3FVTA

Crystal structure of acetyl xylan esterase from bacillus pumilus, monoclinic crystal form ii
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
318
structure length
318
Chain Sequence
MQLFDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEAEPTLESYDYPVKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDGGIHDIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYYYRGVYLDAVRALEVIQSFPEVDEHRIGVIGGSQGGALAIAAAALSDIPKVVVADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEKAFETLSYFDLINLAGWVKQPTLMAIGLIDKITPPSTVFAAYNHLETDKDLKVYRYFGHEFIPAFQTEKLSFLQKHLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyl xylan esterase
publication title Structural and functional studies of Bacillus pumilus acetyl xylan esterase
rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
total genus 114
structure length 318
sequence length 318
chains with identical sequence B, C, D, E, F, G, H, I, L, M, N
ec nomenclature ec 3.1.1.6: Acetylesterase.
pdb deposition date 2009-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fvtA00
4UBNA 1LNSA 1THTA 4QE3A 4LHEA 3A2LA 2LIPA 3QH4A 4KE8A 1XZGA 2RAUA 3PFBA 5HQ3A 2HA0A 2JGLA 5CMLA 3V1KA 1HL7A 1QO7A 4UHBA 5K3FB 3G0DA 4EY7A 3WYNA 1E8DA 1ODCA 4BE9A 1XRNA 3R40A 3F67A 2I78A 2VJDA 1XKLA 1DWQA 2WG1A 5ALTA 5AI6A 1ZJ4A 5CURA 4JNCA 2BJHA 3H2IA 3FYUB 4RNCA 4WDRA 1JMYA 3G02A 4H7IA 3WL8A 3VJKA 1L7RA 4NZZA 1C7JA 3M82A 2Y2VA 1B6GA 4DGQA 3A70A 3G0IA 2QVBA 4CCYA 3QPCA 1EI9A 3FSGA 2X5XA 2OXEA 1LPNA 4GBGA 1VXRA 4Y2QA 2CZQA 5CXUA 5BV7A 1KU0A 1XZBA 3CCCA 1P0MA 1YB6A 5KWJA 1CQWA 5DWDA 3HABA 3H2KA 3G7NA 1EDEA 3UUFA 2HDWA 3E3AA 3C8HA 1UOQA 5ALHA 5HKBA 2B20A 1SFRA 3WQHA 5AKGA 1DWOA 2PU7A 4A5SA 1PJAA 3KWJA 2O2GA 4Y2TA 4HXGA 1XZDA 3W04A 3D59A 1UT6A 2HFKA 5AIAA 2G5TA 5A7GA 4H18A 1BU8A 5T4HA 3E0XA 3WL7A 1CUCA 2FUKA 4FNMA 3JWEA 2HHAA 5ALLA 1Q84A 1A8SA 4RE6A 4XWGA 3KD2A 4J0CA 1CVLA 4UHFA 2QT9A 3FSGD 2HA3A 3LIPA 4PSUA 4K6GA 3STTA 4G4JA 1L7QA 1LBSA 2O2HA 3HYSA 5FV4A 4B9EA 5AM5A 3I6ZA 5IVDA 2JGJA 2VAVA 4KAFA 3MVEA 2C4HA 4G4IA 4OD0A 1X2EA 1E5TA 1X2BA 3WK4A 4W1RA 1LPPA 4JEIA 4P93A 5ALWA 1XZLA 3BDIA 2XQKA 1GPLA 3QZUA 1XRLA 4BP9A 1LLFA 5FDFA 2OQVA 5CBKA 1UOPA 3DD5A 1LPBB 3YASA 4UHHA 2OCLA 3QBJA 3I2HA 2JF0A 3H2GA 4AXBA 1XZJA 4C89A 1WCYA 4MEAA 4Y2YA 3DQZA 1TAHA 4EY4A 1CUHA 1EDBA 4IHAA 1F6WA 3W05A 3I6MA 5H3HA 2PL5A 3AILA 4MQMA 1XZHA 1XQYA 2XUJA 4YK7A 2PSHA 1EVQA 1WPRA 3O9VA 1G5FA 2RIPA 3G0BA 4ZV7A 2HM7A 3C43A 3TGLA 2ZJ7A 1E89A 2C58A 3WMRA 4UFNA 2AJLI 5AK4A 4IH4A 5T4EA 1H2YA 3QVMA 4M0FA 5EHXA 1ISPA 2AJDA 2WUDA 4J0DA 3Q8WA 3PI6A 4X71A 3V1NA 1SCQA 2JGEA 1LZKA 3AJAA 5CW2A 5D3ZA 3QMVA 1K63A 3ESDA 1JJIA 4BYMA 3I2KA 3FLBA 4OU5A 1QFSA 2HIHA 1XZAA 4W1PA 3WWCA 1QONA 1J2EA 2XUOA 3WLAA 2QRUA 2OG1A 3O4JA 4UPDA 5LP1A 4EY5A 3OURA 4U2GA 4BRZA 4GDMA 5I7UA 1Q0RA 4DSAA 4AZ0A 1N5MA 1XLUA 3AZPA 2H9YA 1L7AA 2VSQA 1WB5A 4GEGA 4FDMA 1Y7IA 1VA5A 1CUVA 4OYYA 3RKSA 3WWPA 3RM3A 4KJXA 2XUPA 4F5ZA 2CJPA 1MTZA 4DNQA 5HK8A 3HC7A 4UBJA 2GBFA 4X6XA 3DCNA 1AUOA 4G9GA 3TJMA 1CUIA 4J0GA 5EHQA 5AICA 4KR0A 3V1MA 3FNBA 2PKYX 3H0CA 1EHYA 3R41A 4DMHA 5JZBA 1XRRA 3D3NA 1JFRA 4X94A 5AKZA 2BCEA 3DJYA 5AI8A 5AI9A 1ZD5A 2XUAA 2WFMA 1WOMA 2QXTA 2WKWA 3ZWQA 1H2ZA 2YASA 5LZ8A 1ZD2P 1CUGA 5KREA 5EHNA 3B5EA 3H18A 5ALUA 1QO9A 3LS2A 3DEAA 4UFPA 4GHWA 2ZYIA 4CCWA 4UHDA 4W9RA 1FFCA 2XI4A 1SCKA 3AZOA 5K5EA 1G42A 3VDXA 5A2GA 3WIBA 1BRTA 4UBKA 3HLKA 3WKBA 1GZ7A 2JGKA 1W75A 1JI3A 5K3EA 4C87A 4WFIA 5JZ9A 5ALEA 5DNVA 5YASA 2WJ3A 2J4FA 2JIDA 4C4ZA 3V48A 3DOHA 3H1BA 4H7EA 2QOEA 5LZ4A 2WHPB 3BJRA 1YR2A 4ZREA 4WJLA 1WM1A 3ZLUA 3VJLA 1YAHA 5LYYA 2QUAA 2XLCA 2VTVA 2BUCA 2BKLA 1ZJ5A 4DMKA 4MYSA 1QLWA 3BJMA 4WFKA 2PM8A 2WTMA 4JYPA 5C8ZA 3OC0A 3WWOA 1MU0A 1AURA 2W6CX 5K3DA 1JU3A 3WL6A 3HSSA 2DQZA 2OAEA 5CT8A 3G9XA 3H19A 1THGA 1VA4A 4OUKX 4LXIA 3VJMA 2WFLA 3EQ8A 4KE6A 2E3JA 2XMZA 3H2HA 5AM1A 4Z49A 1QTRA 2GBGA 2OCGA 4AZ3A 4IO0A 2XMDA 5C8XA 5A62A 2OCKA 1UXOA 5HF9A 4RPCA 1XQWA 3LP5A 4J0IA 1SOMA 2ZYHA 1MNAA 3EQ7A 5AKIA 2WIKA 3P2MA 1O6GA 2C0QA 4J3JA 4BVKA 2XUFA 1HDEA 1FSSA 5I8PA 4IH1A 4LKOA 3STUA 1WHTA 3RK4A 4ZWNA 1IZ8A 4O08A 2I03A 1VOTA 2WILA 4FLMA 5DNWA 4CFSA 1R9MA 1IVYA 2DQYA 4EY6A 2QJRA 3BIWA 1MAAA 2BFNA 3R3UA 4C4YA 5IVKA 2WU4A 3C87A 3QYJA 3FBWA 4BTVA 4DNPA 1MNQA 6YASA 4B80A 1A8UA 1XRQA 3IVMA 5IKXA 3E4DA 3DOIA 3CN7A 2FJPA 1DX6A 4P9NA 4U2DA 1ACLA 3D2BA 4P08A 1OXMA 4CG2A 2Z8XA 4DMCA 4DIUA 4QLAA 2DFPA 1YSCA 4HVTA 5HQ3B 3QPAA 1XRMA 1R88A 4G1FA 1H2XA 4H7KA 1W6RA 2VEOA 1MPXA 2J3DA 2IIVA 5ALPA 5JD4A 2PBLA 1TCBA 4DLNA 3GELA 1S8OA 2RHWA 3NUZA 3FOBA 1TCCA 3ZI7A 4X93A 3DKRA 4PSCA 2VJBA 4FLEA 3G8YA 4U2FA 1EK1A 1ZIXA 1AC5A 4KE9A 3MGAA 3KXPA 5D6OA 3D5EA 1PFQA 4H7JA 1IUNA 4KEAA 4FBMA 4ZRDA 3R3WA 4BC0A 1J1IA 4CCYB 2XMGA 3W06A 4BVJA 1E66A 1QIHA 4G5XA 2IITA 3FLAA 1DQYA 2B9VA 3PICA 1U8EA 1ODSA 1CUFA 5LIPA 2XB6A 2V9ZA 2OGSA 2XUGA 3I2FA 2JGFA 2VQ6A 1M33A 3I2GA 3RARA 4CG3A 2VATA 2VT6A 3WIOA 3G9TA 1YCDA 4FLFA 1CV2A 2HRQA 4Y9SA 5F4ZA 2JEZA 3UMJA 2UZ0A 1C4XA 4H7HA 5EIEA 4PQEA 5AHXA 4BE4A 2VT7A 1XZEA 2OCIA 5KBYA 5HF5A 2ACEA 3L1IA 4PV7A 2PUJA 3I28A 3WZMA 4LIPD 2AJ8A 4D9JA 3CCBA 2ZSIA 1VLQA 4W1SA 3IUNA 4X6UA 5JANA 3AIOA 2XMCA 1QIIA 1LZLA 3I1IA 4BDTA 3B3QA 1XQXA 1YB7A 1BN7A 4QLOA 2B4KA 2XQGA 4BZWA 4WY5A 5FOQA 4XVCA 5AH0A 4TGLA 3I1YA 2YH2A 3G0CA 4F0JA 3DYIA 4H35A 1QIFA 3Q0TA 5JAHA 1P0IA 4NMWA 1VE6A 4H7FA 3C6YA 2ZYRA 1ZI8A 4BP8A 3LLCA 1ODTC 1G4HA 5HCUA 3BL8A 1E8NA 4OB6A 3GROA 2R11A 1W52X 3K6KA 2DHDA 2HU7A 1A8QA 3IULA 3ZPXA 1XZFA 1BCSA 1UK9A 4LXHA 4Y2SA 4QDXA 4MWSA 2K2QB 4LXGA 4FWBA 4X3CA 1T4MA 3EBLA 1U65A 2HFJA 1BE0A 4GLBA 5ALFA 5AK6A 1EK2A 4EZIA 1QOZA 1F8UA 3IB3A 5DJ5A 5T4FA 4BCBA 3ZV7A 1F0PA 3IURA 1NU6A 2PSDA 5CH8A 2QXUA 3OM8A 2EDCA 4UHEA 5DYYA 4B0OA 1QIKA 1CUWA 4Q3OA 1W4LA 4YX9A 5JASA 2Z8ZA 4C6HA 3HACA 1XKTA 4PNZA 2ACKA 3GBSA 2WG0A 1ETHA 4L3WA 2XT0A 5DYWA 4CG1A 3SWWA 3ESAA 4DTCA 2RHTA 4Y2PA 3MUNA 4BCCA 4C4XA 5AI4A 1EINA 3IUQA 3U0VA 4G8DA 2QS9A 4A16A 3STYA 4XJVA 3QMWA 4UBOA 1K6EA 1UWCA 5D7BA 3CXUA 1YA4A 3C6XA 4H0CA 3VISA 3FYTA 1NX9A 1JT2A 1MAHA 2C7BA 2XE4A 3WL5A 4DYHA 4BVLA 4MXDA 1GQSA 2VAXA 4MYDA 1OILA 5AK5A 3R0VA 1ORWA 4QWMA 3ICWA 4UBLA 1A7UA 4JH0A 3SX4A 3N2ZB 2B61A 2WG2A 2PSFA 3EIOA 5ALMA 5ALZA 2DHCA 4PO3X 4HXFB 4KRXA 3BE8A 5EI5A 3FAKA 2ECFA 1WB6A 1O6FA 5CXXA 4Q05A 5FKJA 1R1DA 4ZV9A 2CEKA 2HA2A 4H7DA 2CBGA 4Q3KA 5FRDA 4EB0A 1YS1X 5DTIA 3WK8A 3HRHA 1ZICA 2H7CA 4G4GA 1TIBA 2DHEA 3HI4A 4H77A 3DKKA 5K3CA 4B6GA 3OOSA 5JZSA 4BC1A 3ZLTA 5JAUA 2AXEA 2CUTA 5E4YA 5CRIA 3DNMA 3FCYA 4F60A 3C5VA 5AOAA 5FPPA 2XQJA 3WKAA 4EUSA 4UUQA 1IZ7A 5CT4A 4Q3LA 1J07A 2BGNA 4LYDA 1DT5A 1QGED 2WIJA 4KRYA 5ALIA 1K5PA 1EXWA 3WK9A 2XMQA 4YASA 4BBZA 1CQZA 3NWOA 2VA9A 3ED1A 4S0XA 2QTBA 1PV1A 3R3ZA 1UOOA 3T52A 4DMFA 2C0PA 5HFNA 5D3KA 5ALJA 3GA7A 3BF8A 5K3BA 5AK3A 4QNNA 3W2TA 4AMYA 4NVRA 1QIMA 4K2AA 4AO8A 3IBTA 4Q1VA 3WA7A 3ANSA 2W22A 4X85A 5ALYA 4GWLA 5CH3A 3WJ1A 2HADA 4I3FA 1R9NA 4Y2XA 2XUIA 5ESRA 2HU8A 2G4LA 3N0TA 2O7VA 4RE5A 1CFJA 3TRDA 3OG9A 4ZI5A 3KOOA 4MWTA 5KWIA 2WTNA 1GPKA 1HLGA 4B7ZA 4Y2RA 5ALQA 2VJAA 4N5IX 3NOXA 3M81A 4Y2VA 4E11A 2GYWA 3FCXA 5FPQA 2XMBA 5AJHA 5LZ7A 1W76A 4X91A 1XLVA 3R3VA 5LZ5A 2XMRA 2X76A 2J4CA 3FVRA 1QIEA 3ESCA 4AB1A 5EIAA 5IVHA 5JIBA 4K6HA 2J3QA 1CUZA 3V9AA 4J03A 3F96A 2R8BA 3D2AA 4HS9A 4IQ4A 1DWPA 3H1AA 1GT6A 3FYUC 3KWFA 1WB4A 3EF3A 1CUAA 1YA8A 1N5RA 3WK5A 1J06A 4E46A 5AM3A 3STVA 3WJ2A 3F97A 4Q82A 2XUKA 1F0NA 2JBWA 5ALOA 3BF7A 4Y2JA 3IUJA 4G8BA 3M83A 2Y1KA 4AN0A 5I9IA 3H04A 1DINA 4HAIA 5J3JA 1FFBA 1HPLA 5C8VA 2WQZA 2GZRA 3F8SA 4FBLA 4G9EA 4KAJA 4PSDA 4BRSA 2XQIA 5FXMA 1BROA 5DNUA 1VZ2A 1X70A 3A6ZA 1AMNA 3L1JA 3QMMA 1VE7A 4QEKA 2WJ6A 4Y7DA 1Q83A 4M0MA 1AX9A 3HJUA 2GYUA 3D7RA 1H22A 2QM0A 3K9BA 1CEXA 3S8YA 4OB8A 2BGRA 3G0GA 4FKBA 1CR6A 1FFDA 1GPNA 2WHQA 4ARBA 4PW0A 1XZCA 2WLSA 5AKHA 1QTIA 3C6ZA 4FFVA 4N5HX 4W1QA 3O9MA 1VXOA 2P8SA 3C70A 4BAZA 5JD6A 1UK6A 1YASA 3M3DA 5DYTA 5AO9A 2H7YA 2RI6A 4KE7A 4X97A 3HEAA 5LKRA 4Q34A 3IIIA 3EQ9A 5LLSA 4U2CA 4I19A 5JARA 3ANTA 2DSNA 3WKEA 5IH7A 2PVSA 1AZWA 1BEEA 3WYDA 2QUBA 3D2CA 3MUOA 4U2BA 3KSRA 1ACJA 3X3HA 3D0KA 3DYVA 4QA9A 4EHBA 1SCIA 3IUMA 1ZI6A 5SYMA 1UKAA 1FFAA 4G8CA 4GXNA 4J0KA 4ZGBA 5K3FA 4GECA 2IX9A 5SYNA 4BZZA 2WJ4A 5ALVA 3SK0A 5A7HA 4FOLA 4IH9A 5AI5A 2BUBA 5C7YA 1HKHA 2V97A 3GZJA 2PX6A 4X7BA 3I2IA 1XQVA 3FYUA 7YASA 3GUUA 2EDAA 2Z3WA 3AINA 4K6KA 3H17A 3HXKA 3ZLVA 5E2IA 4FTWA 1BS9A 1QIJA 4XIIA 4B84A 3AIKA 4J0HA 5ALGA 1R3DA 4CIAA 5FP0A 2V98A 4JUIA 1UK8A 5BOVA 4QDTA 1UFOA 1LPOA 2X8BA 1SC9A 1TCAA 1N1MA 1TRHA 1UKCA 1DQZA 5AM4A 4ITVA 1R4ZA 2C5GA 5E4TA 1MJ5A 1CUBA 3DLTA 1Q0ZA 1QFMA 5AKJA 1FJ2A 4N8DA 3RLIA 3DDUA 1JJFA 4B85A 1QIGA 4UBMA 5E4JA 2WU3A 3LCRA 1JMKC 4QDZA 3CN9A 3UUEA 1VKHA 1MX5A 4L72A 1XFDA 5ALNA 2WM2A 4B82A 2EEPA 2FX5A 2WFZA 4KAAA 3WK7A 1JJBA 1KEZA 2Z3ZA 3C5WP 3S2ZA 4OPMA 2JGMA 1R50A 1TK3A 5LZ9A 2CB9A 4QDOA 1AGYA 1E3QA 3C45A 1HBJA 5CH5A 3JW8A 4BCDA 4N8SA 2JGIA 4BDSA 3C6BA 1DT3A 4C88A 1XZMA 2D5LA 1I6WA 4HZGA 2XQFA 1QJ4A 2CMFA 5ISMA 3WK6A 4MEBA 4X6YA 2PUHA 3BWXA 1ORVA 3D4LA 2G5PA 2GYVA 3ESBA 4X95A 4XX1A 3AUKA 3H2JA 1N8SA 2V96A 1EDDA 5A6VA 2OGZA 2OPHA 2FJ0A 1OCEA 2OLEA 3T4UA 3WWEA 5LKAA 3DS8A 2PPLA 5HF6A 4ARAA 3LIIA 2XDWA 3IA2A 5K3AA 1T2NA 4AMZA 1CUXA 4KYVA 5AKKA 1CLEA 4HTAA 3BXPA 1GKKA 1ZD3A 3OTQA 3WWDA 1C7IA 1RYYA 3JYHA 5LZ2A 3VVLA 3HZOA 1MX9A 1BEZA 3G9UA 4J0JA 5JYCA 2CKMA 3WA6A 1UKBA 1Z68A 3ILSA 5HKAA 1LGYA 2QR5A 2ORYA 5JATA 4BAGA 4DM7A 1TKRA 4TVKA 2WIGA 5AP9A 5HF8A 2GBIA 2WHRA 5FLKA 5T4BA 3SC2A 1EX9A 1H2WA 1LPSA 1BN6A 4OB7A 4B9AA 2DCMA 3DL4A 3BIXA 2HU5A 1G66A 1ZGBA 1LBTA 2Q0XA 4AX4A 4W63A 5ALXA 5AKLA 5ALKA 2JEYA 1BCRA 5HFAA 1UK7A 5AOBA 2HA6A 2Y6UA 5EGNA 1Y37A 5AI0A 4DSZA 2Z5GA 5JAOA 4WY8A 3PF9A 3I6YA 2XUDA 2H1IA 4QWWA 2OAGA 4M0EA 4DNOA 4INZA 5AM0A 2PSJA 4WCVA 1ZIYA 3W9BA 3U1TA 1TQHA 1RWQA 2GZSA 1IUPA 1ZOIA 1VJ5A 2AJBA 3KDAA 3PF8A 3O4HA 4Y2UA 1XRPA 1K8QA 2WIDA 2VF2A 4GI1A 1WPXA 5AKYA 1ZI9A 2D0DA 1CPYA 4UHCA 2AJCA 2WUEA 4X00A 4CI9A 4FMPA 1U2EA 4X92A 3V1LA 4AO6A 2QMQA 1EB8A 1RP1A 1UZAA 4BATA 2ONCA 4L0CA 4JYMA 3OPMA 1JU4A 1YAJA 5IVIA 3O0DA 3WZLA 4EA6A 3W9UA 4QDUA 3TEJA 5AKEA 3F98A 2OGTA 1EB9A 4YPVA 2QKYA 3WI7A 1CRLA 3IDAA 4NS4A 3VVMA 4OSEA 4C01A 5CT5A 3R3XA 2HA4A 5BWBA 1WHSA 2H7XA 5BWCA 4FFWA 1ZD4A 4BAUA 4ETWA 4ZXFA 2G63A 4WDQA 2QZPA 3QM1A 3QPDA 2ZJ6A 1QIDA 4A23A 4EBBA 2HL6A 1VZ3A 1XZKA 3FVTA 3L1HA 1GQRA 5CTAA 1ZGCA 1MX1A 1P0QA 4U2EA 4TPKA 3AFIA 2XUQA 4MJ3A 3WKCA 1YS2X 5JAPA 4FHZA 5CT9A 3GFFA 3I2JA 4MQLA 5HK9A 1DX4A 5CT6A 2XLBA 4HRXA 1GGVA 4GW3A 4LYEA 1Y7HA 4AQDA 3FLEA 1D07A 4OYLA 3PUHA 3C8DA 1KU6A 3ICVA 2WIFA 1CUUA 1CUEA 2RGUA 2WFLB 4I4CA 1DU4A 4PF1A 5FUMA 1CUYA 2DR0A 2O7RA 2ES4A 4X90A 3B12A 1LPAB 2WHPA 2HA5A 1XLWA 5EFZA 5JD5A 3QITA 3WKDA 3PUIA 2RONA 4AN1A 5AKXA 1USWA 3O95A 1MN6A 5EIHA 1EH5A 1XROA 4HRYA 2WSLA 4UFOA 1P0PA 5EHZA 3PFCA 1MO2A 1B41A 2HA7A 2ZSHA 1QE3A 1LPMA 4J7AA 4FNGA 3F9CA 1K4YA 3PDCA 5AIBA 3VKFA 2XMSA 2WUFA 1MT3A 2YYSA 1AKNA 2BAGA 1EVEA 2O2IA 1CUDA 2YXPX 2ZJFA 5JADA 5C81A 5DTJA 2BUAA 2ZYSA 4F21A 4ROTA 5JALA 4OCZA 4EY8A 2VJCA 4WFJA 5ALDA 1AQLA 3K2IA 3STWA 2GBCA 2WUGA 1EA5A 5A7FA 1A88A 4DNFA 3DL7A 3E1GA 3NGMA 5DLPA 5ALSA 1DTEA 5ALRA 1QZ3A 3O4GA 1H23A 1NU8A 4OU4A 2HRRA 3G9ZA 4V2IA 3VXKA 2I3ZA 2ROQA 1GXSA 2OQIA 2XUHA 4N8EA 1U4NA 3A2MA 3R3YA 1GKLA 1HQDA 5AOCA 2I3DA 2Y2UA 3AIMA 2PSEA 3PE6A 1CUSA 4P92A 1IMJA 4UBIA 1CIJA 2Y6VA 5AM2A 4E14A 4CIBA 4B81A 1FFEA 3BDVA 1XZIA 1CUJA 4E15A 1W1IA 4AO7A 4K5QA 4BB0A 1E8MA 2ZVDA 4L9AA 2PU5A 3FWHA 3O4IA 4KACA 4HXEB 4B0PA 3A2NA 4B83A 3STXA 3AZQA 5HZGA 4BTLA 1JKMA 5A71A 4QZVA 2C5FA 2QJWA 4RGYA 2NW6A 1IUOA
chains in the Genus database with same CATH superfamily
4DZTA 5C8DA 3WQRA 1QF9A 1THTA 4UU8A 4KSCA 1K89A 4AMUA 3AF6A 1H2AS 2KLHA 1JDSA 4LHEA 3ER9A 1S3FA 2LIPA 1F4VA 1XZGA 1E7SA 4QRHA 1HLFA 2G25A 3M3PA 5HQ3A 2HA0A 4U3JB 3T3MB 2JGLA 5I7AA 2OQRA 3PPVA 3VKWA 4FB5A 3AETB 4PLVA 1CJCA 3X1XA 4DDMA 2O7NA 8OHMA 4GPZA 4ENUA 4G5FA 2I1VB 3BXZA 3G0DA 5GTDA 1W0JA 4BE9A 2Y1FA 3NDBB 2UUBB 2FPIA 1C4OA 1AQYA 1MKYA 4D1YA 4GLFA 1DAIA 2CLKB 4R0VA 1MRZA 1W34A 4B6EA 1DWQA 1FK8A 2WDPA 5JDIC 1TJPB 2WG1A 3F4BA 4YAKA 2YS6A 2ZI9A 3S2GA 3ZJUA 4JC8A 4YBRA 5AI6A 2C9ZA 1BMDA 4AJ4A 1QYCA 4DLLA 3H11A 5K3SA 1P61B 4KXVA 4RK0A 2CMGA 2ZIFA 3F6CA 3JWJA 3DBHB 2PLNA 1VBFA 3IXMA 5HIMA 1D6NA 1RYZA 3QWHA 4ED9A 1JKIA 1UJ2A 5AXDA 4RTLA 1A69A 4D9NA 2H52A 2Z2KA 1JMYA 4IJ6A 4RIIA 1XHFA 2YV2A 1JQAA 3QTBA 4HY3A 1O0BA 2PZMA 2PKQO 2VPTA 2H48A 5F33A 3VJKA 1L7RA 2QW8A 3UJNA 2WI8A 2BEKA 721PA 1G1MA 5FHRA 4KR3A 2J3MA 3TK1A 4ARZB 1B6GA 5L4SA 3GFTA 2QAJA 2O3TA 3V8PA 2DUWA 1IWPB 2EL9A 2IHBA 2M6SA 2LD4A 3NBZC 3IT3A 4HLCA 1KE1A 4DVGA 3R8XA 5EJ8A 2R2AA 3FPAA 2X5XA 1DJLA 1W8DA 1DKNA 5BORA 4CLOA 1N5KA 3LHKA 4C6SA 2NADA 3O1LA 5ECGC 1TQ8A 4HH3C 1JHVA 3B53X 3QEMA 2GASA 2YJTD 2NO0A 2XF2A 4RV9A 3VZSA 2O5CA 3F8WA 5IHXA 2GSDA 4QBIA 5ARCA 4DIBA 4MPJA 3WWZA 2QTNA 5KTYA 4OAPA 4ZI2A 2ZJ1A 1YB6A 2CXTA 5DM4A 5EMLA 1BHO1 1MV5A 5FOTA 3HCFA 4PTZA 2QAGC 2QMZA 3VH3A 1TUGA 4A0GA 5IANA 3BIFA 3ONVA 3H2KA 3Q4GA 5FTWA 4FS3A 3G7NA 2ORED 4I55A 4JY7A 4PR0A 3UUFA 3E3AA 3NWJA 3H4TA 3M9WA 4B17A 5ALHA 2A4MA 3DDOA 2H2DA 4NNPA 5KEIA 2I6TA 4IHJF 1JXMA 4O59O 3U37A 2R8ZA 2B20A 2WNSA 1VJGA 3NTOA 3K4QA 1DEKA 1X1DA 4XPIB 3FCEA 4LGCA 1PG0A 1TTHA 3WQHA 4LX8A 3CWZA 5AKGA 3IJ5A 3LX8A 1NBAA 1FUIA 1IWOA 4A5SA 1VSQA 5IKEA 1FP4B 2PS3A 2Z4RA 3LX6A 1A2KC 4B6RA 3L49A 1JKJA 3V33A 2O2GA 1QH1B 3F1KA 3GJTA 4YJKA 1L5HB 1CERA 2JFVA 4HXGA 3PC3A 3LXXA 2B78A 3W6NA 3O91A 4RL6A 3HCWA 1BOOA 4LQ4A 1NFFA 1ANKA 2QE6A 4TMFA 4ZZIA 3W4IA 2Z9BA 4UEWA 5GONA 2H2GA 1E5DA 4QOSA 4MIYA 1W44A 1AE1A 3P0RA 4H18A 1F3OA 3FKJA 1Y3HA 2O3UA 4X7RA 1ZK0A 2IPMA 4TLAA 4BQOA 4KODA 1T8PA 1X3SA 4JROA 1APBA 1YC5A 3AR5A 3EXIA 3O94A 2GD6A 4PPFA 3TDKA 1ZN2A 2ZITA 5JECA 2Q07A 3EDMA 5F3RA 4EAAA 3TCKA 4HEA6 2NQTA 4P2GA 4PFJA 1T1GA 2IDJA 4W6QA 5ALLA 3SLKA 6ADHA 1R5BA 2DTDA 3K5HA 1TK2A 3TIIA 1LBEA 1DC7A 4HNQA 5D3MB 4A26A 2JI9A 1YB2A 4JT8A 1Y1RA 3GEMA 4UHFA 3SZ3A 2IIQA 1ZU5A 2PA0A 1LW7A 1V25A 2O54A 1P5FA 2JHAA 5LQNA 2IVZA 2XTJA 2Z2ZA 3CUTA 4QHYA 5H4GA 4ETIA 3LIPA 4H2DA 4XB6B 2WYWA 3D4OA 4RQTA 3GGSA 3STTA 1P7ZA 1BA3A 1KMIY 4N7MA 3IILA 4EYQA 4ESVA 4P4NA 4R0NA 2DBRA 2Q8NA 2L42A 1E3WA 1N6HA 4FEEA 1ABFA 1R16A 4K0RA 2DFTA 5J63A 5MN5A 3BWDD 4YRPA 4AROA 5EWMA 2IYAA 3BPSA 2VAVA 3FBTA 3PVZA 5L3ZA 3V9PA 2P1ZA 4O4IB 3LHFA 3NBXX 1HRDA 3SG0A 2B8JA 1JXOA 1QP4A 3V8EA 1GPUA 4C2BA 3PC8A 3LFUA 3GARA 5CCEA 3U3DA 1B6SA 5G40A 1X2BA 3SM3A 4EI7A 3WK4A 1R4NB 1HG1A 3INTA 4NU6A 4B7UA 1CF9A 2VLIA 4OHCA 3REOA 4DBZA 1RCUA 1VKNA 3BDIA 3GRVA 2XQKA 1RTKA 4NV3A 2X1VA 1XJQA 3QZUA 2FWIA 2CNDA 1XRLA 4HUQB 4EKNB 3FGZA 3KCNA 5FNVA 4HUJA 4ZOBA 3AV3A 4AWBA 5CBKA 1TF5A 1FXWA 3DD5A 1BFUA 2EATA 3FE2A 1E2HA 1U3TA 1TQ4A 4ZQGA 1B2LA 1VBMA 4DPLA 2D4AA 4RPKA 4RF2A 4D4KA 4GXRA 1DIBA 4AXBA 5LR6A 3CUUA 2NQ8A 3GU3A 3RHTA 5JH7A 3ET4A 3QG5A 1UKVY 3F6PA 2YN2A 3D7KA 3BMNA 3LK6A 4Y2YA 4Q7EA 4DEXA 4RENA 1JJAA 5AJVB 5I01A 1TAHA 1WQ1R 3NIDB 4IIBA 1CUHA 4X1KA 4Q7KA 2ZU0C 3EXHC 4F8YA 1F6WA 3HVKA 3QF7A 3WGYA 1RE0A 1UEIA 2PX4A 4FS8A 2P4HX 1II8A 5AESA 6ABPA 2COEA 1A1VA 4XB1A 2OP0A 2Z5LA 2PVCA 3KT0A 1HT0A 2IEBA 1GRVA 4U7HA 1NASA 3GMTA 1N7JA 3HLYA 1X7ZA 2O48X 2FMFA 2W11A 2ZWAA 5FUXA 5LCXA 2WD7A 4HDMB 1JIQA 1Q7TA 2HRBA 1T8TA 3V7WA 2EHJA 1ZMBA 3GD7A 3X1ZA 4MUAA 2WIBA 4YEDA 5G0TA 1KYVA 2WZQA 3IDOA 4UFNA 5JQWA 5AVTA 2I91A 3NC1C 2OY0A 2NTVA 5T4EA 2ABWA 4RU1A 1AY0A 3AF5A 3LBYA 4WLVA 3JVDA 1H2YA 3O4RA 4Q9LA 3VMMA 1GSAA 2GK3A 4F11A 1ISPA 4A2QA 4YJ3F 4HP8A 4GX0A 1GUBA 2W98A 2AJDA 4URFA 4WY2A 5BMVB 4FUQA 5HQJA 1R0SA 1MEJA 3QLVA 1E63A 2WUDA 3DFZA 1RXYA 4A0HA 4J0DA 2FPPA 2X2EA 2ETXA 4ZYWA 2QZZA 5ITZA 1SZDA 5AJUA 4GC9A 3ETHA 5K0EA 1REQB 1SCQA 4ER6A 1EJ0A 3HFJA 2PPVA 3CLHA 2NUTB 2AK3A 1LZKA 2ZI5A 4G01B 3ZZUA 4E5MA 1R7RA 2MR5A 1NBOA 3QYFA 4TTTS 3TLKA 3USCS 5CW2A 2P2ZA 2OHGA 2HGSA 2C54A 2V7EA 3G5UA 4PC1A 4DJEC 5PNTA 1WCIB 4YECA 4D0LB 3FOWA 4IS2A 2JPDA 3VPHA 1UJMA 4FI3C 2EP8A 2GYYA 2Y0CA 3OA0A 4BYMA 4MH0R 3I2KA 4AFNA 4CEJB 4CI0B 3FLBA 1XAHA 3A4LA 5IUJC 2GI4A 3RIGA 4XD7D 4AYTA 3OT5A 1JB9A 4HWGA 3D5TA 5DEIA 3IDZA 4IZOA 4J8PA 1KDRA 3HXTA 3J7TA 1TCVA 1T8WA 4FYWA 4K9PA 3WWCA 1J2EA 1Z8FA 2BGJA 4TKMA 3UT5B 2OG1A 3C24A 3PKIA 4YT5A 3LA6A 4RF4A 2V8OA 4AYWA 3N6RA 2OFXA 4RXMA 1H1LB 1GL9B 3KVNA 2V4MA 3OURA 2IS6A 2R62A 3WB2A 4TLBA 4JOQA 3IIJA 3OD1A 2QTHA 1NZJA 1R8QA 2BHSA 2ASVA 1XLUA 3A58B 3IB6A 3G2NA 1L7AA 4M8SA 4D46A 3RNLA 2AG0A 1DI0A 4DABA 3JY6A 5EUBA 1LQUA 3W4JA 1J8QA 5F12A 2WSBA 1U0BB 2V1XA 3OZXA 1T1EA 2YOGA 5J5AA 3TQRA 2Y77A 4HZIA 4XGQA 4JASB 2WKSA 4A92A 3F6BX 4OHZA 3I5AA 4BX2A 1QE5A 1LRJA 4RQUA 4H16A 4L27A 3C3KA 1QKJA 3DWEX 3IV9A 3BVPA 5F3WB 4XTCS 3NEYA 1T35A 3GMIA 3RKSA 1ELOA 3CPJB 4YI3A 2Q6IA 5HCIA 3WWPA 3EODA 3TRHA 1DS6A 5A06A 2ZPTX 1DQPA 4PNPA 3TEMA 2G08A 1GGHA 2CL6X 3GRAA 4KJXA 1Y3IA 3MLBA 1JZSA 3QKRB 4MQEB 4S05A 3L05A 2DBVO 1MTZA 5EYPA 3RU2A 4GPTA 4KPEC 4HMQA 5A4FS 4DNQA 5HSGA 1N6NA 1P44A 2Q6LA 1IAVA 2V54A 4YJ2B 1DUSA 1WD7A 2PUTA 3OC6A 3NJ4A 2QN7A 5BYAA 4KQMA 1XA4A 1U1DA 3LYAA 2JATA 3Q3VA 1QYWA 2PMCA 3BFPA 1JB1A 1AUOA 3VU8A 4AG3A 4ENQA 1KYIA 1ZUIA 2IEIA 4EVSA 2KE5A 1THZA 2BBOA 4RLFA 2IXGA 2JCXA 5FHQA 2KQUA 2O8NA 4GOJA 3V1MA 1XMSA 1ODJA 1K5DA 1V6CA 5KU1A 4WBNB 2PKYX 5BSRA 1CQXA 3ADCA 1A5AB 3CRVA 1EHYA 3R09A 2PT5A 3EVEA 3ODPA 4I1YA 2NO6A 5G4LA 3OICA 5JZBA 3D3NA 3KKKA 3MOSA 1L5ZA 1O6BA 4PG7A 1WHSB 4QUIA 2GPNA 2YXBA 3EC2A 3HH8A 1M1NB 1AUXA 3DQQA 5BN4B 4XUGB 1C80A 2OO5C 4N49A 4N0QA 3TYXA 2EBUA 5K0LA 1QCZA 1S7CA 3ULKA 3OLVA 1GUDA 1L5MA 1T9ZA 2ODEA 3CRNA 3GGJA 5FAXA 2YW9A 1XF1A 1CKEA 4QPDA 3TNJA 1N2CA 2Y0EA 1ZUD1 2YXNA 4HL6A 1E2UA 9LDTA 2ERXA 3KD3A 3QTLA 1QYDA 4R8MA 3B9BA 4QGSA 3CUWA 4CIYA 1GPH1 4UEQA 1GTZA 2WKWA 3ZWQA 2O8FA 1AUQA 2X8LA 4RGVA 1QHXA 2D5BA 2YASA 3L40A 4CLEA 1ZD2P 3R5SA 2B30A 1T9DA 5KREA 1J4AA 2F8MA 4R8VA 5ERXA 1T2CA 3B5EA 2QTZA 3H18A 1VQ1A 1GPAA 4L4RA 5E1OA 1QO9A 3UPUA 1A5TA 2PKXA 3PDWA 1EPUA 1FL9A 1UPCA 4DG5A 4G86A 2WB2A 1GVNB 3BJZA 4GHWA 3SQNA 2ZYIA 4BMPB 3RUCA 1HE4A 1V39A 1XTSA 1V3TA 2BHLA 4JOCA 5JFTA 2NU7B 5E1BA 3I5XA 4HQNA 2O2ZA 3A6HA 4OG2A 2OHVA 5LYJB 3AZOA 1Q0QA 1T29A 3A1UA 4B3GA 1VIAA 1IM8A 2ZUSA 1O97D 4HBZA 3WIBA 1BRTA 1G7CA 3KQSA 1LEHA 4HGPA 1T5HX 1V9SA 1D2HA 1YIAA 2FR8A 2DMRA 1FX0B 3MMNA 2EFJA 4J1SA 4LOKA 4XQGA 1DJOA 1KARA 1UQRA 2MWMA 2BIFA 3IKVA 3IOBA 3MT7A 2JGKA 1W75A 2LW7A 4Z3KA 1C30A 4Z5XA 3TD9A 2EKQA 3OM0A 1PHRA 2H2AA 5J1TB 3HO6A 5YASA 5JPDA 4LV5B 1JH9A 4C7BA 4DEYA 1MXFA 2Y05A 3GRYA 2ZCUA 3PQFA 2MSWA 2WJHA 4EFLA 1PJRA 3H2BA 5FADA 2IK8A 2JIDA 2GILA 2QRPA 3V48A 4EUKA 7REQA 3H1BA 1B4DA 3IAS1 3KALA 2QOEA 4CL0A 5LZ4A 1NAIA 1N8TA 3BRCA 2FPOA 4RVNA 4L9SA 2WHPB 1JA0A 1XJ0A 2B7CA 3BJRA 3NORA 3S1AB 3BMOB 1H66A 3I42A 4LWPA 4HDKB 3LCVB 4U6NA 5EP4A 1C3OB 3TLZA 3VRHA 2OV8A 2WPDD 3M4JA 4IIJB 3GLHB 2VPWA 3ISTA 1KYYA 3G49A 3KTDA 3DTTA 5LYYA 3SZUA 3W5VA 2H51A 4D3DA 3L1UA 2VTVA 4Z51A 1NSTA 1UKYA 2BUCA 2HMSA 2J5KA 4BO3A 1ZJ5A 1HE5A 3E48A 1DBQA 3BA1A 1ZEJA 2FSVC 1ZKMA 1VKOA 3QI7A 3BJMA 1BWRA 3SMQA 4CF6A 3PTZA 4P31A 4EX6A 3AL2A 1JHRA 4U39A 5EP2A 3B70A 2G28A 3OOEA 3C5HA 4I46A 3N6VA 1TRKA 1UJ6A 2VHUA 2LRHA 3LUGA 4XYBA 1RR6A 4NH4A 2NO9A 3WTBA 4LW8A 3RQSA 2J5RA 1OC4A 3R8FA 1NDHA 3NP9A 1QE0A 1T4CA 1C9MA 2JHGA 5FL3A 1B93A 2FEXA 1KC1A 2O0LA 3KIPA 5ELXA 5L7WA 1YZ3A 1YMUA 4QXPA 3G9XA 1C4WA 1EP1B 3A32A 1THGA 3KVOA 3R24A 1XVIA 1CLUA 4G2NA 4AJHA 4DL9A 3FH0A 3VJMA 3EULA 1NUSA 3EQ8A 3LVFO 4PLGA 4YV0A 1L5VA 3ILVA 4C2TA 5AXBA 3DAOA 3QKUA 2D0OB 4Z7OB 3ANXA 4ZI3A 4FZVA 3H9JA 1KXZA 4M8IA 2VNHA 3VUEA 4TSFA 3C0KA 1YIOA 3WICA 1DIAA 1NBEA 1U8YA 2YNMD 1QTRA 3EPLA 4GKAA 2OCGA 3QLUA 3ZNNA 3MJ4A 4AZ3A 3HY6A 1SK9A 3T1YB 1M2KA 2Z6AA 1KQOA 2LE0A 3SIWA 1UXOA 3PSAA 5CCBA 2ODPA 3EIFA 3UGKA 3KYCB 2O3JA 4JKYA 1U8CB 3JD0A 4ZZ0A 4BFYA 3GT0A 5EIFA 3V55A 2W9XA 1T9HA 3KJHA 3KZ1E 3VU0A 4FC6A 2BD0A 2JDID 4LNAA 3N2NA 1PLKA 1Y3BE 1E99A 2C0QA 2DF8A 2I5PO 3HU2A 4FOPA 3HRIA 3U61B 2JIPA 1EFAA 4EPRA 1HDEA 1KMHB 4CRWB 2XNCA 1MXHA 1Z33A 4MVJF 5I8PA 3RR2A 3CU5A 2W7TA 5B3AA 1QOQB 3BRWD 2IP4A 2JD0A 1NY5A 2I8AA 1Z8HA 2NWQA 2Q62A 4ZQBA 3TR5A 1WHTA 2WSSA 4LC1A 4WKGA 4ZWNA 4IUBS 3VM6A 1GPMA 3AUTA 1W8IA 5B6JA 3KT6A 4GMKA 1U0SY 1VOTA 4FLMA 2NU6B 5DNWA 5LQUA 4A27A 4M0CA 5IUKC 3QY9A 3VZPA 3ZZTA 5JXWA 1H2RS 2GJ4A 1XD2B 4FGZA 5H68A 3VR1A 1DXYA 4KN6A 1IVYA 3JSAA 4LBWA 5DSZA 5F78A 2JKYA 3MSXA 3X1JA 3EQ2A 4LHWA 2DQYA 1UEXC 3O93A 5H81A 2JL1A 2Q1UA 3RYTC 3T61A 4BFTA 4CTKA 2I54A 2PZEA 2W5UA 3BIWA 5JE8A 3V4VB 1DE0A 4EGJA 1FXSA 3K70D 1LF5A 3RROA 3SJBA 2BFNA 3R3UA 4C4YA 4OI0A 4KV9A 1HNWB 2PAAA 1RAFA 4W9NC 4M0KA 4IEIA 2WU4A 1A9QA 1EX6A 2RHBA 2VT3A 3C87A 1I2DA 2XEDA 3PQ5A 3UYKA 5DNCA 5KQSA 4JI8B 3P8ZA 3E1KA 1XMXA 1QG2A 5J4VA 4TV8F 4R1MA 4LE1A 1E9DA 3LUAA 4E7PA 1MNQA 1OI4A 3O7MA 4OGGA 4LYJA 4B80A 4DJFC 1KOFA 5KNDH 4I08A 1Z0ZA 4TMTA 3IVMA 1KJZA 1N1DA 2H0RA 1NVBA 3ACCA 1H05A 2NU9B 1RWVA 1OFUX 1I9CA 5BQXA 3CN7A 2FJPA 1BDBA 4PCAA 3H4VA 1DFGA 4RH1A 4QO7A 3GDHA 4IIXA 2EGGA 2JJMA 5FWAA 2ZAIA 1ZJYA 1YOBA 5CM2Z 1X0XA 1NW8A 4EJFA 1GAJA 1ACLA 4P08A 1OXMA 1AKEA 1YDGA 3Q3EA 2BISA 4YP5A 4A2WA 4S04A 1RHMA 2CVFA 2C94A 2W2XA 4PWYA 4HDAA 2IF2A 4GKKB 2R6GA 1DC3A 4J7CA 3RAJA 1WULS 2W2OA 3A25A 1R0KA 1VI6A 2SKDA 3ZY2A 3HR7A 5K6TA 1IVNA 4HVTA 3R7FA 5CD9A 4ZKEA 1R88A 4B75A 4DSTA 3LCCA 3AB8A 4FHGA 4G1FA 4KNVA 4UDYX 4YT4A 1TFUA 1E9VA 2DU8A 1H2XA 3L92A 5HRUA 4BQQA 1B6RA 4QGFA 4O5OA 1WKCA 5EL0A 4E07A 3PIIA 1LV7A 1KO8A 2R6HA 5IMSA 2ERYA 4F12A 1LDNA 3THXB 1U63A 1C4KA 1MAUA 1Z37A 2WF6A 2ZAOA 4I50B 3K30A 2P68A 2J3DA 4H27A 4R1SA 4U4AA 4I3HA 4XRRA 1EUZA 3NXKA 2JLQA 4IWNA 1EVJA 3AUJB 3SC6A 5MFZA 4O29A 5LOVB 3I52A 5DTQA 3EVTA 1F2UA 4HK4A 4LE2A 2ZR8A 1ENPA 3CH6A 3NUZA 3U39A 5LSAA 2R48A 2ZS9A 3PE3A 3KYDB 1YDHA 3CHYA 4F8JA 5D5PA 3TSZA 3IIKA 2PTGA 1OV6A 5B1YA 2OORA 4EO4A 1OQAA 1GPBA 3R6TA 4L76A 3AR8A 1Z0SA 4UNPA 3PEWA 1BH6A 1XEXA 3HWSA 5GM1A 1L1FA 2XPCA 5TQJA 5FL7A 2WE8A 4EHDA 2EKZA 1NVMB 5JBIA 1EFKA 3LYUA 2JJ8A 1ADGA 1AC5A 2EJCA 3CEMA 3KXPA 2JBHA 2B36A 2JFNA 2AFIA 1NGSA 3IPAA 4RKQA 1XUOA 5HZMA 1QG4A 1JQBA 1RWPA 1UEJA 2NVUA 4KEAA 4N0DA 4K6CA 3MTAA 1FVFA 4ZRDA 4PLTA 3CVWA 2CHGA 1B8VA 5AJXA 1GFWA 1SWVA 2AXQA 1O94D 2JVKA 1Z4NA 4MPTA 5DXFA 1DRWA 4I4TA 4RMHA 5B1HA 4MLZA 2YIVX 1YV9A 4JT9A 5J4KA 2BFBA 2FRDA 3DDSA 1EEXB 2LUOA 4LRUA 5ECYA 3PICA 3PPWA 1ZUNB 1SY7A 1U0LA 1RIIA 3FPJA 2VPXA 5CDGA 5LIPA 2V9ZA 2XUGA 2QRVB 3KXKA 4ITRC 5IJXA 5TPZA 1OXBB 1JMVA 3I2FA 4AJNA 2A35A 3IV6A 4I1IA 4BNJA 4BVGA 5BNTA 4IDOA 1OU0A 2VC2B 2VQ6A 3QJGA 3I2GA 3BULA 1DQRA 1W9MA 2HT1A 1QLJA 5KSPA 4D0RA 1Y9AA 1W73A 1EG2A 1KFKB 3W7BA 2E87A 2G06A 4BNUA 2C59A 1VPDA 2C77A 3KR0A 2BFCA 2UKDA 1BVRA 3ND8A 4EMTA 2W0MA 2BL4A 4LDJA 1RJ9A 4RELA 1L5KA 3UJHA 1GZ5A 4Y1FA 1R2QA 1D09A 2VYVA 4Q00A 4UCXA 3RBXA 3NAMA 3NLLA 1C4XA 4H7HA 3U4QB 3IE0A 5EIEA 5LN1A 1U2PA 1C8LA 3O8NA 2GT1A 3QIVA 2OCIA 1RIFA 3W79A 3VR3D 2E6UX 3L2OB 1GNVA 5HF5A 2ACEA 3GT4A 3UNXA 1KBOA 2X8AA 2AI3A 4Q4CA 4JDPA 1RXWA 3QKTA 2VZLA 4RHUA 3I28A 5ITZB 4BFVA 3IQGX 1HNZB 1CBUA 5IULC 3ICEA 3HP7A 3EBOA 2CBXA 3GZ4A 2QRHA 1IULA 1K7CA 2HSWA 4W1SA 5BWOA 2JLUA 4CEIB 5IUNC 5GPBA 5AVYA 1V8ZA 3I4CA 2LCFA 4ZTBA 3B52X 2XMCA 1QIIA 1YQDA 3NTLA 4ZC1A 4GRIA 1HQKA 1D4ZA 4AJ9A 1E1YA 3FNRA 2HF8A 1Q0UA 2A5FA 4LNHA 2ZXEA 1YB7A 4URHA 4EHHA 1W2HA 5A4AA 2F3SA 3SSMA 1U9IA 1FNNA 1E6LA 4CKCB 4I1UA 1GLNA 1O95A 2P0EA 2I6QA 2DP4E 4QXQA 4MKHA 2GOYA 4R2HA 3ROXA 3VNAA 2D6FA 4PHFA 3P7MA 4KWIA 1DHTA 1KJYA 1RE1A 1XK7A 4QUJA 2GB4A 4TGLA 3I1YA 2YH2A 4M83A 1T3TA 1NR7A 1MRNA 1NPDA 2K2WA 2NAPA 5G02A 3SY8A 1XLTA 1K97A 3DYIA 2RGGA 5JG7A 3AYXB 4Y9RA 3EZFA 4Q03A 2HNBA 3DP7A 2P2DA 5EJFA 2B1QA 4K8RB 3SPXA 4JBIA 4KVGA 4LN1A 5LQCA 3Q0TA 4N3NA 1G5RA 2IRWA 4RA6B 2H29A 5JAHA 4G0UA 4AQYB 2FWBA 1P7YA 4M36A 5KKAA 3UOGA 3FFTA 1TVCA 3G2QA 4RZSA 1G0NA 1XQ1A 3O0TA 4YQYA 1HKUA 4QFMA 2VPIA 5MN4A 3CZAA 2Q1XA 2CFSA 4GZ6A 4RZUA 3ZS9A 1ZGJA 1ZU4A 1ODTC 4JV5B 5E9AA 2E4VA 4UXIA 5BMOA 4DV7B 2F55A 2C07A 3GROA 2CFTA 2RCNA 2VJMB 3H99A 4L2IA 5LUAA 1II9A 2R11A 2ONZA 1C7RA 2DHQA 3UCEA 3T1TA 4CXMA 5BNFA 1AMUA 3MNFA 4XI9A 3UK0A 2FPUA 1WAMA 2HU7A 4BMYA 4EUNA 3KHUA 3LOPA 1A8QA 5KQLA 1KZHA 1OIWA 4UOZA 3Q3IA 4I4IA 4D56A 3IUEA 2FXVA 3W3ZB 1YKSA 2P7IA 4LJ6A 1E4EB 1QVWA 1J2JA 3PFNA 4U8HA 1NBMA 2HJWA 1N7HA 4BV3A 1QZZA 2BFWA 3RJ9A 4DM3A 3Q8LA 4FIDA 4FFSA 1NQXA 2B21A 4N4AA 4LXHA 5DHSA 2K7ZA 1USKA 4MB2A 3H5VA 3ML1A 4MWBA 4MWSA 3ANMA 4AY2A 4LXGA 1KK2A 1TAGA 3L4EA 4YJGA 2PZBA 3EPKA 2Q4EA 4TZ6A 1D4FA 1ENZA 1YKGA 1F8XA 2VYFA 2HFJA 1OBCA 5IDQA 2CXHA 2C1XA 1EK2A 3OJCA 3B5JA 2FEMA 4YJ3A 1OTYA 4ND6A 4QUHA 3VO1A 4P3KA 4JYCA 3L8CA 3WGOA 1F8UA 1P2TA 3SYKA 2XCSB 3T9EA 1U1FA 3UMRA 1ETUA 4XASA 2UVDA 1CHNA 4WHMA 1SB9A 2SNIE 2HCBA 1OXTA 1Z88A 2J9GA 4I1RA 3K3PA 3K1YA 4RY9A 4ZHSA 3BSSA 1UZNA 1C2TA 3A9RA 2CNWA 4BNLA 3Q1LA 1QPGA 3K4PA 3Q2KA 1OW3B 1DXHA 3D4PA 1QU2A 4W5TA 4C20A 3B2QA 4TVBA 1B7GO 2E4YA 3TTSA 1SA0B 1IRXA 3ASZA 3MCZA 4L8GA 4MICA 1E2IA 1S3GA 2IEZA 2VWGA 1TGVA 3OM8A 4WJKB 1LVHA 4P5EA 1XTKA 5DYYA 2FMIA 4YAGA 2C7VA 2XB8A 1SVIA 1UXIA 1S0UA 3AHEA 3KFLA 4JOSA 5BW8A 3KQKA 4H1TA 2XZTA 2GNOA 5T8KA 4BV9A 1MOPA 4JB3A 4YJHA 1T4DA 4UCQA 1RHRA 2XBMA 3OFND 1GGFA 3G59A 1HH4A 4NKRA 5AJTA 4JI5B 3U9LA 5IBPA 4C0KA 1AS0A 5LWQA 3G2IA 1B00A 4XQCA 1MABB 2ZUTA 4H6PA 1TA9A 1SC6A 2B8TA 5GQSA 2ZSEA 3IAM1 2CT8A 4KKXB 2I7TA 4FGSA 2WZDA 2QAGB 2HWUA 5CDFE 2HHHB 2YNMC 5KVVA 1WMSA 5J9FA 3LUBA 4PNZA 4AC9A 5EXDA 5IRCD 4CQMB 1W88A 3JZMA 5E1DA 1RKVA 1CY0A 3BOSA 2XD4A 3MTJA 1ETHA 1J9GA 1ZK3A 2MMCA 4NFHA 4CTMA 2JJ1D 3WMGA 5MDHA 3P9ZA 3ZK8A 2XCQA 4FPXA 4XA8A 2ZWIA 1E0KA 1YJCA 2JI6A 1NATA 1WSBA 3HFRA 3P0HA 5J5CA 3ESAA 2QZ9A 1SQ0A 1A04A 2N0SA 3KPYA 4ZT7A 1UINA 1Z0UA 3PT5A 4Y2PA 3R9XB 2I4LA 3ZQ6A 4HRAA 2IHKA 5HEKA 1EUDB 3C74A 4JLVA 2W90A 3ELDA 5KNDD 1PAUA 3RFTA 1NC1A 3SQLA 4GOND 4ZO6A 5FPHA 1YR7A 3UMVA 4W5RA 4LZPA 2FAXA 2Q3DA 3RTCA 1RQGA 3P97A 4I2NA 4O4IF 3ETLA 1TMOA 1FUUA 1VIVA 1WVMA 4F4IA 3DR3A 1N9ZA 3OTIA 2IY8A 3JD1A 4FOOA 1IEQA 2O2XA 3ADKA 3H7IA 5BSVA 4FYJA 3U0VA 2OV4A 2BSXA 3DZGA 1RRPA 3LY5A 4EPYA 1YR3A 4TV9B 3AJEA 4HR7A 3DE1X 4Q1DA 5COAA 3QMWA 3W34A 1KAQA 1EM8A 3RVOA 9MHTA 4QU0A 2OVFA 4GPBA 3WOHA 4NOLA 2Z95A 3KUKA 4UMFA 2OD2A 4PAGA 3R76A 4BLRA 1XPRA 3ZK9A 5CA1A 5K03A 1L3IA 3CXUA 4J4BA 2RJOA 3WZ2A 1TQ6A 1NMXA 4C6TA 4BEBA 3PK0A 2BP7B 2F43A 4IXNA 1ZGAA 3VISA 2DLNA 3FYTA 1GZ4A 3HN2A 5LQJA 4D9EA 1TVEA 3OPYI 3WHPA 3K70C 1T24A 1W5FA 1JT2A 1TU0A 2C7BA 2O0JA 2V4UA 2ZG6A 4MI6A 1K86A 3OFSA 2XE4A 2W6JA 3ER8A 3FYHA 4ZXPA 1VSUA 2YZNA 4HDNA 4MXDA 4ESEA 5KQRA 1GQSA 4EHLA 2VAXA 1SKQA 3RVRA 4E13A 3SICE 4GM1A 4OUDA 4MW5A 3WTCA 2QUHA 4GNRA 3F7MA 4J6EA 4WAUA 4TWRA 1LSJA 1P81A 4CL3A 4EHNA 1Y1TA 2E4AA 3UAVA 1Y5LA 2G1UA 2WWXA 1Q7GA 4WGFA 1NI4A 4QWMA 3WE7A 4D9GA 5DX8A 5H59A 4G0XA 1JWBB 1OKKD 1WPGA 4LEIA 1W2GA 1T1IA 3EIUA 4MITA 1MC5A 5LA6A 2XCLA 5EMJA 2RK4A 3QV2A 1WXQA 2VDWA 3RWBA 4D4IA 2PUBA 4RY2A 5DP1A 4BE7B 5KPDA 3ELUA 2P6MA 3CLSC 3HL4A 4KN5A 2PSFA 3V7UA 5EPOA 3OIUA 3RWOA 5ALMA 4MUYA 4M9CA 3RT7A 3PVCA 3OCYA 5JAQA 2W93A 4XM2A 2IHVA 1JJVA 3J80A 1AA9A 4MW6A 1WMAA 4ZT6A 2YICA 2D2IA 2EBHX 2RB4A 3FCOA 3JZFA 4LCJA 5EPUA 5FTNA 3ZV5A 3P2YA 4UU0A 2CK3A 1XAJA 4B6OA 3COWA 4MRPA 4XWAA 1H6BA 3PFHA 4KLAA 1JQDA 5FYDA 4ER0A 3I45A 5BMVF 3OOWA 2OVBA 3IEKA 1MOZA 2CBGA 3I8OA 2FN7A 1I5OA 3EEFA 3KX2A 4H7DA 4OXKA 1G2OA 5FRDA 4C05A 2Q5LA 3ROZA 2CB0A 1YRYE 3A6LA 5CJ2A 4BFSA 4KSYA 1U2SA 1P4AA 1JHXA 1YS1X 3VV2A 1MAVA 1NJ1A 4BEJA 1UJ4A 3CT6A 4FHCA 3EXHB 2Q3JA 1GOTA 1XELA 1HFJA 1QRRA 4DLVA 1N5IA 1JE0A 4KC0A 4MRAA 3U7HB 4F5EA 1VPLA 1IPFA 1PF7E 3DKKA 4A8TA 4B6GA 2ZM6B 1W2WB 4KQJA 3RG2A 3EGXB 2FQYA 4B73A 4TMWA 1K75A 2VS1A 1A5BB 3E22B 5IAOA 4FMDF 2CN1A 1LBHA 3CX8A 3N5KA 4HEQA 3OH8A 3T1OA 4DKXA 4IDPA 1E5VA 2CUTA 4F5DA 2IEDA 2I71A 1RBQA 3VR6A 3QX3A 1CEEA 4ID3A 1EVYA 3KKEA 1V43A 5CRIA 3DNMA 3ADOA 1J70A 2FW9A 2QRLA 2VBGA 1KIFA 3G2OA 4EG0A 5GADl 2EQ5A 1ZVVA 4KTVE 1SHJA 3I5MA 2QPOA 1MEEA 2PQ2A 1QPZA 4FFBB 1TEXA 1IXZA 4HLUC 4EDHA 1I4WA 2HZBA 1P3JA 3L4SO 4UUQA 1IZ7A 2NSHA 1CIVA 3CINA 5CAEB 5C18A 1RRGA 1QP7A 4RVCA 1U04A 4DDUA 4HN4B 2IYTA 3G2JA 3UK1A 3LBFA 2IEGA 1GNTA 4KUEA 1G7SA 2ZRHA 2GO7A 2X15A 1Y8QA 1QGED 3FFBA 1GCGA 3KOYA 2I76A 2ZE7A 3BBLA 1U8XX 3Q3CA 1QVAA 3OQBA 5KX5B 1T1RA 4XDZA 3DHWC 2EP5A 5KNLA 1DCFA 2B3TA 2Q5FA 1GNRA 4JEMA 4MA0A 3GR6A 4KQFA 4BB5A 1IQRA 3BRQA 2HX1A 1K9SA 4BBZA 1KERA 5AUQA 3ED1A 4UKDA 2OO3A 2I0FA 5FLYA 3U1BA 1X1RA 4GBMA 3O7WA 1R0BA 1YBAA 3EXFA 5HFNA 3OZEA 1UBOS 1Z28A 2ZJYA 2YHUA 2H07A 3OETA 1JDJA 4JLUA 5THXA 3ZDYB 4RZIA 1SXHA 2ZATA 1PFGA 1KYWA 4GRAA 4JUFA 1MV8A 4KWCA 4PG8A 3L6OO 4XB2A 3WGKA 4FEAA 1CZRA 3DMTA 2Z83A 3OT1A 2P75A 4YJ2F 4AMYA 3QMPA 1E9FA 3IPLA 1JHYA 1NMYA 3NT4A 5EJGA 4QIHA 1AGRA 5LDGA 3SFZA 5FWNA 4NVRA 5FWDA 1KIMA 2WDZA 4KXXA 1YIDA 2WWVD 3O8RA 3OFJA 3ZCSA 4XX0B 2KLBA 2LXNA 4HTFA 5DH9A 3UEOA 4WZAB 4BECA 3WA7A 1G291 1ZN9A 2BCGY 3R0JA 3B2EA 4PO9A 2O06A 5CPBA 4E1AA 2HADA 3OBIA 4PTLA 3VPXA 1I4OA 1FLNA 5HTKA 1BMFD 1MMFB 3T5CA 1R0XA 2LP4Y 1G5QA 1VG0B 4I6GA 3CH7A 4AG6A 4UAUA 4NCXA 1CQPA 3B9RA 3LT1A 4KMRA 3N8IA 2HSJA 1WDKA 4JL6A 1UBHS 2PRZA 4MV5A 4RE5A 4MVJA 5E38A 5BSEA 4G5QA 5JS6A 2HKIA 3TRDA 3KR9A 4UOEA 1J9EA 4DUYB 1C50A 1KOJA 2VQDA 3KOOA 3ZG6A 4EKIA 4UE6A 5KWIA 3E6AA 3D81A 3AP2A 4RLSA 4COKA 1Z0IA 4D6PA 1PQ4A 3WADA 5ALQA 1U90A 3FXAA 3PPIA 5F5XA 2VJAA 5JZVA 4TLLB 1SKYB 2A78A 3NOXA 3EC7A 2VJYA 4CKEB 2X5OA 4F7DA 5GOZA 1JSRA 4OF4A 4HKTA 3MRTA 1KH3A 1BHQ1 1C0LA 1M1UA 3R3VA 3T4PA 2ZSUA 1AO0A 3UHOA 3SKYA 1HETA 1XTIA 3OQVA 3T5GA 1CIPA 4X3PA 3R74A 5JNVA 1M2JA 2NXWA 3N74A 4HSEA 2ODBA 2J4CA 3G79A 4PINA 3FVRA 4S24A 1EHIA 1VI5A 2YUIA 4HVLA 2R7LA 4B35A 4BO4A 5TB5A 1XSEA 4AB1A 2AYXA 1D2CA 2HBQA 3EA4A 1ZD1A 4B32A 5IVHA 5HOQA 3OX3A 5JIBA 4R01A 1SOVA 3AL3A 1DAGA 4G23A 4J03A 3PNBA 4J0EA 4WXYB 5LYJF 3FNFA 1QS0B 4QYIB 4HMOA 2WHYA 1FDWA 5FBWB 5JHHB 2CJWA 5CPFA 2R8BA 2G36A 2VK1A 4C0LA 4XKJA 1VJDA 2X8JB 2ZBEA 4KXUA 1Z6ZA 1SB8A 3L0ZA 3L0BA 4RX1A 2ZQ5A 4O4JB 3CUSA 4G2TA 3TSWA 2MR6A 3WK5A 2P9EA 4BMNA 3O5AA 4R71A 1COWD 1GY8A 2AL7A 2Q3MA 5EJ9A 3T99A 4OH7A 5TR9A 2WTXA 4IX1A 5F7ZA 1JVSA 2R8RA 2PR2A 1UP4A 3PC6A 4E7OA 5ALOA 2VTBB 1U2DA 1RI1A 1YBVA 3GRFA 3BGDA 3L0CA 3NALA 2ZZKA 4PM4A 1PJSA 3SHTA 3T9DA 3AF3A 2UXDB 4J9UE 1WW8A 2FB9A 2IQIA 2IHZA 3OLQA 4K86A 1O3YA 2CLMB 4AIRA 1U98A 3AERB 4NOJA 2O23A 5IASA 4K6OA 1F8YA 3GDOA 4N1AA 4AN0A 4NBTA 1IOLA 1BEUB 1QK4A 2D1TA 3AB3A 4IO1A 5F1PA 1Q1GA 3AEQA 3C3CA 1W1UA 2LVBA 3UZUA 4NICA 2WLTA 4IGIA 2FLVA 1E96A 2FH5B 5FIUA 3CYFA 4IIGA 1G8SA 1PZNA 4ECAA 4TYNA 2V5AA 3UK2A 1W0KA 4F38A 2Q9BA 3JQGA 2DPMA 1Q20A 1YQTA 2EQAA 3KP1A 1TC2A 4IIJF 4RUKA 1KYZA 5EWLA 1N2OA 1RWXA 2WQZA 4BLVA 5JZMA 1NF3A 2QV0A 4P3YA 1MAWA 2GZRA 1FVXA 1X6VA 1O1YA 2XQIA 3D3KA 1S3IA 4JJ8A 1BROA 5KHLB 5AW5A 5M5BA 4ZCTA 4GP9A 1X70A 4K2HA 3E82A 4IIEA 1JDBC 3L1JA 1FFGA 4M1WA 2XJ4A 3JYNA 2JGAA 1FCJA 3RSQA 1KFBB 2O5VA 1UM8A 2VO1A 3WDKA 4CT5A 4EW2A 2OHIA 4QEKA 4JBGA 2WJ6A 4IKEA 5CIYA 2BZGA 1Q83A 5FOUA 1H9CA 1G20B 1C8KA 1E9BA 1AX9A 1EFPB 4V1CI 5LXTB 5TMPA 1U3WA 1EZZA 5CIWA 1J8VA 4PYRA 3Q3JB 1DDGA 3QE4A 4IIDA 4PXYA 5DHRA 3D7RA 4MS1B 1H22A 5GOTA 4XVUA 3K9FC 4FVTA 4GLOA 1U8FO 2BHRA 1JI0A 2DZDA 3GF4A 4UDXX 1CEXA 1IJEA 1GQ2A 2YVUA 2BGRA 4P5DA 2J59A 4LPSA 1CR6A 3U2QA 1UM9A 4ALJA 5DLYA 4YUAA 2Z2JA 2AXPA 3JQFA 3CX4A 2KYRA 2TMKA 3KJQA 1Q16A 4YRIA 3ABQB 4TS9A 1Z22A 5KI6A 2PUEA 1RWKA 4ECEA 2A14A 1JDPA 3C6ZA 3HMKA 1A7KA 3V2GA 2Q1WA 1EFVA 1JEQB 2WTEA 3EHEA 4M0DA 5LBTA 2WICA 3ZBQA 5KNBA 1UBNA 3C70A 2FX2A 2NGRA 4PGHA 5JD6A 4LG1A 2R8YA 3QUTA 4MVJM 4R0MA 4K9DA 2AR9A 1P5ZB 1XB2A 1E4YA 2R4TA 1YASA 1PWZA 3ZU2A 1TZKA 4N9WA 2H7YA 1XCLA 1XCPA 1Z34A 3MT0A 2DUNA 3RHSA 1U7ZA 3GEDA 2BY4A 3LT2A 4PVDA 3VZBA 1UT8A 2I66A 4Q34A 1OH8A 4FNAA 3ZE7A 1JHMA 3DBRB 4XFKA 4Z1MD 2R7AA 3IV7A 4XJSA 2OCYC 3BE6A 1PW5A 3L84A 3TLAA 3O1IC 1ZDMA 5AJYA 2HQOA 3FGPA 3L4JA 3ZHRA 2JARA 4G0MA 4U2CA 2NQ2C 4V3CA 1QGUB 1M0TA 1V6SA 3ANTA 2VOJA 1PYGA 3IAXA 4M21A 4PEVA 2RGYA 4CM4A 1EGQA 4GWKA 4MV0A 1SUSA 4UUNA 2GKGA 1UJBA 1QH9A 3LK7A 3P71T 3WYDA 1G21E 1QVZA 3LC1O 3MQFA 5L51A 4U2BA 3N75A 4B6FA 1PNTA 1ACJA 3ZGLA 5IEJA 5KCMA 2HPVA 1P6UA 1LJ8A 4Q7MB 5EE9A 2IY7A 1HO3A 1Z73A 4QA9A 1KH1A 4PHGA 2YVLA 3GJ8A 3MWYW 4D8YA 5IAAA 2GVNA 4IDGA 2XOKA 3AJDA 3ZOZA 1URPA 4D3FA 4D9MA 5IM4F 1RFLA 1LVUA 2YWDA 2OD9A 4G8CA 1L4YA 1I2BA 2G04A 4M0PA 4U3JA 2FG6C 4NBNA 4AJEA 5CEEA 2NVOA 4EI9A 4HGZA 3AETA 2EKPA 5K3OA 1W30A 3F6EX 2PZFA 2Q2VA 3NDIA 4GECA 4NECA 4JJIA 4YUWA 4KIFA 2J0QA 1WE2A 4QBFA 4DXHA 3P45A 6AT1A 1TU3A 4G4SO 3QFTA 2FY8A 4JJEA 2EJBA 2HHLA 6PFKA 5ALVA 2UXBB 5DM1A 4L75A 1VYVA 2NV2B 4CT4B 1I94B 4MYCA 4ZAFA 2B98A 1RDFA 2BUBA 2Z2XA 3U3MA 3NC0C 1T1SA 4R5MA 4X7BA 1YU6A 3QXXA 3L5KA 2XMPA 4ZMSA 1NYRA 3AF0A 1G9XA 1R6UA 1GN8A 3AHFA 4WK6A 5J43A 1RPNA 1XDSA 3DBHA 3GUUA 4UDOA 4DN6A 2QW1A 4YJDA 3QJYA 3QI2A 4BEVA 3P2IA 1O9HA 1E2JA 1X9IA 1ZOOA 2WJIA 2Z3WA 4LPKA 4JEHA 3RC1A 4YHHB 5AOVA 2C20A 1KY4A 3N6XA 4HQ0A 2B82A 3HXKA 2QVYX 3QFRA 4EY3A 4XD2A 4YRJA 2BGIA 2Q45A 4WNAB 1L7OA 3AIKA 4J0HA 1M5RA 2R1UA 4X44A 2WJVA 5ALGA 5DTRA 1R3DA 5F9FA 2YOHA 4OBEA 2M1ZA 4X7MA 1H5NA 1BQEA 3P1JA 4JC0A 2YJ5A 4C3ZA 4E4TA 5J4YA 2EKBA 2VRBA 1A4RA 2C7OA 1Z5VA 3CUEF 1MIOB 1JHAA 2VOEA 2V9PA 3N7AA 4RVSA 3LOQA 3WGZA 1Q44A 3GLIE 4IZIA 4OVKA 1N1MA 1P91A 3O8CA 5K05A 2AN3A 1SXJE 3DFUA 1DQZA 1KQFA 1PWYE 3CUYA 3EF0A 3VR4D 3B20A 4LRWA 5JCJD 3O3OB 3G23A 1GU1A 4PQGA 1AS3A 1QWSA 1BHJA 2Q9CA 3EA5A 1G8YA 3GMDA 5E4TA 4O2BA 1E1NA 4DC1A 2XKAA 2QTGA 4XFDA 3WQBA 4A03A 2H4XA 3ZGZA 4YLGA 4HGRA 4F93B 1RXEA 2ZJ3A 3SCZA 3E0QA 3CNNA 1DXQA 3DLTA 3HB1A 3MINB 3KKPA 1ZXXA 1RI5A 3MG9A 2XKJE 3ELBA 1PGQA 4BLWA 4E5DA 1QGAA 1Q0ZA 1DG9A 5L40A 2QN8A 3AL0C 3TIGA 4Q4HB 1Z5PA 3VPBA 4Z1OA 4LYAA 3RASA 1X86B 3KS9A 3DZKA 3RLIA 2J4DA 2XITA 4B85A 4J9VA 1M2OB 3U3ZA 2UZ1A 4NG4A 5E4JA 4PFSA 3LW8A 6LDHA 4NU8X 1QPBA 4JJKA 2MOKA 4UUAA 4YQEA 1OB2A 4C5AA 3KPVA 3TW8B 1XZ8A 4CDRA 4L72A 1K3FA 4NULA 3X2EA 1EXNA 1Z0AA 1XFDA 2P5UA 3ND7A 4Q9IA 4CG0A 3KJXA 1FP4A 4IF6A 1BNCA 4MVJG 5ALNA 3TQTA 2VCHA 1ZNXA 3QX7A 1QH1A 1GDTA 4ZEOA 2HMWA 2HCFA 3F2IA 3ENVA 3GC6A 5B2ZA 3U3JA 1O9BA 4KAAA 3BGSA 5EXPA 1KEZA 3WK7A 4HCJA 2G82A 3C5WP 1P9LA 2XYQA 1ZJJA 2EF1A 4R7GA 2RI0A 3OPQA 3EX7C 1X94A 1VGQA 2EG5A 1FUYB 1JX6A 1DSSG 3TTXA 2ZYDA 2JGMA 4Y18A 1GT91 3A11A 2UYOA 4MRRA 4XXHA 4ZAZA 1II0A 1PFWA 4MGEA 1E3QA 4L5YA 3OE1A 3SD7A 4G65A 3EFEA 1WW3A 2ZRDA 1MP0A 3ER6A 3L46A 1TM3E 4CQJA 5E3IA 3RU3A 3PS9A 3UK7A 2YOFA 3DKIA 3LT5A 4JVOA 2GCIA 3OPYA 3KE8A 1USGA 1NTOA 4M6WB 2JGIA 4M76B 4CT0A 4LMRA 2HJGA 1OAOA 1N5DA 3RRYA 2X0NA 4GP6A 2VZ0A 3DAGA 3TN7A 4QFDA 2B2XA 3JU3A 3AI3A 3REQA 2A9OA 1RMYA 1U0RA 1E9AA 4WZZA 3KRTA 2GESA 2VP2A 3AY0A 3ORYA 3P9RA 2PNJA 2G70A 3H86A 1D2AA 3Q11A 4MR7A 1M73E 5CX1A 1TEHA 2JAUA 3FTFA 4KHPB 3QNWA 3OLWA 1WNFA 3QJ5A 4L0QA 1CNFA 1WLSA 1IM2A 1C9DB 3A1NA 3CR8A 5HPYB 3WK6A 5ISMA 5BVGA 1UXJA 4RZ3A 4TN5A 1IBSA 4QAJA 4F3RA 1F12A 2ZUBA 4PRKA 3ED5A 1YCHA 2FPGB 2W2PA 1Z45A 3UV6A 3R4VA 2WWRA 3ESBA 3ZWDA 3HVRA 1JTFA 5TVGA 2ZIGA 2BFFA 2W2QA 4EEZA 1OBHA 3MMPA 3QBEA 5JNTA 3AUKA 2IKSA 3WNCA 2V96A 1EDDA 4O4IA 3EXG2 3MM4A 3KKQA 4R2KA 4BQPA 2OGZA 2OPHA 1YD7A 1S8NA 3I9OA 5KYGA 1KEEB 1VMIA 5BW5A 3VSCA 4R7TA 1R4NA 1UC8A 4U7JA 2OLEA 4C0BA 2DR3A 1KOGA 1J8MF 1ZRNA 2XWBF 1E3SA 5HGJA 4K1XA 1A71A 4GMXA 4YMWA 3U4CA 1RYMA 5LKAA 3DS8A 1WVIA 3OHSX 4DSOA 2VK2A 4QQFA 2WOJA 4HUQA 1U0JA 3DHVA 3DVQX 1W49A 2C97A 2VWQA 2XDWA 3EMBA 3K05A 2ZS7A 5K3AA 1T2NA 3THOA 4MS3A 1I7QB 4S2UA 1CUXA 5H83A 1OUMA 4HTAA 3W2HA 4MPDA 3BXPA 2Q6KA 3ZWOA 3HB0A 2IV2X 4B4KA 1LRKA 4MIOA 2BF4A 2F4NA 3FAZA 3J81k 1U6KA 4DR2B 3SXUB 2Q8PA 1C7IA 3TS1A 1RYYA 1WQ4A 3ND5A 4LRQA 4UVEA 2JLSA 1YACA 2AD1A 4FU0A 4ZCSA 3HZOA 2AUMA 3QXGA 4EX7A 3GX1A 4LCBA 3TQFA 4HAWA 2H5EA 4CMIA 3PU6A 4IWYA 5ERYA 3MIZA 2H1OA 4IDCA 2Q2OA 3PQCA 4DDHA 4G84A 2CKMA 2HZ7A 4NAHA 3IRVA 4ZT3A 3IQXA 1GN9A 1RVV1 1UKBA 2JD2A 3T7DA 3WA6A 3OPXA 5G3YA 3UF0A 3MLAA 4YFVA 5EERA 4ZZ3A 3OFVA 3PFKA 3O26A 5KTPA 3SYNA 2IT1A 1HY3A 1XAIA 3KXIA 1XDGA 3NHFA 4WZBB 2ORYA 1YHYA 3I9LA 4HDMA 3MCUA 1DAEA 1JIIA 1FNCA 4DM7A 3IR5A 1CHDA 1LNZA 4L07A 1WW2A 2J3JA 1YUNA 2WIGA 2E0IA 2ZIAA 4PHHA 1EUCA 2WHRA 3KYJB 3AIIA 3SC2A 2ZQZA 3DV2A 3QA9A 1NRJB 4CUKA 1CY8A 1XEFA 3M2PA 4URVR 3C7CB 4OGWA 2AA3A 3C3PA 4ZVOA 2HU5A 4RSHA 4HGOA 1K8RA 1Y9EA 3T3HA 4KP7A 1AU9A 4MUKA 1RJGA 1AV6A 1FX1A 4CHTA 1UMCB 4TS1A 3ANLA 1X8JA 2IHJA 2QENA 1LBTA 4K7JA 1YJAA 5BMVA 3NV9A 3TM5A 2E37A 1ULTA 1KIAA 1Q1EA 2HOQA 4OBBA 3HLTA 4R5HA 3GGCA 5ALXA 2GPAA 2CDAA 2ZFUA 3GT7A 4P4SA 1PEKE 5BPHA 2I2WA 2CKDA 3CSSA 3MGCA 4W82A 1YJQA 4WNIA 4F3NA 2D1FA 5BRAA 4Y1EA 2Y6UA 4RHEA 1CR1A 1N2XA 3TZKA 1KYQA 5ICSA 5EGNA 2NUTA 1Y37A 1CX9B 3RSLA 4IXDA 3ZGXA 1CC1S 2CY0A 1SQGA 3BEDA 3DV0B 3PF9A 1WCIA 3N1UA 4I8IA 4Y1GA 3QHAA 4PO8A 4QWWA 5B4TA 4JSTA 4UPVA 5DGCA 3L6DA 1KDPA 2PSJA 3T06B 2BEUA 4WCVA 4F9GA 1W581 1CY1A 1R0LA 3B78A 2J5QA 1PT8A 1X7HA 2JA1A 4DF3A 2GCEA 1MEOA 4ZT4A 3U1TA 3ZVRA 1UBLS 2IYQA 3DAPA 4Z0PA 3KJFA 1JR6A 1IUPA 1U5BB 1ZOIA 4ZN6A 3U7GA 1RJFA 2AJBA 2COKA 2QBYB 1VLHA 2IZ5A 2C8JA 3KDAA 1QBGA 3UT5A 4JMPA 1TEZA 2V0GA 1BVHA 3O4HA 4EHIA 2H16A 1H1LA 1MFPA 1QO0D 1AVTA 1K8QA 2GX6A 3FPBA 3JS5A 2VF2A 3K8QA 3KWMA 3PX3A 1UBUS 2FUG1 3I6QA 3CLTD 2CZGA 3LC0A 1WPXA 3GJ7A 2VCEA 4YXWA 5F1OA 3ORRA 3TECE 4K46A 1KGSA 4M9XA 3PYXA 3ZLJA 3S2IA 1CJVC 1Y7TA 2G1JA 3EAFA 3IH5A 2II6A 2Q2NA 1CR2A 1B0ZA 3GN2A 2OZKA 4B2YA 4HWOA 5C3MA 1TLLA 4LJ9A 1XMIA 5GVSA 4FMPA 3RTDA 1U2EA 1OWOA 4FYMA 4R2WA 3V1LA 3GDGA 3EGIA 2J07A 3JQBA 1NRWA 3H5NA 1IC6A 1E32A 2YRFA 4ZZ1A 2A9FA 2QMQA 4RADA 3WBFA 2QNIA 4BJ6A 1HWYA 1UZAA 3QFHA 4PYMA 4TXNA 3WL3A 2B2NA 3DT8A 4YAFA 1VE5A 3NKFA 3OPMA 1E79A 2Z4TA 3AY7A 1X92A 1ZRMA 1ZSVA 2WYIA 3H8WA 3O0DA 4OQDA 3ISVA 1NURA 3QIAA 3KB1A 1DZIA 4MQEA 4TMKA 3U13A 3SSOA 1PBTA 3VNSA 4KH0A 3ZHXA 4YJ2A 1JQ3A 2Y92A 3F98A 3A1EA 3CT4A 4TX1A 3ONDA 3NTQA 1JDZA 3P96A 3BFJA 4KFUA 2BKEA 1R5NA 3CVOA 2QKYA 4LVOA 1X0VA 2FJUA 1TVKB 3CM0A 3SDBA 3KUCA 3UICA 4LK3A 3WI7A 4ZCMA 4BO8A 1PJZA 3Q88A 2CCJA 1WF6A 3QLEA 4GPAA 2G6TA 3WGLA 1S7GA 1VB5A 3IDAA 4ZMBA 4NS4A 5CH8A 2O1EA 1L4EA 5JTUA 4OSEA 5TJHA 4WBNA 3ABSB 4IPTA 5CT5A 4NCJA 4OY3A 3ZJYA 3LXRA 3UH0A 2XYGA 5KC9A 2HA4A 2J32A 5H5JA 5A03A 5DISB 1PK7A 2HJVA 5CLQA 1JFLA 1WHSA 2AC2A 2H7XA 5BWBA 3RLFA 5FJIA 1RTTA 2CYAA 3MJVA 3OZWA 2SKCA 4CEHB 3AUUA 3LCMA 3LDHA 4IBOA 1NI3A 1NXXA 1HUQA 2W6PA 2B5OA 3QM1A 2BKUA 3UM9A 4IXWA 3QPDA 2W42A 2EL7A 3KL4A 4I5DA 3T3PB 2YVKA 4M9QA 2XADA 3LDAA 2RGCA 3UC9A 4BBAA 4P0PB 2HR1A 1RLMA 4LDQA 4QREA 3G88A 2NIPA 1MENA 3FVTA 1PQPA 2FRXA 4I4LA 5CA0A 4GNKA 4XUCA 5L3SB 1Z4PX 2PLWA 2E1PA 5BVHB 1T5OA 4DARA 1FOEB 2WT8A 4TPKA 3LUKA 2P3QA 5JQGA 2WV9A 1PGJA 1VCIA 4II7A 4RVFA 2QQFA 5IU6A 3F71A 3HP1A 4MGIR 1XTRA 1H65A 3NRBA 3OE7D 1YQXA 4K03A 4P82A 1E2BA 3LTEA 4NFSA 3FWYA 5H0IA 3GFFA 2RJNA 1AM4D 1BC5A 4MVXA 1E60A 5HK9A 2A4KA 2NU7A 2B35A 4AW9A 4BOYA 2IHUA 3BXHA 3NANA 5F7OA 1E2DA 1PR6A 1QQ5A 2RAVA 5LYJA 2AC4A 4F2HA 2Q41A 3C4JA 4HRXA 3VNQA 3NM4A 4KNYA 3PRJA 4PYJA 2DLCX 1FYDA 2OECA 1K68A 3DLAA 2ZCVA 4V1CA 3GLKA 2QTWB 2GUGA 2NT4A 3NJ8A 1BQ4A 1AB6A 1JAHA 1FX0A 1L4LA 1ZXLA 1B43A 2K6GA 3EAGA 3FLEA 3RFCA 2DPGA 4PX2A 4E5SA 3CVVA 5EVCA 1HEYA 2BE9A 2X1MA 3C8DA 4CKWB 1H8HD 1X1CA 3O6VA 3MOGA 4IFIA 3UAYA 5KHOC 1ZMXA 1KU6A 4MUMA 2OWEA 1XPJA 4RESA 3ZCPA 1IIBA 4DV6B 1T5TA 2H5LA 3HBAA 2WU0A 3WSTA 5KOYA 4ALKA 1OFUA 2J31A 1SXJD 4MW4A 4PF1A 1M54A 4RF3A 3CH5A 4D8XA 2C9BA 4DR4B 1X8LA 4HD8A 3JALB 1IBKB 3K0AA 4X90A 3DBLA 3TXYA 1ZHOA 2XY4A 1ZMOA 4GVLA 3UXMA 2ECPA 2WHPA 2PBRA 5IAEA 2ZRJA 1FLAA 3WG9A 2I1WA 3BMOA 4DIDA 1GARA 2AZTA 3E9QA 4HDKA 4D0GA 4KPUB 1C3OA 2XNHA 1YZYA 3DL2A 5BUSA 1VJTA 4GEKA 1F60A 3WL4A 4G5YA 5CEFA 3FYSA 3OX2A 2RONA 5A6SB 4IIJA 1Z4QA 1USWA 3O95A 4BLSA 3LXMA 4WEOA 5K51A 3BREA 1EH5A 3TDMA 2WB4A 1XROA 1T2FA 4JLBA 2IX3A 3NQ41 2GS9A 4GE3A 1WS6A 1P0PA 4E5VA 5EHZA 3RH0A 4BNTA 1ZRHA 1QR6A 3DLIA 4HWTA 3E61A 4MZXA 1J1UA 2J9RA 3Q85A 1GZVA 3WLSA 3TLYA 4S1TA 2J5XA 3ZZ0A 1A9SA 3A2KA 4NONA 2FUEA 1OE0A 5B58T 5KX5F 5H8WA 2PHZA 2F7SA 1WBBA 2IP2A 3RVSA 1QDLB 3UV3A 4Z4FA 1LC3A 3KJZA 3NVAA 2XMSA 2PXXA 2H4YA 3FFAA 5TEWA 1T91A 1FJHA 3V4PB 4ADSG 1SHKA 1AKNA 1EZ4A 2W8BB 3GPCA 3HNOA 3ZW7A 1GRRA 4BUZA 1VHLA 5HKKD 2SICE 3DEJA 2E21A 1MCZA 2JHCA 1ONPA 4C06A 1N34B 5C81A 3JQ8B 5K0JA 3WLQA 1NULA 2QRZA 2ZYSA 1E5XA 5EHIA 2GZMA 3FRIA 4ZEWA 1HA3A 2ZOSA 3G6KA 3RF7A 4FI3F 5KWEA 4TTRA 2R6AA 1Y5IA 2VWPA 2VJCA 3HY4A 3KJEA 2IPXA 2GKOA 5ALDA 4EGAA 1H8EA 4LF4B 5JISA 4ZRNA 3TFWA 3STWA 2FEOA 2EBFX 1WY5A 1EA5A 3L04A 4CDNA 1D2RA 4CM1A 1YQQA 5REQA 2XRMA 5HJ7A 4FYVA 5EJIA 4XQEA 3HBMA 3AWDA 3BCRA 4DNFA 2FHSA 2YXLA 3A0RB 3KYCA 5KO2A 1NVKA 1Y8RB 3GG9A 4KBGA 4YHBA 3L7KA 3ZH9B 5DLPA 4YMHA 3VYUB 1E9RA 4Y6GB 5DW0A 3RTGA 2ZJ0A 1A5ZA 5I3ZA 2JH8A 3G9ZA 1VL2A 3LVRE 3ZXSA 1D1QA 1KMHA 4YNBA 1D1TA 3M4ZA 1P3DA 4KYUA 1PO7A 3OZBA 1PZGA 2PRIA 2ROQA 4FC7A 2QG6A 3KQNA 2CDBA 4NENB 4N8EA 3R7SA 4N48A 1Q17A 2CLCX 621PA 3A2MA 1X87A 3WGQA 2NP6A 2C0CA 4ISBA 3ZHOA 4YRGA 3MWKA 1GKLA 4P7KA 2VPQA 4ZJYA 4Q02A 1CCWA 2NU6A 1DELA 1L3CA 2EFHB 2J7PA 2R6CA 2Y1DA 1DIGA 2YWRA 3AIMA 1XD2A 2G7ZA 4HGNA 4D42A 2XCRB 1M10A 3GJ6A 4YB8A 3DLPX 4X8OA 1E1KA 1IMJA 3F9RA 5G0VA 4EA7A 1DJPA 2Y6VA 3ADPA 4Q37A 5EQFA 5EEHA 1YJXA 2E4ZA 5F4BA 3RJZA 2OV3A 1J42A 4C5CA 1PEYA 1SD5A 2D5CA 2TECE 4K9RA 4CIBA 5C9ZA 2FQWA 5IM4A 4PN3A 3BDVA 1KH2A 2JKZA 3BH6A 3PEEA 4PBRA 4XWYA 2F9FA 3N8NA 4XH9B 5C8YB 4QG3A 3PD1A 1AKTA 1X77A 1CUJA 1H1DA 1DRVA 4E15A 2LBPA 4F46A 2IYFA 3ZD6A