 1CUWA 4BZZA 1CFJA 5AKIA 1YASA 3OTQA 3STUA 4KE6A 4AN1A 1FFAA 5ALOA 5I9IA 3WK5A 4N8DA 1CUSA 3BWXA 2XQJA 1QIIA 6YASA 1R9MA 5A7FA 1BEZA 4G4IA 3QH4A 3AZPA 2QXUA 3FSGD 1BS9A 1JI3A 4HVTA 4B80A 4J0DA 3FOBA 1EDBA 1EDDA 2BUBA 4IH9A 5LKRA 3DYVA 5JASA 4I19A 4BVKA 5CRIA 3R3UA 3W9UA 1YB7A 3AUKA 4UHEA 3V1MA 4HXFB 1XZCA 3CXUA 1KEZA 2WHQA 3RKSA 4L3WA 2PPLA 2WHPB 3D3NA 4H7DA 5ALWA 4J03A 4WFJA 2WIGA 5HZGA 5ALHA 4M0MA 2QTBA 4DMFA 4OCZA 3H2GA 3OOSA 2PKYX 3QMMA 3QYJA 4WDQA 5CH3A 1EVQA 2XUHA 3VJMA 1JMKC 5C8ZA 4JEIA 4X6UA 1DT3A 1MU0A 2WFLA 1JMYA 1ZD4A 4K6KA 4UBJA 3O4HA 3GZJA 4LXHA 4BDTA 1FFCA 1CUFA 5IVHA 2JGEA 4BTLA 4AO7A 1BEEA 2DHCA 2DSNA 2NW6A 1XQXA 4UBOA 1O6FA 4A5SA 1YAHA 4BCDA 2J4FA 3F67A 2HRQA 1EX9A 2J4CA 3DJYA 1AUOA 1FJ2A 4L9AA 1XZDA 3U0VA 1XKTA 4AZ0A 4U2FA 2Z5GA 2OGZA 1G4HA 4C4YA 5FPPA 2XLBA 4N5IX 3LS2A 2J3DA 5ALGA 5T4BA 4FBLA 3TJMA 4DNOA 5AM3A 5JD4A 3AINA 5ALQA 3IUQA 2H7CA 4YPVA 3IIIA 1XRMA 3H19A 1TCBA 2H9YA 3PE6A 4HRXA 1WM1A 1K6EA 3FYTA 3X3HA 5CMLA 2OGSA
chains in the Genus database with same CATH superfamily
1L7XA 1Q0RA 3CU5A 5ERYA 4X97A 5TJHA 2G28A 3PQ8A 2HEGA 2QMZA 3AF3A 3GRZA 3T3GA 5LWHA 2IP2A 2D7CA 4GUAA 4RK1A 5C7IO 3CCCA 3SHFA 2HIAA 4WNAA 1LVGA 5EOVA 3KSRA 3OCXA 1J06A 3ETCA 3QTBA 1JHQA 4E0BA 4Z4HA 5JMOA 3SDBA 3GUCA 4ML3A 1E3TA 1YGYA 5BUQA 2FWMX 3MJFA 5DLDA 3BVPA 5KYXB 2LV8A 2WVAA 5CNIA 2C2XA 2DPGA 5FTLA 2Q8PA 4RGVA 1A9XB 1GR1A 4BTVA 4P7KA 2IPNA 3ZCTA 1AT1A 4KXNA 5ALEA 1FU8A 2HHLA 4Z0TA 1G3QA 2QTHA 1DOHA 4V0QA 5CJPA 1H6BA 2QN7A 3NRCA 2GD0A 1MP0A 3NTLA 1DRVA 1QNFA 1RMTA 2A9JA 2FKAA 3T34A 4DZRA 4Q9JA 3E2MA 1JYSA 3EXHA 4WH0A 2XWBF 4JOQA 4AQYB 2ZPUA 4FJ2A 4GECA 5JYEA 1BFDA 2W2OA 1CX9B 1QXSA 1K3UB 3LTEA 4R8MA 3TWOA 4BMXA 2ZUDA 3WHIA 2XZPA 2DZDA 3RJ5A 3PDJA 3TSYA 4B3CA 5JANA 2R6ZA 4BJ5A 1AZSC 1ISMA 5B4TA 4OHFA 5LBUA 3RC2A 1RBZA 3H4VA 2X77A 1GSOA 3K31A 2J41A 2BFPA 3D0QA 3PWZA 4A92A 1PS0A 3D81A 3F4LA 2OHJA 4LQCA 4EW2A 4KPFC 1EUDB 2VNJA 2Y1EA 5EJ2A 5K03A 2AFRA 1H8HA 1Q3TA 1R0KA 3JZIA 5AM0A 4X95A 3SZRA 1XD2B 1PSDA 5REQB 2J3HA 2QM8A 3H9BA 3A3PA 4G1UC 5FWDA 3G0CA 1KPGA 2WFZA 2B2CA 2Q1SA 4G63A 5FO1A 3IVMA 1N2GA 4IL5A 3NBZC 5IBRA 5L40A 2AVNA 2W6NA 1GTZA 2Q2WA 3EXG2 3DZDA 1L7AA 3ONVA 2R7NA 4TXJA 3PJRA 3KVOA 1EUCA 4CLOB 3LBFA 1O4WA 4DQDA 2LDBA 4K87A 1RWXA 4W1PA 4DIFA 1JJBA 1XJQA 4D79A 5IJZA 1DAHA 3CVVA 2WAMA 1U3CA 1NONA 1X7XB 2NAFA 3AY7A 3FZGA 4JBNA 4L8LA 4AMUA 3ICVA 1UKAA 3O9ZA 1U9CA 4U3JA 2CEKA 3IKJA 4HF7A 4C0BA 1FP1D 3C97A 4RZ3A 2JAOA 1KJIA 2ODAA 3GRRA 3ITNA 3PUJA 1E1KA 1E7YA 1AXEA 2AE1A 2VL7A 5MFZA 2GJ8A 2FX3A 3EVFA 5KQRA 2H7YA 1L7EA 4HYQA 4ILEA 2J31A 2FWNA 2KQUA 4ALLA 3K92A 1F0PA 5SYAA 1R0YA 3B3GA 4CKCB 4RS3A 1XKXA 1S8NA 4HRAA 2XSZD 3GGGA 4JSTA 4QRIA 1ZYUA 2PPVA 2YHIB 3SGLA 3E8SA 4BYGA 2YXBA 1CR0A 2R4QA 1OJ7A 1AE1A 1R6VA 3JSAA 1QIHA 4R5HA 5B64A 3WGKA 1CUVA 1GU0A 4XPZA 4E1AA 4TLAA 3UJ7A 2AD5A 1AQLA 4MYDA 4ZAZA 5T6BA 3W06A 3W6UA 4CUJA 4V0OA 1YOVA 1ZIDA 5FTJA 4F7WA 5B55A 1ZCJA 2VXCA 4LNUA 4P5PA 3GT4A 4PNHA 1QZXA 4NMXB 1ENPA 1YNOA 2Q9UA 3BXHA 5BV0A 1Q22A 1IXYA 1MX1A 1OFHA 3TLEA 1L7PA 2QAGA 3F3KA 3HA5A 5KTNA 1FFSA 3NUQA 5ISMA 2EXXA 2IUSA 1SAYA 2QTCA 4NCJA 1E0SA 2C5FA 3AESA 3N8GA 4RPLA 5DI9A 3EZGA 4IZOA 4FHZA 5ALFA 3OA0A 2NACA 2YYYA 3E27A 5DI3B 5JXJA 4NARA 3M82A 1VXOA 2JFOA 3WB1A 2IEDA 1KO1A 2JIBA 4US1R 3UGKA 5BXQC 2M6SA 3LC7O 2WYVA 4JLSA 3QITA 1EXVA 1DQYA 2ETXA 4BNYA 4YHBA 2BFWA 3IJRA 1T8RA 3PXDA 4ND3A 4J3NA 3T12A 1ZCZA 2JGDA 2PGLA 2VFAA 4FQ5A 3USZA 1JQKA 1NHWA 1GT91 1A77A 2BMWA 2WHXA 1QH1B 5HZHA 3KQVA 4E22A 2JLSA 4BMOB 3SY8A 3Q72A 3IP6A 1N5RA 1VL2A 2ZS9A 1ZOSA 3HMKA 4AUEA 5L45A 2CF5A 1AUPA 1H4VB 2VIIA 1KJYA 4EY3A 3V2IA 3JU3A 5LZ7A 2AEMA 1N2CA 3A6LA 1LD3A 2KWIA 4Q01A 3E4CA 2ZB7A 1L7VC 1P73A 1ZCAA 1IRIA 2I3AA 2N46A 3A4YA 4HDNB 4PM4A 4TV9F 3VKGA 3O0DA 1ECJA 2OCKA 4KK4A 2FR8C 2G5TA 2YJ4A 3HQ4O 1TA0A 1Q0ZA 2EEPA 4TT8A 1TT7A 2OV8A 4UM9D 2AF3C 3ROGA 4C29A 4WZBA 4W9MC 2HJHA 1PDVA 1SKQA 4MKIA 5BQFA 2Y2UA 3NRBA 2OD9A 3CC8A 2Y05A 2A30A 2G25A 5GJWC 4MQFB 1F9AA 1WCYA 2WU3A 4NAVA 1VTKA 1RM4A 1SD1A 1L4LA 3QFSA 3HNPA 2PLNA 1NOKA 2ZJAA 1M1UA 3R2JA 4L95C 5CYOA 1CQIA 2D4HA 2J67A 3F7OA 2VHYA 2WV7A 2YRFA 1TZ2A 2H1CA 4ENUA 4BNTA 4Q1BA 1ABFA 5E6SA 2B6HA 1WUJS 3CPHA 1MBZA 3TNJA 3WRYA 1ZRSA 4IR7A 4AKTA 5ITWA 1JWAB 2GT1A 3RUCA 3TTUA 4YAJA 3G7NA 3I8OA 3IJEB 3QE3A 4BUZA 4E1VA 4ARCA 1LNSA 4HH3C 2GZHA 4R71A 3K9CA 1PS9A 3FWPA 1P6UA 1N5KA 1R6AA 2RC5A 3R7DA 2FJ0A 5TX7A 1U5AA 5JLAA 4C4SA 1K0FA 3R0XA 2ZOSA 1J39A 3T0GA 4BZXA 4RKEA 2YBEA 1F51E 2XEXA 1HYHA 4KWCA 5K09A 3U19A 4PPGA 5IC4A 3GF4A 4B6FA 2EFGA 2JI7A 4WEOA 5CCDA 2D2XA 1QG0A 4F21A 3FNIA 2XRMA 3CNBA 1QPBA 4DTCA 4DG8A 4JDPA 1U1CA 1VECA 3CKKA 3PDIB 4MQUA 5EIHA 3AO0B 4JYMA 1PWHA 2IHBA 1GRQA 2XT6A 3HPRA 2YR0A 1VE5A 3T4UA 2JGJA 5KSZA 1ZN7A 2I7VA 3A10A 1XMOB 2NX2A 3TFOA 4KIJA 5F5XA 2HPAA 4MV0A 4XUGB 3SCZA 3K2BA 1T2DA 1JF8A 4H16A 2K7FA 1GJRA 4Z3OA 1N92A 1T0PA 3GLRA 1T36B 1YQEA 2QD1A 1BX0A 2HQOA 2HJRA 2A4MA 2GPSA 2J3EA 2MIIA 5D01A 5JH7F 1D09A 2OM2A 1AHIA 3A4IA 1E3EA 4FKBA 4HX2A 2QTMA 2QENA 1Y1RA 1BAPA 4LWQA 5J1TB 2B5WA 3IAS1 4FOTA 1PKEA 4UNNA 5EQFA 2WINI 4E5NA 1B42A 3L1UA 5HCNA 3W6OA 4YUZA 3ZDCA 3AYZB 3L6UA 4NF2A 1S3IA 2WD7B 3DEJA 3OIUA 3WL5A 2C97A 2H2HA 3EVZA 2ASVA 2HQBA 4S0XA 1IONA 3SF0A 2XVAA 4YAGA 3C7DB 1DP4A 3CG4A 2YWJA 1M6VB 2OV6A 4L50A 1GTG1 2I6SA 2WM9B 4UJ5A 1FDSA 4H3HB 3BMCA 4MGYR 1YU6A 3C5VA 3GJYA 4MP8A 3D1LA 1YT5A 1TOAA 4CR8A 1MHPA 4GT1A 4IS2A 5G0SA 5AI5A 1KY2A 1XCOA 5JU6A 3NJRA 4DIBA 4XWKA 3ONFA 1OXUA 4QAJA 3DCIA 3R20A 3JAKA 5KNDA 3JQGB 5REQA 1E2FA 1MTOA 5CH8A 4ZO4A 4DY6A 1L1QA 4J7XA 1H2YA 2HJWA 3KUUA 3E3AA 5KNCD 5GIOE 1QKIA 1C9KA 1AO0A 2GHTA 4MKHA 4NU6A 5TV2A 4XA8A 2C3YA 4KGVA 5B1IA 4RVHA 5HRAA 5LIPA 1OYOA 3EA0A 4ZICA 2IF0A 1XMXA 3DVSX 1VLVA 4HN9A 4KGXA 4Q4JA 2F9LA 5GQSA 1YB6A 3EASA 4E32A 2M6KA 5KOJA 1D4FA 1JI0A 3LM8A 4RHYA 3O4FA 5F7ZA 1NVGA 4IJKA 2JLBA 1W85A 3W7BA 1JECA 2CLMB 4ZO8A 2DY1A 1GNPA 4MOWA 4BRUA 4CM3A 1B23P 1L5OA 1LQTA 1N7GA 3AI7A 3D7KA 3L7CA 4Z9XA 3HEAA 5FIUA 1W4BA 2FPPA 3INTA 2J9XB 4Z8YA 4DNXA 3LX8A 4Y9RA 1E9DA 4F9GA 2Q6OA 5KYNA 4O63O 1NASA 1RRVA 1KA9H 3EY9A 1WB4A 4HDRA 5A9RA 1UANA 1T24A 2W6MA 4PXSA 1G5QA 5K8IA 3OQ6A 5JCJD 2J3JA 3KXLA 6PFKA 2QTVB 4MS3B 2GBLA 2BR4A 1XX6A 1R74A 4RJTA 4NDZA 3HJUA 4L3OA 1N3YA 1H6CA 5E6UB 3U62A 5BMOA 1XK7A 1XRPA 4V1CB 4AI6A 3O8DA 1U28C 4Y67A 5AVOA 3EDCA 3DOJA 5L6LB 2CFTA 3RG8A 1AXRA 1Y4DE 3B70A 3DO5A 1WBDA 1KS9A 1SB9A 1EK1A 1DJNA 3G1TA 2A33A 2GEJA 4TTIA 1OOEA 2ZI4A 3H16A 2AJ8A 1TW3A 3LMKA 3H2KA 3IP9A 3V4LA 4L7QA 2OV3A 5C4GB 4CMIB 4BNNA 3O0TA 3VO2A 3H5LA 3WBJA 1C3LA 1GKYA 2RI6A 3D4NA 4LYJA 4IILA 3AFHA 3FJYA 1CJSA 1U0GA 1QRRA 5ARBA 5K6TA 2BZSA 5CTAA 5BWBA 5J40A 5CJ2A 5I7HA 4F5EA 2XWPA 4JUDX 2H5EA 3H11A 1LI4A 2Q7DA 2B8JA 4BGUA 4ZI2A 1PYOA 4KKXB 2O1EA 3EXG1 4IZ6A 5A3SA 3NGMA 1DELA 1FRVA 2BLNA 2YCBA 2C0QA 3KO8A 2RGNC 5E4FA 3M9LA 3IR5A 1C41A 3AEKB 3EUAA 4XQEA 4DLXA 4GC9A 1BJTA 3W8EA 3UNXA 5FTNA 4AW9A 3O90A 4TMXA 5KWIA 2TYSB 4B3MB 3DEZA 4B87A 3CF2A 1DKUA 3AILA 1Z07A 3EIUA 4NR0A 3ZH9B 1QIKA 1FJHA 1SU6A 2CZCA 2ZDGA 3LDFA 2QZPA 3F6YA 2HF2A 4PZZA 4XCQA 1GYRA 4D0GA 2XQGA 2IUFA 3K8QA 4Y1FA 1P2GA 1EVIA 3R41A 3FETA 4LDZA 4QBFA 4BNIA 4OD0A 4X9XA 1YDGA 2XXAB 3E2IA 5FV7A 5H81A 3MF4A 4TMFA 4MGIR 5IARA 1ESDA 4COKA 3GMDA 3TZ6A 1AO3A 2Y9MB 2G6BA 2PY6A 4JGBA 1KIMA 1RCFA 2K6GA 2Z8XA 1GQOA 1T5BA 4RJJA 1T91A 2WD9A 3ZCXA 1QTIA 3H5NA 2E6KA 2Z3WA 1WZCA 4R81A 3OFND 5BN4A 1W0JA 3NJ4A 3H9JA 3FFTA 3DCYA 3DMPA 5TSDA 1KU0A 1F8GA 2VNIA 2IXBA 4OI4A 1U80A 2NSJA 2Q6TA 2P9JA 2E55A 1CUHA 2FQ1A 1JDTA 2Z08A 3E3NA 3KDAA 1T8PA 3Q3GE 4Q15A 3A4NA 4J6FA 2LVBA 3JYPA 2UVDA 3GEIA 2Q1TA 5HQTA 1QRSA 2GBCA 2EARA 1ZD8A 5I45A 3AVOA 4IDOA 1K5DA 1A1SA 1BQ4A 1NC3A 1UM8A 3DLAA 3M6WA 4LNUB 1A8QA 1LK5A 2FPXA 2ZB2A 1ZY2A 5AVZA 1LDYA 3C14C 4BMNA 1GARA 4WBXC 2QM7A 3KLOA 4B6GA 4OGGA 5EJFA 4J0FA 3LDHA 3VBEA 5A5VA 4GZ5A 2XA1A 3SQMA 5DHFA 1J9EA 3KPJA 4UCQA 4EUFA 5IANA 2ILVA 2XCIA 2PBZA 1LEHA 1OWMA 1FMTA 1T5TA 2PGNA 2V59A 4NU8X 3ZDDA 4HQKA 4ISBA 5TQ0A 3X43A 1I32A 1R4MB 1GCGA 3Q40A 3O38A 1Z36A 2JKYA 4ZC8A 1QFZA 3H6GA 5EMKA 4XVUA 2XMDA 3FMFA 3SHQA 4G0QA 2VDVE 4H15A 2I8CA 2VNKA 3UMBA 4CM8B 8MHTA 1RMQA 3KVVA 4QOHA 2XXAA 3HVIA 2R96A 2BCGY 3VH3A 1OR8A 2JH8A 3PUWA 3PRJA 3S99A 3B3AA 1J5XA 7AT1A 5AVXA 2HYIC 3VPAA 4PTZA 1D1TA 1H1DA 1JW9B 1ZN8A 3C43A 4W5WA 4YRPA 3REQB 1E7RA 4ENWA 4ABTA 3U1VA 2AS0A 2CW5A 3K5HA 4HUQA 3I2KA 2ENWA 3O8BA 4KJZA 1V8ZA 2F6RA 4KI7A 4RENA 5IHXA 2LCFA 4N82A 2IYXA 1RFGE 4PWYA 1USVA 2RAVA 3FUUA 1QO0A 2BEUA 3LRXA 4IHJB 4LF9B 4S0ZA 4MGKR 3A3YA 3NUZA 2PM8A 4QG7A 1JAIA 1JFLA 1KO8A 2XUJA 2OZKA 3D8BA 4LY9A 2OO3A 2C2BA 4KHPB 3O2QB 4L57A 1BD3A 1XD2A 2XNDD 5JCXA 1SVWA 3UICA 3ZHYA 2GFIA 2HV9A 3E58A 4N5LA 3ZLBA 3E70C 2WNHA 5DT2A 4CLDA 4CKZA 5KOHA 5KNBD 4QUGA 1PGPA 4CM1A 3CNEA 1NVFA 5ERXA 5KSWB 3ROMA 2IYZA 5ENDA 4DRXA 1FP2A 4LVCA 3CG0A 3WDLA 2AFIA 9ATCA 3SF8A 3D02A 5KNDD 5FI0B 1PGJA 2RHHA 1MO4A 4WCDA 1M2VA 4URYR 5DTJA 4AJKA 3AUAA 4J16C 4NS1A 5ALYA 4DSZA 3BIFA 1KQNA 2I2BA 4F5WA 1IATA 3T5PA 3V7YA 1MQAA 3M34A 2YJTD 1ESCA 3FYHA 5CCBA 1E7MA 4JU9A 1IZ8A 1WXQA 2D62A 3QVXA 3VC2A 4YT8A 1CUJA 4KQFA 3CLHA 3FX2A 2GPTA 4EX7A 3GJXC 4X64B 4BLWA 1KK3A 3P4XA 3JXEA 4HMOA 4V03A 1WRBA 4WLFA 4L0MA 3L8CA 1VZ2A 4KO4S 3E7XA 3FJ1A 2JEYA 3K5PA 3L9WA 1U63A 2C9OA 4Z1MD 4Y6OA 1IQPA 1ESNA 1NQWA 1IOLA 3MINA 1T9DA 3DP9A 3H04A 5EEGA 3RYHB 2YUIA 3BTVA 5C4MA 5TMDA 2JD2A 1Z4NA 2BE9A 4ZGBA 1JNYA 1N0UA 3JQ8B 4QYMA 4RL4A 1WUYA 1YZNA 2JCSA 1U2DC 4C05A 4ATNA 2BVNA 2BIFA 3KYCB 4EG6A 1WCV1 4YR7A 5HDBB 1G0NA 4OQXA 1P4JA 4A6DA 2DBZA 5F7XA 4E5DA 1PZMA 3K9FC 2WWXA 5FWXA 4RMIA 4Q1CA 2VJNA 4DJFC 2FG6C 4W8HA 1K89A 3JAKB 1JG2A 1U2SA 3FW1A 1FTNA 2J0UA 2WJJA 4LRQA 3AFNA 3IDSA 5H59A 3SJZA 4EY7A 1YJXA 3USCS 1CS0A 4CMJA 4H1WA 4FOPA 1CK4A 3LPLA 2VBCA 1ZLXA 2BBWA 4U7TB 2O07A 1N4AA 3K8ZA 3Q9NA 5AW5A 2VPIA 3PE4A 5KINB 1HFKA 1Q0UA 2QU8A 1UFRA 2HHAA 2IV2X 4RKRA 1IHXA 1W5SA 4M0EA 1TKAA 3WGUA 1FLNA 2D5BA 4D92A 1Y0BA 1TVKA 3LBNA 4UEOA 4Y2UA 1QTRA 1TQ4A 4L5YA 4ROSA 1XNJA 3B3FA 3V4ZA 4QVIA 2P75A 3VO1A 2FPKA 3AY0A 4IDEA 4KFRA 3GYBA 1CWUA 1U3UA 1T5OA 4ND2A 4PRYA 2K4MA 5FF9A 4EG8A 5IABA 4KTVE 2AI3A 1T6BY 5FLXA 2ANCA 4FX2A 3RYTC 1Y7HA 5JDCA 2G3YA 2PMWB 2ZGVA 4LECA 1OCEA 2FGKA 3GQBB 4JJGA 4P08A 3NRJA 3FRIA 1TE2A 2X1LA 4KN8A 5ERGB 5CVTA 3IPRA 3DQZA 1Z4MA 3IUEA 4MUXA 1AF7A 4DCVA 1ZX1A 1MQSA 1UAGA 3AQ4A 3E35A 4KQ2A 3I9MA 3LFUA 1G9XA 3E22A 4RZIA 3FGPA 2BHLA 4D3FA 3DS8A 4G6ZA 1T9HA 2OGUA 1M8JA 2VEOA 2SKDA 3F9CA 1XTSA 4JVLA 4M9UA 3RCBA 1UZLA 2WTMA 4OIFA 3WK7A 1V39A 4AZSA 3W7VA 4D2IA 4DILA 3PNMA 4BFCA 1AOXA 1W52X 5ILGA 1DDIA 4ARSA 2BSAA 1HQKA 3WVNA 3C85A 4WAUA 3Q7IA 5FRDA 3PNOA 3WMXA 3HXLA 4AECA 1C9EA 1EP1B 2GXSA 2QP9X 3UXHA 5IEJA 4B3GA 3BJMA 1ODSA 3SM9A 1GDTA 3MCZA 1Z45A 3R09A 1F06A 2V58A 2VUUA 1GO2A 5BSTA 2B61A 4KUEA 4BVJA 5CHYA 2MR6A 1O94A 3TI9A 5JEEA 4QTUB 2G4CA 2XCTB 2GCGA 1I33A 3GFRA 3MLEA 4EW3A 1XPRA 5DWQA 4DQ0A 1N9ZA 4BB0A 2QN9A 1ZH6A 2ACWA 5GOTA 3H0KA 4EG4A 2XKKA 2FKNA 5D5QA 3ESAA 3HJRA 3G0IA 1VSTA 3L7DA 3LP6A 4UHJA 1M1XB 1PR6A 1A96A 4X45A 1V9CA 4MW5A 2FN8A 1T4CB 4P4SB 1KP3A 1NVXQ 1V0JA 3AETA 1D5WA 1ZIXA 2CSUA 2HADA 1U6KA 3NNNA 1KSGA 3M5PA 4G4GA 4L4XA 3TCXB 1Z12A 4GXTA 3HLYA 1O7JA 1XMJA 4K03A 5EJ7A 1RYBA 3EMVA 5L4SA 3PVCA 4FZ3A 3N5CA 5JWHA 5LLSA 3TNYA 4CIAA 4KP7A 4YCLA 5FBQB 1DC5A 1VFPA 4URVR 1B16A 3RFTA 1DWUA 1UPAA 4XARA 2R5FA 4HZUA 1W36C 4UDYX 3W1EA 4LI0A 4DBLC 3GLFB 1AUVA 2PXHA 3ZGVA 3KAPA 1WU8A 4IDFA 1V43A 1QGUB 4ND7A 4EP1A 2Y0DA 3HBNA 1JMVA 3ZLTA 1V41E 4IGAA 5HMMA 3UJ9A 2CY0A 3VMMA 1UDBA 2GD6A 3N2LA 2BH9A 2EIXA 4HO1X 3KHKA 5E9QA 1X13A 3ZX4A 2QMEA 4YRIA 2Z0MA 2XB9A 1ABEA 3WLIA 3FPEA 1QHSA 1SM4A 3WMRA 2BV3A 3V7WA 1RQXA 4FR0A 4KIWA 2IOYA 3WTCA 3ZZMA 2Z5FA 2ZS8A 4EENA 4CQMB 2VLBA 4ZVOA 5TRTA 5IAAA 3B13B 4Q6BA 4MVWA 3V4OA 1S1CA 3LUHA 1DL5A 1DMRA 1XRJA 1DTWB 2G8LA 2ZIUB 3NCHA 1WB9A 3SZGA 2I9PA 2YY5A 1M76A 3IKVA 4OREX 2IL1A 3VAAA 3VSCA 3QRWA 3S5UA 1NX9A 2O6LA 3DYIA 5JBNA 2PXAA 3KDPA 1Y80A 2Q28A 1OXMA 1Z8DA 1XMSA 4XZ3A 2NVUA 3IGFA 3TKAA 3AQIA 3WTBA 3UWDA 1A2BA 3V33A 2CLDX 3CHYA 4Z4QA 1KRXA 4HV4A 3L5KA 5CD1A 3ELBA 1OC4A 1T34A 2JJ2D 1BJKA 3D31A 3JQPA 4IIUA 3UMRA 2BGRA 2V98A 3HGTA 1X9IA 3OCJA 3A6EA 3MFYA 1OFVA 5BQOA 5A4KA 2AGVA 2PGIA 3WZMA 3TGLA 3IHWA 3V55A 2HA6A 3AR9A 1GUYA 2AOWA 3FDJA 4RQTA 2QYHA 4KAJA 5G1OA 4EHNA 4ZI5A 3ZCUA 3IQEA 4DARA 1DXYA 3OIDA 1Y1QA 2QD3A 5K7SA 2GJ9A 4HLDA 4RZQA 3WRYC 3DAHA 1BHO1 1TJYA 1B6TA 2PH7A 3PNQA 4FZRA 4QASA 1CUXA 1TF2A 5LMUB 5JS1A 3VI3B 4P33A 5CXUA 2OILA 3D5EA 5CG2A 3AFOA 5FHQA 3AEXA 1GKLA 3WOHA 4G36A 3RPEA 1AKRA 5IW8A 4AKIA 4B4VA 2J6IA 3H2HA 1LPOA 3HJGA 4PY2A 2C9MA 3I5MA 1ZI8A 4XCVA 1B8PA 5DWDA 2QR3A 3M3DA 2BR3A 1JEOA 3WXBA 3AKCA 4LWZA 1QRUA 1JAXA 3EG9A 1PT7A 1KJWA 2ZRPA 4FINA 2PUJA 3B6MA 5K3EA 2CJPA 1S1MA 5AKKA 4LJKA 4IP0A 1R66A 1DXOA 4GLLA 1JG6A 2C2OA 3Q6IA 2NTJA 3HU2A 4KSBA 2AG0A 5JC1A 5SV2A 2VSYA 4X8OA 2RHLA 2Z5VA 3E9CA 1VLLA 2QW8A 3LYHA 3OZAA 4JAVC 4ZYXA 2UVPA 4RPCA 1M2OB 1P1HA 3L6RA 4CMKA 2ODNA 5IDWA 3D2AA 1WEHA 3H4IA 3AJ8A 5DGCA 1L5GB 5CDYA 1EX7A 4D8YA 1ZXXA 5I8WA 3KL4A 3TSWA 4M55A 1J21A 4DT1A 1Z2CA 3U56A 3DTVD 2H63A 4CM6A 2HA3A 1DB3A 1KO7A 1I7SB 3PQEA 4CMHA 4OHKA 3KWLA 3HDJA 3R0JA 2JLYA 1UMDB 3VKFA 5D5PA 3R5TA 1ZEJA 3BJRA 4YB8A 5TGDA 3PQCA 3PD1A 2P6PA 4QVKA 3SSNA 4BPRA 3CKYA 3EFHA 5EVCA 5TARA 1NMXA 1QIFA 4JWKA 5IDXA 4FFBB 1QRAA 4G5OA 6ABPA 4MS4B 2ZQYA 5CA0F 5LYJB 4O4LA 1C1DA 2NV6A 1K63A 2Z1MA 1HXHA 1H66A 1E9FA 2XDWA 4PG8A 3I04M 4JROA 1E2HA 2WUWE 2WZCA 3DZHA 3VVLA 1V25A 2O3TA 3NXKA 4PHHA 4EJ0A 3IP8A 2GXQA 2J1LA 1ZBDA 2R1TB 2X7JA 4NC9A 1H2WA 4LXXA 2G67A 3EXIB 4Y2TA 4QREA 2Y0PA 1Y3CE 1MO2A 1MG5A 1WHTA 2HNKA 2XD9A 3LGXA 3RWOA 1TVKB 1TYAE 4AUKA 5I3ZA 3GFQA 3IB3A 1VSVA 3LP5A 3PB3A 4M87A 4RJ2A 3THSA 5JAIA 1YDHA 4UXIA 4TTJA 1NP6A 4GR4A 2FUG6 2P8JA 3BE8A 4DIOA 3C5WP 3HYRA 3ZPXA 3HN2A 3JZMA 3L8MA 3VPCA 3R74A 4MVJD 4D99A 1T0JB 3VYWA 4TZ6A 5FTKA 2QTAA 1VOTA 4HYTA 4LF7B 3CR7A 5E1BA 2WU8A 1QYRA 2AW3A 3A58B 3L5OA 4W9RA 3RR2A 1NT4A 2WWWA 4PX5A 3RT7A 2R5WA 1ADBA 4YAUA 2HMYB 4W5JA 4YC7A 3IDAA 4I46A 4F38A 5JPIA 4EHJA 1XQWA 1X8LA 2GVNA 1ZOPA 3EWIA 2RIPA 3DAYA 1C30B 2FRDC 3G0BA 4II3A 4PC6A 3TGWA 2I91A 3CLSC 3L7YA 2W00A 4PQRA 3KR1A 4IIJA 4KLAA 3QLTA 5IVDA 3B85A 4HVCA 2XUKA 5LXTA 1ONPA 2G9NA 2P2GA 3NHLA 1CUYA 4HAUA 1R15A 3BSYA 1T6ZA 3EZLA 3OSUA 4MW2A 3ROTA 5L6MB 4PTYA 1YFJA 5BWMA 3QUCA 2P35A 1MC8A 4QXRA 3DEFA 5AM1A 5EGNA 4WRRA 3RU7A 4TZ0A 3RYHA 2VHWA 5CURA 4JYZA 1I7DA 1DJLA 5B58T 1QFJA 1I36A 4OHCA 2QXTA 2NTYC 3R9KA 4AL4A 1GUFA 2AN1A 3OFSA 1QIJA 2WTXA 5LXTB 3CH7A 1GRRA 5COBA 1K3FA 2VAVA 4LJ8A 4IJMA 2G08A 3EUEA 2VTBA 2OQ2A 4U0JA 1BROA 2C2ZA 2I55A 3K4QA 1XE3A 4FFMA 4NEGA 3SS8A 2OR3A 4Z51A 5CDHA 3KC2A 1Z0UA 4FNOA 4RLFA 4ENTA 4O3MA 4BVAA 5KWSA 2PVCA 1XCGB 4N39A 1QHIA 1ZR4A 2I22A 3SIRA 3WA6A 1G8KA 5G53C 3N3BC 1Z5WA 1Z82A 3D8NA 3KTAB 2NU7B 4MI1A 2FJPA 3OF2A 4Y7CA 1XA0A 3Q12A 4ZEXA 1ISFA 1HOTA 2CHQA 1U4OA 3KD3A 5BNFA 4FB4A 1ECCA 1EH5A 1RLIA 3N28A 5LZ2A 3RVBA 2CYCA 3L1JA 4NQZA 4IWXA 2IKQA 1A4UA 3RIXA 4BIIA 2R8BA 4Y6PA 4YV7A 5LNK6 1VJ5A 4D57A 5ILOA 3KE8A 2DBYA 2GN0A 5KWEA 2HU8A 2RARA 5K6RA 3G2JA 4EFKA 1L4YA 2Z6AA 3EOBI 1CUEA 1PGOA 2JI4A 3EXEB 1PJZA 1WUTA 2CDAA 3RHSA 1UWLA 2IDJA 3V8BA 3EHDA 3HYCA 3PFHA 4CMBA 5B30A 1OILA 2IT1A 4YT4A 4M53A 4FLFA 4L5CA 2FN3A 3NALA 4CF3A 1NBMA 2OUIA 4OQMA 3RVOA 3QXSA 4B7ZA 3DBHB 4ARVA 3CZ4A 3MHPA 2X7XA 1E2BA 1R7RA 2ZXFA 4Q9LA 1ZVJA 3UK0A 4CM9D 2PX0A 2CJWB 2IUYA 4UVHA 4I1RA 3BK2A 4YBZA 3CX4A 4CRWB 1LZKA 1Q0SA 5A9TA 3W5VA 5AW8A 1GGKA 1KI7A 2RB4A 4GQAA 3R7SA 2W2XA 3KQHA 1PX2A 3O26A 2V7QA 1Q3KA 3LKDA 1KXJA 3IAS6 3C3WA 4I7EA 4LZPA 4RHFA 1K2WA 2A4KA 1LJLA 4BX0A 3HFJA 3FFAA 1HF3A 2QN8A 5CTJA 2WIDA 3S7TA 4BX8A 1W4RA 5HW0A 5IC6A 4EBFA 2ZJYA 4BFYA 1J7JA 3AJRA 1UMBB 4QBIA 1YOVB 1D6MA 3GROA 2Z6UA 4IMPA 2A2ZA 5D7NA 3K35A 2VZ9A 3A6DA 3JRXA 4OHUA 5EMHA 3W4JA 2QRZA 1F38A 4WOJA 2WT9A 3OY7A 4YMTA 1U8YA 4I1SA 1PZGA 3W1WA 3RC8A 3PHBE 1DSSG 4IXTA 2HMWA 3BM5A 3FZEA 1JNXX 3ILSA 5HKKD 2CCJA 2WF9A 1RRPA 3R7LA 2VYQA 3DPIA 3IQIX 3PUYA 4L2IB 4DV3B 5FOUA 2DLCX 4REOA 2KE5A 1AQ6A 4D6XA 1U9IC 3DTTA 1J5EB 4XCXA 3AHJA 1LVHA 4BLPA 2AJCA 4KYUA 5EUCA 3T5AA 5JS2A 1C5KA 1X70A 4UUQA 4B84A 3THYB 3K6SB 4NZPA 3WIEA 4BVEA 3VNAA 1ZWLA 3CF4A 3PC8A 4RCZA 3OZCA 4EM6A 2EQ5A 3BRWA 1WP4A 2O7QA 3R3VA 4GP6A 2DQZA 2SHKA 4QU9A 1WZIA 1QCYA 2OGTA 3ZQ4A 3ICOA 1OI3A 5BSKA 2B8WA 3N0TA 4QICA 4ZT2A 2PD6A 1LDNA 2V03A 1V16A 2Z6VA 3JQBA 4KYVA 4P83A 2VP3A 1BZYA 3NNDA 4CHTA 2DH5A 4CMEC 3OUZA 4W9NC 4YAKA 1GTJ1 5KKCA 4OL9A 5JVDA 1DAOA 3HO1A 3SFZA 4IRMA 5AJVB 2Z9DA 2CDBA 2X19A 2E89A 3RRMA 3S40A 2BAGA 3L4BA 3WP1B 3T1TA 1WMSA 5GAJA 5FAKA 4LHYA 5GMOA 2WSLA 5F77A 4UFPA 1RYDA 1KP9A 4QUAA 2M6RA 4YIKA 2F00A 1X42A 1UJMA 1HKUA 1C2YA 3E9DA 1FQOA 3HACA 2OBLA 2PRIA 4UEJA 4UM9B 1U8EA 5I7WA 2PYZA 3O8OA 4GPBA 4M9CA 5AHXA 1SK9A 4BBJA 3IEMA 2FPMA 4XQ0A 1NRIA 1U0OC 1FBTA 2DT8A 1KYIA 2H54A 1EP9A 4PCLA 4Z9AA 3SIXA 4PSVA 2PLFA 5F51A 2MINB 4ZRDA 1P0MA 3GFOA 3D0KA 1W6RA 5T5QA 1MT0A 1XPUA 3CLTD 1DRUA 3ODPA 1RKBA 2HMSA 3D8SA 4JVOA 3MOSA 3AHHA 3QF4A 4PGHA 1Y9JA 4K1XA 1EWQA 3OOYA 1HL7A 3NDJA 1EUQA 3CSUA 3CMMA 4PQGA 2I3ZA 1ZJ4A 1KJ8A 1MJGA 1RWNA 5JCZA 4TWIA 3BX1A 2DT5A 2IDZA 4EI2A 1SD5A 4TT3A 1AS0A 2O19A 4OAOA 2WJ4A 1PJLA 3UGQA 4B4UA 1WVGA 1YJ8A 1JKIA 2VHZA 3G2PA 3H1PA 2ZWAA 3R44A 2XI4A 2GX6A 3CUSA 3P5SA 3R3ZA 3FYDA 5HIAA 4AYTA 4H7PA 3E53A 3PQDA 4F2DA 5L53A 5E95A 4RHXA 1S2GA 1SWWA 2QT9A 4Q4HB 1UZNA 2QMOA 4WK2B 5DBEX 3FNBA 4D9NA 3E1KA 5K8LA 2EW1A 1THTA 1KI9A 3KEGA 2XYVA 4FKMA 4FMCF 2IU4A 5TY0A 4JYPA 3AVWA 2ONCA 5IN5A 4Z2AA 1LDMA 2MSLA 2XTZA 3ND9A 4G0MA 3MAAC 4B3RB 3DL4A 2HDWA 3NTUA 3SBOA 1NMYA 2DFDA 3ND8A 3WGHA 1P2FA 5C80A 3G1WA 5IUNC 3K0AA 2JANA 5T57A 5T67A 4DAEA 1FFDA 2DECA 4ZRMA 1GA4A 4LE2A 5UKDA 4LDJA 4EHHA 5IM4A 1NG9A 3CVOA 3SC2A 3TUIC 3ZWQA 3RT9A 4JC4A 4OIMA 3D3KA 4TMYA 1U2GA 3PRHA 3ROPA 3BWYA 5EJ6A 2ISCA 1CRPA 3QVKA 3LWBA 3JATB 4YREA 3WIVA 4NG4A 4QEDA 5ALTA 5GWXA 5I6DA 2PVSA 2UXCB 1MPXA 4RXTA 1CRQA 1W8IA 5AMXA 4QOSA 1Q6YA 1UOPA 3PDWA 3CIOA 4R2KA 5GADl 1EX6A 2ESRA 2ZJOA 3OESA 3LUPA 3WV5A 1AGYA 1DOAA 2V7XA 3PCTA 3EMBA 3C6BA 4DFDA 5CT8A 2JGKA 4BLRA 3FCYA 5FDFA 4GYJA 5J43A 2WK1A 2PKCA 4DT1B 4R6WA 4Z9BA 1RM3A 2P9BA 3LLVA 4UAVA 2M9MA 2X9NA 2ZYSA 3N5KA 3RV4A 4EA6A 3HCEA 4I1PA 2W2TA 3QF4B 5LA6B 3AK4A 3DMHA 3QLVC 5TQVA 3WLEA 3MTBA 3K8OE 1ORRA 4GGPA 4QUIA 4B3HA 1YRWA 2GZ1A 4JN6B 1VG9B 3JARA 4PC1A 5DIZA 1L9XA 3MT8A 4HEQA 1ZRNA 3B78A 5C32A 5CBKA 3J7TA 3PQ7A 3U44A 1ACMA 2WZQA 4X7RA 1GXSA 4N7RA 1FSFA 1ZD3A 3AW8A 4D5GA 1T36A 5JATA 2CXOA 2WSYB 3LG2A 4CEHB 1FTWA 2WOOA 1A5AB 2I2WA 3EC7A 4QOEA 1C3JA 4QARA 3T5GA 2HDNB 5AM2A 2REOA 4JBLA 5IJXA 2GPJA 5HQ3B 3AI1A 3UAZA 2MOKA 3D7LA 4EY5A 4XVCA 1JH9A 2AQHA 2YMPA 1Z47A 2FA9A 5B3JC 1JHUA 4JI0B 4FVTA 4Z86A 4OBEA 3UCFA 3W6ZA 5H02A 4ZGWA 2X9GA 2XW6A 4CCYA 1C9NA 1IPHA 1GN8A 5LQSA 1EM8B 1RAEA 2DQYA 3OPYB 4XAQA 2GBLC 4EL5A 3W9YA 4JDUA 2GSWA 4DMGA 1GPJA 3RYCA 3LJKA 4KXLA 4AIIA 4FI3C 5ALKA 4YMGA 4Y1RB 5EINA 1QIGA 1UBSB 5NLLA 4P4GA 1SBCA 4JXJA 4MA4A 4KMOA 3BBPA 4PHGA 3ZHRA 2WU4A 3N76A 4FE4A 3RVPA 1LWOA 1QH8B 1YUNA 4MQEB 4ND4A 1CIJA 3LCJA 3OZTA 1ICIA 3FBWA 4HEJA 4IG4A 3WDSA 1PFKA 1X15A 2XAUA 3H97A 4MLCA 1L1FA 4DLVA 3U31A 5JAUA 3OQNA 2QX4A 1DIGA 4M1SA 3WK4A 3RHTA 1CDZA 4FK8A 3EQ9A 4MUBA 1Z0ZA 3KJNA 1MORA 3R3JA 4I5IA 4NYIR 1E5DA 1ZN2A 2ZG6A 1Y8ZA 4IEEA 3NBQA 3N2YA 5DBOA 2EWWA 1UZAA 4YT2A 4K8RB 3T7SA 3L6BA 4CUKA 1FFGA 1VE9A 4FB5A 5F33A 1M5UA 4D4MA 3RSGA 1Y8QB 2VF2A 3VZRA 4O2BF 2ZE5A 1NZJA 1NYQA 1W0KD 2GTIA 1NQTA 3C8MA 3TOCA 2DR2A 4L75A 4WA7A 3LY8A 4HFMA 3T7KA 5CGZA 4HQ0A 5IVPA 2W2LD 3ANMA 1IXZA 2EHJA 3OWHA 3MTGA 5GP1A 3CZPA 4BP8A 4IUYA 4OFZA 1EFVA 4IO1A 2WYIA 1PJRA 1JBEA 3DP7A 1Y8QA 4OMDA 1BS1A 3WNCA 3GZNA 3U4QA 5HSGA 1UOOA 2PAAA 1MAVA 3NO4A 9LDBA 3RC7A 2HTEA 1P6XA 2XJ4A 3K1ZA 2ZJ6A 4Q37A 5LUBA 3OAAD 2J0QA 2CJWA 1Y48E 5HEKA 2BZ0A 3TVTA 1D4OA 2FJUA 2XWQA 3U1TA 4E15A 4KOAA 3VH1A 3VPHA 2C7OA 1MB9A 3MNFA 2HH9A 4OTZA 2PUWA 2C9ZA 4IWYA 1V1MA 5BT9A 1RI2A 1UBJS 2I66A 4RV9A 4RK5A 4KV7A 4W6ZA 2GCPA 1E7QA 2Z2ZA 2VUHB 2CVOA 4DLUA 1TRKA 2E3JA 3MUNA 3OTGA 2JH9A 1PWZA 1I14A 1K6JA 3FSRA 2Z58A 1CJKC 1XNHA 4YGXB 2M6LA 1K4KA 2ACVA 2BMFA 3QVTA 1A27A 4BZWA 1L4BA 4FFBA 3MTQA 4R2JA 4XSHA 1IYZA 1HZZC 1QO0D 4HI0E 5L7YA 5BYKA 2IKSA 4F56A 4GAEA 4IDHA 4W5HA 5JROA 4YQEA 3SICE 3H9EO 4XFKA 2DC1A 4HNQA 4KQXA 2H2GA 3HXQA 1NVEA 4GOLD 2OOKA 3HVUA 3F98A 4BLVA 3BS4A 1JHZA 2JBHA 1YQXA 3EIFA 4FUTA 4HZUB 1YRAA 4L6CA 4W5OA 3PQ5A 1OTXA 3GRKA 1V2HE 1UZUA 4JHLA 2QVZX 3RS5A 3D4OA 4X61A 4Q3OA 1E8NA 3PGMA 6GPBA 1G55A 2GO7A 4Q9KA 1L5ZA 4MAAA 3AJEA 1VB5A 4EYSA 3SX0A 2NV0A 1IMOA 5E9JA 1E79A 1SIOA 2W6CX 4GPIB 3MPOA 4ZPJA 1SUCA 3MGGA 4IDDA 5AOVA 3ADBA 4RD6A 1CU1A 4GKJB 3UOAB 1LPSA 2DMRA 2C58A 1IMJA 2HNAA 3ICWA 4PZAA 3R3WA 3SZLA 1JLKA 4QVGA 4JJ7A 4CL2A 3PGLA 3BHJA 3W5AA 2BP7B 3RWBA 1BCSB 4JZKA 3PFNA 4QZVA 2F90A 2O7NA 4F96A 3R5SA 3LUFA 1SOUA 2J7PD 1USGA 1XAGA 2Z4SA 4B3FX 4TMVA 1ZU4A 4TLBA 3EARA 3R7FA 1NXWA 1W1IA 2X3YA 3DE1X 4EL0A 3MWEB 5DNDA 1TTQB 1XO1A 2FSSA 5LDDC 4GKKB 4TMZA 4NE9A 5ALIA 3WY9A 3OPNA 5A5EA 2YWDA 5K99A 1WE2A 4FS8A 1XWIA 4BQIA 1IJKA 4QRHA 2JJQA 2R4UA 3VTAA 2X0RA 1DRWA 3HKCA 3GLTA 4DV0B 3IIJA 3CZCA 3JATA 1QIDA 1GGJA 3EEBA 4QFBA 4X71A 2E4ZA 4MKFA 4WA8A 5DM0A 1CRWG 2K5UA 5AW1A 2JBAB 4ZREA 2PJUA 5FFFA 5F5LA 1VLMA 2AR0A 4M89A 4YRTA 3ICCA 3U7RA 2ZIZA 3DO6A 2RGDA 2WT8A 4FDMA 3U9SA 4CM4A 2UYHA 3H9QA 1FIUA 1VE6A 2JZNA 3I3SR 1LQUA 3LPCA 1QQ5A 1TMOA 4NOLA 1KEVA 3MGAA 1KS2A 4P36A 3L84A 1XU4A 2EOAA 3E2PA 5BOSB 5JEDA 2WJZB 4C7KA 2ZZMA 3OFKA 2UYGA 4Q4HA 3FBGA 4RIFA 4E31A 1W36B 2A5JA 4WX2B 4D97A 3UHAA 1VMKA 3TUZC 3DKIA 4DQKA 4BECA 2VPWA 1XEXA 1RJWA 2AN9A 3ENZA 4OI2A 4PC2A 4Q9IA 4LZLA 2CMKA 1M73E 1CG6A 2PR2A 1J0CA 2FFQA 1T1GA 4QYWA 5LXTF 5AUQA 4D6PA 3WGNA 4C4RA 3JS5A 3ZXUB 4Z53A 4AMGA 1KFBB 1XXHA 1NXQA 2H2WA 3DTVB 1ADYA 3PR2B 4ZHQB 1W6UA 2YRWA 3V7NA 3AFIA 5CXXA 5K0SA 2AKYA 2P1RA 3CUKA 3WISA 1BEUB 5EWLA 4INPA 2CV1A 4I8XA 4C0HA 2VC2B 2M1ZA 3AP3A 4BQQA 2ZE8A 3EMDA 4I4LA 1Z8NA 3GA7A 1KMHB 1GQQA 2RHDA 4YJ3A 3I45A 2PSDA 1G1MA 4DZTA 1GHTA 4Y2HA 1JEDA 5FQNA 1P5ZB 1QG2A 3AR6A 2QRKA 4ZT4A 3IUPA 5EA2A 5LPNA 2V9ZA 3IT3A 4PBTA 1MXHA 4BFVA 3PFWO 4X1IA 3O03A 3HPQA 2I80A 5LYJA 1W34A 3FE2A 1SKBA 3N1UA 1KDTA 4XB1A 3Q8XB 4CU2A 4IFBA 1S01A 1T2NA 2HC9A 4RQUA 4MVXA 4HCJA 2C9DA 2ORIA 2BEWA 4YCJA 4YAEA 2PWYA 5BSRA 4MMXB 3AM1A 1MB4A 2VDWB 4G8DA 3U4CA 3PHIA 4ZZ3A 4NCKA 4YCNA 1P5RA 1NN3A 4AKHA 2W37A 2V8BA 1P3DA 1W8DA 3C4QA 3QPDA 4BLSA 2FSGA 1PJ4A 2OPBA 4U7PB 4CTMA 2UUOA 4LYGA 1E3MA 1Y4UA 1S2DA 1EFRD 2H8KA 4FILA 3QFCA 1XWWA 3H2YA 3H1GA 2ZTVA 2JASA 2BC9A 1TIKA 3PXAA 3KJIA 4KB5A 4B17A 1E60A 2ORVA 1R0BA 1R9GA 4MAMA 1UKCA 4IQGA 3K6SA 5FKJA 3ROQA 1GV0A 3FMGA 3NAGA 2HU5A 2ID4A 4UASA 4HJXA 4W7SA 2I4MA 4FOSA 1FQJA 1J0DA 2O48X 1JFVA 3CBGA 1EK0A 1Z29A 3E81A 3HCOA 3K6KA 4GU5A 4IIEA 3T5CA 3HZRA 4MW6A 3WGTA 1CUUA 1FXUA 2BSXA 1ZNWA 4X20A 3TNLA 3TZQA 3TTXA 4CKCA 5AXAA 1PV1A 1FVFA 1FTSA 2O0MA 3KVRA 4B6EA 4QNMA 4KFTA 3U3XA 2IH4A 4AMZA 1IH8A 1J8MF 3NIGB 1DIAA 3UJ8A 1LUAA 4ZVLA 2X3FA 1EP3B 1EK2A 4R68A 2YUTA 1Z28A 4CFSA 3P0RA 3LGAA 1IIRA 4RO0A 4R7GA 4AWAA 2B6NA 2QT1A 1EXWA 3C5CA 1UJNA 2J30A 1TEHA 1RNLA 2V1UA 3FTDA 3MTIA 1Y1LA 4XVQA 3L1IA 1U99A 3IVXA 4OQZA 4Z6KA 5MN4A 2YRXA 3KQSA 4DA7A 1FDVA 5FA6A 3MT0A 4QXQA 1S8AA 1D1QA 4ZDWA 4F46A 1E92A 4ZT6A 1B26A 4QWWA 3Q8MA 1BMTA 2LWIA 2RK6A 3E7PA 4FD3A 2ACEA 1AKEA 4TV8B 3LF1A 4EARA 5C8VA 5HVNA 1WBBA 4DV2B 4J0QA 2G0AA 3TQIA 4FR2A 2ODBA 1QE3A 2HU7A 3OD5A 3T3PB 1MHTA 3JQAD 2X5JO 1PR5A 4FGZA 3DOFA 2R9VA 4BNJA 3LPNA 1R4MA 1XROA 2AWNA 3KOXA 4OB7A 4PZLA 2Y3IA 1T2CA 2XVMA 2Q8QA 3BFPA 4QOGA 4DC0A 4EG0A 2ZRDA 1N75A 1JQJC 1F2TA 4H3SA 4IGKA 4I4CA 4LGMA 1VZ3A 2ZIGA 1WXGA 1MRZA 3RS3A 3E1SA 1PQYA 3H6KA 1G41A 4UQPA 5FBKA 4RTLA 1I7NA 1KQ3A 5CU7A 4BNHA 4FT4A 4DDWA 1ZJ5A 4S04A 3ZDBA 2OAP1 2DGDA 3CIFA 3M6MD 4LZWA 3ZU3A 5AVWA 1IOWA 3BEOA 5K0JA 3GJQA 5B3JA 4RTMA 3U60B 4KVZA 2EKLA 3QELB 3UM9A 1J42A 1DV1A 1E6WA 2V7UA 2WJVA 2DOKA 3F2IA 3I5YA 1MX9A 4G5XA 3D6VA 1TQHA 2Q9CA 3KQUA 3ZVMA 2HZ7A 4LDRA 4RD3A 3WRXC 3ZD8A 1P9RA 4C4XA 1TGVA 4PU0A 1OWPA 5CW2A 2ZSBA 4UD6A 1QS0A 4ZVTA 3FUWA 2X0EA 1E1NA 5I9TA 1KYZA 3HJHA 4IFEA 4MQBA 4D0LB 1C3XA 5JSYA 4L02A 4O59O 3RDPA 1VJ0A 1ODKA 3HABA 2V7EA 1GZ6A 1EFLA 1G21E 4EMUA 2YZ2A 4Z1OA 1AGXA 3ZWBA 4ZCMA 1RWOA 4UDNA 4AULA 3U61B 1W44A 1XJCA 3BGIA 4Q9NA 3LSTA 4ARZB 4D1YA 2P9TA 2YIVX 3IBSA 4HNAA 5EE9A 5AESA 1OUMA 2AJDA 2JD1A 3QPVA 1G20E 1G5FA 5FNVA 4B7AA 2VOJA 4GS5A 3PZRA 1P9LA 5IBPA 4NLLA 4ECEA 2VJCA 4DLWA 3Q6NA 1HYEA 1HPLA 4PICA 2QAGB 4DBLE 1K88A 3K9NA 5EHGA 3IEPA 5MGBA 3HXMA 1MJ5A 1TLFA 3WSWA 3AVPA 1FVXA 2N9UA 2X6RA 4PRLA 1UR5A 4RK0A 3ZWPA 1SVLA 3B1XA 5DZSA 2P9EA 4K3UA 2IY7A 1ISPA 2IXGA 2TMKA 3PUVA 5TPZD 1BDJA 3GLGB 3UHFA 3V1KA 4C20A 3IXLA 1TU4A 4N0QA 5KZMB 3QKSA 4DLBA 1U2EA 3H18A 1B74A 1ECFA 3DO8A 3WLRA 2HT6A 2Z83A 4HB0A 3BSFA 3IEVA 4E46A 5TE9A 1K3TA 2Q49A 2WP0A 4K05A 2F1JA 4OO3A 1P1KA 1W88A 4P86A 4BZQA 3JAMA 3WWDA 1ZGHA 2CHGA 1XN4A 5IVIA 4ZV7A 4KIGA 1J70A 1N2SA 5IUKC 1DBQA 2OVFA 4AP6A 2J33A 2JIZD 2XUAA 3IQGX 5CFNA 1SPXA 3QGMA 1H5UA 2BT4A 1OBCA 1IM5A 1Z5GA 4CEIA 2BI8A 3RS2A 1COWA 2PZGA 1UQRA 5L3RA 4RK7A 2OTCA 1EDEA 2V7VA 3EGDB 4ENPA 2PA0A 3VV2A 1F5SA 2ORED 2UKDA 2VSNA 5EWLB 3M6FA 3WICA 2P2DA 4LBZA 2Q5EA 2QQFA 4O6VA 4PCVA 2PFKA 4W99A 4C6HA 1KJZA 1HWYA 1DLJA 1MVOA 3EXHB 4RCYA 5IJWA 3ROFA 4NOMA 3TDKA 1NM5C 2HJGA 2J48A 3T7TA 2ZUSA 1I6WA 1O0BA 1WPGA 4NE7A 1CW2B 1LDBA 5FORA 5A0VA 3ZXIA 5KYVA 5AVSA 4YIHA 3GFSA 3DOCA 1XDWA 1C7EA 1NI5A 4I5EA 4PLTA 3TIIA 2PSJA 2OKCA 2X58A 3R3YA 2X1VA 4GMHA 4M49A 3AVYA 1ZISA 2NO0A 1YC2A 1U65A 2HPVA 3GWZA 1Y6RA 1HNNA 3NBMA 1YL6A 4L5BA 4H6WA 1EUDA 3EZ2A 2O8EA 4HTAA 3UUGA 4DBVO 4U2DA 2C42A 2XGOA 2CE7A 4QHSA 4TYPA 3SM3A 1L3CA 2WZBA 1D9ZA 1TCAA 2Q5LA 1GPWB 4Q0MA 3QVWA 1SG6A 2BMJA 4D25A 2ZUTA 1Y7LA 1N3IA 2VF7A 5EXXA 4NH4A 4LDNA 1PFWA 3BMQA 3UA3A 4ADSG 4PN3A 1CUBA 4YAOA 2ZR0A 1N9GA 3HR7A 1H3NA 2RAPA 2YN0A 1RC1A 2NU8A 9LDTA 1HR0B 1KFKB 4M0CA 2PKRA 3B8EA 5DXAA 3MA0A 5DN6D 5JJBA 1KC3A 2FZWA 2OCGA 1SQ0A 4PIMA 5HOEA 2W22A 4V1CI 4PSCA 2VDQB 2FMKA 1F0KA 4B6QA 4RHTA 3T41A 5I7VA 4EA7A 4BV2A 3I72A 1Q19A 1R9JA 3HEMA 3PPWA 4ZOLB 4D7AA 1IHDA 3Q7SA 5K3CA 5HF6A 1UK9A 2VP9A 2WA1A 4E5UA 2GZAA 4ETNA 1MCZA 1QDLB 1XQ6A 3HDHA 2V5AA 3O1LA 4ZOLF 4K3VA 4GNKA 5IHPA 4LEIA 4KNVA 1YBVA 3TW6A 1KY3A 3RRFA 3HUEA 2ZBPA 3D6FA 4YK7A 2ZTLA 5FLYA 1BMFA 2BTOA 4GSKA 4EHFA 5BYJA 1EA5A 3OT5A 3RYIB 2O1XA 3KKEA 2VDUE 4BXOB 1PD0A 4EFDA 4RFVA 1U2DA 4NYMQ 5BSVA 1IM8A 5THKA 5E1DA 1NJ6A 4C2UA 1CZNA 2J9RA 2CXPA 3B5IA 3IPLA 4QODA 2A0XA 1Y7TA 1R27A 4Z3KA 1EPUA 1SXJC 3IAFA 4TL6A 2IX3A 1MC5A 3WGMA 3PTAA 1FX0A 3NV7A 1PZHA 5U1PA 2ZAOA 5HF8A 5LR6A 1LDGA 1HA3A 1YSCA 2I6GA 2JIPA 4MP3A 1RQRA 1G0OA 3EQ7A 2EJWA 3DOIA 3MWFA 1HT0A 2QD4A 3I34X 5F7JA 3EX7C 1A9QA 3VMFA 2OYSA 3ROXA 3DNMA 1MDBA 1ZL2A 2JRCA 3T95A 16PKA 3R3SA 2XNDA 2DU8A 1DKMA 4XJSA 4DEXA 2AOTB 3WQHA 1S89A 4LZAA 3KXIA 1WW2A 1QHYA 1U5BA 3E8MA 4JL5A 3LUAA 1EEXB 1ZKMA 3RJ9A 1GQ2A 2B4QA 1EDOA 3V6MA 4G0WA 5L51A 1ACLA 4NDNE 3QU9A 5B4UA 5I9LA 4D9CA 4Z4GA 5HIIA 3FNQA 1L6RA 3LYAA 4FYHA 2QIOA 3CWCA 3P9QA 1B0ZA 3ZHQA 3OX4A 4OU4A 4ER6A 4B4WA 2R0QC 4V0SA 1SQGA 2XZTA 1SUAA 4WERA 4D56A 3SPXA 3OHPA 3H75A 4QEKA 4HWRA 4UHKA 4BO2A 1WJGA 3HTXA 1RWVA 2I6QA 4KN5A 1HURA 2F1RA 5BQXA 1U2TA 4J0KA 1KMNA 5J2TF 3SS7X 1VG0B 4CQMD 3WLAA 4RVDA 2CL6X 2G80A 4LKRA 2W6IA 3FNEA 1KY4A 5AVRA 2BGGA 2IK8A 2AE2A 1V71A 6CHYA 4TL8A 1UBLS 2DBQA 5FLEX 1U7WA 4QQRA 3JYLA 3HB4X 4IQFA 3HADA 4Y9UA 3RJTA 3ZHBA 5KQPA 2CHVA 5B5SA 1T9GR 4IH4A 4PQFA 1AMOA 4H7EA 4O4IF 3UUEA 1Q3HA 1P2SA 4ESHA 5A0TA 1WCIB 3RTBA 3R23A 1CRLA 4JBYA 4ZI3A 4R3NA 1H4TA 4GI7A 4X1YB 3SYLA 3JTEA 3NBAA 3VR2A 3ZIDA 2FWIA 1Q50A 1M2FA 2C88A 2WM3A 4WCFB 4JH0A 4QSHA 3STXA 4CIYA 1VPWA 1BXGA 2OGWA 3QOYA 1D2HA 3OT1B 1NW6A 4OB8A 4MXDA 5FXMA 1G20B 3Q5GA 3IMGA 2V74B 1ZSNA 1TTTA 1OQAA 3SZUA 4A1OA 2C2HA 1EFPB 1YBHA 4D80A 4WOPA 1R0ZA 1FF9A 1D2GA 1YB5A 2BBTA 4KGZA 3T3MB 1Y42X 2ONZA 5CCEA 4Q1EA 2WQ7A 4N6NA 2FQWA 4JODA 4XWGA 3I2FA 1LLQA 4LJRA 1T9CA 5AH0A 1CQXA 1FMCA 2JFVA 3CO0S 2Z3ZA 4L27A 2Q1UA 2ZJFA 1H3FA 2HUPA 3STWA 1E66A 2AIRA 4KKVA 5F1OA 4JBGA 2WKQA 4RJKA 5KWJA 5KTYA 1WB6A 1NIPA 2G7ZA 1NUPA 5T8KA 5M3BA 4G9BA 2QY6A 1Z5PA 2YVQA 3D6UA 1T2FA 4B40A 5CDUA 3A26A 4W4TA 5K3AA 1N6RA 1FK8A 3QJGA 1IBCA 1Y63A 2OBNA 3OD1A 1RTKA 3RVKA 1PLLA 2E9SA 3S2EA 4XWOA 3FPFA 3F9IA 2G40A 1RVDA 1G4AE 2CLLB 4H0FA 4OKIA 3VH2A 3IBCA 5HKOA 5KQLA 4KDEA 3L8ZA 2RDMA 1XCJA 2Q5JA 4XM1A 5DM1A 4DLLA 2RHRA 5CDFE 3CPJB 2VH5R 3QF7A 4WNAB 1JQDA 4ZFNA 4PEVA 1HV8A 2RGGA 2AOVA 4M0UA 1SCBA 4K88A 5EKXA 2X8BA 1NTRA 1QF6A 3F6EX 3O3MB 3KKMA 4YI3A 3STYA 1L5HB 2C7PA 5AW2A 3DHWC 2XUPA 3IFSA 1YVEI 3KP1A 1YONA 1U9JA 2H1VA 5K4AA 2XZLA 5AKIA 3ILHA 3OTQA 4R1LA 4YO7A 1KQPA 4J3FA 4AN1A 3OE1A 3K1JA 3I9FA 2WJYA 3A4LA 3QLUC 2P2LA 3VPBA 1GTRA 3MTAA 4ECAA 2VH2A 3ZWKA 4LBVA 1KJ9A 1WTAA 4G1CA 4U7WA 4XDYA 1QIIA 2FTKE 2VUTA 1HG1A 5FBLB 4C06A 1R9MA 1WSBA 5PNTA 2ZJZA 6YASA 2XTNA 1SEVA 3L02A 1XL0A 2EX4A 2PKXA 2EW8A 3RS9A 3TFWA 5A7FA 5JXGA 5ES4B 3IERA 4KFUA 4JVNA 3TNDA 3U3DA 3I73A 4G4IA 3OJLA 1X0XA 3NBXX 1SR8A 4L9SA 1XT6A 2GNOA 4G2NA 3NIBA 4L0QA 3K0BA 2LZ0A 1RXWA 5T64A 3PYMA 4J0DA 2CSXA 1SUWA 5HFJA 5AW9A 3WAKA 4E4TA 4KLCA 2VPTA 4R51A 8ATCA 1O3YA 5EKTA 3ZD9A 4M8LA 2XY4A 5EFOA 2B5VA 5EG5A 5F1PA 1I01A 1F1BA 4B5KA 1FMFA 3C7AA 5FOSA 4BTEA 4E5VA 1B00A 1JTVA 1VRCA 5KUTA 5MDHA 5EP1A 4YDHB 4GUDA 3RH0A 4FBGA 1XEFA 2H2AA 1R37A 3I5UA 3GJ3A 3GEMA 1QHHA 4CKWA 5F4BA 1PKXA 3AUKA 5FUQA 5IC5A 4YJ2A 2QTWB 1LF0A 4RF5A 3ZOZA 5BVGA 4W5RA 2XIQA 3PKIA 4RDXA 3TMKA 4KFSA 4UNSA 5HKLA 4XPIB 2KS6A 1OU4A 4KXXA 4TTAA 2IYLD 3H5AA 4K9NA 3HA7A 4URHA 2A9PA 4IZHA 4WY2A 1QQTA 5LM3A 4Y0VA 1BYUA 1NVBA 3KR2A 4KXYA 4WLVA 2YYZA 3Q2KA 2PS3A 2PZFA 1ULSA 2Q2QA 4EB3A 5H83A 2NUAA 3V4RA 1FY2A 4RJLA 1EQ2A 2F43A 4ZOCA 4LTMA 1F2UB 5TMBA 4YP9A 4FCVA 1IN7A 4A03A 4BNKA 4C43A 2MMCA 1GNLA 2A78A 2PX5A 2WWHA 3QIVA 3I05A 3NKLA 4I9GA 4IXNA 4LZJA 5HZGA 4DRXB 3FWNA 1BVHA 2J59A 2GWRA 2I67A 3EAGA 1V9SA 4I1UA 4MUNA 4M9SA 4MUMA 4Y98A 3ZDZB 3VHXA 3OOSA 4ZRNA 3QMMA 1TFRA 3EAFA 2RK4A 1COWD 2C61A 1QF7A 2QAJA 3QYJA 4WDQA 1KDZA 2NZVG 1EVQA 2QR2A 3PCXA 2A5DA 1D9XA 4O1HA 4CMAA 4QT4A 3KZNA 4YLYA 4KWTA 3ZHCA 1ISRA 1GWNA 1DT3A 4AJEA 2TS1A 3H84A 4FMDB 4LXQA 4YJ3B 5F2EA 4F1JA 1BS2A 3NOVA 3H13A 4LSMA 3CEPB 4AU1A 2WFLA 3FWZA 3FZYA 4ZCPA 4PR0A 3A6FA 5J4VA 2YJZA 4R1SA 3N05A 3C98A 3MJTA 2IHNA 1QG6A 1EWTA 1OE0A 2I2CA 3JASA 3GLGE 4F4DA 1PTKA 2Z9CA 2WJHA 5B2FA 1YKSA 4RDCA 4AO7A 1BXKA 3B48A 2C9CA 1WW8A 1ZXBA 2FAXA 1QFXA 3IBGA 2DHCA 4CM7A 3IJ5A 2NW6A 1E77A 1TXGA 5DT9A 4L51A 1XQXA 2ZCVA 4U6SA 4WIAA 3ZDXB 2DHQA 1JDBB 1F7VA 4WKOA 3JQ7B 4A5SA 3NATA 2HK6A 2ZRQA 1JZQA 3NP9A 4CT0A 5E6SB 2J4FA