3FVTA

Crystal structure of acetyl xylan esterase from bacillus pumilus, monoclinic crystal form ii
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
318
structure length
318
Chain Sequence
b'MQLFDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEAEPTLESYDYPVKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDGGIHDIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYYYRGVYLDAVRALEVIQSFPEVDEHRIGVIGGSQGGALAIAAAALSDIPKVVVADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEKAFETLSYFDLINLAGWVKQPTLMAIGLIDKITPPSTVFAAYNHLETDKDLKVYRYFGHEFIPAFQTEKLSFLQKHLLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyl xylan esterase
publication title Structural and functional studies of Bacillus pumilus acetyl xylan esterase
rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
total genus 114
structure length 318
sequence length 318
chains with identical sequence B, C, D, E, F, G, H, I, L, M, N
ec nomenclature ec 3.1.1.6: Acetylesterase.
pdb deposition date 2009-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fvtA00
2XQJA 4GXNA 4X6XA 1BCRA 2FJPA 3I2IA 3WIBA 4N5HX 3QPDA 3L1JA 4AQDA 2C0QA 5DYWA 4HXGA 1TIBA 2HFKA 1LZKA 1JJFA 2WUDA 2XMCA 3UUFA 3LCRA 1QIGA 3E4DA 3BDIA 1SCKA 1I6WA 1VJ5A 3AZPA 3VDXA 4BBZA 4B84A 5I8PA 5JAHA 4ZI5A 5KREA 1VE6A 3ESBA 2WHPA 4AXBA 3QMVA 4DMHA 4G4IA 5JALA 3JYHA 2CKMA 2VAVA 2XMZA 3ESDA 1R4ZA 5ALTA 2YH2A 2OCIA 2VEOA 1CQWA 3WWDA 3BIWA 5YASA 1TK3A 1EINA 4W1PA 3PF9A 1ZI9A 5K3BA 3WKCA 1XRLA 5E4YA 4DNOA 1PFQA 4B82A 1CVLA 2JGIA 3BF8A 4DNQA 3R3WA 3QMMA 2QR5A 2QRUA 2OGTA 2J4CA 3CN9A 3PFBA 4D9JA 2O7VA 1EB8A 5JADA 1K4YA 5SYMA 4E14A 1RWQA 4M0MA 1X2BA 1AMNA 5ALXA 1C7IA 4UFOA 1VOTA 5SYNA 3WK7A 4H35A 3VJLA 1CFJA 2OGSA 5A7GA 1N5MA 3FVTA 3RK4A 5LIPA 1P0MA 3R3ZA 2B61A 3I6MA 3B3QA 4GBGA 2C5FA 2WILA 2XUOA 1UKBA 4FMPA 5AKJA 2OAEA 3YASA 5K3DA 2RHWA 1H2ZA 3V1LA 3C5WP 2WU4A 1EDEA 1LZLA 3FAKA 2HHAA 4QE3A 2XMGA 2PU7A 5EHXA 2CMFA 2WFZA 1QONA 4X91A 2BKLA 2AJ8A 1MN6A 1LPNA 2E3JA 3QBJA 4P92A 5DNUA 1N1MA 1LBTA 2YYSA 5AKZA 4AMZA 3FLAA 3G9UA 1N8SA 2GZRA 5AH0A 5KWJA 1CUBA 3V1KA 5E4JA 5CURA 3D2CA 2WHPB 2K2QB 3WA6A 1EK2A 3FSGD 1JFRA 2RI6A 4Y2UA 4QDZA 2AXEA 5EI5A 4Y2XA 2WQZA 3RLIA 4BAUA 1R9MA 5JAUA 4QDOA 5BV7A 4BZZA 2J3QA 2FX5A 1ZD3A 4ARAA 1ZGBA 4XIIA 3H2HA 4DGQA 2BFNA 3PUHA 3STYA 3HACA 3ESAA 4HTAA 3BIXA 4N8SA 3TEJA 3Q0TA 1XZGA 3OG9A 4OPMA 4Q3LA 4EB0A 3O4HA 4MJ3A 4Y2SA 1YA8A 3HJUA 1QE3A 1Y7IA 1UOOA 2QXTA 5K5EA 5AIAA 3WKBA 3F67A 4TPKA 1K5PA 1AC5A 1CUCA 1UXOA 3T52A 3VJMA 2H7XA 5CH3A 4W1SA 1GKKA 1T2NA 3HSSA 2HA2A 1QIEA 1W76A 1QZ3A 5D3KA 1UKAA 2G4LA 5LZ9A 3ZLUA 2HADA 3M3DA 1WPXA 1DU4A 2XUQA 2V97A 2EDCA 2HRRA 3DYIA 1E89A 5ALDA 2Y6UA 3H2KA 3DD5A 3AIOA 2I3DA 2GYVA 4FWBA 3QVMA 1TQHA 2WIKA 4BATA 1FFEA 5ALLA 3WK8A 1U4NA 4X7BA 2OCKA 4FHZA 1ZICA 1SCQA 2V96A 1CPYA 4PW0A 2XQIA 1TCBA 1C4XA 2ZJ6A 1M33A 1XZLA 4MWTA 5T4BA 3WZLA 3LIIA 2VA9A 2QMQA 3E0XA 5EHZA 4HXEB 3G0BA 4JEIA 4W9RA 2JGFA 1E8MA 1ZIXA 4KE8A 4U2CA 4CFSA 5LP1A 3M82A 4YPVA 5AKGA 4A5SA 3VISA 1HQDA 3WKAA 1YS2X 5IVDA 4EBBA 1SFRA 3GUUA 3WZMA 1WHSA 5JYCA 1ZI8A 3D0KA 1H22A 1CUSA 3KSRA 4FFWA 2OGZA 1FFAA 5LKRA 4HXFB 5CMLA 1A8UA 5IH7A 1R9NA 2DHCA 1G5FA 2YXPX 4ROTA 4MQLA 5AK4A 3GBSA 1XZJA 1YSCA 4A16A 5AI5A 2QUAA 2IX9A 4Y7DA 4PSCA 4BDSA 3BJMA 5AK3A 2XB6A 2WG0A 1TCCA 4LXHA 4X97A 4BC1A 5DTIA 2WUGA 4H7JA 5ALKA 3ICWA 1XZIA 3F98A 2HA3A 1IVYA 3AJAA 4WJLA 2WKWA 4DMKA 3WL7A 3HZOA 1QIKA 5AOCA 5IVIA 4KE6A 2W22A 2WTNA 2XQGA 5BWBA 4Q82A 1YR2A 1TAHA 5CH8A 1E5TA 4QA9A 1CUAA 2WUEA 1W1IA 4RE6A 4DM7A 1Z68A 2RGUA 4Q3OA 1PV1A 5FPQA 2RIPA 5CXXA 5K3AA 3TGLA 1Q0RA 3DJYA 2PM8A 3FYUA 4U2EA 2BCEA 3H2JA 1ZD2P 2Z8ZA 3DKKA 1WB6A 3WIOA 3QZUA 2OCLA 5DNWA 2J3DA 1T4MA 3ZPXA 3H17A 4H7EA 3NOXA 1ODSA 1ZD5A 3ZLTA 2AJBA 3STXA 5LZ2A 1R1DA 4DSZA 3I6YA 4AZ3A 1WHTA 2D5LA 4WCVA 1U2EA 2B4KA 2BUBA 4BAZA 2XLBA 4UHHA 3X3HA 3W9BA 2GBFA 3ILSA 2XT0A 3IUJA 1CUXA 1XRNA 4H7FA 4RNCA 5CH5A 3BWXA 4KE9A 1HL7A 2C58A 4F21A 2XMQA 3QH4A 4KACA 2HU7A 2G5PA 4ARBA 4H7KA 4O08A 1FJ2A 4GECA 3HLKA 4B85A 1GZ7A 2PSDA 4H0CA 2VQ6A 2HIHA 1G4HA 4E15A 4C88A 1JMKC 5ALIA 4CCWA 1QO9A 1XQVA 4N5IX 3M81A 1EX9A 4MQMA 2YASA 5LZ7A 3A6ZA 4BVJA 1E66A 1K63A 2XUJA 3PFCA 4INZA 3FYUC 1NU8A 4BE9A 3K9BA 4FFVA 1XZHA 2HU5A 3F97A 4C4XA 2G63A 4Y2TA 4YASA 2WJ6A 4LYEA 4X90A 4DMFA 1C7JA 3KOOA 3AZQA 1XLUA 3MVEA 4G5XA 1BEEA 3R3YA 3PE6A 4DMCA 5ALVA 1E8DA 4PV7A 4CCYA 5LLSA 5HZGA 4PNZA 2WG1A 3R0VA 3AILA 1UWCA 3O4GA 4LKOA 5ALNA 4FOLA 5AI6A 1IZ7A 4UPDA 2C4HA 5K3EA 3N2ZB 1BU8A 4IH4A 4F5ZA 3I1IA 1K8QA 1XZMA 5A7FA 1NU6A 3FYUB 3PF8A 1W52X 2FUKA 1ACJA 1YA4A 3C70A 5DLPA 2ECFA 2C0PA 4EY6A 4LXGA 1Q83A 1XLWA 1QIHA 2QUBA 1O6FA 3W06A 4DTCA 2OCGA 1U65A 2WLSA 3FBWA 4Y2YA 2PUJA 4W63A 4FKBA 1ZIYA 4UHCA 3WJ1A 5ALFA 5C8ZA 1QIFA 1CUHA 1LPMA 5CW2A 1QFSA 3FWHA 4I19A 3WK9A 4PSUA 1HLGA 3R3UA 2OQVA 4UFPA 3C8HA 3IURA 3I28A 2JIDA 2BUAA 4UHEA 3WJ2A 5AHXA 3G0DA 5BWCA 5EFZA 3D4LA 4KRXA 2QZPA 1EH5A 1O6GA 2AJCA 1CUVA 1LPPA 2HFJA 3C8DA 3WWCA 5HCUA 2DHDA 3GELA 3NUZA 4WFIA 2XQFA 2VJAA 5H3HA 4B81A 4S0XA 1JU4A 1BEZA 3IULA 1ORWA 4V2IA 2V9ZA 1EA5A 1UOPA 4Y2QA 3UMJA 2BAGA 3IUQA 5AK6A 3VVLA 1BRTA 5HF8A 4OB7A 4QLAA 1VKHA 2EDAA 2JF0A 2VTVA 4Z49A 4N8DA 2XUAA 1Y7HA 3STVA 2QS9A 1CUGA 4BTVA 4OCZA 2IIVA 2QM0A 3AZOA 4XX1A 5HFNA 3WK5A 2CB9A 1SOMA 3HC7A 5AKKA 5ALMA 2WUFA 1DQZA 4UHFA 1CUFA 2Y1KA 3WKDA 4X6UA 1EK1A 2X5XA 3STTA 1XROA 1YB7A 7YASA 2JGEA 5KWIA 4C6HA 4UHBA 1CR6A 1XRRA 1XRMA 4XJVA 3WL8A 4CCYB 4UBIA 3CXUA 2WJ4A 1CUWA 4AB1A 2X8BA 2WIJA 4BC0A 1LGYA 3WYDA 3RKSA 3WLAA 2HA0A 3OURA 4HVTA 2PL5A 4EZIA 1HKHA 5ALHA 1QTRA 4A23A 5IVHA 4BCBA 4U2DA 2Z5GA 3IDAA 1A8SA 3QYJA 1LPSA 1R3DA 4MEBA 3A2NA 5A71A 2JEYA 4KAFA 2Z3WA 2ZSHA 1XZDA 2DQYA 1MNAA 5JAPA 2D0DA 3BE8A 5ALUA 1YS1X 3K2IA 4AX4A 4DIUA 3IBTA 1U8EA 3CCCA 5CT4A 1CUIA 4F60A 5CT8A 1P0QA 3EQ8A 1QIDA 5DJ5A 3RM3A 5HKAA 5JATA 4BP8A 4WFKA 1L7QA 5FV4A 4W1QA 4GI1A 5AKEA 2HRQA 5ALGA 1GGVA 4GWLA 1UK7A 1VXRA 3F9CA 3O4JA 4ZREA 2XUPA 5ESRA 1DTEA 2WFLA 2R8BA 3WK4A 1DT5A 1F0NA 4TVKA 4X85A 3GROA 3DYVA 4WDQA 1EI9A 1B6GA 5AKLA 3G02A 3P2MA 1QTIA 1ODCA 1CUZA 5AI8A 2BGNA 4EA6A 1F6WA 3ESCA 4H77A 1SCIA 3H2IA 2DCMA 3FYTA 3ZV7A 4J0KA 2ZVDA 4EHBA 2HA7A 4BRSA 5AM1A 4G4JA 4W1RA 1JMYA 1ZOIA 2CEKA 3IB3A 4J0CA 5EIEA 5ISMA 3I6ZA 2V98A 1DT3A 3D7RA 4KAJA 4MWSA 5EIAA 2QJWA 5HF5A 3O9MA 5EIHA 2ZJFA 4BAGA 2JEZA 1F8UA 1JJBA 2Y2VA 4QDTA 4BB0A 4AZ0A 2OAGA 5ALZA 2AJDA 1THGA 1J2EA 2P8SA 4G1FA 1EDBA 4CG1A 4DNFA 1DX4A 1LPOA 3L1HA 3IVMA 3D59A 4G9GA 5JD5A 1AQLA 1EVQA 3WL5A 1B41A 2XMBA 1LBSA 2ZYHA 3C6ZA 1OXMA 2EEPA 4ZV9A 3MUOA 1GKLA 3HEAA 4QNNA 4IQ4A 5LZ8A 4CG2A 3V48A 3IA2A 5LZ5A 1VZ2A 2XUGA 4J0DA 3WA7A 5ALRA 2QKYA 5HQ3A 4QLOA 5AO9A 5F4ZA 5D3ZA 4OU4A 1R50A 5FP0A 4UBLA 3K6KA 3WWOA 4QDUA 2B9VA 2WIGA 5AM0A 1X2EA 4YK7A 3I2JA 3SK0A 3VKFA 4ETWA 3EQ7A 1FFDA 3DLTA 2VATA 1QJ4A 3ANTA 4PF1A 5A7HA 3B12A 3A2LA 1XZFA 3HRHA 3DKRA 1CRLA 2WIFA 4EY7A 3HI4A 4G9EA 3HXKA 3G8YA 1EB9A 1H2XA 3R3XA 2WFLB 1X70A 1VA5A 1MAHA 3S2ZA 4CI9A 4PSDA 3MUNA 3R40A 4TGLA 4WY5A 4X71A 3STWA 5EGNA 4Y2PA 5I9IA 2JBWA 1E8NA 4OSEA 1UFOA 2JGJA 5J3JA 4K6KA 5BOVA 3NWOA 4EUSA 4KRYA 5FRDA 4G8BA 4GHWA 2O2HA 1JJIA 4Y2JA 1MJ5A 3PICA 2HDWA 5JZ9A 2Q0XA 1DX6A 3FLEA 4DNPA 4MYDA 3H0CA 2PSFA 3H1AA 4G4GA 3WWPA 1EHYA 4B6GA 2O2GA 2WM2A 3I2KA 2OLEA 2J4FA 2Z8XA 2VJCA 3WKEA 1GPLA 1JI3A 1IUNA 1W75A 4Q34A 2GZSA 4RE5A 1QIMA 2I03A 1A8QA 4CIBA 3O95A 5FXMA 2BUCA 4BCCA 4OUKX 5E2IA 1QIIA 2XQKA 1CUEA 3GFFA 5HF6A 3C6XA 1GQSA 1XLVA 1MU0A 2RONA 1HDEA 3E3AA 1VA4A 1HBJA 3A2MA 2JGLA 1H2YA 1WPRA 5CRIA 1YB6A 4RPCA 3LLCA 1JU3A 4X94A 3CN7A 5T4FA 5FDFA 5I7UA 4U2FA 5JANA 3W05A 2WFMA 2Z3ZA 4Q05A 4L9AA 5HQ3B 1XKTA 3H04A 3PUIA 4I3FA 1QIJA 3SWWA 1MO2A 4OB8A 1BN6A 3H18A 2ZYIA 5A6VA 4BE4A 2ES4A 2OXEA 1IUOA 1BN7A 4U2BA 4B0OA 4FLMA 4EY8A 5AM2A 1TRHA 3IIIA 4B0PA 4FLEA 1JT2A 2VT7A 3DL4A 1UK9A 3D5EA 3O0DA 3OTQA 1J07A 5C81A 1R88A 3G9ZA 4BP9A 3LS2A 1Q84A 2B20A 1UKCA 3FLBA 1Y37A 4J0GA 3W2TA 5CXUA 1OILA 3VVMA 1A7UA 1UOQA 3HYSA 2PUHA 4B9EA 2QT9A 5AKXA 1XZCA 1QFMA 2XUIA 5HFAA 3BJRA 3C45A 4IO0A 3TRDA 4B7ZA 4DYHA 2ORYA 1XFDA 1VXOA 1QOZA 2PKYX 4KR0A 2QVBA 1YAJA 3QPAA 4PO3X 2CJPA 3BF7A 2PX6A 4GLBA 4J03A 3WWEA 3OC0A 2WSLA 3D3NA 4K6GA 4LYDA 3BXPA 2R11A 4G8CA 5LYYA 5A2GA 2CUTA 5ALQA 5IVKA 2XMRA 4X6YA 1CEXA 4HRYA 4HZGA 4NMWA 2GBCA 5AKIA 2I3ZA 4AO8A 2HM7A 5D6OA 5D7BA 1S8OA 4UBOA 4UUQA 1EVEA 5FKJA 3DL7A 3KDAA 2WIDA 3DNMA 4M0EA 1ZI6A 4MXDA 2Y6VA 2ZYSA 1D07A 5ALYA 1AZWA 3R41A 4C4YA 3V9AA 2HU8A 1DWQA 5FLKA 4E11A 5T4EA 1CUDA 1AURA 4HAIA 1PJAA 3AFIA 1UK8A 1J1IA 5DYTA 1MX5A 4ZRDA 3FVRA 4LXIA 1DINA 4B80A 4FDMA 4UBKA 4J7AA 2OPHA 1AGYA 2H7YA 2H9YA 3DCNA 1CQZA 4DLNA 1KEZA 4QWWA 1LLFA 1BE0A 3GA7A 4KJXA 2WHQA 2VSQA 2G5TA 5CBKA 4Y9SA 2I78A 3FOBA 1ODTC 2XLCA 3A70A 4QEKA 3FCYA 3O4IA 1FFCA 3Q8WA 4J0HA 4LHEA 4G8DA 3S8YA 3C6BA 5AM4A 5AOAA 4Q1VA 4RGYA 1MAAA 5DWDA 2Y2UA 1XRQA 4FBMA 3ANSA 3QMWA 5JZBA 4IH1A 1DWPA 3F8SA 4HS9A 5LKAA 2FJ0A 1DQYA 4PQEA 4BCDA 1W6RA 2ACEA 3W04A 3DS8A 2XMDA 1THTA 5IKXA 5EHNA 1CUYA 4C87A 3QITA 2QXUA 1QGED 1H23A 3KWJA 1XRPA 2WG2A 4JNCA 1AX9A 2ZJ7A 5C8VA 1VLQA 1VZ3A 2ZSIA 3BDVA 4L72A 3KXPA 5A62A 3JW8A 3WMRA 1EDDA 1HPLA 2PPLA 5CT9A 4KYVA 3VJKA 4XVCA 2C5GA 4FNMA 4WFJA 4EY5A 1XKLA 4AN0A 1BROA 3I2HA 3SX4A 4NZZA 2PBLA 4P9NA 1AUOA 5E4TA 4OU5A 5DYYA 5JZSA 2UZ0A 3FNBA 1MTZA 3G0IA 5EHQA 3ZLVA 4AN1A 5JIBA 2DR0A 4ZV7A 1CV2A 2PSEA 4JYPA 3EBLA 3DOHA 4K5QA 3M83A 4ZGBA 3WK6A 4C01A 3TJMA 3MGAA 4BTLA 3O9VA 4UFNA 2OQIA 1XQWA 1ZJ4A 4UBMA 3D2AA 3EIOA 1ACLA 5K3FA 4K6HA 4J3JA 5AI0A 2XUDA 4B9AA 3EF3A 1UT6A 1A88A 1Q0ZA 2GBIA 3IUNA 4K2AA 4Q3KA 4NS4A 3AUKA 3WI7A 1CIJA 4U2GA 3DEAA 1SC9A 3KD2A 5DNVA 1QO7A 1MX9A 3CCBA 2NW6A 4XWGA 1MT3A 1CLEA 3OOSA 3N0TA 5ALEA 4B83A 3G0GA 1L7AA 2PSHA 1ETHA 3DDUA 1GQRA 2VAXA 3H19A 1NX9A 2ACKA 3OPMA 1MPXA 2QTBA 3R3VA 4NVRA 4BDTA 1YAHA 5JD4A 5CT5A 4H18A 2XUKA 3WYNA 2PVSA 4GEGA 4BYMA 4QWMA 5AM5A 4L3WA 3ICVA 2VJBA 1RP1A 5AICA 3L1IA 3PI6A 1XQYA 3V1NA 1OCEA 2DFPA 1N5RA 4CIAA 4WY8A 3LIPA 4E46A 1E3QA 1BCSA 5ALWA 4HRXA 2JGMA 4IH9A 4L0CA 2XI4A 4FTWA 1P0IA 4X95A 3C5VA 1QLWA 5KBYA 3PDCA 1XZBA 5AI4A 1BS9A 4DSAA 1UZAA 3QM1A 1JKMA 4KE7A 1GT6A 3ZWQA 2XMSA 3H2GA 5JARA 4I4CA 3LP5A 5ALJA 4X3CA 2HA6A 2JGKA 1GPKA 2CZQA 1USWA 2VF2A 3AINA 3DOIA 3STUA 1KU6A 1XZAA 4Y2VA 3WQHA 4X92A 1WOMA 5FPPA 2LIPA 4M0FA 4OD0A 1DWOA 2DHEA 2H1IA 4AO6A 2WTMA 1G42A 2PU5A 4BZWA 5K3FB 2GBGA 2CBGA 5HK9A 3VXKA 5FOQA 5JAOA 5AKYA 1F0PA 5JASA 1LPBB 2VT6A 2ZYRA 1MX1A 5LZ4A 4OYLA 3T4UA 3FCXA 2HL6A 5ALSA 4OB6A 1YASA 5AJHA 4J0JA 3SC2A 3IUMA 4UBJA 1ZGCA 3C6YA 1ISPA 3FSGA 3WL6A 1WB5A 4KAAA 2IITA 4H7IA 4GW3A 4BVLA 1UK6A 4C89A 2PSJA 1CUJA 2HA4A 1ORVA 5C8XA 5FUMA 1MNQA 5C7YA 4X93A 1IUPA 3V1MA 1WB4A 5ALPA 3GZJA 1GPNA 5CT6A 4AO7A 4KEAA 4N8EA 5HK8A 1TCAA 4MEAA 2W6CX 2O2IA 5AP9A 3W9UA 3AIMA 3C87A 5CTAA 5AI9A 5ALOA 3B5EA 3OM8A 3I2FA 3JWEA 1IZ8A 3DQZA 4BVKA 4BRZA 3C43A 3I1YA 1CUUA 1RYYA 4EY4A 4OYYA 5AM3A 3F96A 4GDMA 3I2GA 4P93A 2WJ3A 1XQXA 2XDWA 1LNSA 2XUFA 2O7RA 4CG3A 1WM1A 1ZJ5A 4X00A 3G0CA 3UUEA 3E1GA 3U0VA 5HF9A 3AIKA 3KWFA 1P0PA 1VE7A 1XZEA 2BGRA 3D2BA 2C7BA 4FBLA 4H7DA 6YASA 1K6EA 2DSNA 4FLFA 4C4ZA 5AIBA 2AJLI 4JYMA 3QPCA 1EXWA 4P08A 3U1TA 1YCDA 5AKHA 4JH0A 5K3CA 4YX9A 3HABA 1FSSA 4JUIA 3G9XA 2GYWA 4UBNA 1KU0A 4LIPD 2XUHA 3EQ9A 2OG1A 4ITVA 1FFBA 1LPAB 4Y2RA 5JD6A 2ONCA 2XE4A 5HKBA 3ED1A 1H2WA 3G9TA 3H1BA 4ZWNA 4F0JA 2QJRA 1GXSA 4MYSA 1W4LA 5DTJA 1XZKA 2ROQA 2WHRA 5AK5A 4QZVA 3NGMA 5AOBA 2RHTA 2X76A 2WU3A 2VJDA 4AMYA 4J0IA 1ZD4A 1J06A 2RAUA 3ZI7A 1G66A 4WDRA 1L7RA 2GYUA 4IHAA 2HA5A 4ZXFA 1WCYA 4QDXA 4H7HA 2H7CA 1IMJA 3RARA 4FNGA 1AKNA 2BJHA 5T4HA 3BL8A 3G7NA 1TKRA 2DQZA 4UHDA 2QOEA
chains in the Genus database with same CATH superfamily
2PLAA 2QRMA 4RZHA 5EWLA 4Z0PA 5SV2A 2HQBA 2VCEA 1B26A 4DCPA 2ENWA 2B94A 2X86A 5KYYB 3H05A 4KIGA 3Q8MA 1KDTA 2Y0DA 3Q9NA 1JTEA 3KQKA 1MB2A 2QD2A 1BTOA 1XTZA 2PUTA 1JKJA 3M6IA 4JJ7A 4KNWA 3ZHZA 3U61B 2P9TA 5E1BA 4OHMA 3H1TA 1I2BA 1YQXA 2EHDA 2QQGA 4GICA 5JFTA 2E5FA 1T2CA 2HWXA 5A5VA 1XDDA 5BSWA 1O94A 2J1LA 2XJ4A 4FDAA 2BMFA 2WTUA 2RAPA 4EJSB 3UMBA 4WERA 2VHUA 2Q6LA 1LZKA 3AGQA 4BPRA 2J0UB 5GZ1A 1JTFA 2OVFA 1QWSA 4QNRA 2ZUUA 4N3BA 3HVKA 4FJ1A 5AXBA 1JDJA 1UJMA 3R3HA 4CHGA 3OQPA 4G81A 1DDOA 3V3KA 3BD8A 1RJ9A 4RLQA 3LCRA 5AW9A 2E21A 1TEZA 3BDIA 3QVJA 3HCWA 1W49A 1PQPA 1ZUNB 4LCEA 1GZUA 4G0VA 2QMOA 4PHGA 3VDXA 4LAFA 4HSEA 1K8XB 4B84A 3CNLA 4IDGA 2DERA 3WLFA 2CXPA 4CMHA 4B6PA 2W83A 3B7PA 1ML4A 3QW2A 3FBTA 1Q6ZA 1TZJA 3BXFA 3CLVA 1IJFA 1GFSA 4ZI5A 1WKBA 3M6VA 2QN8A 4Q48A 3JQQA 5CDUA 1RXVA 4OFZA 1Y4SA 2BFOA 1XG5A 3R3JA 3COPA 1K3FA 2RI1A 1R4AA 4RBNA 1K06A 5DF1A 3WLMA 3UN1A 2R1UA 4M89A 3L1VA 1ZKMA 3L8CA 1OFVA 3EG9B 3GD5A 2ZWOA 3CW8X 3QMVA 4TQ9A 2X0NA 3U3OA 1DKLA 4GL4A 3ZHCA 2IOYA 4FGSA 9ABPA 2FEOA 1SUPA 4CLXA 3LDFA 2GRAA 2KHZA 2CKMA 1I14A 3JYHA 4IQFA 4P7JA 4YJ3B 1EJBA 4AJ2A 1Y6ZA 5DW3A 1LWOA 5ENZA 2C3YA 4MHTA 4RHUA 3TQOA 3O47A 2XOXA 4C4TA 4IWNA 4PZAA 4IDOA 1Q50A 5EJ5A 4X20B 1G38A 1FS5A 5BW5A 3O5AA 3ZV3A 1G55A 1N6LA 1JEYA 3G82C 1JN0A 1EM8A 4MV4A 3ZHQA 1Q95A 3R0JA 4LPKA 1F0YA 1CY6A 1CQWA 1DJPA 3QU7A 4DCMA 1GG2A 2OE2A 5B7PA 1XVLA 2J6BA 1OWMA 4ZVLA 4NQRA 3OIDA 4OHYA 4W1PA 1CDEA 5DCYA 3PF9A 4KYTA 3WHPA 1F6DA 2OY0A 5CDYA 4OQZA 2JAQA 1GGHA 1Y63A 1LRKA 4BLUA 4V1CB 1RQNA 1XD2B 2EFYA 2GPAA 4MR7B 5JZVA 1X7YA 4DMRA 5LMUB 3P4YA 1T0UA 2REQB 1MZPA 2ZJZA 1WUHS 2W70A 1I7NA 5KOHB 1Y34E 2NU9A 4TS4A 5HMMA 2ODWA 3K5IA 3RGWS 4PWZA 1UT8A 4PPNA 4WA8A 3VR1A 2C7OA 2BFDA 1PNRA 2LDBA 2G07A 3PTLA 2HXYA 4CUJA 4DEXA 1A7KA 1MG5A 3G23A 1G5RA 3KFVA 4BQPA 2B1IA 4F46A 1JR3D 1GNLA 1E5VA 3HU1A 5BT9A 5U1PA 4BECA 1IIRA 3BSFA 4ZCPA 2B1QA 2O7VA 2Z5LA 1E4OA 1U0SY 4CL2A 2NXCA 5I6DA 5EN4A 3TOVA 1G5PA 3ZGLA 1AQIA 1O94C 1KVTA 2WA2A 5EP4A 4AP6A 1RPNA 4X1YB 5DX1A 5FBVB 5KSZA 2C77A 4D4MA 3EZ7A 5DM70 1SUAA 2GN6A 4MPTA 4GXQA 5JXJA 1P5JA 2FZWA 1IEWA 3TNYA 4A6XA 1KFEB 3FF1A 2YFQA 3KU4A 4KLAA 4TSFA 1UZLA 4OHUA 4RM3A 5JCOA 2H4XA 2NLOA 3WK7A 2GZMA 3GJ7A 1M1NA 1L1FA 3JRWA 4CUKA 5IRCD 1ZNYA 4ZVQA 3FVTA 3OZDA 3HGMA 3TTXA 2PGJA 2O3TA 4IDEA 4U8GA 4M36A 3RS0A 3R3ZA 1K68A 3OM0A 1A4XA 4GX0A 5EIOA 3KETA 1RMTA 2YV4A 3B3QA 2BCGY 2IEBA 1TUIA 3S27A 4HH1A 1I1HA 2CDBA 4IJWA 1M6VA 2WUVA 4N39A 2CT8A 1I1OA 1K8RA 1OXVA 3NTQA 3A06A 3O1LA 4HI0E 2XUOA 4EGJA 1BJRE 3JASB 4RA9B 3NXKA 1LNZA 4PSKA 1JSCA 4F1JA 2CSXA 3SIXA 3IUSA 1USIA 1A8HA 3VU1A 4Q9HA 2QV0A 3VR4H 1P62B 3IMKA 3ZQUA 1I3KA 1JYEA 3WHIA 1OB5A 3WLQA 3TRHA 1BCRB 5MN5A 1GA4A 5T64A 2XXJA 5K3DA 3RSHA 1QZXA 4N0EA 4HDRA 4RABA 5C46F 3U16A 3KUCA 1JQ5A 2HU2A 1N0WA 3C5WP 2H8GA 2YHUA 3FSRA 3JD4A 3L1UA 3L2OB 3NWPA 1V1MA 1LZLA 2JJMA 2GM9A 3AEUB 1E6UA 2SBTA 1GL3A 1WEHA 3TSCA 1WCXA 3ZHRA 5HZHA 3RSZA 3QYPA 4HNHA 3CPHA 3KUKA 3H84A 3PHJA 2IV2X 4X91A 1NHGA 2LP4Y 4H4DA 1T2VA 2AJ8A 4B45A 3TF5A 2ZBEA 3N0VA 2JFOA 3CUTA 4RM2A 3VBEA 4UDYX 5GAJA 1C1YA 3Q7QA 1LPNA 4QFDA 4RLHA 2ZJ2A 1Z4IA 3QE0A 2O8DA 3AFNA 1U2TA 3LMKA 5ICGA 5DNUA 1YRHA 3IAEA 5E38A 1DO2A 1KBOA 3FLAA 1HKUA 4GM0A 1EM6A 3WSVA 3NPMA 4TZTA 2O8VA 1N8SA 1Z7YA 2Y4OA 2XTZA 1Q19A 1D4ZA 2VNHA 3T0IA 1ZN8A 1R0LA 1LLUA 5G0TA 2O06A 2JARA 4UJ3A 5KWJA 3TUJC 5EE1A 2BMDA 1BE6A 5K3SA 4HFRA 3TG8A 1NJSA 2A0YA 1EFDN 5CURA 1GCIA 2K2QB 5C8YF 1EIZA 1GA6A 4WEOA 1HI9A 1JB9A 1ZUIA 1VE1A 2RHRA 4LQCA 3X1KA 1HG0A 1U0NA 2HLDD 3FY4A 4GPBA 4HWRA 4MVYA 1ECPA 3O2SB 2R86A 3TLXA 4KQCA 1O95C 2Q9UA 3AV3A 3LDHA 4HAVA 2AXEA 1UANA 5A03A 3A6HA 4OVKA 2PYIA 4Y2XA 4MRMA 2R8OA 2VH2A 2JJ2A 3K8YA 4L9WA 3UKDA 2ISQA 3OOWA 2X9GA 5H8WA 2CWWA 4NDNE 1NUUA 4O2AA 4PVDA 3O8NA 1M34B 4ID9A 1GTMA 4QDOA 4BNVA 3Q6MA 4TX1A 5SYAA 1M2VB 2GD2A 2QLJA 2Y1GA 3NHYA 5JCOC 1NF8A 1YHZA 1JJVA 5EJ2A 1YU9A 4ARAA 1X1RA 1Z0SA 2Q1YA 5CEJA 3NKFA 4MCHA 1T2AA 4MSUA 4IPTA 4KR9A 5L6LB 2E6UX 2BFWA 3OWHA 2YV5A 1RWOA 4I1RA 5EJAA 3RYIA 1SN7A 3E9CA 1ZM3A 1PJCA 2I4LA 3ZYCA 1VPWA 1MIOB 3MJRA 1K66A 2ADFA 4QELA 4HTAA 4DBVO 2E6KA 1UXGA 2HO5A 3TEJA 1VLJA 4MTCA 4LYYA 5KEIA 3O91A 4EB0A 4G4SO 1XN1A 1R0RE 2A5DA 5E9AA 3NGXA 3QVGA 5JPCA 5I4CA 5F5XA 1EE2A 2IEDA 2QXTA 4D9IA 2YY5A 4HLDA 1D2AA 3WKBA 4BLWA 3EVDA 1ZAYA 1SHLA 2ZSBA 4QBFA 1NPDA 3ORSA 4AY3A 4GOLD 2GZAA 1HL3A 1K6MA 2QL9A 2FP4A 1F4PA 2JCGA 3EXIB 3H7IA 2G6TA 1P29A 1R10A 4WXEA 3VJMA 1GZ4A 1XDUA 1U0TA 4E51A 2NSJA 1LFAA 4EPVA 1E2KA 3RJMA 2VJQA 4J4BA 2EFCB 4TL6A 3AP1A 5G53C 2R6R1 3D1VA 4DR4B 1C1HA 1XXHB 2G76A 3PT9A 5KTYA 4ZHQB 1P60A 1TYBE 1ULTA 2YWHA 1AF7A 2PE5A 3EODA 2YXDA 1OOEA 2JGAA 4GIBA 2HOQA 3BQNB 4H31A 4QOEA 1HMPA 1L4UA 2VHXA 3IYLW 4MA4A 5AMXA 1XWFA 4M88A 1F7UA 2CHEA 1VSBA 4FYHA 4B31A 5KKCA 4KH0A 3QTLA 1YGYA 2INGX 4UNPA 1SQ0A 1DXYA 4R0NA 1IAQA 3GZTB 5D3KA 2FSFA 5LZ9A 3ZLUA 4L4UA 3K0SA 2F8TA 1WPXA 4B3GA 2UUBB 1DU4A 3O31A 2CF5A 3NT2A 1PG5A 1CK4A 5DW0A 5KTMA 4IIGA 4S1NA 3I4FA 2C7RA 2VWHA 2HRRA 5KWVA 5FOUA 3B6ZA 2C8KA 1GSIA 3LDAA 2Y6UA 2G9UA 4OREX 3WYAA 2NN3C 4QLBA 3QIVA 3QF7A 2B7LA 2MSKA 3H2KA 4GBJA 4M1YA 4RF3A 2QR2A 1HOTA 3DG9A 3A6KA 1G59A 4GMHA 2GYVA 4FWBA 1XMOB 1LTKA 3G6WA 5TNXA 2BM1A 4LCBA 4Q47A 1X8LA 2H52A 4RPLA 4QYIB 4UNRA 5B36A 4BFVA 1LQTA 2A1TR 2HIMA 3SLKA 3D7MA 1QK5A 1U4NA 4LNHA 4F9GA 2KB0A 2OCKA 1FQJA 3QHPA 2EZ9A 4D74A 5JSZA 4UUOA 1ACMA 4UZSA 3LI2A 1AJEA 3HMQA 1TZCA 2G9RA 4OK3A 2XCSB 4Q12A 1RM3A 3LU1A 3TINA 3K9NA 5KJ1A 1H2RS 4GQIA 3VNVA 2BEUA 1C4XA 1JG6A 5AVKA 1WDKA 3NPAA 2ZJ6A 5E7QA 3RW9A 4Q0MA 3UWKA 4A15A 4FCTA 4YRQA 1GGMA 3SEAA 1USUA 3WOHA 4QTZA 2P2LA 5ILQA 2GTIA 1J7KA 3IP7A 1L1QA 4O63O 3I53A 4C78A 4E5VA 1I4WA 2W6MA 1VMAA 4PTZA 4YJHA 2QLLA 5ENDA 3HG7A 3CT4A 2NZYA 5H83A 3VPGA 4QEZA 2FXVA 4DS3A 1HH4A 5IBQA 3FUTA 4YUAA 3PIIA 3RHZA 1GTVA 2XY4A 3CNHA 1TPZA 1ZXLA 2WB4A 3TTYA 3IQEA 2C5LA 4PLHA 4CEIB 3RUEA 1XXLA 2OD9A 1A8IA 1G5QA 1J0XO 1ZIXA 1SBHA 3M82A 3K3PA 4YPVA 3RRFA 4XA8A 3UMSA 5JWRA 1E94E 4DWOA 5BQXA 4HF7A 3G2NA 1G7RA 4A5SA 4H08A 4HSGA 2WD9A 2B0JA 3SIRA 4AS2A 2XGOA 2GJKA 1FTNA 1PAUA 1PN3A 1G3UA 1DEOA 2NU7A 3FZYA 3P4UA 5EZSA 5IVDA 4EBBA 4G1VA 5KHAA 2PZAA 3CJTA 4CM1A 1M0WA 3Q40A 4NOJA 3EC7A 2I9PA 3AUAA 3EA0A 3K70D 4TN5A 1N8NA 5DX8A 1B1CA 4QPNA 2EGUA 2JH3A 3UAWA 3ZBQA 4CR8A 1MQAA 4D9MA 1ZI8A 4HATA 1G4UR 1H22A 1M1YB 1CUSA 3M49A 2FK7A 3PE3A 4IXNA 4RV9A 3TM5A 4BO6A 3K71B 1F51E 4FFDA 5J43A 3AJ8A 1X9GA 2HYIC 1T36B 2XSZD 3M2TA 4EB8A 1A8UA 4HFMA 3UW1A 1R9NA 3IR7A 1SVUA 4D8XA 2G40A 1JJAA 4F4JA 4Z7OB 3MINA 4XSGA 4D4GA 1P9RA 5CYOA 3ZE9A 1DBRA 3G8CA 1XZJA 3NP7A 1KI2A 5ICFA 1MOZA 1OLXA 4XCQA 1R9JA 1GUAA 3EDMA 5B1YA 1M74A 1QUFA 1V11A 3QUAA 1BX1A 4NV1A 2QUAA 5AI5A 4KP7A 4N0DA 1YDWA 4QC2A 2XB6A 1KSGA 3DWGA 2DPGA 3IUPA 2BR4A 4Q9LA 5DTIA 1UM9B 2GX6A 4BMNA 2WUGA 3OBIA 1QO0A 1UPXA 3N86A 3ZNNA 4YLYA 3VZPA 3F6YA 1XZIA 3ICWA 4Y3UA 1KF0A 3V2HA 4A1FA 3T41A 3T38A 3CVVA 4Q4DA 4MO2A 1WZ2A 2AUTA 2AI1A 2CD7A 2CVFA 4BVFA 4YMHA 5IUJC 4Q4CA 3SY8A 3S1LA 3DOJA 4QVIA 1IVYA 1GAWA 2X8WA 4HBZA 4HN9A 1Z35A 4MI3A 3DPIA 4MUJA 4EJ0A 1Q0TA 4D4LA 2Z1DA 5EWJA 4WJLA 2CXUA 1Z2EA 3AUSA 3CC8A 3F5FA 3TKLA 4XRGA 3HZOA 1QIKA 4P54A 3ZC3A 4KQHA 4P1ZA 2ZAIA 2I1VB 3IHTA 1A9YA 1K2VN 3UY4A 4Y0NA 2W8ZA 4KE6A 5J5AA 3P9ZA 2WJGA 4HNAA 4B33A 2ZBDA 2IBSA 5EYPA 3MWGA 1K5HA 2WTBA 1T35A 2CL6X 2WD7A 4Z9XA 1GFIA 1CG6A 2DSTA 2VNSA 3GPIA 1TAHA 3DB2A 3RI3A 3DHNA 2AOUB 3PDIA 5IYZA 2WUEA 1SXHA 2HJRA 3E2MA 3OFVA 2V45A 3W1WA 3B1FA 5KTRA 1MBZA 1ZGGA 1NN3A 3IDSA 4LY3A 1DI0A 4N01A 3BCRA 2JI7A 2EBUA 3FROA 3OX4A 4FBGA 5EEHA 5UKDA 3RFTA 1DLIA 3IAUA 2E7ZA 5EMNA 3JYQA 1P91A 1YB4A 4Q3OA 1GV0A 2B5WA 1Y9JA 2DT8A 2W2LA 2QN1A 4RA6A 5CXXA 4FX5A 1II0A 3I6IA 5F78A 2Q6KA 4BFCA 4L5YA 1ONBA 1Q0RA 2ERXA 1AKEA 1PGPA 1Q11A 2VBGA 2XWBF 2P90A 3HP4A 3EGOA 3MZ0A 3QE4A 2C00A 1AXRA 2WF6A 3KUXA 4WT7A 3W90A 3U9LA 4H0FA 5KNCH 3L7NA 1KQOA 3ZU6A 3IAS1 1TD9A 4HS4A 3H2JA 2GZDA 1UDWA 4FXPA 4F2GA 5K6AA 1VI2A 1QGUB 4M7WA 1WB6A 5K0BA 3GXOA 4HBGA 1NI4A 1IBMB 3ROTA 2OCLA 4QG7A 2RE8A 1T4MA 3HA3A 3TD6A 3AI2A 3EJ6A 5DBIA 3Q7TA 4MI6A 1EFRA 1N6KA 2OHFA 1DEAA 4I1VA 3EFOB 2PH5A 1G0NA 4FYKA 3ZHOA 4D43A 3UW3A 1GLGA 1G2IA 2ZJOA 3BREA 5KSYA 1BD4A 1TAQA 4DMGA 3WRVA 3U7HB 1JLLB 2G67A 3LX4A 5FUWA 1Z73A 3ND6A 5HUJA 1NFFA 2RFLA 2C94A 4M49A 4OXRA 4UVEA 3PT5A 3R7SA 1FDVA 2YMMA 5LZ2A 4B3RB 3KU1A 1P3Y1 4PZYA 1EP2B 1Z16A 3WGKA 1PEAA 4DSZA 3B53X 2PQMA 4AZ3A 1MOSA 4DCVA 4U7TB 4M55A 1HYEA 1H9AA 2BC9A 3G2LA 1FNMA 3UHFA 4CDNA 4MHOA 2B4KA 3VYUB 2PQ2A 1WBDA 4JC8A 2J5KA 2YUTA 3NIDB 4WK4B 4RDXA 1Z22A 2NO6A 3E3LA 1Q0PA 3P2KA 3IQXA 5ICSA 2VTBB 5CNJA 1GAEO 4B4VA 1SXJE 3IUJA 4ITUA 3PQ8A 3W8EA 4NFYA 4DDHA 1CUXA 1E62A 3L7BA 1XRNA 3RK0A 2P8JA 4EG0A 4DV6B 2C3PA 2EW8A 3JQGA 5TQ0A 1UQTA 3SDBA 3ZLJA 1OH8A 2PMDA 2OHVA 1HX7A 2K4MA 2ZDGA 3BWXA 3EVAA 4KE9A 1OV4A 2Y0EA 4L75A 4YRFA 1Y6FA 2UUAB 3UANA 4TSRA 1GRCA 2EP8A 4F21A 2ETVA 3V8EA 3FDFA 3GLHB 2GTPA 1BDJA 3IMEA 1U0RA 3AWIA 2CUNA 2W2KB 2H4JA 3VX4A 1C9KA 1W581 3N0RA 2I67A 4WKNA 4MYCA 3PUJA 4CHTA 5F9MA 4C3UA 3W5IA 1WHSB 3GP3A 3R20A 5TF0A 2BGKA 3ZQKA 2P68A 2A9PA 5I51A 1W88B 4AWBA 1SRQA 5J58A 1FJ2A 3VNQA 2DG2A 1I36A 3GC6A 1GILA 1GZ7A 1RQ2A 2UAGA 5DFAA 5H70A 2VQ6A 1PR5A 4RFSB 2R3SA 1RCTE 1FU7A 3DE3X 3BEDA 1E0DA 1NVBA 3GQVA 4B8ZA 4I1PA 3W34A 3W2GA 4ANFA 4RV4A 4PFKA 2OYRA 1IWOA 4CCWA 1JMKC 3WY9A 1CETA 4E08A 1I10A 1AN9A 4C7MA 1HV8A 4H9GA 4O2BB 4B74A 2NSLA 3V4PB 3W3AD 1T1SA 2PZKA 4YRAA 3M81A 1KS2A 2F8MA 3ZGXA 1QYRA 4Q7MB 4EUNA 1EX9A 2AN1A 3LGSA 3PFFA 5CB4A 4CLEA 1T0HB 1UODA 3FZEA 4OHWA 3AWDA 1BZYA 1BRMA 1E66A 2XUJA 3WDLA 4YCCA 2XBMA 1Z12A 3EIXA 2KI5A 3CNEA 4MQFB 4EHAA 1Q0HA 1U99A 4G3XA 4BE9A 1LEHA 2OFFA 5FOTA 4FFVA 4HDKA 1XZHA 1WTAA 2HU5A 1OGJA 5K6AC 3W6OA 2CLIB 5CFZA 3BHIA 1IHOA 4OV6B 4Y2TA 3L41A 4UD6A 4WHMA 4QPPA 4M9SA 2UUPA 4PYNA 4DMFA 4EI2A 1ZCBA 1X13A 3AZQA 4IVQA 3LLSA 1GCAA 1F8YA 4KXWA 2F3SA 3SVTA 1JKFA 2YL2A 3RUPA 4CLHA 4P38A 2I5PO 4TWRA 1JHYA 1T5BA 4OXQA 4A03A 2DPMA 3R3YA 2HMVA 3PE6A 3GA5A 3SHOA 1I5OA 1RXCA 3GOQA 4DMCA 5ALVA 1U3WA 3Q85A 3KZNA 5HZGA 5LLSA 4TWZA 3DLCA 2N42A 1UMKA 1HLDA 1P3DA 1FCJA 3CRNA 2WG1A 1L9XA 3JVVA 4IOLA 5KSOA 4EI7A 5HS4A 1LF0A 3N2NA 4XWWA 2GN4A 4Q1BA 5K6RA 3KFXA 3DV0B 1SXJD 2GAAA 2XHEA 1KSHA 3QHQA 2V7UA 3UUGA 2ZBRA 2EKBA 2HRCA 3NBYC 4FOLA 5AI6A 3A7EA 3FBGA 1W0KD 4LFBB 1V9SA 3N2ZB 2AXQA 1U3FA 3NHZA 3OA2A 2I65A 3R4VA 4M8SA 5BQFA 1QDEA 3HM2A 4R83A 1BU8A 1R9GA 3L0SA 1GDDA 1EDZA 4FS3A 4LOJA 4LS3A 4JLJA 4F5ZA 5ECYA 3I1IA 3KK0A 3KKZA 3O03A 1TM7E 4FDTA 1PYDA 4BEBA 1Y80A 4XYEA 1FVFA 4L2IA 4N9QA 1XZMA 4ZT4A 2QYOA 2CNOA 2Z1NA 1SHTX 4HV4A 2BGGA 5JZMA 4EMUA 1A1VA 4LDZA 3KVOA 1MPTA 2Q1SA 5I7EA 2ZE8A 4REOA 5ADHA 1XTIA 2GRUA 3KJIA 4JAVC 1H8ED 1TT5B 3L46A 3WX0A 4F5DA 2CV2A 5DLPA 3Q7IA 1MD9A 1S9DA 1Q83A 4CFYA 4PG4A 2ZE6A 3UBTA 4IJQA 2N75A 1N32B 1PR2A 2QUBA 3HN7A 1Z5NA 2I3GA 3AHEA 1R4MB 3T54A 2BFEB 4FZ5A 2DWUA 1GNVA 2YTZA 1ZINA 2QZ9A 5HRUA 4B8YA 4C7JA 3RAGA 2QLBA 2PUVA 1SKAA 4R6WA 5BUZA 1TMYA 2RIRA 4GP6A 2RJOA 3L7YA 4FYMA 1ARZA 3T61A 2IS1A 1ETUA 3K31A 4R16A 1IJBA 1ZIYA 5K9ZA 2VK1A 4NENB 3VFDA 3KOUA 2PUCA 5IDYA 2FHSA 5CGZA 2VYVD 1QIFA 3SQXA 4DV2B 2XZDA 3ERCA 1CUHA 4DLKA 4ZAYA 4YMLA 1TQ2A 3GVXA 3VBCA 1ZNXA 4RVHA 3FWHA 4BLRA 2D1YA 5H5JA 2ZB2A 3HRIA 4AF6A 3T1OA 3VAAA 3R3UA 4A9AA 5BUQA 1VCHA 4IRMA 3DDNA 1WCWA 2RHCA 1KZ7B 2OAP1 4UEQA 3TL2A 1JG2A 4DA7A 1L7XA 5FUVA 2Z83A 4BNIA 1GL6A 2WFAA 2FN4A 3M1LA 4NSNA 1BVYF 4S2UA 3TQFA 5AHXA 3G0DA 3GGCA 3PQ2A 1SPXA 4QYWA 1O96B 1CJBA 1Q1BA 3A0RB 5EFZA 5E1MA 5EY5B 1JBEA 3UMVA 2H00A 1EBUA 4CI0B 2OBXA 3DF7A 2QVGA 3HL0A 4XX0A 1XMSA 3C8DA 4Q9KA 4C2UA 2AHOA 1X1CA 1QKJA 2I4TA 3PSHA 5LNK1 2DHDA 3GELA 4WFIA 1K89A 5J1TB 1H1TA 4PLWA 3QF4B 2Q7DA 4IFEA 5CLIA 2VJAA 2C84A 1SOVA 4PR0A 1NMQA 1BHO1 1ZCAA 1AKMA 4K9DA 3IULA 3ROFA 3EWIA 2O2EA 2WJZB 3KAKA 4NBUA 3RC9A 3EISA 1F4VA 4NYMR 4RGBA 5THQA 3TLZA 5F12A 2BAGA 4QGHA 1OLSA 3UK6A 1KEUA 1JNXX 2YZ2A 5AJTA 5KQMA 2RHMA 4NEGA 1F2UA 2O9JA 1BRTA 2C42A 4QLAA 4F8JA 2J6CA 3N87A 1JA0A 3P9PA 4MKZA 4K6CA 5B4TA 1PGJA 1PLKA 1LVGA 1HXHA 2FCRA 2GWRA 2HCRA 1UDBA 1Z0UA 3CZRA 3PKZA 2VTVA 3KLBA 3LZCA 5E95A 1FZQA 4QRIA 3PPWA 4Z49A 2QS9A 2IW1A 4LYHA 1LLCA 2B25A 2I55A 3W5VA 2IYNA 2VF4X 1MVNA 4JVLA 4M99A 4KNVA 2IIVA 3SJBA 2W98A 5JJ5A 1Z8NA 3KQVA 2PO7A 3PCXA 1NUQA 4XSHA 5HFNA 4C5CA 1SOMA 2VNJA 3HC7A 1KQPA 3SXUB 2WUFA 4F4DA 1DQZA 1Y5NA 6REQA 4PG6A 2VK2A 3LLUA 2XNKA 3UIEA 1ZMRA 3H1PA 1JMVA 4GM4A 4QTTB 4YDHB 1LLQA 2JNWA 3Q3CA 2Q0QA 2VJOA 2AMJA 4R0VA 1EK1A 2VVTA 2I7CA 5H9WA 2G9VA 4R2XA 3RAEC 1SURA 5BSMA 4B73A 1VKNA 3ZHYA 3RADC 3LAWA 4L28A 1S4QA 1PHRA 3TD2A 2QE7A 1CR6A 1QCCA 3INRA 4FFSA 2PZBA 4TWAA 4CV2A 3AM1A 2W93A 4EHDA 4XJVA 4CCYB 3ZJUA 5HOEA 2R25B 4UBIA 1TYAE 3FTCA 3VC7A 1RCUA 3U44A 4EG4A 1U0FA 2Z5FA 2WJ4A 5H68A 1CUWA 1ZMBA 3U3DA 2OD2A 3H87A 4EF6A 4RXMA 3HJAA 3Q3HA 1NXXA 3D6NB 3DEFA 1KO7A 3MERA 4LGCA 1NBMD 2DULA 1JDUA 3L6OO 1ICEA 3M5CA 3WDKA 3N76A 4GD3Q 4YQEA 3VM6A 4O5OA 2V6GA 2VSOA 2W11A 3QFRA 2XHZA 1X80B 1PYOA 4YJ2F 2CZGA 3DOCA 1AB6A 1TZKA 4EZIA 4JMPA 4TZ6A 1YL7A 3RTGA 1FSGA 1UBCA 1IQRA 1WR8A 5ALHA 1P74A 2FF7A 5CX1A 4OFXA 3RVJA 1GGEA 1YIDA 1W35A 1T5DX 1E99A 1K6IA 3ABZA 2FOIA 2FPWA 3WJAA 2CL7X 3IDAA 4KQGA 1WXHA 1E7YA 1LPSA 1QMGA 1XTJA 5FTKA 3B3AA 3EW7A 4AJEA 3EIWA 4G41A 3MWJA 2FFBA 3LWNA 3P9IA 1R3DA 4FHFA 4MEBA 5KYWA 1D2HA 1ABEA 3WGQA 5E9WA 4R81A 3FF4A 4ITRC 4TUYB 4B3TB 4DUZB 1A4UA 1CQIA 4LOKA 5A71A 4ODIA 3DE0X 4DJTA 5C1OA 1NQVA 4AXXA 2VFAA 1ORIA 2A3NA 3OZTA 4KXXA 2JEYA 3SHVA 2OXRA 2HW8A 1VFNA 3FPKA 4GKJB 4Y1RA 1PT5A 2DC1A 3SJ7A 1XZDA 2DQYA 5KQPA 3V7WA 5JAPA 3HVIA 2D0DA 1PS8A 4K87A 1SBCA 1FUUA 1RYHA 1WQ4A 3IDZA 5ALUA 1K2WA 5EE9A 4AULA 1QU2A 3H1FA 3QIAA 4UDNA 1L6IA 1Q21A 4DIUA 3DA8A 3QV1A 1FSFA 1C4WA 2MSLA 1HE5A 3IBTA 3ED5A 2OFWA 2VF5X 3GUVA 1BNCA 1DC7A 1PT6A 2P4UA 2W37A 4DJJA 5FQNA 2PFKA 2VNKA 2Y1EA 3EDCA 1E1RA 4I4IA 4UU7A 3VTFA 2AH5A 1OROA 3IAM6 2YVKA 5LXTB 4REQB 2YMPA 1Y7LA 4LE0A 1Z7WA 1D1PA 1E3WB 5AVTA 1NONA 1N4DA 3AP2A 2C2ZA 1DCFA 4IV5A 1U1CA 4W99A 5DEOA 4QT0A 2FSVA 2PKRA 3W5DA 4GI1A 3FKJA 3S7ZA 5TARA 3R6DA 2H54A 1GGVA 3GIDA 1FC0A 3R5JA 5CDTA 1ECJA 1MFZA 1FUIA 1MO4A 2X2PA 2JFFA 4U7WA 1S2OA 5B58C 3VPSA 2XUPA 3R76A 2EX1A 2XNCA 1A5AB 3U0BA 2WFLA 1N1GA 1J5PA 2OZEA 3I9NA 1I9CA 3OE4A 4RD4A 1JDBB 5IJXA 4D56A 4PZEA 3JARB 1E6EA 3RUDA 5L3VA 1DT5A 1IXYA 2EG9A 1MP0A 1YJBA 4FMBB 4C7OA 5EIFA 3F7TA 3RG2A 5EMJA 3LY5A 1EI9A 4FD2A 4N03A 1JR2A 1B6GA 1Y1LA 1JFFA 1Q77A 2X42A 3G02A 4IWXA 4EPRA 4CN8A 5B4UA 2RDMA 2XOEA 5AI8A 4ZYWA 4K9KA 1GVNB 1SCUB 4O4JB 4JSTA 4H77A 1N2IA 3X0DA 2Z2ZA 4G4SP 2QW8A 4U4AA 5K3OA 2JCVA 1I5EA 2CBXA 1ECCA 1P3JA 1NUSA 2H4YA 4IR7A 2IPAB 3LA6A 4E70A 3F9RA 3PQ3A 4GKAA 2DCMA 2I2AA 4HPJB 4L74A 3CRW1 1VP3A 4V0OA 4YREA 2PD6A 1KA9H 3H9UA 3MPOA 1XD8A 4J0KA 2ZI5A 4XVHA 5F5NA 3PHBE 4LJ9A 3DR3A 3TLGB 2HSGA 4EVRA 1JQAA 2OTCA 2JIZA 2F00A 2F8LA 2J32A 1GQYA 2ECQA 2GR9A 2IOFK 4EJ6A 3WYCA 1V6CA 1KI9A 2A86A 1Q7RA 2CEKA 3AERB 2GDJA 4MAAA 2PCLA 3QJGA 4PCLA 4ZV4A 4U6NA 4BNUA 1A9XA 3IKMB 2DCUA 4JT8A 4B4UA 4ZPJA 5KQSA 2QQEA 4DRZA 2HEGA 4CV3A 5HF5A 1E4EB 1QTNA 1C80A 1WMSA 3HCBA 4JKYA 4KN6A 4P3KA 4I6EA 3SS8A 5JJCA 2X4DA 3IERA 2OYSA 3A6PC 3LP6A 1IOZA 1JJBA 2Q3JA 2Y2VA 5KX5B 2QMEA 1T6BY 2K6GA 3NHUA 4FCVA 2IZOA 4LI3X 2O4UX 4YVFA 1QDLB 1CDZA 1TVKA 3EXHA 4WIAA 4X8HA 3KKKA 1EU1A 1GARA 1THGA 4Y0AA 2DP4E 3O8BA 1QPBA 1U7UA 3C8MA 2YZNA 4J29A 3SE7A 1XU9A 4AU1A 4CG1A 5L53A 3WNDA 1AF4A 2F1JA 4OXNA 3K32A 3DPSA 1DX4A 2I1LA 2CW5A 3AEQA 3IVMA 3PS9A 3QNUA 4GGPA 3GFTA 4JLDA 5BV2P 3B9PA 1BDHA 2VLBA 1SXJB 3IALA 1K5GA 2IHNA 3ZWYA 3AVOA 2FSVC 4Q19A 2X8JA 1U90A 2D7CA 1KARA 2Z6UA 1VBFA 1OI4A 3P5SA 1CJKC 3OJLA 3RFUA 1B41A 4P35A 1GYQA 2XMBA 5KQGA 1XI2A 2ZYHA 2ZKLA 4WVFA 4PZZA 4KGXA 2ZRNA 2D2VA 4ZV9A 5GJCA 2CXQA 3NV7A 4XFDA 4QNNA 3DMDA 3VTKA 1NV9A 1G8PA 2FPIB 5E9QA 4AJJA 4FFLA 3PUWA 2PGIA 3M5DA 3L07A 4R8SA 1NMEA 4EDHA 5K0JA 1NZFA 1P5RA 3WA7A 4EG7A 2EYQA 3GFRA 4QLOA 3AVQA 2O2SA 2BM0A 1BWQA 5DGIA 5AO9A 1YZLA 1YR3A 2OL4A 3LYLA 4AKHA 3C3AA 3N6RA 5FP0A 1YDGA 1FE8A 5DM0A 4QRHA 3OI7A 1RFLA 3DXXA 3QUQA 3BH6A 1A50B 4NZPA 2WYOA 1R6UA 4LJRA 1CB0A 4FFBB 4RPIA 1QP4A 3SGLA 3QVSA 2HSWA 1E0AA 1D1SA 1PCXA 2JK0A 1KEKA 3MG9A 2ARKA 1DX9A 1Y3CE 4MA0A 5JZ9A 3DO8A 5AM0A 5J5VA 3SZOA 3CS3A 1VMIA 3HXTA 3QEJA 4KV7A 3KEMA 3SK0A 4ETWA 1QTQA 2O3SA 1IXRC 1XJWA 1W85A 3BERA 3DLTA 4P7KA 2BY4A 4UNQA 4CDRA 4E03A 3U4QA 4XJXA 2HMYB 3CW9A 3LNCA 4PTYA 1KAOA 4ERNA 1T4CB 2XXAB 2V7XA 2HUNA 5HP4A 2IW3A 1JYSA 4HUQB 2JIRA 3BWBA 4MRRA 1BFDA 2X0RA 1NLUA 4V0MA 2X2FA 3CE9A 5BXYA 8OHMA 3WICA 5FL3A 3HVUA 2ICAA 3HI4A 2ZJYA 4G9EA 1X7XB 3SDSA 4RJJA 4EITA 5K05A 3FOAA 3HB9A 1A77A 3R3XA 4MROA 5GQSA 3WJ7A 1VA5A 2GLUA 3S2EA 1UMCB 3UK1A 4PSDA 4EP1A 4TLDA 3EEOA 3I9KA 4YDQA 1Z5ZA 1M76A 2P9FA 2QTRA 3Q3JB 5IC6A 3WNBA 5JECA 1E2FA 3OLXA 4P4UA 1V5WA 4Y2PA 3VH2A 1L4EA 4OSEA 1C7EA 2NYRA 1RLUA 2HMWA 2OHIA 3FRHA 4DVGA 4BWGA 5FA6A 4XD7D 4ZK2A 5J3JA 5LWHA 1NDUA 3EXHC 4MKIA 5CLHA 4MUXA 5LQMA 4CLRA 1GTZA 2OFXA 4ZDWA 1V3UA 4D57A 2Q4TA 1JXAA 3RIMA 3CG0A 5HWSA 1UH5A 4KRYA 1BMTA 3N2KA 3ESQA 2QN2A 3RD5A 3PEVA 3FPEA 4MVWA 4US2R 1XHEA 2W6PA 1UDXA 3E9QA 4GHWA 3DBRB 3P9KA 2O2HA 5A5FA 3E61A 3X1YA 1U98A 1DWUA 4DBLC 3S68A 1SAYA 4HADA 1DSSG 4LGMA 1W47A 3RBXA 3IVCA 4MWZA 4ND7A 5DBFA 5BOSB 4H4CA 1JJIA 1ZX1A 1MJ5A 2AN3A 2FW8A 1JAXA 5EMHA 2EKZA 3PL1A 3PXXA 5FI1B 5IBRA 3W2HA 5TVGA 2RHLA 1L7EA 3ACDA 4QL3A 3H0CA 3DL2A 4RTMA 1GDTA 2EKLA 5KDDA 4OQLA 3RAFC 3ROXA 2DFNA 3TXAA 4HLUA 3RU9A 1LV8A 2PA0A 3H1AA 4OMFG 1UJ5A 4CIWA 4TKVA 5BRJA 1J8QA 2K7FA 4XUEA 2GF9A 1RE1A 1KYVA 2IYTA 4BN5A 2O2GA 2W2XA 3D64A 3MT7A 4FSXA 3I2KA 4PM4A 2J4FA 1FOEB 1JVSA 5AVQA 2L69A 4OGFA 3EYWA 5DGXA 3DVQX 4O4HA 1IUNA 2BLLA 1AUVA 2EQBA 1RWBA 4XR4A 1SKUA 1L1EA 3CSUA 2GBPA 4IIDA 1KDYA 2PO5A 4U3JA 3IQHX 4DLAA 4JQZA 3W8DA 5CA1B 4RE5A 3RVOA 4NKRA 3DDCA 1A9QA 2GF0A 4RJKA 3S2FA 2JKVA 3ZY4A 4MQ6A 3ZK7A 3O95A 4EARA 4ZICA 4U9HS 2J9FA 1NV8A 2QN9A 3CPEA 1LY1A 3AW8A 4A3SA 1ODIA 1T29A 1O9BA 2HY7A 3M4NA 4L4RA 2GDZA 3ISTA 1N7HA 1P1IA 4GVPA 3SYMA 4AKEA 2DPYA 5HF6A 3S1AB 1I94B 4NCHA 4OL0A 1T5IA 3P32A 1NVTA 3P0IA 4CQMD 3H5VA 4JL6A 1AD2A 5AVYA 1HDEA 4G1EB 5KTSA 1EVZA 1E1NA 1XD9A 3FN4A 1T2UA 4PAGA 2E55A 2ZYUX 4MW2A 1Z38A 1HT3A 1QU3A 3A2MA 1H94A 2BSQA 2JGLA 1EFVA 4UU8A 2JFQA 1U0HC 3ZWNA 2BF7A 5DZSA 2HMAA 1ADCA 3PSAA 1SOAA 1U0OC 1XN4A 3L18A 4MHSA 3TLCA 3UG6A 5IJ0A 3DTYA 2D74A 1SELA 2M9MA 3I72A 3TZKA 5I7UA 1IDOA 4U2FA 1SHKA 2WFMA 2Y1OA 1O4WA 2Y0BA 1KHTA 2A0KA 1E9RA 4OKIA 3B6KA 5DI3B 3CB4A 2DFLA 4NRDA 2VSYA 4NV0A 3EZ9A 3DBIA 1N9ZA 3KX2A 3TR0A 1FUKA 3H04A 5B53A 4I55B 3BVPA 3LZ6A 3IR6A 3SEQA 3UTCA 5A06A 1EWVA 1A5ZA 2CMKA 4K0KB 3LBFA 1FYWA 3CCFA 3DMPA 4HLQB 4MCAA 4YACA 3ZXSA 1MO2A 1Z4QA 3ZD6A 2CVOA 1N2SA 2L17A 4JJKA 1XTTA 4QGAA 3H18A 2ZYIA 4BE4A 1P5FA 4BQIA 3KLMX 2PT6A 3HXPA 4R1UA 3DVAA 1IUOA 2LCIA 3GRRA 4DE5A 4EA7A 4PXSA 4AJNA 1FFSA 1UXHA 4PLYA 4B4OA 4CVNA 2HHLA 5ITVA 2FB9A 4B44A 1Q22A 3OPYB 4EMBA 3JSXA 3ZDFA 2DKOA 1B8UA 2F4NA 4S0ZA 3GFOA 4HAXA 3A4IA 4M7PA 3O0DA 4ZO8A 5BQ3A 3Q11A 5HCIA 3INTA 3IIJA 4JOBA 2DLCX 1AQNA 4FM9A 2Y93A 4E88A 3ZBUA 1EJ6A 4KO1S 5BY2A 4P7BA 1F60A 4DMUB 1KIAA 2AOVA 1FUEA 1TVCA 2DFVA 2C3UA 3ELWA 1AUPA 3L7AA 2D5CA 3Q1KA 4PAMA 3WGLA 2CCJA 5CXUA 1AS2A 1E58A 3VVMA 1A7UA 1UOQA 3NBZC 4REMA 3TK1A 4WOKA 4XFJA 1MAUA 2PKWA 2YRXA 1VIDA 1GKUB 3IGFA 3K96A 1LTHR 1VRWA 1QFMA 1C3OA 3T9AA 5HFAA 1ZUWA 1ZESA 1CY1A 3HKCB 3HN6A 1QZUA 2I76A 4FSHA 4PONA 4IO0A 4BUZA 4B7ZA 2FN3A 2QLMA 5AVOA 3ZQ4A 2ORYA 2QA5A 3HNRA 4HQFA 1VXOA 4BNFA 5H3CA 4DA0A 1HEUA 1A04A 2HSZA 4UM7A 5K0SA 4H1UA 2D3WA 3W8FA 1VDMA 2A0FA 3QFTA 3M89A 1TYEB 1TEXA 2V7PA 3AHJA 2D0OB 1YF3A 4J03A 3WWEA 2JLYA 5LQDA 1U3UA 2ZBUA 3VDRA 4K6GA 2RGAA 5DT9A 4L78A 5I9TA 4AL4A 2BGLA 3BXPA 2PZEA 1T0PA 2F6RA 3OZRA 4AX8A 1ZRSA 3CF0A 5A2GA 1HYQA 1S1MA 3TBKA 4UVIA 1ZONA 3PNLA 1ZNWA 4CKWB 3FPCA 4ILEA 1S8NA 1QVRA 2PL1A 1UWVA 4HZGA 2ZBVA 2VOJA 1G6OA 4AO8A 2BE7A 3D9QX 2HM7A 3DBLB 4F85A 1Y8RB 3GWGA 2R65A 2ID7A 3PVSA 1S8OA 2O50A 2R87A 1GNRA 4HWOA 4QJ4A 2XDYA 1EVEA 3AL3A 4II7A 1IHUA 4UUQA 4FILA 4NOMA 4GKKB 3V9PA 4F06A 3V5NA 3U56A 1TJ3A 1JSLA 3DNMA 1SKYE 3F7OA 1QLHA 5EESA 5JDIA 5C32A 1JUDA 2ZYSA 2O2YA 1FLAA 3JY6A 5ALYA 1OFIA 1NC1A 4A0GA 4RTJA 2DTEA 1X39A 3V9AA 1NUHA 1RI1A 1XVUA 3WMEA 1WCIA 3OUTA 1NPYA 4ZQEA 5CHEA 3RS3A 5T4EA 1UDRA 3ZNPA 1ZK1A 1AURA 1L8LA 4S1TA 3NI2A 3MJCA 1T9BA 4HAIA 3GBVA 4BKMA 4PC7A 1OXKB 2WWRA 1FMTA 2CHQA 5G3ZA 3B9QA 5JAIA 1V48A 1QV6A 3GT3A 4ZRDA 1JILA 1Z33A 2B5OA 3FVRA 3K0CA 4K0RA 2VPPA 4LWZA 3NIWA 3ACBA 4J07A 1K7CA 4J7AA 3NV9A 1PR4A 4MW1A 3CUUA 4RF4A 3SIPA 2OPHA 4CQLA 4ZODA 4V38A 1BXGA 5ETJA 1NW7A 4IHJF 2FGJA 1GQQA 2H9YA 2R4TA 3B6IA 3QBDA 4LJYA 4MVJP 3ZU4A 3FOZA 4ZDIA 4MO9A 4RIFA 2PDAA 1VHTA 3LWZA 1ZC3A 2VYNA 3JAMA 1HDZA 2NTJA 2XQVA 3N6XA 4KJXA 3S55A 4N5MA 3OWXA 4EVIA 5TSDA 4NZOA 3RASA 3FAZA 3HKEB 2REOA 2XLCA 3SC4A 1RPZA 1Z88A 4QEKA 1QG6A 1VYUA 5LYJB 1N7IA 1QFXA 4IHJA 1NNEA 1XTKA 3KDSE 4AUNA 2BR3A 3DCJA 1D09A 5IJ9B 3FNRA 3GGJA 2FWIA 4EECA 4TTAA 3TQHA 3VO1A 3S8YA 4E5DA 4HDAA 4HNSA 5AM4A 2UZ1A 3U3JA 2WP8J 2WF9A 2Y77A 3VR0A 1Z6ZA 2PXHA 1MAAA 4WOCA 2PD3A 4ZVRA 3HK2A 5E8JA 5F7OA 5JNUA 5EWMB 2E5WA 6AT1A 2AX4A 4MUIA 1F9EA 1A97A 4ALKA 1KPHA 1WY7A 1GQOA 3ANSA 3UHJA 5D7BA 1JPNA 2AFHE 2F43B 3VR2D 4HB2A 1RWXA 3F8SA 5KMGB 2RGNA 1OXXK 1PEYA 3IV9A 5LKAA 2IYWA 1KSFX 3W5AA 1U3DA 1MB0A 2ZYWX 2AW3A 4KGZA 1RWWA 1Q1ZA 3G2QA 2ZS9A 4LMAA 2K7ZA 3GBPA 4PQEA 2WQ7A 4WBNF 4UPVA 2ACEA 4BX8A 2WF8A 3GRPA 2XMDA 4ECEA 3MJTA 1THTA 4J49A 1KZ1A 4LHXA 4G26A 4EO7A 5EHNA 3NB0A 2HBQA 1SU6A 4KQFA 1C1XA 1MABA 1A82A 5A05A 5J4KA 1FZTA 3H42B 3MRSA 4DUYB 4C87A 1DEXA 1BXRA 5JDIC 2VBIA 1JAYA 1QGED 3WFZA 1E1LA 2CV1A 5A0VA 1L8AA 4WBXC 1VCIA 1Q20A 4GYJA 4JNCA 5F1YA 3TL3A 3C5EA 4HB4A 1E98A 3U6KA 3UJPA 5K45A 1Y33E 3K0AA 5BYAA 1MMFB 4GOMD 2ZSIA 4IIVA 1UAAA 4WBNA 1EGMB 4GPD1 2WNIA 3RYFB 4QDKA 2OBMA 2ZM6B 1NN1A 2NACA 3ZV4A 2EJWA 4O6VA 3CH5A 3K0CC 2IHKA 4TTPA 1F8GA 5IP5A 1OREA 4FONA 4HEJA 3L0CA 4HEA1 1EDDA 1GUZA 4OIFA 1DUVG 3UZUA 3OVMA 5KYGA 5CT9A 2PZLA 3VJKA 3WBJA 2QJTA 2XVZA 4G0WA 1OX4B 1HMYA 2D06A 4YUYA 2JJQA 1KP2A 2XDQA 3ZGNA 2GPJA 1QANA 2NTYC 4AN0A 5KHOC 1GCGA 1XZQA 2H5IA 1D2MA 1NW3A 1BROA 2P6OA 3BFVA 3I2HA 1M0SA 4NZZA 3OLYA 2IV3A 4BQQA 3AY7A 2J9XB 3ND9A 3PFNA 5DHPA 2O2XA 3U09A 3T3OA 1IK6A 2DUWA 1NSYA 1VSVA 3L02A 1FFXB 1QAOA 1ZD1A 4UM8B 2CYBA 2NO5A 3EF0A 1PJQA 4URZR 5DYYA 3TLKA 3D6JA 5FOVA 4EL0A 4CGYA 3DLHA 1E9AA 2QPAA 2VJYA 3ODGA 1Q74A 3O94A 2W4MA 2GF2A 3S5UA 3AR6A 2QTLA 3CGGA 2IFTA 5CVJA 2YWGA 3IQWA 1HZJA 4PPFA 3BH0A 2I80A 4FHDA 4PLPA 2X6QA 4UTNA 1HWYA 3EGEA 5CXSA 2Q28A 4F9FA 2PIDA 3ZEAA 3OZUA 1NGSA 1X6VA 2PJZA 4J3FA 4WZZA 4BHTA 1EXNA 4OBWA 1SEVA 4BZXA 1GEGA 2F17A 2QRNA 4K81B 2VHYA 3RC1A 2AEJA 2JFZA 3OJXA 3VPAA 3WK6A 2R6ZA 4A0FA 1SC4A 1S96A 1YE8A 5JNTA 4WACA 2FPRA 3K9WA 4XUDA 3V1YA 2P9YA 2W6NA 4G8JA 4WCFB 4D3SA 2J0QA 1XQWA 1ZJ4A 2CJWA 3O90A 5JG7A 2RGNC 3D6VA 5ICEA 3K5PA 1L7BA 1V96A 4K9OA 1OH5A 1B73A 3QFFA 4NZYA 4N4AA 5AW1A 2QGZA 5LU9A 4AN4A 2HTEA 1NXPA 4MR8A 2ZIVB 5AI0A 3IDFA 1R4NA 1QB7A 1XO1A 4CQMB 3KOMA 4D98A 4ED9A 5HRCA 3EF3A 1XAJA 3GP5A 3L6DA 3I42A 2ZUTA 4ARZA 5J2TA 3RS8A 5F98A 3V4LA 4TQUS 5IAEA 5BNTA 2IXBA 4LJ6A 1JJ7A 3ZIUA 3D5TA 4UTOA 4Y2RA 1W8DA 2QTVA 3K0FA 3QBEA 4B3SB 4ZT3A 4RY2A 3MUFA 3WBKA 2GOYA 3Q5EA 3H7AA 5KO2A 1TFUA 1SC9A 3KD2A 5KNCA 5KB3A 2FWRA 3WGYA 1L7VC 1V1RB 1BMFA 3GI1A 7REQB 1T9GS 5B3LA 1MO5A 2NW6A 2CLFB 1MT3A 3OCCA 4JD5A 3FJOA 1CLEA 2DE0X 2XWSA 4I50F 2CE7A 3A1SA 4OKNA 1RYBA 4QUIA 4D99A 5I5EA 3OICA 4FOPA 2YHIB 1NA5A 3B1JA 3RFCA 2I34A 5IN5A 2PRZA 3N0TA 5ALEA 1T9ZA 2DJIA 3EHDA 3LUKA 4Q7JB 2ZJ0A 4HGZA 3G17A 5CD1A 4RSRA 1ZW1A 2PSHA 2ZYVX 4YAWA 4HHEA 3ES9A 3F4LA 4ZDKA 1I7DA 1RHUA 2PLFA 2YQZA 2AG1A 4GPEA 1EQUA 2LKDA 1H1LA 2WVAA 1ZL0A 4L4XA 3QK7A 3CR8A 3CVJA 1QQAA 4Y6OA 3S7TA 1MPXA 2QTBA 5L3RA 4R71A 2G7ZA 3THRA 5JVDF 3OPNA 4PQGA 2G77B 1SCAA 1RQPA 5FOSA 3Q8KA 5EUCA 3LXRA 4DCCA 2BELA 5DNDA 4H18A 4E94A 1MB4A 4BUCA 2VSNA 6Q21A 1XVTA 1DQPA 2LNDA 2PVSA 2NOAA 3C1TA 4UQOA 4WOPA 5EIWA 3TVTA 3VYVA 4W8HA 4QWMA 5EZ5A 3FNHA 3L05A 2NU8B 5AM5A 1O57A 1COWD 1RHJA 1SULA 5CVCA 4F56A 2VJBA 2V03A 4OQDA 1DTWB 1OTYA 1RP1A 4ZZ2A 5AICA 5F33A 2PUBA 4FGWA 4P0PB 3AOGA 4B47A 1ZN9A 3KWMA 1R00A 4NNPA 2BH9A 4Q16A 3R9XB 2J3JA 1XP5A 3VR4D 5KVVA 1D6NA 1TM1E 1PSWA 4F2DA 3BFKA 3UOWA 3LIPA 4F2WA 4AG3A 4E46A 2GPSA 2BFDB 4X45A 3FMPB 4RHEA 3IAAA 1ZHOA 1X94A 2FPSA 2GS9A 2X0EA 2ZZNA 3GCZA 1EVKA 3SS9X 4YPOA 5KOJB 4HRXA 4D45A 3FKSD 5P8WA 4OMCA 5LU8A 1P72A 3SEFA 2XI4A 2QNBA 4B2IA 1B3BA 3AO0B 2YQ4A 1WSDA 4H3VA 3CMMA 1S3GA 2ODQA 2GN1A 1UP6A 4JJ8A 4DLWA 5CTJA 4MVJA 3JQ8A 5DH9A 3PDCA 1N7JA 1ID8A 2Q1XA 5JZOA 1UBJS 2GEBA 2IDJA 4Y6RA 1CZLA 5IN4A 1NVXQ 5FFNA 2XGMA 3NRBA 3KJHA 4H1VA 4B7UA 4NYJR 1Z2OX 3BRWD 3QM1A 4HFJA 4HNTA 5KC8A 1JA1A 4PR3A 4AY5A 1YFJA 1QYWA 2H57A 3FTPA 3NJ4A 4M1OA 4B76A 4R05A 4UAVA 3X2EA 4A1OA 3KV1A 4IUCS 5JEDA 1Z18A 3G2JA 1BS1A 1X1AA 4N7BA 2D13A 3VI4B 5KYUA 5FBQB 3LP5A 2Y8EA 2FPPA 1VCNA 5TS2A 3TJRA 3I30X 3KCQA 3OQHA 1VC2A 2EF1A 1XK7A 2VAMA 3VMFA 1GPKA 4AG5A 3GUHA 3I23A 4G67A 2EP7A 4RCVA 5EPEA 3RHFA 2CZQA 3CRVA 4D8VA 2O19A 2M1XA 4LNAA 2FN9A 3GFQA 4LJ5A 2V7EA 3UAZA 2UYYA 3DYBA 4EGSA 1KU6A 1OIVA 1YE3A 2HRDA 3PE4A 3UPDA 1KMHB 2HWKA 4N3GA 3CLSC 4BL5A 4E09A 2PJUA 1FX0A 2GVDC 3DTVD 4U39A 4BU1A 1W8IA 4DCNA 1WOMA 1T1IA 4RQBA 1GG8A 4XZ3A 4XJSA 5ED0A 4M0KA 5FPPA 2NM0A 4UMFA 5L7WA 2LIPA 1KGSA 2P3SA 3R3SA 2IJGX 4INPA 5EA2A 1IJKA 4RMHA 3U62A 4FE4A 1V35A 4ZJYA 4N7JA 4OD0A 1GZVA 1XJQA 4JYAB 4F45A 1HSOA 2H4HA 1QLJA 3LY8A 5TQ2B 3T9DA 1G42A 3ZS8A 3O8CA 4M3NA 4U5XA 2PU5A 1TL7C 1ZGZA 3AHFA 3MCUA 3O8LA 4RZXA 3TLEA 3QOWA 1GWNA 4I8IA 5K3FB 4MLZA 2GBGA 3RC2A 1W5AA 5DXAA 2ERCA 3WOVA 4HN2A 2UZ4A 2CBGA 4RQTA 4PC1A 4WA7A 5HK9A 3HJGA 1NVVR 1B8NA 3MWDB 2Q46A 3U7JA 4KWCA 4TXHA 1M10A 3G8BA 5FOQA 4A5OA 2ZDQA 3GT7A 5AKYA 5IW8A 1Z82A 2QRGA 1F0PA 3DLIA 3LY9A 3UCEA 1N3IA 3WLTA 3I32A 4M2LA 3VHLB 2G06A 4S1WA 1Z0KA 1DC8A 5GONB 1KEEA 5JR3A 2X9NA 4Q7KA 3UOAB 1PTKA 3F3KA 4GZMA 2HBRA 4RF5A 3DUFB 3FCXA 1HLFA 1QFYA 4PG5A 1KKUA 4CV0A 4J4TA 4OHFA 4DJ5X 1J25A 3P2OA 2P2ZA 3GDGA 4MVXA 4Q02A 4G5GA 3TLBA 2YMLA 5IDXA 4C9BA 4EABA 2PKEA 2OCYC 5AJHA 4MJ7A 3VO2A 1WPQA 1TKCA 2HJHA 4RY0A 1T9CA 3QNWA 4TKUB 1LUAA 4UBJA 3GLUA 5D3MA 3ROMA 1YZTA 3EVZA 4EKDA 2YFYA 1BVUA 1FJHA 3C6YA 1IM5A 4EWLA 2OILA 2G1KA 2FDXA 3BRQA 1Z47A 1UKZA 2OCAA 2WEKA 2X2EA 2ZIWB 4H0NA 1MDFA 4M86A 2JHCA 1B8OA 4O4IB 2QG6A 3R7NA 4R7GA 3KUUA 4Z4CA 2WKPA 2D0IA 2QM3A 1L5LA 1GP2A 1Q1GA 1KMIY 2B36A 4HDNB 4IZ6A 2BM9A 2GZ2A 3N2GB 1M6EX 4MVJM 4BVLA 4BFYA 4PX5A 4OUDB 1HO3A 4OAPA 4XPIA 1V37A 1WF3A 2C5BA 2B2XA 1A0OA 2ZIXB 4LQLA 3T5AA 1CUJA 1RBZA 3AF4A 3KT3A 3MBIA 1V2HE 5B6PA 1VCMA 2Z2JA 2FLKA 1ORVA 4GX5A 4ENSA 4E1BA 1G6KA 1OZ0A 3L8FA 3NNSA 1GPDG 4NICA 3VNSA 2GAOA 2NYVA 1VIMA 3F6PA 1NIJA 1X1DA 1SKYB 1W96A 1OXUA 2IOQA 2VSXA 4XEHA 4X61A 3T4EA 3UHOA 4ZCRA 3VA7A 4XDYA 2YJZA 1JWLA 2E4VA 2OLKA 3MTDA 4PPYA 5ALPA 1UBNA 1J2YA 1I4EB 2XNDA 5EJEA 1ONOA 4MUNA 4WWHA 3VR6D 1T2DA 3HNOA 4G01B 4N8EA 1BCSB 3OY2A 3IMFA 4G5SA 1JX6A 2LV8A 3HY3A 2FP4B 1GG5A 3FUVA 4WLVA 1SQSA 1WKVA 1ZSVA 1R74A 2ZTLA 5ERXA 3LO5A 1T8TA 3M0EA 3S8MA 1JP7A 1VSUA 2IOHA 1Z7BA 3S70A 2C9DA 2L42A 2B78A 1L3BA 5DDIP 3USZA 4US0R 4R1MA 1Z3CA 2HRBA 1LVUA 4E22A 3AKZA 3ZJVA 1E2PA 3H5WA 4E1AA 1DBSA 2QZ4A 3A4MA 5AI9A 3FI0A 5JRJA 5D2CA 2JJ1D 3MTJA 4Q3NA 2C29D 1SBNE 4BFUA 5KYYA 4UE2A 1HTBA 1T1JA 3Q3VA 4PINA 4R1LA 5KYXB 3C43A 3I1YA 1ADYA 1N6OA 1UWLA 1CUUA 1ZOPA 1Z62A 3FWNA 3TNFA 1RYYA 4GO1A 4B3MB 4OQ4A 1DG3A 4MWEA 3L04A 3IHLA 4OYYA 3GG9A 5J40A 4L51A 1YMUA 2V65A 3D4OA 1NXQA 2OD7A 3I45A 4P93A 1BKYA 1OYOA 1UC4B 2WJ3A 2C4UA 4DM3A 1HLPA 1SGWA 4EJSA 1PUJA 1E5QA 1P39A 2D1TA 3UF0A 2XUFA 2DJ5A 4EVQA 1GTSA 2J0UA 1JQDA 3IP9A 1Y3BE 3SR3A 5EKTA 1ZJ5A 1P45A 2C0CA 1RJWA 2RK3A 1P1CA 5AHOA 1DADA 1Y6GA 2JATA 4QVGA 5FT9A 2QP3A 1ZUNA 4QBHA 2XCLA 4YJ3F 1EFAA 2PZGA 4BOYA 4YJKA 3KSBC 3AIKA 4WK0B 1ZCZA 3OC6A 2HB6A 4DILA 4ZI7F 2O14A 2Q5EA 1EX6A 1HGXA 1SXQA 4Q1DA 5JXIA 3ZTTA 1P9LA 4H7DA 3ESZA 2AFHB 1KTIA 1D0SA 1K6EA 1Y9EA 3KCNA 2GEKA 4IX1A 4ZXPA 2P2SA 4FVTA 5CFMA 1SBIA 3EG9A 3PUYA 2Z4TA 2BEJA 4G0OA 4UCXA 4TV8B 3CLTC 3TZEA 4G0XA 5BSEA 2XGSA 3D3WB 3PXEA 3AUJB 3DHVA 4UE3S 5JS6A 3WDMA 1K86A 3M3PA 5AKHA 5IT4A 1S3SA 2PS0A 4YJ3A 2EZ4A 4JH0A 1SKQA 4TV9F 1X9IA 2IYZA 3M6AA 4YX9A 2J30A 5HTOA 3U13A 1YQ9A 2QQ0A 3K09C 2C03A 2BWJA 1P17A 4UTXA 3O1HB 3R23A 2QZSA 4X20A 4XYBA 3SBXA 4AUEA 1JS1X 5LQKA 1Z34A 3S2UA 2B4TO 1VG8A 5K2MA 1N57A 3FHTA 3NYIA 4FX2A 1ICIA 2AZ4A 2BD0A 1YCFA 4YRPA 2V4UA 1VG1A 2JD1A 3F4KA 2RK6A 2RGBA 4YS6A 4BRWA 1V4NA 4YXWD 1UCFA 3NTLA 1IQ0A 1DCKA 1HNNA 1LK5A 1XZNA 3PWKA 3PFGA 1Y1KE 1LPAB 2FKAA 2A5LA 4WBSA 2FMFA 3SJUA 3AX6A 4COKA 3PNSA 4PN7A 4V1CA 5JD6A 3PKIA 2CXTA 2ONCA 1XD2A 1JSRA 2X1VA 3LH5A 4MR7A 3GJQA 3LOPA 4ABTA 2XGJA 2REQA 3G9TA 3B36A 1I3OA 2W48A 5BN5B 4DR1B 3I1FA 3OE7A 4N3AA 3S2IA 3RTAA 1PFVA 5KOHA 1HDOA 2WWIA 4ZWNA 3KSDO 2NUAB 2WSIA 3KO8A 1UBRS 2QSUA 2HEIA 3OQ6A 5BSGA 3HXLA 4GPZA 4JLBA 4MW0A 5EZYF 1UBHS 2Q2QA 5G0VA 4W5NA 1E2UA 4ALJA 4KO3S 5JSUA 1U7PA 3RU3A 4PCUA 4GLJA 5FWYB 2GTHA 2JJ8A 5KNCD 1REQB 2DBYA 3K72B 4ZQGA 3NHBA 4UAJA 1XAGA 1WV1A 1MLDA 5F4BA 3NGMA 5AOBA 1H93A 3NORA 4KBFA 3WP1B 1N5DA 4AMBA 3QLUA 1PJ3A 1S1CA 2RHTA 4X1YA 1E3EA 1JHXA 2YRWA 1YBAA 4EHNA 4EJSC 3K8OE 2NZXA 4QUAA 2WAAA 2W6JD 4AP9A 3BMQB 1XZ8A 3E15A 2PEYA 1CZRA 3MEQA 1DG1G 3BH7A 5IKOA 2X14A 1J06A 4FMDB 1DEKA 2RAUA 5DBHX 3OCVA 4GR5A 1W48A 3WLLA 3ZWDA 2QL6A 1G66A 2QNRA 4JQSA 4F71A 4YAKA 4TTQA 4JI2B 1L7RA 3NGLA 3OHSX 2GYUA 3PNMA 5GINE 3ER9A 5JJIA 1ECGA 3M33A 1WOYA 4N82A 3E7WA 2HA5A 1H8HD 1GFWA 1EMDA 2NWQA 2QRZA 3ISVA 3QFCA 5B1SA 2KYRA 4II2A 3RODA 5BSHA 3S28A 4F97A 2PGAA 2QQFA 4KQ6A 3P9XA 3R44A 3LFHA