3FVTA

Crystal structure of acetyl xylan esterase from bacillus pumilus, monoclinic crystal form ii
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
318
structure length
318
Chain Sequence
MQLFDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEAEPTLESYDYPVKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDGGIHDIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYYYRGVYLDAVRALEVIQSFPEVDEHRIGVIGGSQGGALAIAAAALSDIPKVVVADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEKAFETLSYFDLINLAGWVKQPTLMAIGLIDKITPPSTVFAAYNHLETDKDLKVYRYFGHEFIPAFQTEKLSFLQKHLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of Bacillus pumilus acetyl xylan esterase
rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
molecule keywords Acetyl xylan esterase
total genus 114
structure length 318
sequence length 318
chains with identical sequence B, C, D, E, F, G, H, I, L, M, N
ec nomenclature ec 3.1.1.6: Acetylesterase.
pdb deposition date 2009-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fvtA00
4C4XA 4KRXA 3DJYA 1MTZA 3S8YA 2O2GA 1P0QA 2RONA 3IUMA 2X8BA 1XZMA 2XUIA 4FOLA 3W2TA 1QIHA 1MO2A 1VOTA 3CXUA 3WKDA 4YK7A 1R3DA 2WJ3A 2DR0A 3R3VA 2J4FA 1R4ZA 4W1RA 1CUJA 4QNNA 5K5EA 5LZ9A 3HYSA 4BCDA 1HLGA 5A62A 1EB9A 4TPKA 5C8VA 1K5PA 1Q0ZA 4BB0A 1GPNA 1VXOA 4X71A 4DMFA 4B82A 3HJUA 4Y2VA 2BGRA 1QONA 3QPCA 5DNVA 3C6XA 1LZLA 1L7RA 3IDAA 1B41A 2VF2A 4P92A 4EBBA 1WB4A 5HF6A 1KU0A 1HBJA 1OXMA 3FCYA 3EQ9A 2OAEA 1QE3A 1Y7HA 1OILA 4BATA 4BC1A 3HABA 3M83A 1LPNA 7YASA 3KXPA 4I3FA 3PICA 4TGLA 4B84A 1XZHA 4CCWA 2DFPA 2JGLA 4L72A 1O6GA 1MN6A 5ALSA 1EDBA 3G0IA 5BWCA 1QTRA 2WHQA 4DNPA 5JAPA 2PSHA 5CTAA 5CT8A 4H7IA 3DQZA 1ZGBA 3OPMA 5ALVA 1A7UA 5JD6A 5AM0A 4ARBA 5EHXA 4GW3A 2D5LA 1YSCA 4Q3KA 4FFWA 1G42A 4BE9A 1RYYA 1CLEA 1QO7A 2WM2A 5JATA 5EHNA 5FPPA 1LBSA 1THTA 2ZYSA 2PSJA 3SK0A 3RLIA 3FCXA 1E89A 1TAHA 4PNZA 3ZLVA 1CUSA 2I3ZA 3DOIA 4IH1A 4PW0A 4YPVA 4LYDA 4W1SA 4X93A 5JD5A 3ZI7A 4PV7A 4EA6A 4S0XA 4QLOA 2QM0A 4H77A 4YX9A 3B3QA 1HL7A 3WJ1A 5KREA 1UK8A 5DWDA 1CEXA 3I1YA 1IZ7A 2WG1A 2PKYX 4DSAA 4B6GA 3G9TA 1YR2A 3HACA 1LZKA 2WILA 3VVMA 4Q05A 3GA7A 1F8UA 2CBGA 1MAAA 5ALTA 4B0PA 3Q0TA 3GELA 2WJ6A 4L0CA 4W1PA 5AK3A 4LKOA 3V1KA 1FFBA 4GEGA 5JARA 2XUAA 1R50A 5EIAA 4EY8A 1LPOA 4XWGA 3V1MA 1XZDA 3OG9A 2XMRA 4BAUA 3A2MA 2XQKA 1H2XA 2ACKA 1BU8A 2JGEA 2OQIA 2WHRA 4ETWA 1U4NA 5AK6A 1J07A 3I2HA 3E4DA 3V1LA 4LXHA 4WY5A 5LYYA 4DNQA 1A8QA 2XLBA 3RARA 1CUWA 2H7YA 4BE4A 1GPKA 4H18A 1QGED 4V2IA 3U0VA 3C5WP 5FOQA 2DHDA 2PBLA 2WFMA 5ALRA 5HZGA 1C7JA 1UT6A 2WUDA 4J0KA 4MYSA 5HQ3B 3O4JA 1N5MA 1ZI6A 3IUJA 4BAZA 1K8QA 3P2MA 1ZJ4A 1JMKC 4BVLA 2QT9A 2VSQA 3WKBA 4CCYA 3GFFA 4G4IA 1G66A 2PPLA 3SC2A 3NOXA 4N5HX 4X6UA 1E8NA 2AJLI 4DNFA 3H2JA 3WWEA 1XLWA 1S8OA 3D7RA 1F0NA 4J0CA 3QPAA 4MQLA 4X7BA 2G4LA 2QS9A 3D2CA 5K3FA 3GUUA 4U2DA 4XVCA 4NZZA 2RAUA 1CQWA 1WOMA 3EIOA 1A8SA 4GXNA 4QA9A 2H7XA 1R9MA 5DNWA 5ALWA 1ZD5A 5CT4A 3ICVA 3D59A 5ALUA 5AI6A 3LIIA 1Z68A 1CUYA 3BF8A 2WSLA 5HKBA 4DM7A 2ZSIA 4X97A 2QRUA 5ALOA 1JU3A 2XT0A 2HU7A 2OGZA 2WQZA 2RI6A 1L7QA 4U2EA 1BRTA 5I8PA 1YAJA 3IIIA 1L7AA 1WB5A 2QZPA 5HQ3A 3AZQA 4G4JA 4JYPA 4J3JA 3BIWA 2DCMA 5AM1A 3AINA 4UBKA 4N5IX 2YH2A 3WQHA 1VLQA 3RK4A 4DTCA 4Y2JA 4QLAA 5FKJA 2XUJA 3LIPA 1DQYA 2I78A 3WZLA 5IVHA 2IX9A 3DOHA 4AB1A 1CUXA 3I6YA 1WPRA 2HA3A 5IVDA 5AKIA 4ZREA 2WLSA 1XFDA 1QIEA 4BTVA 1F0PA 5ALLA 2HA5A 4IQ4A 3PFBA 3YASA 4KACA 1CUGA 4FDMA 4BP9A 4MQMA 2PSEA 2VEOA 1X2BA 2WFZA 4UHDA 2ECFA 3R40A 2O7VA 4RE6A 4KE6A 5ALYA 1BCSA 2BCEA 2WHPA 4LIPD 5EIEA 1CR6A 3WA6A 2VT7A 4ZV9A 1QIFA 1ZD4A 3Q8WA 3HXKA 4H7EA 3AZOA 4U2BA 5JIBA 1YA4A 4OPMA 3STVA 1FFAA 4GECA 5AKYA 2QUBA 3C5VA 3O0DA 2DHCA 4BRSA 1LPMA 4KE7A 2V9ZA 5T4BA 3QVMA 4AMYA 5A6VA 1LBTA 2YXPX 4OYLA 1BN7A 2XDWA 1IUOA 4B0OA 2BUCA 2WIKA 2WFLB 4KAJA 3TJMA 3V9AA 4ZGBA 3IUQA 1PJAA 4GBGA 1C7IA 5AI9A 1N1MA 1UOOA 4J0HA 4BDSA 2JGKA 2RGUA 1MX9A 3AZPA 1DQZA 4Y2YA 3VXKA 2ES4A 2WKWA 1PFQA 4B85A 5JAUA 4KAAA 2YYSA 5AK4A 3WMRA 2OAGA 4X94A 4JH0A 2JGJA 2GBIA 5ALHA 2B61A 3H2HA 2G5TA 1UOPA 3R3XA 3NWOA 4PSCA 3F97A 5T4HA 2PSDA 3F98A 4AN1A 1CUVA 1AURA 1GQRA 3R0VA 4QEKA 1TCAA 4AO7A 1UK9A 4AMZA 1TKRA 4EHBA 1YB7A 5I9IA 4B7ZA 1FFDA 1XZBA 2XUDA 2Q0XA 2QR5A 4Y2RA 4WFKA 2AXEA 5CRIA 4H7KA 1XKLA 2JF0A 5CW2A 5ISMA 2JGIA 4H7FA 1N5RA 4K6GA 1LPSA 1ZGCA 3ESDA 1QOZA 4MEAA 1DX6A 4I19A 3E1GA 5LZ5A 5AM4A 5IH7A 3SWWA 1LLFA 3AILA 1IVYA 1SCIA 5AIBA 2XUKA 5HCUA 1JMYA 1QO9A 1DU4A 2BGNA 2GBCA 2VAVA 4U2FA 1DWPA 4W9RA 1A8UA 2QOEA 2PUHA 1C4XA 1AQLA 3KSRA 1CUDA 2H9YA 2B20A 4Y2PA 2Y6VA 4N8SA 2W22A 1XRRA 3N2ZB 1GGVA 3C8DA 3EBLA 3QMMA 2V98A 1EDEA 1AUOA 1BCRA 3QPDA 4GDMA 2ZYIA 4EY6A 4OSEA 1I6WA 2XUOA 3W9UA 2BAGA 2J4CA 3SX4A 3FWHA 1VA4A 3H2IA 1XRLA 2Z8ZA 4WCVA 3IA2A 4BVKA 5FPQA 1GKLA 4UHBA 1BE0A 1FFEA 4FWBA 4FBLA 4U2GA 3MGAA 5A7HA 3OURA 1MNAA 3H19A 3DEAA 4FLMA 3G9ZA 3ESBA 3DNMA 4E46A 4PF1A 5ALXA 4HRXA 3BDVA 3FYUB 4GHWA 3WL6A 2Y2UA 2C5FA 4AXBA 1TCCA 3IULA 3JWEA 4O08A 5ALQA 5HF9A 3WA7A 5AH0A 3NGMA 2K2QB 1XZJA 2YASA 4G9GA 4Y2XA 3T4UA 5AKXA 5CH3A 2J3DA 3ZLTA 1GPLA 4HXFB 2QXTA 2WU3A 5ALDA 1YS1X 1K4YA 3IURA 3A6ZA 2ORYA 3BIXA 1ZIYA 1HKHA 5FV4A 2ZJ6A 1XLUA 4N8EA 3QBJA 4OYYA 3QITA 1JKMA 2O7RA 4Q3OA 1QIKA 3G0GA 5E4YA 2VJDA 5JAOA 1MX5A 2XMDA 4JEIA 4WY8A 4C6HA 3G0BA 3WWOA 3HEAA 3K9BA 1CV2A 1VJ5A 2BJHA 2WIDA 4PQEA 3VVLA 5K3EA 3WK8A 4WJLA 1LPAB 5HFAA 4F21A 4L9AA 3WL7A 4UHFA 4BVJA 1NU8A 1QIDA 2C0PA 3HRHA 2ZVDA 4ZRDA 5CMLA 1FFCA 3FLBA 2CB9A 2WUGA 5HF8A 3WWPA 3UUFA 1TK3A 1F6WA 4UBLA 4DMKA 3F96A 5KWJA 4I4CA 2XQGA 1DX4A 3WK5A 3WIOA 1CUCA 3BDIA 1VZ2A 5AKEA 3AUKA 2PU5A 1WCYA 1X70A 1TIBA 4KYVA 5AO9A 4FNGA 5AOBA 4KE8A 2I3DA 2O2IA 4CFSA 5T4FA 2OXEA 5EI5A 1A88A 3I6ZA 2VAXA 3IVMA 4FTWA 1M33A 3U1TA 6YASA 2PX6A 2RIPA 2EEPA 3FLAA 3K6KA 4W63A 2XMQA 2G63A 1CUIA 3UUEA 1K63A 1W1IA 1SFRA 3C8HA 2VJAA 5LLSA 2QTBA 1E8DA 4UFPA 1Q84A 5DYTA 1ZJ5A 3WWCA 4L3WA 5ALGA 4U2CA 3R3YA 2V97A 5C8XA 3DYVA 3PF8A 5CBKA 4ZV7A 5AK5A 3WYNA 3DKKA 4RE5A 3F9CA 3PUIA 2PM8A 1EH5A 4C4YA 4KEAA 5AIAA 3HLKA 2ZJFA 4M0MA 5CXXA 2BUAA 1CVLA 2B9VA 1WPXA 2HL6A 2OPHA 1ORVA 4DMCA 1B6GA 1VA5A 3R3ZA 4BDTA 4E14A 2OCIA 5C81A 1XZLA 1EK2A 5A71A 3C43A 5YASA 3WKEA 1UKAA 5FXMA 3LP5A 2DQZA 5ALNA 3EQ7A 2QMQA 4A5SA 1K6EA 5DJ5A 1XQYA 1U65A 5LZ8A 3JW8A 1QTIA 3I2IA 4HTAA 2Y2VA 1WHSA 1ORWA 3V48A 2WIJA 3ILSA 2XUHA 3AIMA 1UOQA 5F4ZA 3DL4A 4RNCA 1W6RA 4UBMA 4BC0A 5IVKA 3CN7A 4PSUA 2QXUA 5ALEA 4OB6A 2XLCA 1QJ4A 2EDCA 2RHTA 2ONCA 1XLVA 1P0MA 4IHAA 1YB6A 3MUNA 1XRQA 5LZ2A 4UUQA 1QIGA 4CG1A 2JGFA 4HXEB 4BTLA 1GKKA 4AN0A 4AO6A 3GBSA 4OCZA 2PSFA 1ZD2P 5AKZA 4OB7A 5K3DA 3C87A 3OTQA 1QLWA 5DTJA 5DNUA 5JANA 5LKAA 3AIOA 2XMZA 3T52A 1MX1A 2GBGA 4FNMA 2C5GA 4INZA 1HQDA 1XZIA 1USWA 3QH4A 2JBWA 5LZ7A 2IITA 2XMSA 4EB0A 5D3ZA 1WM1A 1EINA 3AFIA 1GZ7A 3N0TA 4Y2SA 1SC9A 3DS8A 4QDTA 3KOOA 2Z3ZA 3CCCA 4H7HA 3ZLUA 3H1AA 3KD2A 3WKAA 4GI1A 1EXWA 1ODTC 2WG2A 4UBNA 4J03A 3B12A 5JADA 1BROA 1TQHA 4CG2A 5EIHA 4KR0A 2VATA 2NW6A 3BF7A 5KWIA 1VE6A 4DSZA 1IMJA 4LXGA 1EI9A 1DTEA 1EK1A 3VDXA 4D9JA 2DSNA 2PUJA 1VXRA 4UHHA 3H2KA 4G4GA 1JFRA 3H04A 3QZUA 4G8CA 2ZYRA 1GQSA 1EA5A 1DWOA 3H17A 5FRDA 3WK6A 1E66A 2FJ0A 4C88A 1E3QA 2PL5A 3C6ZA 1BN6A 4Y9SA 3K2IA 4B80A 4FMPA 5JAHA 1EX9A 3PUHA 1CUAA 3D4LA 2Z5GA 3D2AA 3QM1A 3QMVA 4XIIA 1H23A 4C4ZA 3I1IA 2DHEA 2HM7A 3LCRA 1LPBB 2WHPB 5LIPA 3W06A 4FLFA 5K3AA 5EFZA 1T4MA 3STWA 3DL7A 1XZAA 4Y2UA 3O4GA 1R1DA 2J3QA 4Q1VA 4MWTA 2D0DA 4P08A 1ZOIA 3D2BA 4FKBA 1U8EA 2JGMA 1YASA 2H7CA 1XZGA 4P9NA 2ROQA 3DKRA 3G9XA 3R41A 4UHCA 3ICWA 5AI8A 2XUGA 4X92A 3FBWA 1G5FA 3I2KA 1MJ5A 1UZAA 2UZ0A 5AI0A 4Q34A 3PFCA 1N8SA 3D3NA 2EDAA 5ESRA 2HU5A 2GZRA 4G8DA 2OCKA 1SCQA 2CMFA 5AI4A 3C6YA 3STXA 2R8BA 3TEJA 4QE3A 1Q83A 2GYWA 3UMJA 3LLCA 1THGA 4PO3X 4UBIA 5AI5A 1KEZA 4RGYA 3OOSA 3CN9A 4F60A 3WL8A 2JEYA 1ACJA 3ZV7A 5IVIA 3F67A 4LHEA 1QIMA 2HA0A 4H7DA 1CUBA 5K3BA 3QYJA 2FUKA 2W6CX 1GXSA 1ISPA 2HA6A 4FLEA 4QZVA 5J3JA 4BZWA 5E2IA 1EVEA 1J06A 1W75A 3ED1A 4OU5A 5ALJA 2AJDA 2CKMA 1IZ8A 3KWFA 1QFMA 5A7GA 3HI4A 3FOBA 1PV1A 3GROA 1IUPA 5AOCA 1E8MA 3PI6A 4CI9A 4AX4A 3ESCA 2R11A 4WFJA 3DCNA 4K6KA 3O9VA 2P8SA 1JJFA 4GWLA 2VA9A 3FYTA 5HFNA 5CXUA 5JASA 3O4HA 1P0IA 1XZEA 1JT2A 3W04A 3WK9A 2XUFA 3S2ZA 2XMGA 1Y7IA 2Z8XA 4CCYB 2WG0A 4J0GA 4QWMA 5JZSA 2G5PA 1HPLA 4BAGA 2QJWA 2XUQA 4UBOA 5DTIA 1UXOA 2ZYHA 1OCEA 3IBTA 4MWSA 3H2GA 4XJVA 2HRRA 4IH9A 4EUSA 1J2EA 5JD4A 1MU0A 2HA7A 1HDEA 4MJ3A 5AKLA 5BOVA 4DMHA 3WZMA 5T4EA 4CIBA 2QUAA 1XROA 2AJCA 3MVEA 2Y6UA 2QJRA 4KE9A 5BV7A 4EY7A 5JZBA 4FBMA 1H2ZA 3ANSA 1DT3A 1AKNA 1H22A 1T2NA 3X3HA 2WUEA 5A7FA 1SOMA 2ZJ7A 2X76A 1XRPA 3I2FA 5ALIA 4C89A 2IIVA 4W1QA 1YA8A 4G9EA 1W52X 4ARAA 5H3HA 5DYWA 5ALKA 1XRMA 4J0DA 5D3KA 2V96A 4X6YA 3VJLA 1UWCA 3WK7A 2ZSHA 4WDQA 2E3JA 3G02A 4A23A 1CQZA 4HXGA 4M0EA 1R9NA 1CFJA 2C4HA 5JALA 4UFNA 1LGYA 3IB3A 3DLTA 1XQVA 3OM8A 4DNOA 2XI4A 3VKFA 5DYYA 5AM2A 5EGNA 2QVBA 3WLAA 1EB8A 5JZ9A 4C87A 3NUZA 1JU4A 4ZI5A 1JJIA 1JJBA 3VJMA 4EZIA 4QDZA 4LYEA 4PSDA 4JNCA 2I03A 3H18A 4BCBA 1MT3A 5EHQA 4RPCA 2HU8A 1ODSA 5FDFA 2HADA 5LKRA 4EY4A 2HFJA 1CUZA 1Q0RA 3G9UA 1QFSA 1GT6A 2Y1KA 3BJMA 3WKCA 5K3FB 4JYMA 5C7YA 2GYUA 3TGLA 3I28A 5C8ZA 4EY5A 1TCBA 1XQWA 2JEZA 4P93A 5CURA 5EHZA 2CZQA 3R3WA 4OUKX 2BUBA 1MPXA 2VQ6A 4G5XA 2CUTA 4BZZA 1Y37A 3A70A 4XX1A 3GZJA 5HK9A 1ZI9A 2WJ4A 1W76A 3C70A 3BE8A 1UK7A 2OGSA 2XE4A 4H7JA 5D7BA 2OLEA 3PF9A 3G8YA 3G0DA 3E0XA 5IKXA 1YCDA 5E4JA 4Q3LA 3ESAA 3ZWQA 2GBFA 3L1HA 3I2JA 4X6XA 3H0CA 1QZ3A 3BWXA 3WIBA 4K2AA 3IUNA 2QKYA 4NMWA 5CH5A 4KJXA 2OCGA 5AKKA 3M81A 5CH8A 3WI7A 1LNSA 2CJPA 4N8DA 2BFNA 1UKCA 3C45A 4IH4A 1SCKA 1J1IA 4CG3A 3I6MA 2BKLA 4ZXFA 4Y2QA 2XMCA 1ACLA 3F8SA 4KRYA 4IO0A 4J0IA 3STTA 3C6BA 3FYUC 2DQYA 1NX9A 1XRNA 4WFIA 1LPPA 1NU6A 5ALFA 4Q82A 5CT6A 2H1IA 1CRLA 3I2GA 1QIIA 1QIJA 1VE7A 4H0CA 5K3CA 3TRDA 1RWQA 1YS2X 5AKHA 4C01A 4JUIA 2FJPA 2Z3WA 2WU4A 3DYIA 1IUNA 3BL8A 4DYHA 4OB8A 3FVTA 4QWWA 1UFOA 2VT6A 1AZWA 3HZOA 1R88A 1ZIXA 4TVKA 1AC5A 4X3CA 5AJHA 4MEBA 2ACEA 3DD5A 2OGTA 4BCCA 1CUHA 4ZWNA 2WUFA 4AZ3A 3RKSA 4QDUA 4CIAA 1EDDA 4UPDA 3OC0A 4DIUA 4G1FA 3G0CA 2RHWA 1CUEA 2WIGA 3ANTA 4UBJA 2HRQA 1U2EA 3EQ8A 1X2EA 3LS2A 3R3UA 2PU7A 1DINA 2O2HA 1EVQA 4F5ZA 3AJAA 3CCBA 4J7AA 4X95A 1BEZA 1ZICA 4OU4A 3KDAA 3BJRA 2XQJA 2VJCA 5CT5A 3WJ2A 3WWDA 2HHAA 2GZSA 2XMBA 4X00A 4Y7DA 2LIPA 3M82A 1H2WA 2XB6A 1H2YA 3QMWA 4KAFA 1D07A 3BXPA 5AICA 4ROTA 3E3AA 5HK8A 2VTVA 1E5TA 3FYUA 1AX9A 3W05A 4H35A 3WL5A 2B4KA 3G7NA 3FVRA 4AZ0A 1BEEA 2GYVA 4F0JA 3RM3A 3ZPXA 5BWBA 1W4LA 3STUA 2X5XA 4MYDA 3O9MA 5KBYA 3AIKA 1MNQA 1EHYA 4NVRA 2C7BA 1ZI8A 3HSSA 5CT9A 4UHEA 4BBZA 4B83A 5JYCA 3H1BA 2HA2A 4AQDA 2C58A 1G4HA 5DLPA 2FX5A 2C0QA 3B5EA 4BYMA 5ALZA 1DT5A 1YAHA 4Z49A 1CUUA 4DGQA 3EF3A 3FNBA 1XQXA 5ALMA 2JIDA 3W9BA 1MAHA 1VZ3A 3FAKA 4HAIA 1KU6A 1XZCA 3PE6A 4B9AA 1BS9A 1UKBA 5AOAA 5FP0A 4MXDA 2OCLA 4HZGA 1TRHA 3WK4A 5LP1A 1RP1A 3DDUA 1VKHA 4LXIA 2HDWA 4ITVA 5I7UA 2OQVA 2AJBA 5FUMA 3KWJA 3O4IA 1ZD3A 3VJKA 1JI3A 5SYNA 3O95A 1FSSA 2CEKA 2HA4A 1UK6A 1DWQA 1WHTA 4J0JA 4YASA 1AMNA 3JYHA 1CIJA 4E11A 1AGYA 2XQFA 3L1IA 4X85A 3FSGD 4UFOA 2WTMA 5HF5A 5AKJA 2HFKA 4BRZA 1FJ2A 2WIFA 3L1JA 5E4TA 4HRYA 5AM5A 5AKGA 4DLNA 4B9EA 1CPYA 4AO8A 3A2NA 5AHXA 3A2LA 2HIHA 3D0KA 1ODCA 5AP9A 3STYA 5SYMA 4BP8A 5HKAA 2WTNA 2OG1A 4K5QA 4G8BA 2WFLA 4E15A 1XZFA 4FHZA 3WYDA 4GLBA 4A16A 1P0PA 5LZ4A 1CUFA 4WDRA 4B81A 4OD0A 1O6FA 1WB6A 3HC7A 2AJ8A 4FFVA 4M0FA 4Y2TA 4X90A 1XKTA 3MUOA 4QDXA 4HVTA 1XZKA 4K6HA 4X91A 1ETHA 2XQIA 3D5EA 3VISA 5AM3A 2VJBA 4HS9A 2PVSA 5ALPA 3V1NA 3FLEA 4NS4A 3PDCA 5FLKA 2XUPA 4QDOA 3FSGA 3M3DA 5A2GA 5D6OA
chains in the Genus database with same CATH superfamily
1F60A 2EHDA 3GFRA 5CDFA 3DMTA 3JQGA 3OQHA 4P31A 4N41A 4C0KA 2WJIA 1GG8A 1ULAA 2VPXA 2J5RA 1V8BA 2OBNA 4QTZA 1MTZA 2W2XA 5J1SB 1DELA 3BQNB 4QO7A 5AW1A 3VPAA 4Z2AA 3DHWC 1GUYA 5JRDS 4PLTA 3CGWA 3SHVA 4FOLA 1A4XA 5LC1A 4YYEA 2EBHX 3PRJA 1Z56C 3GBPA 2Z09A 2V8OA 1MO2A 1VOTA 4L5IA 2RK4A 3N05A 3WKDA 1YRWA 2JH3A 4RKQA 3AVYA 2J3KA 3NM6B 4DJFC 3V8VA 1AQNA 1MDBA 3AFMA 3PVCA 2O0MA 3AEUB 1AB6A 4XDZA 4YDRA 4RWZA 1OLSA 4I8IA 1YVEI 3W4IA 1S2OA 1A9PA 2OOSA 4PG4A 4KIJA 1I9CA 3ZU5A 3ZV4A 2RGRA 3KQUA 3BWYA 3HYSA 1IPEA 4JHLA 1E4EA 1WDWB 1LNQA 3FAZA 2FFQA 2B4TO 4HGPA 4IOKA 3SOZA 1EB9A 1V1RB 3ZI4A 4TPKA 1RZRD 1WTAA 1K5PA 1SQFA 2DFVA 4ZYLA 3Q5GA 1VJGA 1VXOA 4QTTB 3ZWDA 3RS2A 1FDUA 4Z8XA 4NXNB 3U3ZA 2JFVA 4Z4QA 4XCXA 3L4KA 4DMFA 5IMBA 2OHIA 1RHQA 3UT5B 3KZCA 4B82A 1RQGA 2BGRA 2GZHA 3QIVA 2DBVO 3PWSA 2ID4A 3C8ZA 4QOFA 2CMDA 5GONB 2PUCA 3K73O 3IQIX 3KEMA 5DNVA 5HKOA 2HZBA 4NIMA 1U3FA 4DA4A 1DWUA 1NMQA 2I9PA 5CFLA 1JXOA 2XOEA 1L8QA 2CNOA 3T1NA 5BN5A 3GRRA 3D9QX 1DJLA 2H2AA 5KU1A 1EG7A 1JEEA 2EP7A 2VDVE 2UYQA 2UV8A 3ZVRA 2Q8PA 2XADA 2OBLA 2V6JA 4P92A 4TLLB 1F06A 3WWYA 2BEKA 3PITA 4RVGA 1RZUA 3OZUA 1WB4A 5LOVA 2R79A 1Y3HA 3NBQA 5C2JB 1NXWA 4KO2S 3Q6IA 4NFLA 1KU0A 3FCYA 1D5CA 1M2NA 1U0NA 1S8FA 2H9AA 1PZEA 4TMKA 4Z9AA 4NU8X 1Y3CE 3UK0A 2ECOA 2AG0A 2QN2A 3GPDG 2HNKA 4N39A 2PXXA 1JQKA 2HMVA 1W93A 3M83A 3RS4A 3I04M 1U1CA 1FTWA 3K53A 5L6MB 3A14A 1SIBE 3H4VA 1G2IA 4KJZA 1EJBA 4WD3A 1UPXA 1QQ6A 3QEKA 4ZODA 1N34B 3D7MA 3OFNA 1R3UA 1XTKA 1X92A 5CW1A 2P11A 4OTZA 3GEPA 3DT9A 3ICOA 2D2VA 3TL6A 1F8XA 2JGLA 1TU3A 1DARA 1UMBA 2BGJA 5KPJA 4MKHA 5H4GA 2ID9A 1MFPA 3N70A 1QTRA 1ZEMA 4TS4A 4HG2A 3OFKA 4DNPA 2BP7B 4NCNA 5KVCA 2NWQA 1OAKA 1N92A 2OBXA 3ZHSA 1G0NA 2PSHA 2FPLA 5A9RA 3THSA 1H4VB 5JJLA 3EGDA 1J21A 1P9RA 3BVPA 4TKLA 3FI0A 2AF4C 1ST2A 3PJFA 4H7IA 2XF8A 1G16A 5B1HA 3T4EA 3TPZA 4EJSA 3HVRA 3FMVA 4GQBA 4YJ2B 2QL5A 1T3SA 3MJHA 3QRWA 3QW4B 4HGYA 4MCIA 4S1NA 4Y9DA 5TPZA 3ZZNA 1AT1A 3Q85A 4A8JB 3IDZA 1A9QA 2OCPA 3DAFA 1J7KA 1TYZA 3PXCX 4TTRA 5L7YA 3SIWA 2KQUA 5HJ2A 4HNQA 1E2NA 1YDEA 3QY9A 3U3MA 3ZHXA 5JNWA 2CJWB 2JJ1A 1JG2A 3ZCVA 3O91A 1V6SA 4O3FA 4BE9A 1J00A 5E6UA 1QO7A 2FEXA 3LUPA 1XALA 4ZQBA 5J4HA 3DFKA 2XF2A 2ZP1A 2CHQA 4B3GA 4DV4B 3KKZA 1TUEA 2XYVA 4FFOA 5FPPA 1LBSA 4YCSA 3QVOA 1SXJE 3FTPA 4IILA 1THTA 2P5TB 3DFMA 1WVIA 2PSJA 3O3CA 2OY0A 2WU0A 5BUQA 1I2ZA 1CZLA 4EO4A 1P7VA 2A0KA 4HGRA 2C5HA 1NYQA 1G4UR 1E89A 1ZC4A 3JVIA 1J8QA 3FOAA 4R9UC 4BO9A 2VTBB 2R7LA 4R1UA 1UMKA 2PUTA 2CK3A 2QQEA 4R2MA 4UHJA 1VBNA 1YJXA 1I36A 2KX7A 1QTNA 3F9RA 4KZKA 2CBZA 1D09A 4OJKA 4P5DA 3VDMA 4BMZA 1FMLA 3RROA 4TV8B 1M2OA 1ZRHA 3SHWA 3HY6A 1C9JA 4M9RA 3AVWA 4YPVA 3ROZA 4FCVA 2FZWA 1CJTC 1MGOA 4JODA 3AKYA 4BQNA 3KTFA 1L5FA 2EOAA 3IESA 4LWPA 1MBZA 3PNPA 4PV7A 3ZI7A 1OWNA 4ZYXA 5GZ3A 1ND5A 3IPLA 3A1TA 1LDBA 4QLOA 3RDPA 1W5FA 5MN6A 3MJSA 2NYVA 3GEMA 2ZGVA 5DWDA 4YA6A 4BMPB 3HKEB 5JYBA 4IXNA 1Z08A 1EP9A 1NBHA 3HDJA 3I42A 4ZOEA 3SQNA 3TZKA 4CKEA 1WDTA 3N3BC 3B1VA 3C3JA 4O33A 4G25A 4M22A 3G9TA 3GUHA 4DWOA 4ZJPA 1VKOA 4UKDA 3WAKA 1E60A 1KOJA 3CLKA 2GEUA 4IGEA 4Q05A 2VJKA 4YC7A 4QYXA 4JKIA 3TR5A 3QLEA 1N4AA 1BXKA 3IUEA 1H0HA 5K8VA 4WN9B 2ZETA 1GFZA 5KQGA 1FUYB 1O9BA 3D6TB 2JGNA 3PGJA 1XAJA 2NUAB 1MABB 5K6AA 4X8HA 3DTNA 5EMHA 5JARA 5A5GA 3ASZA 1IXKA 1APBA 3OT1A 3U1VA 2R48A 1S4MA 1E2IA 1P3Y1 4EY8A 1G63A 4FDTA 4LJSA 4RL6A 2Y0DA 3WMFA 4LMPA 3AFGA 4FQ8A 4XWGA 3V1MA 2XKAA 3UW3A 1T6BY 3KV1A 3W77A 1BE1A 5LDDC 1PS0A 3SJ7A 3RW9A 3UWKA 4C3OB 3H3FA 4EUKA 1WW3A 2ANCA 1A5AB 4RIGA 3PX2A 4EMBA 1H2XA 3EIWA 3PPVA 4M8LA 5C37A 3GFVA 3KOXA 1I33A 4GMDA 4YJHB 5F1KA 2FX3A 4Y1EA 2FPIB 4K9RA 2JLUA 3VMFA 2HNAA 3IAM6 2EERA 1O5TA 1WULS 1P8JA 2PA3A 4ND4A 1ELOA 3O3NB 5K0GA 3A6PC 4BNJA 3NHMA 1D0SA 2NO0A 1ATIA 1G9XA 2QJFA 4TKVB 1KOLA 2XNJA 3HA3A 3DP7A 1C3OA 1M76A 1SUCA 2OESA 2QW0X 4D3FA 3I30X 4ESOA 1UXJA 4HVCA 2FYTA 1OU0A 4FFNA 1YK1A 5J2UB 1PNQA 4YS6A 4AP5A 3CF6R 5B55A 3GFTA 3OQ1A 3UJ7A 4BWYA 2J9FA 2P9FA 4UATA 4RTRA 1N32B 3T61A 3RARA 1QVRA 2F9LA 5LQCA 4RQUA 3DVRX 3LRXA 1NPTO 3G3EA 1CS0B 1N4DA 5AHOA 2JI9A 1V11B 4PGHA 1U94A 3OOHA 3U0VA 5FOQA 1Z2CA 2X86A 3KETA 1C30B 1P77A 3LX8A 3W8EA 1C7JA 4U9HS 2WUDA 5DLEA 5D7NA 3RS8A 4RJIA 3AFOA 1XYGA 1Z9BA 2WAMA 3G8CA 3Q3JB 2WY2D 4Z0TA 3I52A 1D2RA 1ZI6A 3ZHZA 4G1MB 4BV2A 1W85A 3U13A 5F7XA 1KYQA 3PEWA 4RJ2A 3ZW7A 2HO5A 2FCAA 1G3MA 3W1VA 3WVNA 4BAZA 7MHTA 5CEEA 4MVXA 2G1KA 4NMLA 4G81A 4MUGA 4N3CA 5HM8A 1J8DA 3KZVA 3AW9A 2CDAA 1EWRA 4EJMA 1IVSA 1R10A 2VSQA 3VNQA 2O50A 4MAMA 3WKBA 5C5CA 5DOVA 3CRVA 4KPYA 2ZIUB 4KK3A 4NFHA 1E4EB 2YWCA 4AC9A 4N5HX 2BJVA 4OHWA 3L49A 4Q18A 1Q44A 3AETB 3LAWA 4QYIB 4RHEA 1E8NA 5EIWA 4XD7D 1N6LA 1ZSYA 1PL6A 3BRWA 4GP6A 2D1YA 4MRRA 1XLWA 4DLLA 2VFAA 4MJ7A 4DZRA 4H17A 1S3FA 1F0NA 4J0CA 1U04A 3AY3A 4FZJA 3VNBA 5KTSA 1SU4A 1UDRA 2QUHA 2VNSA 4D97A 3OP4A 4BVFA 4ZCIA 1C8BA 4X7BA 4CM4B 1HORA 1VPDA 3EVCA 2G4LA 2P62A 2QS9A 3DONA 4HC4A 3LK6A 3LECA 5J47A 4Q21A 3K9HA 5J43A 3S8EA 3COVA 1DC8A 2RK3A 2ZR7A 4LQDA 2YXBA 4P7JA 4XVCA 4ETIA 2F1KA 2AA3A 4MW1A 4TN5A 1T4DA 4Z4EA 3T1OA 1E59A 1FDSA 1D9ZA 3CRW1 1HLFA 2X7XA 5GWXA 4G01B 2VKTA 5TPWA 2Q27A 2M32A 2WPNA 4QA9A 2ATIA 4HAUA 1R9MA 2EIHA 2EKZA 3I1JA 5HQTA 3LVRE 1ZD5A 4PRLA 4O4LA 3KJNA 3TH5A 2VRBA 3DXYA 4D0GA 1S9HA 3ORYA 4K46A 1QVAA 4PXAA 4AJKA 1E99A 2DB3A 1XVAA 2Y99A 3L8HA 1Q1ZA 5TJ9A 1JSLA 4GX2A 1DBQA 1OLOA 3OE5A 2RHOA 5AI6A 3PSAA 4J4TA 4NL4H 1ORIA 5IUJC 6CHYA 1CUYA 1L5HB 2IYPA 2JDIA 1C4WA 3H84A 3UKJA 4E2WA 4CF7A 2EBFX 2R6JA 3ONVA 3CZRA 4IYRA 3T1YB 4MSUA 1A98A 4UU1A 2A1TR 3AM3A 3D3QA 4DM7A 3ENNA 4X97A 3NRCA 3OFSA 2H3HA 4EI8A 3HKDB 3WSVA 2XT0A 2GAIA 1UPTA 4XE5A 3LP6A 3LT0A 1TECE 2ZUUA 3V3TA 4ECEA 1XDUA 3OT5A 5AD1A 2NADA 3WGMA 4COKA 2GN1A 2WQZA 2ZUFA 4BMSA 2QR2A 2Y0EA 4MMYB 1J0AA 3VI3B 1GAJA 3EWNA 5ED0A 3WLSA 3E7FA 4FDVA 4A0FA 2FQQA 3CONA 3E81A 4UMFA 5FTWA 4BYGA 3JQ7B 1X0VA 1L7AA 4XB6B 3IT1A 5ARCA 3LYUA 2XXJA 1QB8A 3UMRA 3EN0A 3IAAA 2JGDA 3Q2OA 4Z51A 4P3OA 5BNWA 4ZMSA 2J45A 4FUQA 2OVFA 4Q1CA 3A3KA 4JYPA 2ZBEA 3WYAA 5E6RA 4FHFA 2ZVJA 4J3JA 1QQTA 3QHPA 1AKYA 3IQHX 4DR7B 2E82A 1JDTA 2VXBA 4WVFA 4UBKA 3T99A 2IGTA 4ALIA 3G88A 1FNBA 3BK7A 5IU6A 1LTKA 2C9MA 4B3HA 3BTVA 2GMWA 3NIGB 1SA0A 3N3AC 4D26A 4Y2JA 2YBDA 1KGDA 2ZQYA 1DAKA 2PD4A 3QUTA 1H0SA 3M5DA 1Z2OX 1U1FA 2I78A 4BFUA 4M49A 3WZLA 5C3MA 4RLQA 5IVHA 4GC5A 1TE2A 1EJ2A 4L57A 3HU5A 4HZIA 1T3TA 4GR4A 4E70A 1WPRA 1VHLA 3GP3A 4HYEA 2JGAA 4MW6A 4C4PA 2I8AA 4ZRNA 1Z74A 4L85A 4WXMA 1MO3A 2YNMD 3PXUA 1EFCA 4ZCTA 1XJWA 1A76A 3VNSA 4FFRA 1XJ5A 4MV3A 1UMCB 2C8JA 4EFKA 3BCRA 3N2GB 4BQFA 4ARSA 1HZZA 1JHMA 4KW7A 4M0LA 4G36A 1M9NA 1XFDA 3U4HA 4A8HA 3AP3A 4A0SA 1OTYA 1QIEA 1T1EA 3DC2A 4BTVA 1HXHA 4GE0A 2EJWA 2JLQA 3BZUA 3EPLA 1LJLA 5DBOA 2UKDA 2DRIA 2BVNA 3F71A 3PUZA 4FHEA 2H18A 4NZNA 2HA5A 1GD1O 3KP1A 1DBWA 2XCUA 2XZPA 3EIUA 4IQ4A 4ZDIA 4GEKA 1KDZA 2BTQA 1QRUA 1VJRA 1TQ8A 4CN8A 5JMWA 3TOCA 1SXJC 4D8YA 1IHUA 1Y6ZA 3NTUA 4JLPA 4OHZA 5AVOA 3C3CA 5F3RA 5CM9C 1BDMA 1ZRMA 4IXTA 4E5VA 3HB0A 4OLAA 3B6ZA 2WYIA 2ECFA 5M7EA 2O7VA 3PNVA 2PS3A 4RTPA 1G3UA 3CTMA 4RE6A 1PNTA 2Q3DA 3SS8A 3H1PA 2I7CA 2XDQB 1VRCA 3R0ZA 3BIJA 5E6RB 1L3IA 3UPDA 4BFWA 5KB3A 2ACVA 1Q17A 3O84A 1GCAA 5IW8A 1N8TA 3RYHB 4A26A 3ROXA 3CLRC 1CR6A 1X8LA 2QX7A 2EQ5A 2VYNA 2ZAOA 1F2UA 3GMSA 2DWUA 4ESVA 4BVGA 1IY0A 1QIFA 3KT6A 3MWJA 5T6MA 1AZTA 4FWTA 4A27A 1O7JA 4JBXA 5JIBA 1GXSB 3UAWA 1GGEA 2BN4A 3TFWA 1Q1BA 5AVKA 4B3IA 3GNLA 4KFRA 1U3WA 2EWMA 2CCGA 2C99A 3STVA 8ABPA 4J29A 1JXQA 1PGOA 5AKYA 3IUSA 1DKRA 1KZ7B 3AHHA 5EPUA 4UD6A 4BRSA 4DIDA 4ENRA 4KIFA 4YRNA 5K0ZA 3L9WA 2DH5A 3O2NA 4KXMA 2GK3A 1P6QA 1AK9A 2V9ZA 3D0RA 5AJWA 4D99A 1E0JA 2VH1A 3RQSA 3E58A 3LTNC 4OHFA 2ZRPA 1TM5E 3OSUA 4G0PA 3KQKA 1LBTA 4DEYA 4EGSA 5I4KA 2XDWA 3SLRA 4D9IA 5G0VA 1A95A 2V6IA 1SC3A 4D7AA 4UNRA 4I0WB 5KJFA 5LA6F 3ROTA 4IUCS 2WVHA 2ZSKA 1ENYA 1XE3A 3R5KA 2CFCA 1XNHA 4EENA 1ABFA 1UEIA 4DM4A 4JNKA 2GN2A 3PKZA 4HDRB 1SULA 3IUQA 1NP3A 3B6KA 3CBQA 4LMBA 4P3KA 4J0HA 5AXBA 1VLJA 4BDSA 1QHGA 2JGKA 4XOUA 2HYIC 2SCUA 3LV8A 4DBVO 1NYLA 2GCOA 2SBTA 1Z4JA 3H75A 4E32A 5IG2A 2C5BA 3VXKA 3PHHA 4MQEA 4TXJA 2ZIEA 1C1DA 3BH6A 2PKWA 2WKWA 2XHZA 2BFFB 1EX6A 2XV1A 5KNBA 4OAPA 5JAUA 3RC3A 2NXNA 3MILA 4HXYA 2IX3A 5JCOC 3V2UA 4KAAA 2YYSA 4BV9A 1H6AA 3QLJA 1K1EA 2OK7A 2HT1A 1FFHA 2WJHA 3EQ6A 3EEQA 4QREA 4F9FA 5J2TF 4X94A 1H0KA 3ZEAA 5JCZA 5KNDH 4L8YA 3JQAA 4AECA 2DKFA 1AHIA 3N2LA 4DHEA 5JI2E 2R6ZA 4RTNA 2PUVA 2XSZD 1NUPA 3FN4A 4RFLA 3BC1A 4A2PA 4RC9A 2BM1A 3R3XA 3WMWA 1AN9A 1U2DA 1IOZA 1I80A 2HB6A 1DRUA 3F97A 4BMCA 3DD1A 3RJMA 2PSDA 3IAUA 1S1MA 3V4SA 2VCHA 4ZOCA 3TNLA 3A58B 3EDOA 3NHJA 3GWZA 1AMUA 3R6WA 4U6QA 4NH0A 2P77A 4ZAYA 2CUNA 3NC4A 4PLYA 1JFTA 1K06A 3WDSA 3Q2IA 2GEJA 3KCNA 2ATCA 4U5XA 1ZCAA 3CH4B 3TDMA 1JXMA 2HPVA 4QEKA 3RSOA 4TTSA 1U2GA 2ZTSA 3FM9A 4EQZA 3R8CA 1UK9A 1EP3B 3W8DA 4AMZA 1TKRA 3C3DA 4PONA 3KOZA 4EHBA 3ZHBA 1AK2A 4RDIA 1P9WA 5DCLA 4GZ6A 2PXCA 2NU7B 4Y2RA 3MBOA 4J7UA 5TY0A 1JEQA 2QR5A 2JK0A 5LMCA 1KSHA 1JKFA 1B3RA 2BBOA 2QW1A 2FK7A 4B4UA 3TLGB 4U3JB 4H7KA 4AG6A 5ISMA 4NC9A 2YX1A 1N5RA 4IL5A 4K6GA 3A3PA 1FS6A 2H1VA 1Z6AA 1DOHA 2MSNA 3INYA 2O2EA 2PUAA 3IV7A 3GLQA 4KHPB 1NVBA 4TWBA 1AQYA 4G5FA 4I19A 2C4NA 3MJTA 3HXOA 4DV3B 2O2JA 4YJ3A 2BWJA 4MW5A 4YCLA 4QGFA 1P4AA 2FDRA 3QTBA 5JS8A 5DI9A 2ZUCA 4XUGB 3WL3A 1LLFA 2Z5FA 1Q7TA 4WEOA 4R8LA 1ML3A 3D6UA 4H27A 4RF5A 4WCFB 5MFPA 1MW9X 2AD5A 5HCUA 3NHRA 2P41A 1QO9A 2YYZA 3LC7O 5CGQB 1HT1E 5H3LA 3CF2A 5A4JA 5IULC 3KVYA 3LXMA 3E9MA 3M6XA 2PHZA 3TTSA 1I2DA 5JNTA 2ZJ0A 3U5TA 1QGZA 4U2FA 1Y1SA 2GO7A 5JQGA 1J8MF 3P1JA 4ZTZB 4M7WA 3M70A 1T8YA 2IZ7A 4W9RA 2ZYGA 3JATA 3MS4A 2QOEA 2J3MA 5L3RA 2PUHA 4CTKA 1Q20A 1CB7A 4ZCQA 3C4QA 1YS9A 1S0UA 4I99A 5AVJA 5THKA 3SF8A 1P1JA 2NVOA 2CLDX 2H9YA 3I64A 1XTPA 2F6RA 4Y2PA 4UMVA 3ONFA 1NUAA 4P4LA 4XCQA 4M1QA 4PLPA 1DEOA 1HL3A 4OK5A 4CDGA 3PXDA 4LY9A 2HV8A 1FJHA 5DMHA 4AI6A 2TYSB 1FMJA 1XRRA 4B3MB 3K9CA 1X1RA 4GLOA 3X1JA 2CY0A 3KQYA 3CE9A 1DOAA 4N0PA 3KJEA 1EDEA 2GPBA 1G7SA 2R4TA 1XVIA 3M9LA 4D9KA 5IABA 1IVNA 1JR4A 1OBHA 2Y3IA 2CF5A 4GDMA 4JLJA 4Z9BA 5F5LA 1R8XA 2GPWA 1RM5A 1DSSG 1Z4NA 3ONEA 2P1RA 3FMPB 5TDHA 1G5RA 1SOWA 2J4CA 4DQVA 1VHTA 2CWWA 3BFVA 4UAUA 3SVZA 4D3SA 2FPIA 5HIIA 4QM7A 1QG6A 3W0LB 1LSSA 1NMYA 2XZTA 3C8UA 3K72B 2ADMA 3ZTTA 4HPWA 2YWBA 4DV1B 5CX4A 3HFRA 1CD5A 1PV2A 3D5QA 5FPQA 1REQB 3JU3A 3TINA 1JIJA 2GHRA 4RJJA 1HKUA 4KMSA 4CMJA 1OMOA 1YRLA 1Z36A 2VTBA 3I01M 2CNKA 1O0SA 4WZ6A 1PFWA 4MS4B 3R9XB 3ABOB 1E1QD 1V1MB 5EYPA 3D3KA 1GUBA 3OURA 1WLYA 4CEJB 4FOTA 3BWEA 3I73A 2CDCA 3GDHA 1N2HA 5F7OA 3ZDBA 5KTTA 4PX9A 3N2IA 3NANA 4DDVA 3DZJA 3U61B 2GSDA 3VAYA 1D4AA 1GKUB 3ABRB 3B3JA 4U8GA 4AULA 3RU2A 2PAAA 4LXUA 2IPNA 3ESBA 1YBAA 3LUDA 1M0EA 4U7GA 3OPXA 1TPYA 1N36B 1OPXA 1SQ6A 3LCUA 4LZZA 4C14A 5HRAA 1A5BB 1XA3A 4RTOA 3RT7A 5BORA 3TLCA 5TVKA 3RUFA 4EG3A 2FZ4A 3MTEA 5EINA 1GAWA 4HRXA 1SVOA 2EFHB 4YP1A 3NTVA 2JFPA 3ZZ0A 1E32A 3TPFA 5C7OO 2QVXX 1FE8A 1PK9A 4JCOA 4RTSA 2V55B 4HFNA 2HGZA 4ZAFA 4AD8A 5AHRA 2OYSA 2BTOA 2ZRBA 3GLTA 4MA4A 1PJBA 3NT5A 4FFBA 1IXZA 3L8YA 3NV7A 3NWJA 3FWZA 4K0RA 4D74A 2HLDA 3FRIA 4Y6OA 1ZH2A 3SSAA 1NVFA 2QLTA 2DUUA 1OI3A 1Y9AA 3A25A 2I9KA 3WLKX 1E9EA 3A4IA 1JHAA 4Q7LA 4PVDA 3L7JA 3T7DA 4ZVOA 4X0EA 3F3MA 1WW2A 2AUNA 4QQFA 3JQ6A 3RUCA 3U9LA 1IQUA 1DP4A 1N6OA 1FL9A 1AXRA 4KNVA 5DHRA 4LF5B 2A5YB 3EH2A 4BQPA 5FYQA 5FPTA 3W5BA 1XZJA 3L79A 3DAOA 2ZBVA 9LDBA 3UHFA 4YUAA 4GNRA 4RLSA 1T4BA 1Z29A 4Q03A 3T4UA 4CTNA 1WCIA 1JKJA 3NNNA 1X7ZB 3GGCA 2HXSA 3QE2A 4GVLA 5CH3A 5AKXA 4C2UA 2J3DA 3QFTA 3E5HA 2PWBA 3U62A 3U6BA 1X7WA 3E7XA 1O1YA 2FPSA 3MS2A 3TW8A 5D3MA 3EDRA 1DJMA 1JTVA 2JAHA 5ALDA 2WOOA 1U8YA 3CGGA 1SCJA 4GD3Q 3H05A 4JJ4A 4QXQA 5CDSA 4DLTA 1I24A 1HKHA 3LHFA 1XXHA 3RKUA 1NAIA 1P0FA 1VCOA 1WEHA 4C0JA 2OPBA 1Y48E 3U4CA 1P1HA 2HV9A 2W6ID 3HJTA 4GXTA 1H5QA 1XLUA 2WU1A 3EVFA 5A5DA 3RVPA 1GTRA 1IPFA 2W0MA 1JLSA 2C3PA 2QY9A 3MB8A 1E2LA 3QBJA 4LV6A 2HK7A 2R751 4NYJQ 3PXGA 3T54A 5ED4A 6REQB 2VNKA 2WVAA 1QHYA 3CWQA 3OIUA 3CJQA 3TZCA 4Q3OA 2XEDA 1G8KA 1IH8A 2VZ0A 9ATCA 1FDOA 1W36C 2J87A 3SG0A 4HDSB 3OEYA 4HB3A 3SXUA 1WPQA 5E4YA 3FUVA 2VJDA 3C6MA 2OXTA 4W5JA 2OO5C 4WY8A 3U9TA 1PT6A 5K8JB 2R60A 3HEAA 4R1QA 1PT9A 2J6HA 2V7XA 5LPNA 3ZGZA 1E7SA 5JNUA 3EC1A 4K1LA 2V6FA 3K9BA 1U3CA 4WNCA 4D9NA 5BRJA 2GM5A 4OJQA 3QX3A 2BJHA 4YRGA 5KJ1A 2GQ0A 4HBZA 1OY1A 3T06B 4J1NA 3CNNA 1XDGA 4F2HA 3T15A 3NRJA 3FFWA 5ICGA 3MQFA 4RCYA 2FPOA 1WA5A 3WK8A 3I05A 3UJ9A 3T7JA 3KU1A 5I3ZA 3GT7A 2RBGA 3ZHUA 5AJUA 2B8TA 4AW9A 1Z47A 2QMHA 2KPOA 3D8UA 4XD7A 2QRHA 3FCCA 2M9MA 3LO5A 5DTMA 5E38A 3S5JA 5TGTA 4BVJA 2DFNA 1DKMA 1TVCA 4MV1A 5EESA 3TLKA 3SYNA 4D4MA 1COWA 3Q3VA 2D6FA 1PSWA 4QICA 3W3AA 4KPUA 4OLFA 4V03A 3RREA 1FFCA 3EPKA 1VJ0A 4NNJA 4B44A 3K1JA 2DCUA 3O2JA 1FXWF 5JAQA 3MW8A 4Q02A 5EHGA 5PGMA 1E3TA 2V4UA 3FROA 1YONA 3O2QB 3ASVA 4B3DA 4G24A 3OCWA 2OO5A 3OOWA 4RD2A 3DMYA 1P4RA 1TK3A 4O4IF 1F6WA 2AHRA 1FJGB 1W73A 5HIJA 1X15A 2C2WA 2JFZA 4TKMA 1S02A 3PZRA 3H9BA 3BFKA 4WFQA 5AVRA 3LFHA 4QYWA 4X8LA 2IPLA 4MUEA 3QU4A 2A5JA 3U3OA 1U7UA 3OQIA 4I4NA 2GEDA 1YUNA 1TC2A 1KI6A 4LK2A 4TVBA 2BGKA 4QGSA 3BILA 3PCRB 3CUSA 1X70A 3RSZA 2YVAA 2R96A 3C16C 2C77A 1IB0A 3PT9A 4KYVA 4RYLA 5FBKA 1P1FA 4L3OA 3LYAA 4ER0A 1ZXLA 1NZJA 3D6JA 4KE8A 2I3DA 5D84A 4I14A 2PWPA 4FEEA 1P45A 5T4FA 2VN8A 3OLQA 4ND6A 3A9TA 4C2BA 1F5NA 2ABWA 5T7BA 4LI0A 2B1RA 4FTWA 5JCXA 4EG6A 2ATXA 3WSTA 4W4TA 2DPXA 2EEPA 1R5OA 4W63A 2XMQA 1OBCA 1XVTA 3WBBA 4YIHA 4QBGB 1PZGA 4Z3OA 4EVRA 4UE2A 4YP0A 1BG6A 2O5VA 1CERA 1Z5GA 2AMYA 2PL3A 1CIVA 1PZFA 2Q62A 2VUTA 4UEJA 2IPXA 3UAYA 4CLEA 4DXDA 5MGBA 4WESA 2HMWA 5FI1B 3R2JA 2PUDA 3LQFA 1E8DA 2X14A 3EK2A 4YMGA 3N87A 5EN4A 2HJGA 4D0LB 1C7EA 4CKEB 3VH1A 1FFXA 5K6TA 1F2TA 3WWCA 4L3WA 1VIMA 1F20A 3TOZA 3TEFA 5CUQA 2WMYA 3OOJA 4F3RA 4DLBA 1HTWA 1ENZA 3AM5A 2H52A 2V97A 4U7JA 1SCDA 4EA7A 3KLMX 4JIMA 3OP1A 5AK5A 4ZZIA 3KEQA 3BHIA 1XK6A 1U0SY 1WUYA 1M10A 1Z4KA 4IMJB 2F3QA 3OU7A 3UMMA 1EH5A 1JQJC 3SIXA 1DRKA 4Z1MD 1WG8A 3PKIA 1RBQA 1G8JA 3IKTA 4KKVA 1FS4A 4BVBA 3PFKA 5AIAA 2ZJFA 2VQEB 4RA9A 1B26A 2BUAA 4FB4A 2RJ3A 3P27A 2X5JO 4WLVA 1JVSA 2G1UA 3LQ1A 3F6YA 3UJPA 3ZDCA 3OTGA 7REQB 1WPXA 4BNDA 4L7VA 3QNUA 2HL6A 4X6LA 2E48A 2JAXA 2M2IA 3AEYA 1GR1A 2NU6B 5IBRA 4RKRA 1ORVA 4Z0PA 3SVLA 2C98A 4J1SA 1MH1A 3EAGA 3DMNA 3OCZA 1RR6A 3VZRA 4DLRA 1UC8A 4IDHA 1M83A 2PT6A 4BDTA 1RZRA 2BYTA 1O3YA 1E9VA 2BY4A 1NW5A 2P91A 3S2EA 1ESMA 3ILXA 3ZDAA 1Z7WA 3Q72A 3T9BA 2FSVA 2HBYA 2OCIA 2NN3C 4DRZA 1WWKA 3PD0A 3LKVA 3OUZA 2XJ4A 3HWRA 4WESB 5H81A 2IRWA 1QH9A 4KLAA 2YINC 4OGGA 3BL5A 3NMUF 1ZNZA 2YR0A 1I51A 3EQ7A 4PZDA 1C4OA 3I5MA 2H4HA 1U4SA 1B15A 3U44B 4WW0A 4OQXA 4WKCA 1CRQA 5DJ5A 3JALA 1V4VA 1V4NA 2G80A 4X1YB 4A9AA 4EVQA 4G0NA 1XTJA 4RYDA 4F93B 5LZ8A 3FZEA 4NBVA 5DKFA 1YI8A 1RXCA 3GJ7A 4BN5A 2OHFA 3JW8A 1MV5A 1U9CA 3IHLA 4HTAA 2PX3A 2DSTA 4FGUA 3OT1B 2CXTA 2PMBA 4NPAA 3B1YA 1ZY2A 3KTOA 5IEJA 1BKYA 1KH3A 1ORWA 4IX1A 3R74A 3DWIA 1D2CA 4ZMRA 1H4QA 4REQA 1GVNB 4OHUA 4E51A 1VSTA 2ZCUA 1UOQA 2B94A 4KLRA 4NBLA 5KJCA 3NDBB 1C8LA 2Y9MB 1RXUA 3JQ7A 4AUEA 4J3FA 5G3YA 3R24A 3E5MA 2O0JA 2IY9A 3AJDA 3V4LA 1A9XA 5EA2A 4UBMA 4NYMR 1TTTA 2VWHA 2EKLA 1TJ3A 2AI1A 1NBEA 3V1TC 3G5UA 3JRNA 2WD7B 3P2IA 3VR5D 4AKGA 2OM2A 3VC3A 2OILA 2LR0A 4CG0A 1QORA 4PY2A 2GX6A 5HJ5A 1P4SA 1G8GA 5G3ZA 2H1HA 2VBIA 1CX9B 3KSZO 5FR1A 3AVVA 3DT8A 3CWZA 4YRDA 3DW1X 3PSHA 3NEYA 4DLWA 4AJOA 4YJFB 3QVUA 1KQNA 3X1KA 5BR7A 3PU6A 3IL2A 5NULA 1XLVA 4ENUA 1NPDA 2BT4A 1M75A 1NLYA 3CYFA 3M6VA 5GJCA 3DB1A 1YQGA 1MGPA 3VQTA 3F47A 5CFQA 1XRQA 5CYOA 1U7ZA 3C14C 1NKTA 2RKBA 3QHAA 1ZZEA 1MZVA 2A4MA 5FL3A 4EYGA 1M8KA 1XD2B 2BISA 3OZRA 4WNYA 5DGCA 3PQ6A 1RLJA 4EX7A 3QVVA 4FGSA 3KVRA 3ND5A 3FDFA 3L8CA 2OV4A 2GEBA 4FIDA 4TV8F 1TW2A 3PYLA 4BTLA 3M5CA 3NXSA 3BFPA 1P72A 3EWSA 3QVKA 4BNXA 2IH5A 3A04A 4IFIA 4L95C 2E5WA 1M5UA 1PW7A 1Y4SA 2IYOA 2OHGA 1IQPA 1AF7A 1J42A 4IR7A 1DFIA 2PSFA 2F9FA 4HWRA 4OCZA 4OB7A 1F0KA 3LNCA 3M6WA 4XSGA 3ZD7A 3PFFA 2Y9PB 2DMRA 5K3DA 4BGUA 4CN9A 4GL2A 1PTJC 4HDSA 2CL7X 3GLFA 4MVJA 5BWNA 1T5IA 1E1RD 3I9V1 5LKAA 3H99A 4OK3A 5CD1A 3JQAD 4GOLD 3B78A 3JQFC 1MX1A 2GBGA 2YHAA 3EPRA 3EW7A 4F96A 3W2IA 5CVCA 4YFVA 1UDXA 5A6SB 4PM4A 2EC5A 1L5VA 5DHSA 1USWA 2ZUBA 3PD7A 4DCPA 2FPUA 1PW5A 2IITA 5LZ7A 1MMFB 2FPGA 2RJNA 2ZT8A 3LX4A 4QYTA 1QH1B 1EINA 2W2KB 4M6WB 1D9XA 4HFRA 3WGLA 2AQHA 1U8CB 3ZGLA 3GLGB 1GZ7A 1NMXA 1NBME 3BD8A 3C6QA 5CLLA 4QOEA 4FDUA 4KO1S 3CX6A 3CCCA 1N6HA 3ZLUA 1I94B 2I2BA 1CF4A 1SCAA 2A84A 2HJWA 4DLAA 1T9KA 3MGBA 1BEUB 3F6BX 3L02A 4FHGA 4K1XA 2YUIA 3IMEA 2HK6A 3KXLA 2I34A 1GIAA 2RB5A 4WSOA 5KU7A 1EXWA 1QQBA 4JSRA 1R64A 2AZ4A 2DUNA 1FPQA 2FFJA 1BROA 2WF7A 3WGVA 1RAIA 5EEGA 1EU1A 3A6GA 3KYCB 4PSVA 1KZHA 3ZVKA 1B2LA 1QHNA 2FWBA 5EIHA 2D0IA 2C1XA 4KR0A 4A0GA 5BURA 3AC0A 3HDHA 4MV0A 4D45A 3M2PA 2GEKA 3NW9A 2F3UA 4RMHA 3UK6A 4JIGA 2IV3A 1WIWA 4G0OA 9MHTA 5C5DA 2JH9A 2JI8A 2VNAA 2JHCA 3Q15C 4QJ4A 4ZAWA 1EK1A 3SX2A 4JUBA 2GF9A 1MOQA 2DSNA 1BWPA 5KC8A 2P2LA 3G9QA 2GPSA 3OQPA 3WX0A 2VIIA 3ZGOA 2HDOA 2F00A 5COBA 2JIRA 5FCDA 3H04A 5FYDA 4JROA 4ZHQF 3BGSA 3F3SA 1GQSA 2P35A 3QGMA 4C3UA 2OD9A 1NVKA 4DLUA 4RXTA 5IXYA 1DWOA 2J9XB 4PNPA 4HPJB 1FPMA 1IWPB 4GPIB 2W2LA 3K71B 5FRDA 3ZE0B 5JFGA 3KZKA 3JQ9C 5G1NA 5FORA 5JPDA 4RK6A 5EZSA 3QENA 4MZXA 2KS6A 2ZJYA 3ZY3A 1WW8A 1BN6A 1GPYA 1B16A 1RBYA 2YY6A 3PGVA 3GMDA 4B80A 1DKOA 2QE6A 1Y9DA 2EFYA 3C4VA 3R7DA 2COKA 4HDKA 1W9HA 1RJGA 1CUAA 3HUEA 4FFLA 1QRDA 4MI9A 1XCPA 3IHKA 2Y71A 3ZQJA 1KMCA 1E69A 5CJJA 2PE5A 4EM6A 1ECCA 1XEXA 2PMWB 1R0KA 2VSFA 4XIIA 4ZO8A 5LQAA 2A9RA 3I1IA 1TU0A 1Z07A 2REXB 1MC5A 3CX7A 5CLFA 1M1XB 3W6ZA 2B37A 3ZGNA 1E77A 4POOA 3HP1A 1YRQA 1B6RA 1NFQA 2GZAA 3G0OA 3IIKA 4FONA 4LYGA 2B99A 3OLYA 4M1YA 2H5IA 2GBPA 1A1SA 2WSBA 3M4ZA 4RV4A 3GB9A 1Z28A 1DHTA 3HL4A 1T9ZA 4GI3A 2WU8A 3R7SA 1V7PC 5EFZA 3STWA 2D06A 4RZHA 2PX4A 3O4GA 1SVKA 5B57C 3JQ9A 4MICA 3MTDA 4GSLA 1WZNA 2VDWB 4MWGA 4MWTA 1CS4C 4Q1VA 2FR0A 4MUFA 4P36A 4UDYX 5HXAA 2BR4A 5MN4A 1OHHD 1SXIA 1C3OB 5SY6A 3V3KA 4CL3A 3D2BA 4FINA 4BB5A 4FKBA 2Y1FA 3JWJA 3TAHA 1S2MA 1U8EA 2ZOSA 2JLRA 2PT5A 3L4EA 3PT5A 1UOEA 3DKRA 5T5QA 3RVNA 3R41A 1T9GS 3A9SA 3RRXA 4GSYA 2FSFA 2XDYA 1RPAA 4F6RA 2C9DA 4OGFA 4AG5A 1NVUQ 4BFLA 4IXMA 2SKCA 3KR2A 2FZVA 3H7AA 5KX5B 5DLQC 1XTSA 4CDMA 1Y5RA 3RCBA 4BUJA 1R0YA 1TVKA 1X39A 2LDBA 2VJPA 4B43A 2NO5A 1ZR2A 2GTIA 1USUA 3CCFA 4AG3A 1OB5A 3CEPB 2MSWA 8ADHA 3FBWA 1G5FA 5TARA 4XIFA 4CZ2A 4F06A 4NZPA 5HGXA 1E2HA 1SBQA 2AFVA 3H5RA 4RK1A 2FH5B 5E8JA 1C3EA 5AI0A 1TMKA 3GRUA 1NNEA 3EODA 1JFFA 4E2YA 4KXVA 1ZM7A 4ZN6A 4S1PA 1BMQA 3IP9A 2W2PA 5BSUA 1C29B 3IR6A 2YXDA 4URXR 2GN8A 3PFCA 2LPMA 1KO1A 1KEKA 2X6TA 4DJAA 2L18A 2VUUA 3QVJA 4EHKA 4UXHA 5K0JA 2GCPA 1GGJA 2J6BA 4HWGA 4EDHA 2HU5A 2Y1OA 3IGFA 4NG4A 2Q2WA 2GFIA 2JJYA 3GJ3A 3O21A 4C7JA 2GK7A 1VMDA 4H2DA 3NVDA 5AI4A 2V7BA 3STXA 5C8YB 3F2VA 1ONBA 2R8BA 4HL6A 4J94A 4NWIA 4E1AA 1XTUA 2BSAA 3I0ZA 3ZU4A 4GBJA 2WV9A 4FT2A 4M1MA 1RYZA 3P4UA 1CVIA 1RDFA 1JUDA 2Z2YA 3A1FA 2JJMA 2WWWA 3SKXA 1XI2A 4FGLA 3RSSA 2FSHA 4EOGA 2X41A 4WOKA 4KVGA 1CY6A 2GYWA 3Q12A 5JFOA 1IN1A 1GY8A 4MV7A 3LW8A 1JT9A 2X8AA 3TVDA 4DV2B 3GPCA 1KEZA 4EAQA 3GVCA 4HEQA 4F60A 4ZV4A 3R9XA 3HVUA 1L0BA 3H5NA 2JFOA 4D9MA 5CAEA 4HNTA 3U09A 4KNYA 3G5AA 2JS7A 1XL1A 5DGHA 2HA0A 1U3UA 5ADWA 4H7DA 3WLLA 4QXPA 4U8HA 4E12A 1CUBA 2ZRCA 5JLJA 3TGPA 2RGWA 3A4YA 4JVOA 4CU5A 4F8JA 1PR9A 4G84A 4PS0A 2C84A 1N7IA 3VUFA 3M6IA 3ETJA 3GJTA 2X9LA 1Y1KE 4UTZA 2W6CX 1BXRA 2IQ5A 3WLNA 1E6CA 3RYTC 2QP4A 4RL4A 2Q99A 2I4RA 2WJJA 2HA6A 3FPBA 3MBIA 3TJZA 4QZVA 3NM4A 4R3UC 6GPBA 1T25A 5HGJA 1Y3DE 3GHHA 1KC3A 3HKDA 3PPXA 4KQIA 3S7ZA 1UBLS 4F3YA 5L3QB 3M4XA 3EE6A 4LOIA 4ODIA 1ZLYA 1RYBA 4EKGA 2I4LA 4B3RB 1J06A 4TS9A 2PTHA 4Q7MB 5L6LB 2QDKA 4OU5A 4CMCA 1E4YA 3MXOA 4AY6A 1VBMA 1I6KA 1NVWQ 4MVJP 4QU0A 1QH1A 1KGSA 1MA0A 2Z2KA 3LBFA 3JQPA 3T95A 4G63A 4RHUA 5JAIA 3AL2A 1MJFA 3KDPA 2NGRA 4ZYZA 1G3IA 1V8PA 1RWXA 4JL5A 1FFXB 2QM3A 3QXCA 1C7ZA 3HI4A 5B53A 2I4OA 4GLJA 4RXMA 2AXQA 4IZHA 2GCOB 4F9TA 1DGQA 4LZOA 1Q3HA 4B6EA 4O2AB 3SNHA 2K87A 1IUPA 3NHFA 4JP5A 1E8MA 2FP4B 1E64A 1RIIA 3PI6A 4QQ8A 1SKQA 3DEKA 3RABA 1HYGA 4AX4A 5F9FA 3QF4A 4ZDWA 3H5OA 3ZGVA 1JHRA 3LBHA 1YB2A 1AGXA 5F1OA 1MOZA 1NN3A 1PJQA 1YIDA 1VLVA 1VYHA 2Q7XA 3QHQA 3R5TA 2FHSA 4IPTA 4K6KA 1CY1A 2PLNA 1ZCFA 2I6SA 1HRKA 4FOPA 3VX3A 1Q50A 1O6CA 2LVBA 3KR1A 3OTIA 1KQFA 3TNYA 1JS1X 3MT7A 3RJ9A 3MINB 5CXUA 4WCFA 1ZVKA 1KJJA 2OR3A 5H0IA 2B4AA 4I8DA 1P0IA 3NHBA 1XZEA 2NTJA 4XQEA 1W85B 1I01A 1F4PA 1O96B 2POQX 3PBKA 1HF3A 2X0RA 4RIFA 2YHIA 3K8YA 1RI4A 2XUFA 2FDXA 2C9BA 2PFGA 4O1HA 3SFZA 1ZW6A 4MW4A 2R47A 3F1LA 4PPYA 3OM9A 2V3VA 2OE2A 4H6VA 1S6YA 2WWRA 3VH3A 4B73A 5A5VA 2WG0A 2O3SA 4QWMA 4KBGA 1JQ3A 3ZDRA 4LZPA 1IZYA 3ORQA 3QYPA 4FYJA 1N2GA 1KZ9A 2JVIA 2W4QA 3DC7A 2QJWA 3C39A 1I1OA 2XUQA 3UAOA 5KKCA 1FY2A 2QROA 2Q4RA 2PZGA 3ENKA 3HBNA 1UXOA 2N1MA 2OBBA 3FI9A 3K5PA 3R5SA 4QPCA 2R6CA 2AYZA 2CDNA 3VHXA 3I5XA 3AVXA 1ARZA 5B4TA 4JUCA 1A9XB 4WXHA 1JPNA 4MWSA 2ZIWB 3H2GA 4AIRA 1IEQA 2BZ1A 2FXVA 2GARA 5DNYB 2VK8A 3FWNA 5JWRA 2ZU6A 1IG3A 2IWHA 5B2FA 4I8XA 4N3NA 5ERYA 1T9HA 2VBGA 4R4JA 2C9CA 3U3DA 1D2EA 2GFHA 3CZ4A 4CGYA 3O4RA 721PA 3U4MA 1EWQA 1TVMA 5IWAB 3WLJA 3X1ZA 3CZAA 4DMHA 3G7SA 2IOFK 3MQ4A 5JVDF 1P91A 5LVAA 3OPVA 3AGQA 2QUAA 4YP9A 1KJIA 1XROA 3GXBA 4FILA 1NJ8A 2Y6UA 3Q7EA 2ZSDA 1BJTA 5EXEA 3EY9A 3USES 2EW2A 4K6OA 2FP3A 5BV7A 2YRFA 4H0NA 2YZKA 1EHIA 5BVGB 2B4YA 2O3TA 3HHPA 2XB4A 4EG5A 5A3QA 1H22A 1AKNA 1T2NA 4EWLA 4BHTA 1UQTA 5D85A 2WUEA 4N01A 3WMEA 3PC7A 4UREA 1TM4E 3SBXA 3PHCA 4J2OA 1XRPA 4RMIA 1D8AA 3SFTA 2Y68A 1KVQA 5A1JA 2NM0A 2LP4Y 3O7MA 4M89A 2IHKA 3NQ41 3DLAA 4NBTA 4RO0A 1JFVA 2QN9A 2FQXA 4W1QA 3LUAA 1F6DA 1LLUA 1WP9A 2EZ9A 2EQBA 2QMUA 3M1LA 3NPMA 4ALNA 2O9JA 4ARAA 4DEVA 1Y89A 3HRIA 3JAKA 3V8EA 1HI9A 5ALKA 2H1FA 3PHGA 5EP2A 1HH4A 3P2EA 3IXQA 4DL9A 4TLEA 4L08A 4L4YA 2X6RA 5D3KA 4GKJB 1F5SA 2H0AA 3VO2A 3HJBA 5JTUA 2JDID 1LJ8A 2D1FA 1UH5A 4PRKA 1XMXA 3D8HA 2EKPA 3E35A 4X5OA 5T8KA 4ZEWA 3DKVA 2ZSHA 3EGXA 4WDQA 5DM0A 3KVNA 4LV5B 3S8MA 4MWCA 5B3KA 2Q5OA 2VQDA 3FTEA 4WVLA 3JWIA 4RGQA 1R9NA 3AHIA 2BCJQ 3HB9A 4H3SA 4WXRA 3TB4A 2C4HA 1SOAA 4LYJA 5JALA 2EZTA 1LGYA 2VF7A 4YRAA 3IB3A 5K8TA 4AKIA 1ORTA 1CZUA 1VE3A 3CUYA 4GPZA 2G09A 1H8ED 4GO1A 4DNOA 2B8NA 1HOTA 3ZHYA 2IOFA 3K2QA 2IYAA 3DZIA 3LT2A 3VKFA 3CVUA 1ZSNA 2H2FA 4G5HA 1EFPA 4QGAA 5I7AA 2JAPA 4D6YA 2XAAA 1L5WA 5D5QA 5IS2A 2C4MA 3TLXA 3VR3D 4CLRB 3TN7A 4C87A 1NW6A 1UC9A 2WJYA 1JR6A 4OGKA 4WLUA 4BEJA 1JU4A 5EUQB 3TQOA 3VJMA 1XUOA 1PDWA 5GOTA 3U48A 1QPGA 1OV6A 1U2PA 3H18A 1A3CA 1O8CA 4AS2A 4D4LA 2FN3A 1CNFA 1KO5A 1FTNA 2O8NA 3HUDA 4DARA 3VSCA 3QVXA 3V8PA 4DUPA 2F17A 2GRJA 4MAFA 4RPCA 3DM5A 4OQLA 2HU8A 2V5AA 3DNPA 2PUFA 2I7VA 2IZ0A 2J6CA 2PZ8A 2R66A 3EHDA 4PYQA 4WT7A 3HNRA 3R8XA 4BVHA 3AHFA 1NTRA 2GHIA 4UM8B 1LKZA 4CKBB 1JAXA 2Q4TA 4NECA 5LKRA 1CUZA 3G9UA 4ZCLA 2H59A 2Y1KA 2EKBA 1CDEA 2JD0A 4NENA 1LUAA 4KH0A 2ZE7A 2HQSA 1SCNE 2P9BA 1XPRA 3EAQA 5C7YA 2GYUA 2C5LA 2CJYA 2QYSA 2WKPA 3BFXA 2A3NA 4FE7A 4LYFA 4XJTA 3T1VA 1TCBA 1YJAA 4CFZA 2IYQA 1J49A 1G5QA 1XQWA 2ZIFA 3SU8A 1FP4A 4IJMA 5G0TA 1YZYA 3MCTA 2AC4A 2JEZA 2EBWA 4QYMA 5BSRA 2NO6A 4R84A 3VC7A 4YMHA 3I61A 1JLRA 1CZKA 2C7VA 3KB1A 4OUKX 2P2ZA 4YXFA 3KQOA 2GK4A 5CCDA 1L7VC 3EGDB 4CR8A 4IJVA 4I66A 1CEEA 1KS2A 4RAOA 3LWDA 2A94A 5GV7A 1IN8A 5I6DA 1VL2A 3F6CA 4MI6A 3BGWA 2OK8A 2QGZA 2CUTA 5D3QA 3CJTA 1OFHA 1XD9A 3A28A 3Q7TA 2OO3A 1P5ZB 4PG7A 5DWVA 5SYAA 2NPOA 4F5DA 1SUPA 3VPCA 3WGHA 2FR8C 4XWAA 3MCAA 4B5KA 5HK9A 3CF0A 5KHOC 4GGPA 3ZX4A 1Z6PA 4PZYA 3BWMA 4C0HA 4B7UA 1YKFA 2Z95A 2E9SA 4K3VA 4OGLA 1EVZA 1S2GA 2XE4A 3FRHA 3LDUA 2CKDA 4FMCF 4HH0A 4LQ4A 1L4GA 2AL7A 4JC4A 2E4VA 1CRPA 3UCFA 2QG9A 2WTUA 3PLNA 4IIHA 4PLGA 4E2FA 5EP4A 1Z38A 4RJKA 6NULA 2C59A 3QPUA 2YJ5A 5B5SA 1PJ2A 1ECJA 4EUEA 4UE3S 5EC8A 1YT5A 2C03A 4B2IA 1L1EA 4XQ0A 3LHKA 4ZGGA 5F5XA 1JEAA 1TYAE 5LOVF 1KH2A 1T36A 2AXNA 4JC5A 4CHTA 4EF5A 1SG0A 1MEOA 2GBFA 4BLQA 1NQUA 2JFUA 2ZTLA 1L8OA 1JYFA 1RJ9B 3OAAD 5JWOA 1E1QA 1YL6A 2IP2A 1U1GA 3ES9A 3I2JA 3E2PA 3H0CA 1ENOA 3C3PA 2JLCA 2CDRA 4ND5A 4OI2A 1RWKA 2NQTA 4YRQA 1RFLA 3BWXA 1LX6A 3WIBA 5AOVA 2C92A 4JLVA 3E1KA 1Y98A 1L9KA 5FA6A 4M53A 2OB2A 3WQRA 1TTPB 2YHSA 5EXXA 1TMOA 2VDWA 3AF1A 3BHMA 2JFXA 3HMKA 3M81A 1KPIA 1RSZA 4JCCA 2X58A 3BM5A 4BUCA 4CKYA 1EVYA 4TROA 4RY9A 5C4GB 2CJPA 1D1TA 1WMBA 4KQGA 4KR6A 1PEYA 2I29A 1V5FA 3KR9A 1ECPA 1R6VA 2WTXA 3NVMB 4JITA 4LI3X 3KLNA 4M1KA 1AN0A 3WXMA 2AWNA 5IFKA 3K35A 5E0KB 4D4HA 5MF6A 3AI2A 4JJEA 5K6RA 2A86A 1ZUWA 5F1YA 1PNVA 1E6KA 4E5NA 2I62A 1YWGO 2Z2ZA 4Y2QA 2AR7A 1XDBA 1PJLA 1DAIA 1NPYA 1GTMA 1P31A 1KYWA 2HLDD 3F8SA 3ISVA 3KPYA 4ILKA 4NYMQ 1CP2A 1GNLA 1QHEA 3VR4A 3ZOZA 4BNDB 4RK0A 1G55A 1E0AA 4AY4A 3BX1A 1R6TA 2FRVA 2HHHB 4X8MA 1ZOPA 2I65A 4EG0A 5HP4A 2WFAA 1NP6A 4OX9Y 2VWQA 2XSZA 4QATA 2XUZA 8LDHA 2C20A 1MRNA 3W7AA 3I72A 2Q1WA 3C6BA 5FJJA 2DQYA 3A7DA 2ZI4A 2AW5A 5BSFA 3ECAA 5TVGA 2W43A 5EKXA 3A9CA 1GZ3A 3AH8A 3SJUA 4OXYA 5JS2A 5ALFA 4Q82A 5JSQA 3QI7A 1PU2A 2AFHB 2AOUA 2NU8B 2H1IA 5HEKA 1CRLA 3FE2A 5KOJA 1TW3A 4MPTA 5DEOA 2NP7A 2PRSA 1ZLXA 2EEZA 2VT2A 2XVAA 2ET6A 3DMFA 5K3CA 5LBIA 3Q9NA 4ADSG 3TRDA 1RWQA 2HHCA 4Z4GA 2Z4TA 5AKHA 2VAPA 2VKQA 3EUWA 4QFMA 3EXHC 1SBYA 1IN7A 4J9UE 1Q0QA 2J9GA 4AJ4A 1F4VA 1EFUA 5BXYA 1J39A 3GG9A 4HH1A 3DHVA 1PVDA 5COAA 4BEVA 1AOXA 1VG1A 1M2WA 4LHYA 2P9CA 2VVTA 2Z6VA 4OB8A 5LMZA 1OLXB 4DR5B 3ADCA 2YW9A 3ZUGA 4J16C 1RJEA 3ELUA 3O4FA 1N78A 4JVSB 1ZFNA 4PHGA 5J59A 3NLLA 3L7KA 4JYBA 3U7QA 5TC4A 2HWWA 2IUFA 1QB7A 1B8PA 1H85A 4TVKA 4Z9YA 3TRIA 1ITZA 3IEXA 2FF5A 4O4HA 5JH7B 4X3CA 3O8CA 1XTVA 2AYXA 2BEVB 4XIYA 5CK4A 2PS0A 2PJDA 3K1ZA 4KO4S 4RBNA 16PKA 2IY7A 4OXIA 2FUG6 4URVR 4Z7JA 2CJWA 3CEHA 2KW5A 4P82A 3M34A 4IGAA 2KLHA 2HRZA 3W5JA 4WOCA 1U9YA 2WYVA 4CIAA 1SHTX 1P61B 2EQAA 3MRSA 3VNVA 4LZLA 2ZWIA 3MSXA 3D8TA 4L5CA 3OKCA 3FX2A 2EZ4A 4I36A 4LDRA 5U4QA 3SLKA 4RELA 4TZ6A 3G0CA 4N7RA 2C3OA 3E2MA 4HMQA 2WIGA 5JI3E 1UAYA 4UBJA 4W6QA 3DSRA 2Y4NA 2Z08A 4GMKA 5CHEA 1KO7A 5K20A 1SBNE 3LHSA 5FTKA 5EPOA 5JSKA 4X8OA 1EP2B 5C3UA 3H42B 4O4JB 4R41A 1K9SA 3UMBA 3LS2A 2EW1A 2XNCA 4NJMA 3W3AD 3ZZ1A 2JFHA 2GZDA 4I4TA 4CM8B 2FU5C 3M5PA 3DZBA 1FBNA 2BW0A 3D8RA 5L3SB 2R9VA 3AR9A 4F5ZA 3HM9A 1D2HA 5DF1A 5LQNA 1H3FA 2I33A 3PEUA 3QEMA 4X95A 1Y1RA 1JAYA 3VRHA 4CNBA 2PYDA 3RIHA 2HYDA 4PSKA 5DTRA 4S24A 1ZUIA 4RK5A 2IKSA 3RHSA 2MYPA 1P73A 3R7NA 1U2ZA 3KSMA 4RD0A 4BNHA 4HCJA 4L6IA 2IIBA 1R7RA 2VJCA 4LE1A 2OHOA 5EUMA 4UAJA 5CT5A 3ZWVA 2X3UA 1M34B 3M6LA 4LDPA 2GN9A 4LMAA 4N82A 5LL6P 3KUKA 5FEMA 4Y7DA 2LIPA 2VNIA 4CKCB 3TOSA 1H2WA 1KK2A 2JB9A 3B9PA 1DRVA 4TL6A 2MMGA 2GN0A 3ESYA 3KZMA 3RS0A 3U4AA 1SK8A 3KZXA 2IHZA 3VNAA 5JS7A 1R37A 1G59A 1SQGA 3I8XA 3LKZA 1VL6A 4RVNA 1GQ2A 4U9UA 3E3AA 2PGIA 3B1FA 2O8BA 2B92A 1ZH8A 1GHTA 1MQ8B 5IJAA 4BQQA 2JATA 1Z6XA 2ZYAA 1S01A 3LWNA 1E5TA 1FVFA 1EWTA 1X13A 1YFZA 1EWVA 3JVUA 2XD4A 2XPCA 1XDWA 5EFOA 3R7WA 4EQ6A 5CA1F 1PZHA 2PX5A 1DZ3A 1DTWA 4H35A 4LDZA 4NCXA 2ACWA 4PYIA 1KI7A 2O3UA 1Y0BA 2GASA 2HSGA 3H86A 4QXRA 3RM3A 3M6AA 1EAMA 2HK8A 1X80A 4J2TA 3KLOA 2VQ3A 4ZVRA 2JLZA 3TRJA 1U5BB 4KSYA 3Q3IA 4MV8A 2C9OA 4RMJA 1O95C 5TQJA 4A3SA 5KYWA 1G9TA 3A11A 1WPGA 3R6TA 5I9MA 2G88A 4NVRA 1WL8A 5G53C 1UT5A 2QLFA 3HSSA 3TWOA 4MCHA 3H9JA 1NJ1A 3SR3A 4EGJA 2XNDD 1SKUA 5I8ZA 1T3ZA 1Z5ZA 2C7PA 2BLNA 4C7BA 3A1VA 2ZANA 3KPWA 4W5HA 1G6Q1 1BYIA 3IVXA 4A8JA 5BQ3A 1DXQA 1YH3A 3OCYA 4Y9UA 5FUWA 2B8WA 4WLNA 3B5EA 1OT5A 3BB3A 3LCJA 3OE1A 5CVVA 3O3OB 3F5FA 1DT5A 2QUKA 5I9LA 1L7EA 1CUUA 5JAZA 4DGQA 1IJBA 4YMTA 5A2QA 1EFVA 2FTKE 3TUJC 3OF2A 1US8B 4G4SO 1WKCA 2F43A 1MAHA 4UARA 4BP1A 4N03A 2FSSA 1EHCA 4RKEA 1E96A 1SQ0A 3PGMA 2C61A 2AVDA 2DBZA 4N1AA 3HDVA 1ANKA 1CQJA 3HV0A 2XITA 4B9AA 5T64A 1CXZA 5WRFA 3S2SA 1L5MA 5FP0A 2OCXA 1GG9A 3DDHA 1USKA 2O1SA 3EXIA 4I1RA 5J9FA 1ULBA 4DPMA 5IM4F 1C1XA 2WTBA 3ABIA 3G7UA 4HZGA 4URHA 1RAEA 4XDGA 4B7XA 5FUXA 5LP1A 3FTQA 1M67A 2P9ZA 3ESRA 1L8AA 2XYGA 3IDOA 4JGBA 5DW0A 4RNDB 4ZVPA 1RC0A 4EJ6A 3HM2A 3QVLA 2GOYA 3BE4A 4DY6A 4P1ZA 1HTBA 1QF6A 4H4EA 4ABTA 5LU9A 1PK7A 3Q2KA 1Z6ZA 2FEPA 1KDOA 3H65A 5I7UA 4L2IA 5LQKA 5LR6A 4ROSA 2EJBA 5A03A 2AKYA 2MJLA 4P7FA 3SC2B 1ZKMA 3KWJA 3P9RA 3GPBA 3IPRA 2P27A 2CXPA 3ZH9B 3VU9A 1TA0A 5CPFA 3ET5A 1FYVA 5IH3A 4AZWA 2G82A 4Y0NA 1VKZA 3UYKA 1KJ9A 1KFEB 4NU0A 5E7IA 3DL0A 3HH8A 1VIDA 4EGCB 1ZD1A 5AQ1A 1QM5A 2YYYA 3QJGA 4P80A 1H65A 1M8PA 4G07A 1A5TA 1YBFA 5SYNA 3BBLA 4GIBA 2QWXA 4JGGA 1ZC3A 2CEKA 3E3OA 5DHPA 1V37A 3E9YA 1UK6A 1DWQA 4PZ9A 4Z4CA 1NONA 3WLQA 1AMNA 2ZKIA 3GF4A 3LFTA 5LYJF 3TQTA 1DIRA 2XQFA 4OV6B 3NB0A 4MUNA 3TD9A 3D1VA 4DF3A 4E21A 1JX6A 5BVGA 3EPJA 2A7QA 2WTMA 1SXJA 4LY3A 4KQJA 1NQOA 4XX0A 1IXRC 4KPFC 1W47A 1Z0SA 2QI9C 3F46A 4DDTA 1FA9A 3S1SA 4J0QA 4DLNA 2AZXA 4ZXPA 1TZCA 1CPYA 3KEGA 2Q5EA 1SUSA 5KPDA 3RAPR 3N39C 3WNVA 1FFWA 2AUTA 3UJCA 1OAOA 1W5SA 4JU8A 1I5OA 3T9DA 3LX6A 4O1IA 1GSHA 3FDXA 5JSHA 4XGNA 2PX0A 2EF0A 5F9MA 5B12A 1RTKA 4JXZA 1PAUA 3OJEA 3UENA 5CDUA 3E7PA 1KI4A 2II6A 3KXIA 4JXJA 4UEKA 1KKLA 3OA0A 4DXHA 2WJWA 3S1AB 4MVYA 1N6KA 3QKIA 1XEWY 4K5QA 3GY0A 1KKMA 1MJNA 5CB4F 3JD1A 1W2HA 4ARIA 3DFZA 3LPMA 4GLFA 4R2KA 3MWEA 3QUAA 2H17A 4HNAA 4A0RA 3L43A 4YALA 1ODJA 1EM8B 5KQSA 3KAJA 3P5SA 1F12A 4H1TA 4A16A 1P0PA 4H1WA 1IY9A 3V9PA 4BZXA 1L4YA 1DJPA 2XX3A 2R8YA 6ABPA 3LQKA 1DKNA 3AYZB 3SIRA 1N1DA 4B81A 3OH8A 3MUEA 1XTZA 1I2CA 4LHZA 1WB6A 2C7RA 5BYKA 4L07A 3TS1A 2IS2A 4FJ0A 1AXGA 4Y1FA 1OKKD 1TEXA 4F9EA 1RWNA 1BFKA 2W4MA 5HKLA 1X42A 3QFSA 1UAGA 4MVJF 4XKJA 2JRCA 4CCAA 4GYKA 2M1XA 1RAAA 1VJTA 4HVTA 1T29A 1O03A 3BMCB 3I5UA 1DEHA 1XZKA 4K6HA 4X91A 1ETHA 4XWYA 2XKJE 1Y9ZA 2Z9CA 5TGDA 4PTZA 4F2WA