3FVTA

Crystal structure of acetyl xylan esterase from bacillus pumilus, monoclinic crystal form ii
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
318
structure length
318
Chain Sequence
MQLFDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEAEPTLESYDYPVKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDGGIHDIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYYYRGVYLDAVRALEVIQSFPEVDEHRIGVIGGSQGGALAIAAAALSDIPKVVVADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEKAFETLSYFDLINLAGWVKQPTLMAIGLIDKITPPSTVFAAYNHLETDKDLKVYRYFGHEFIPAFQTEKLSFLQKHLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Acetyl xylan esterase
publication title Structural and functional studies of Bacillus pumilus acetyl xylan esterase
rcsb
source organism Bacillus pumilus
total genus 114
structure length 318
sequence length 318
chains with identical sequence B, C, D, E, F, G, H, I, L, M, N
ec nomenclature ec 3.1.1.6: Acetylesterase.
pdb deposition date 2009-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fvtA00
3WYDA 5LLSA 4PO3X 1EVQA 2ZVDA 2WIJA 4F60A 2XUHA 4I19A 1QIGA 2WFLB 2EDCA 5FPPA 2XUAA 3F96A 4BAUA 2ONCA 3ED1A 3V1MA 2BAGA 2YASA 2ZYIA 5HF9A 5JD5A 1TCCA 1VKHA 1UKBA 2C58A 3EQ9A 1DT5A 3GROA 5ALEA 2PPLA 2HRRA 1FSSA 4Y2UA 5K3CA 1XZLA 5FXMA 4B9AA 4YK7A 5EHNA 4U2FA 2RHWA 3IBTA 4NZZA 4H7HA 4KACA 3FLEA 1LZLA 2WKWA 4JUIA 4FFWA 4IHAA 3NWOA 1E8DA 1ZD3A 2XUPA 2EEPA 1ZD4A 3D2CA 2O7VA 5AKGA 5FOQA 5AK6A 4E11A 1IUNA 3I2JA 1QIJA 2IIVA 3OG9A 4X6YA 3UUFA 4J3JA 5HCUA 1BCSA 1F8UA 4G1FA 4X97A 5KBYA 1C7IA 1OXMA 2YYSA 3A70A 4TPKA 1USWA 3KXPA 1K8QA 1BN6A 1Q0ZA 5AI0A 1FJ2A 1ISPA 1H2XA 2QOEA 2C5FA 3FYTA 3ESBA 4BTVA 4OYLA 4LYEA 1FFDA 2WFZA 1H2YA 5ALIA 1W6RA 5CT5A 1W4LA 3YASA 2PSHA 4CG1A 4QDZA 4FLMA 2VF2A 2FUKA 4MWSA 4TVKA 6YASA 4Q1VA 2ROQA 4KE8A 5ALZA 4DMKA 3KWJA 2WIFA 2PKYX 1HKHA 1FFBA 3I6MA 3JYHA 5AKJA 1ZGBA 5CT6A 1LPPA 3CN7A 5IVIA 2R8BA 2V9ZA 1EHYA 5KWIA 1NU6A 3NUZA 2C5GA 1EB8A 2BGRA 4WCVA 3H0CA 5DLPA 3M3DA 1CUCA 1IUPA 2Z5GA 3M83A 3C43A 3QITA 5HK8A 4LXGA 4EB0A 3HLKA 4RE6A 3WL5A 1GT6A 5ALVA 3HACA 1MN6A 2GYWA 4OSEA 5T4HA 3R3ZA 4HVTA 4Q82A 4P92A 4JEIA 4HRYA 3E3AA 3RM3A 1H23A 1QIMA 3AJAA 3O95A 3C8DA 5F4ZA 1XZFA 4UBIA 4KR0A 4EA6A 1R50A 3QMWA 2X76A 4BRSA 4X91A 5HFNA 1XKTA 4IQ4A 1CUFA 4ZWNA 1BCRA 5DTIA 3BIXA 1ZGCA 1UXOA 3R3WA 1Q84A 4BC0A 4YX9A 5ALUA 5AI4A 2I78A 2HA3A 3C87A 3STTA 5D7BA 3UMJA 2XMBA 5JAHA 4JYMA 3DYIA 1GQRA 1CUSA 3ZLTA 4BE9A 1MU0A 3IIIA 2Z3ZA 3STXA 5HF6A 3G8YA 3BF8A 3DCNA 4AZ0A 3KOOA 3WK9A 1LNSA 2WU4A 2OXEA 4W1RA 1AQLA 1T4MA 4IO0A 2PSEA 2AJDA 5HQ3B 1E89A 3I2IA 3F98A 5LP1A 2H7YA 2PSDA 3L1HA 1QIHA 1IZ7A 3FYUB 5ALQA 3NOXA 1GKKA 3I6ZA 5JADA 3TRDA 2BUBA 2VJCA 1G4HA 4XWGA 5CT9A 4DNPA 3QPDA 1B6GA 1CUAA 2GBIA 1K6EA 1CUJA 3BXPA 3R40A 5AKIA 1BROA 2RAUA 3DD5A 3FCYA 3OOSA 3WKEA 1CUEA 2WG2A 4F21A 1EDDA 1Y7IA 2HFKA 4PNZA 4DLNA 4EY6A 3A2LA 5AI5A 1YB6A 1GPNA 4BRZA 1XFDA 2DHDA 2BCEA 2QXUA 4L0CA 1E8NA 5AI9A 4AXBA 3R3YA 3P2MA 5HKAA 5FKJA 5E4JA 4X6XA 3QMVA 2BUCA 2WUGA 5ISMA 3E4DA 2QMQA 2XUQA 2VQ6A 2XUDA 2FJ0A 1DT3A 4H35A 5AM2A 2OCLA 3JWEA 4LYDA 1QZ3A 4OB7A 5ALWA 1MT3A 4IH4A 3DKKA 1UK7A 2HU5A 2XLCA 3I2FA 2GZRA 2WU3A 4DMHA 4QDXA 3WKAA 3I1YA 4HTAA 3H17A 4WFJA 2J4FA 5D3KA 3B12A 4FKBA 2QUAA 3I6YA 3ESAA 2OAGA 2VSQA 1QOZA 2VTVA 5A7HA 2OCGA 4QA9A 2AJ8A 1XZBA 3ANSA 2B61A 2WJ4A 1BE0A 2AXEA 5A7GA 5JAPA 2WFLA 1GXSA 1QONA 3IUMA 5CTAA 4M0EA 2Y1KA 3G02A 5AJHA 2WHPB 2CZQA 3RARA 4Q3LA 5EGNA 3F67A 1XROA 1G66A 2DR0A 2OCKA 1J07A 2QVBA 2Y2UA 5FRDA 3KD2A 4KE6A 4HXGA 2WM2A 4ITVA 5AOAA 2ZJ6A 1BEZA 4H7IA 4A5SA 1AURA 1XKLA 4PW0A 3WWDA 1EI9A 4AO6A 1QE3A 5AOCA 1A8UA 1A8QA 3L1JA 5AIBA 3ZPXA 5HK9A 2ACKA 5IH7A 1WPXA 4KE9A 3A6ZA 5AHXA 3W04A 1WHTA 5ALRA 3SWWA 1E3QA 4LKOA 2VJAA 1P0MA 2LIPA 1UKCA 4GECA 5AICA 5ALKA 2XQKA 2ECFA 3D2BA 3FWHA 4ZREA 2VJBA 2K2QB 3TEJA 2FX5A 4B0OA 1MX1A 1E8MA 4QDOA 4Q3OA 3C5VA 4DSZA 2OAEA 3I2KA 1UFOA 4BP8A 3M82A 1H22A 3DJYA 3WYNA 5AM4A 1R3DA 2WG1A 2ZSIA 2XQIA 1XZMA 2OLEA 4B81A 1G5FA 2ZYRA 3PFCA 3TGLA 3LIPA 2C4HA 3GBSA 3HXKA 4QDTA 3VVMA 1R88A 3AIOA 2W22A 3O4JA 3IUQA 2O2GA 5KREA 1MX9A 2GBGA 3ESDA 1R9MA 4BVLA 4GI1A 5AM5A 4J0CA 2PX6A 1GQSA 1SC9A 3R3VA 5A71A 5FP0A 1AX9A 5SYMA 2ZYSA 3OM8A 2VAXA 3QPCA 4M0FA 4H7FA 3AIKA 3LIIA 3QVMA 1XQYA 5LKRA 2ZYHA 1JU3A 1ORVA 2XUOA 4ZGBA 4UBMA 2ES4A 1EK2A 4ZI5A 3VJMA 1TKRA 5A2GA 2GYVA 1JJBA 4H0CA 1C4XA 2OQVA 2CBGA 5BV7A 3W9UA 5AI6A 4CG2A 3X3HA 3TJMA 4EY4A 2FJPA 4ZV9A 3DS8A 4Y2QA 4CI9A 1DX6A 3CN9A 4EUSA 1J06A 3C6YA 3H04A 3V48A 2UZ0A 3K9BA 5AM0A 5EHXA 1W1IA 2CMFA 3ZV7A 3GZJA 2QUBA 4Q05A 1ZIXA 3WA6A 4BVKA 1JMKC 1WPRA 4G5XA 3WWOA 4X93A 3WA7A 4CG3A 1K4YA 1MO2A 1JJFA 2AJCA 2B9VA 4QDUA 2VT7A 4L9AA 5ALDA 2XUGA 1J1IA 5AKEA 4EY8A 4WFKA 4L3WA 3EIOA 3NGMA 3L1IA 4ZRDA 2HADA 3I2HA 1BEEA 1A7UA 3O9MA 4IH1A 5HF5A 1VZ3A 2QKYA 5IVHA 1N5RA 3EQ8A 5DYTA 4G8DA 3HI4A 5HQ3A 3V1LA 3VVLA 5AK3A 1UK8A 5A62A 1JJIA 1IMJA 1LPNA 3DEAA 5AK5A 2HU7A 2JIDA 3BWXA 4FMPA 2XLBA 4UHCA 5BWBA 2HA6A 3QZUA 4X85A 5JIBA 4E46A 3C45A 2I03A 3D7RA 4J0HA 4QWWA 4HXFB 1BRTA 2PSFA 2DFPA 4BCBA 5ALSA 1K63A 1LPBB 4QEKA 3H1AA 5LZ2A 2YH2A 2QXTA 4PSUA 1THGA 1ZICA 1O6FA 4H18A 4JNCA 5EI5A 1C7JA 5ESRA 1ZI8A 1UZAA 4FHZA 1TQHA 3KDAA 1CFJA 1XQXA 2DHEA 4V2IA 2JGEA 1VE6A 1R4ZA 4HAIA 4BE4A 1CUWA 1MPXA 1XZEA 5LZ8A 4DSAA 3RK4A 1BU8A 3B3QA 2NW6A 4BYMA 3EQ7A 3F8SA 1QIKA 1FFEA 2XUFA 4E14A 3VKFA 2J3QA 4Y9SA 4FLFA 2WUFA 1XRQA 4CFSA 1U8EA 3QMMA 4X92A 1JU4A 2XMZA 3I2GA 1UOOA 4UFNA 4OB8A 5AKHA 5K3DA 4B6GA 1W76A 3IVMA 1XZKA 3DDUA 5I9IA 1TK3A 1ETHA 2XMGA 3SC2A 4X94A 4BCDA 2IX9A 4K6GA 1WB6A 4MEBA 4H77A 2XQGA 3ILSA 1SCQA 2DCMA 1GKLA 1U4NA 2PVSA 2WHPA 1WB5A 2XQJA 5LYYA 1UT6A 2DSNA 1QTIA 4Y2SA 4Y2YA 4U2GA 5K3BA 4Q34A 5E2IA 4C89A 3N0TA 3MGAA 2O7RA 1TRHA 1XQVA 4G9EA 1A8SA 2WUDA 4MYSA 4LXIA 2QR5A 1YA8A 4INZA 4KYVA 3R3UA 4IH9A 1SCKA 1EDEA 1CUXA 1XLVA 4OB6A 1CUYA 1E66A 2CJPA 2JEZA 4A16A 1N8SA 3GA7A 2PU7A 2D0DA 4G4IA 2GYUA 1Y37A 4CIAA 7YASA 2DQYA 3DYVA 3FYUC 3N2ZB 3BF7A 3PI6A 5CH3A 4OUKX 3D0KA 4J7AA 1BN7A 1PV1A 1CRLA 4MQMA 3O4HA 3PUHA 1CUUA 5AP9A 2VT6A 3H2JA 3H2IA 5ALHA 4MEAA 2HHAA 3WJ2A 4EBBA 1AZWA 1F6WA 5CH8A 5AM1A 2WUEA 5ALOA 5ALGA 5CURA 5EFZA 4GWLA 5DYWA 3WL7A 4L72A 4ZV7A 5CXUA 4AMYA 2Z3WA 1JI3A 2QJWA 1CPYA 3AIMA 2D5LA 2QT9A 3MUOA 2Y2VA 3STVA 3E1GA 3H2HA 4DNFA 4BAZA 3AINA 3C5WP 1KU0A 5AH0A 4Y2XA 3H2GA 2XMQA 5CXXA 4NS4A 4AN0A 4Z49A 2OPHA 4UHFA 3IUNA 2XB6A 2JGJA 1VOTA 4EY7A 1CQZA 3OURA 4KJXA 4KRXA 4I4CA 4B9EA 5HF8A 1VJ5A 3FLBA 5JARA 3OTQA 3SX4A 3O4GA 5HFAA 3T52A 1KU6A 1FFAA 1UK6A 3I1IA 1P0PA 5C8XA 3IA2A 5DNVA 4B0PA 1L7QA 4UFOA 4UHBA 1YSCA 4LHEA 5A6VA 1QFSA 2I3ZA 2HDWA 3DKRA 1F0PA 2CKMA 2BFNA 1HBJA 1D07A 4CCWA 1NX9A 1YS1X 3ESCA 3VDXA 4U2EA 4BAGA 5EHZA 1G42A 4DMFA 2B4KA 3W05A 4AZ3A 1TAHA 2O2IA 3FSGA 3V1NA 4B83A 3G7NA 5AIAA 5SYNA 4NVRA 1XRPA 2XE4A 3T4UA 3AFIA 2OGSA 2PL5A 4X90A 4K6HA 3AZOA 3BJMA 2XMRA 4DGQA 5HKBA 4Y2JA 1EA5A 1RP1A 1T2NA 5YASA 2JEYA 4UBLA 2PBLA 2AJBA 4PSCA 1YA4A 5AKZA 4UFPA 3BDIA 1LPMA 1L7AA 2BUAA 2RIPA 2HA7A 5K3AA 5T4BA 3MVEA 1UK9A 1Z68A 1HQDA 2JGFA 1AC5A 5JZ9A 2HIHA 5CW2A 3WK5A 4F5ZA 4OD0A 3K2IA 5AK4A 1A88A 3DL7A 1DINA 3IULA 3H2KA 2JGMA 4ZXFA 5AKKA 3PDCA 1TCBA 1P0QA 4K5QA 4GDMA 5JAOA 2JBWA 3I28A 2PUHA 3KWFA 1DU4A 4WY5A 2CUTA 2PM8A 3W9BA 1MJ5A 4O08A 5ALFA 4J0GA 2P8SA 1QIIA 1DQZA 5E4YA 2XUKA 1NU8A 3STYA 5EIAA 2W6CX 1ZIYA 4P08A 1ZJ5A 1DWPA 1EINA 4E15A 3G9UA 5BWCA 1MAAA 4W1SA 2AJLI 2H7CA 3FAKA 1CR6A 1ZOIA 2XMCA 5J3JA 2E3JA 1H2ZA 4U2DA 5C7YA 3WK6A 5ALTA 4QWMA 2ACEA 3IURA 2ZSHA 4FLEA 1QO7A 2VAVA 1JMYA 3LCRA 4N5IX 5C8ZA 5EHQA 3C70A 4XVCA 5JAUA 1UOQA 1M33A 4X71A 4FWBA 1QIFA 1X2BA 2OG1A 1QO9A 3WK8A 4B85A 4Q3KA 5JATA 3HYSA 4AN1A 3FNBA 1QJ4A 3DLTA 2XUJA 1WHSA 2H7XA 5JD6A 2BKLA 2XT0A 4JYPA 1VZ2A 4FTWA 3WWCA 3G0IA 2GBFA 2WIGA 1SFRA 5DYYA 1UWCA 1XLUA 3WZLA 1ZJ4A 3HABA 2BGNA 5K3EA 4PSDA 1LLFA 3Q8WA 1GPKA 4C01A 3FSGD 2QM0A 1UOPA 1CUDA 3AZQA 1AMNA 3D4LA 1J2EA 4X7BA 1ODTC 2HA2A 4JH0A 4PF1A 1LGYA 4X95A 5AKYA 5T4FA 4EY5A 3WQHA 4KAAA 4CCYB 3R3XA 3ICVA 3ANTA 3VJKA 1AUOA 2Q0XA 2DHCA 3KSRA 3WKBA 2XDWA 1ACLA 4BATA 1JFRA 5ALJA 1QGED 3DOHA 1YCDA 1ZD2P 1AGYA 1ODSA 1F0NA 5FPQA 3QBJA 1ZD5A 5BOVA 1CUIA 5K3FB 1O6GA 1ACJA 4GBGA 3C8HA 1ZI9A 4UHDA 1EB9A 1XRMA 5H3HA 4DNOA 3A2MA 1UKAA 3K6KA 2WILA 1IZ8A 4GXNA 1XZHA 1MX5A 4KEAA 4BP9A 4C88A 4C6HA 2V97A 4B84A 2PUJA 4S0XA 3RLIA 3U1TA 4NMWA 3FYUA 1CUZA 4Y2VA 1CV2A 2CEKA 1XRNA 5LZ5A 3STWA 4C87A 4HXEB 4RPCA 3ZWQA 3R41A 2G4LA 1W52X 2QTBA 1EK1A 4N8DA 3FBWA 3PUIA 3PF8A 1QTRA 4BVJA 1QLWA 3VXKA 2RGUA 4W9RA 4X3CA 1GZ7A 5D3ZA 5HZGA 3U0VA 2HM7A 5K5EA 1MNQA 3HZOA 3F9CA 3QM1A 4FNGA 1XZAA 3D2AA 4WDQA 1HDEA 2OCIA 4J0JA 3DL4A 4BZWA 1X70A 4U2CA 5ALNA 4OU5A 3CCBA 4XIIA 2VEOA 3O0DA 3R0VA 4KE7A 5ALYA 3RKSA 3BJRA 3S2ZA 3DNMA 5A7FA 4W1PA 1Q83A 4C4ZA 2QRUA 4GEGA 2WJ6A 3LS2A 2WTNA 4N8SA 3FLAA 1DX4A 4CIBA 3OPMA 4UHHA 3G0DA 2X5XA 1CEXA 5AM3A 2CB9A 4BCCA 2H1IA 4UBNA 1H2WA 2HL6A 3FOBA 1SOMA 5CT8A 4FNMA 1PJAA 1YAJA 4J03A 4WFIA 3BDVA 4I3FA 4QE3A 1CQWA 1KEZA 5AKXA 3DOIA 2WTMA 5AI8A 1MTZA 3G0CA 3S8YA 2XI4A 2XUIA 1ORWA 4P93A 4FDMA 4UPDA 1OCEA 3G0GA 3HJUA 4XX1A 4UBKA 1ODCA 3H19A 2JF0A 5DJ5A 5AOBA 4HS9A 1OILA 3W06A 3PFBA 3O4IA 3WL6A 3D5EA 3GUUA 4DYHA 1CIJA 4A23A 5JALA 1VA4A 5I7UA 2GBCA 1N5MA 2HRQA 1LBSA 1E5TA 4K6KA 3HSSA 4GW3A 3WK4A 4EZIA 3PF9A 4C4XA 1N1MA 2XMDA 1CVLA 2I3DA 2QZPA 4HRXA 2G63A 3BE8A 4UUQA 4OPMA 4QLAA 1EVEA 4B7ZA 2WHRA 5AKLA 4K2AA 4HZGA 1Q0RA 5FUMA 4EHBA 3O9VA 4H7JA 2ORYA 3LP5A 2V98A 5JZSA 1XZCA 4B82A 4WDRA 4AQDA 5LKAA 1THTA 3G0BA 3WWEA 2X8BA 4G4JA 4U2BA 4UHEA 2GZSA 2J4CA 1S8OA 1JKMA 4J0KA 1VA5A 5IVKA 1CLEA 4H7KA 1MAHA 3QPAA 1DQYA 2YXPX 4FBLA 2Z8XA 3VISA 2C7BA 1XZIA 2WSLA 4G4GA 2OGTA 3C6ZA 3B5EA 1PFQA 1R1DA 1LZKA 4ETWA 1QIEA 4RGYA 5FV4A 3DQZA 1LPSA 4W63A 4OU4A 5LZ4A 5C8VA 2PU5A 4XJVA 2XQFA 4F0JA 5E4TA 4H7EA 4Y2TA 1IVYA 1B41A 1QFMA 2HU8A 3W2TA 3BIWA 1CUGA 1SCIA 3G9ZA 3M81A 4FOLA 2ZJFA 5EIEA 4AO7A 4DMCA 3OC0A 4AMZA 2EDAA 4DNQA 3WWPA 1VXOA 1GPLA 3D3NA 1LBTA 3ZLUA 2WHQA 5FDFA 2HFJA 4MYDA 2G5TA 5ALPA 5DTJA 4CCYA 3JW8A 5LZ9A 2WJ3A 5CRIA 1X2EA 2WIDA 4J0IA 4RE5A 1K5PA 2WG0A 5FLKA 2WFMA 1EX9A 4UBJA 4BDTA 4KAJA 5LZ7A 1CUHA 5CMLA 4BC1A 5D6OA 1MNAA 4PQEA 4X6UA 1YASA 3V9AA 2WLSA 1R9NA 5K3FA 3WIBA 4DTCA 4B80A 1QIDA 4OCZA 4G8CA 3ZLVA 3H18A 4Y2PA 3WK7A 3FVRA 3H1BA 1JT2A 3AUKA 2BJHA 3IDAA 4W1QA 4WJLA 5AO9A 2G5PA 4M0MA 4AX4A 2VATA 2VJDA 4TGLA 2HA4A 4AO8A 2DQZA 2XMSA 4MWTA 5EIHA 3CXUA 3FVTA 3MUNA 1YAHA 1YS2X 4MXDA 1YB7A 3WL8A 4LIPD 2JGIA 3PICA 1XLWA 2JGLA 4ROTA 4FBMA 4PV7A 1HLGA 1EH5A 2J3DA 1EXWA 4BBZA 3GFFA 4OYYA 4X00A 1RYYA 1VXRA 1WCYA 2VA9A 4MQLA 1U65A 1XRRA 2C0QA 3IUJA 2OGZA 1DWQA 2V96A 1CUVA 2O2HA 4D9JA 1DWOA 3HC7A 4DM7A 1FFCA 1WM1A 2WIKA 3WI7A 3PE6A 4J0DA 4ARBA 1W75A 5JASA 2QJRA 4Y7DA 3Q0TA 4G9GA 1IUOA 1TCAA 2Z8ZA 1DTEA 5ALXA 1I6WA 3UUEA 5JYCA 2JGKA 2ZJ7A 1L7RA 5C81A 2C0PA 3WMRA 2RONA 1HPLA 1XZGA 2HA0A 5LIPA 4P9NA 2RI6A 5CT4A 1XQWA 3WLAA 1VLQA 4KRYA 5ALMA 1AKNA 4RNCA 1EDBA 1P0IA 1YR2A 1Y7HA 3AILA 2Y6VA 3FCXA 5ALLA 1XRLA 4WY8A 1U2EA 3G9XA 1LPOA 4YPVA 5JANA 4YASA 4BZZA 1XZJA 4GLBA 2Y6UA 3HRHA 5DNUA 4BTLA 5I8PA 4Y2RA 4ARAA 3ICWA 3CCCA 1CUBA 2RHTA 5JD4A 4N8EA 3F97A 3WIOA 4BDSA 3C6BA 2QS9A 4C4YA 3WJ1A 3SK0A 4QNNA 2PSJA 3STUA 3GELA 4AB1A 3LLCA 4G8BA 2OQIA 4N5HX 4DIUA 3IB3A 1BS9A 1ZI6A 2H9YA 4BB0A 4QZVA 1LPAB 1VE7A 4KAFA 3VJLA 3QYJA 1GGVA 3V1KA 3ZI7A 3BL8A 4QLOA 1TIBA 4FFVA 1XZDA 3AZPA 5IVDA 3WZMA 5T4EA 5DNWA 5DWDA 3G9TA 2WQZA 1WOMA 2B20A 1HL7A 3EF3A 5CH5A 1RWQA 4UBOA 5KWJA 3WKDA 4LXHA 2R11A 3E0XA 5JZBA 1WB4A 3C6XA 3EBLA 3WKCA 2IITA 4H7DA 3A2NA 3HEAA 4GHWA 3D59A 2HA5A 5IKXA 5CBKA 4MJ3A 3QH4A
chains in the Genus database with same CATH superfamily
1XVAA 1KBQA 2JI6A 5PNTA 3ZE7A 1TT7A 2X5JO 2RGGA 2VAMA 3PUJA 4HDRB 1XQ6A 4MR9A 1JG7A 1P9RA 2OM2A 4LDJA 1XDWA 2ORVA 2P8JA 2W48A 4I19A 2GK7A 1JBEA 3PRYA 3BFVA 1Y6JA 3UCXA 1T4DA 3N2GB 5B64A 4B3IA 1JBQA 1YOVB 1OV6A 3VQTA 4POAA 1W4CA 3U9TA 4KR3A 3F73A 1BHJA 2EJVA 3OOEA 4DZRA 3TRHA 3IP8A 1C3OB 4WCFA 4YP5A 2ONCA 5HRCA 1OXUA 3L6EA 3TZ6A 1MW8X 3I01M 2V7TA 3R44A 4UU7A 3PR1A 1P5FA 1Q6YA 1P1HA 4RABA 2X2OA 4WEOA 4CMCA 3RS7A 4G26A 1TCCA 1UKBA 1VB3A 3HBAA 5DMHA 2E7ZA 3EQ9A 3GROA 2ZTUA 3CVOA 1Y3IA 4RZIA 5ALEA 4DCJA 3W3AA 5AVSA 2ZIEA 3IPLA 1CEEA 1JWBB 3EA4A 3HCFA 1CY6A 1TQDA 3T3PB 3D8TA 2BFDB 4Q3CA 4S1WA 4NDZA 3FKSA 1OU4A 3O47A 2B4AA 2NNLD 4YBZA 3RRBA 3L7MA 2R48A 3IBTA 4EUFA 4YT4A 4KU4A 2AN5A 3FMGA 3ZHXA 2EQ5A 1PJQA 5KCZA 1FX1A 4RELA 3THXA 4LY3A 2HZBA 1CEQA 3UAGA 1WMSA 3FZQA 1PR1A 3NWOA 4UATA 3ZV4A 1ZD3A 3Q7IA 3K9CA 4F3RA 4UU0A 2EP8A 2XUPA 1TTHA 4IXDA 4MWBA 4J9UE 4E4YA 4MVJD 4C4TA 5K45A 3RC8A 3D9QX 3K1JA 1XAJA 3UIEA 1YJXA 2P90A 3RSOA 3TZQA 2FG5A 2V4UA 3HO6A 2Q5QA 1HI9A 1XXHE 2GFHA 2UZ1A 3IUEA 4DRXB 2QJOA 1JXOA 3AHFA 3I2JA 2PMCA 3MLBA 5EJ4A 5BUZA 4RCYA 3RIGA 1SHZA 4HNRA 3CLTC 1MC5A 4J94A 3MXTA 1YUBA 4X6YA 3A6HA 3UUFA 4M8LA 4BKUA 1ECPA 1XUOA 4GM0A 4YMHA 1WZEA 1SOWA 4QHYA 3FRJA 1O5TA 5I7WA 5L9AA 4A8PA 1U2GA 4DOMA 2PD4A 3OE4A 2QTAA 1XPRA 1K7YA 2IE0A 4P81A 1JDBC 3FDFA 3HM2A 3MWDB 3UNXA 5EZYF 4IL5A 5AXAA 5TGZA 1WKBA 1KBZA 1MMFB 4DCVA 4FHCA 1DC6A 1SA0B 1XCGB 3C3BA 4H1UA 3K0CC 1LD3A 4HLCA 3UTDA 4RTLA 5JLJA 2BM9A 1VIAA 5J2UA 2H2WA 2CMHA 3C4QA 2NU6B 4PZUA 4N47A 4F8JA 3JQBC 3LSTA 2G40A 4GPEA 4MW7A 4KFSA 4WZBB 1DMRA 3M7IA 2I9PA 1LSSA 4TPKA 1J21A 1CZHA 3KXPA 1K8QA 4Q4HB 3UM9A 2N42A 1N2OA 4L1KA 2P1RA 4C5AA 3O73A 1IN1A 2FSGA 3NEJA 3N2KA 3P97A 1FJXA 3UA3A 1P1CA 4Q3DA 4QO7A 2W7TA 1WETA 5C31A 1YQGA 2FAXA 1I3MA 3MHPA 1Q20A 3DTVD 1J0BA 3DGEC 3LQ1A 3BFKA 2QOEA 2C5FA 1RRFA 3UH1A 1BVUA 3FYTA 3MUFA 1R12A 4N5DA 5TSDA 3D6TB 2VQSA 1EFTA 1VPVA 4Z3DA 5BSGA 2FE1A 2AFHA 2WFZA 2XRYA 3M3HA 4J8PA 2QBYB 1FIUA 1BTOA 3KK0A 5IABA 3MT7A 3VRHA 1HUQA 2IPNA 3QF4A 2V0GA 3TDMA 1Q1AA 1Z7WA 2PEZA 2EXXA 3OLWA 2PGNA 2PS0A 2VF2A 1UC8A 3DMHA 3PS9A 2J5QA 4MWSA 5JADA 1ADJA 1IU9A 1CIPA 2REQB 1EP3B 3PC7A 3UKJA 2RK4A 1ESZA 3NTLA 4J49A 3EIHA 3MILA 2H4ZA 4PO9A 3QJ5A 4TV9B 3T3EA 3UMVA 3JRXA 3V7UA 2FR8C 2PKYX 1RKXA 2O7NA 2PX5A 1BH2A 2R8RA 3AEQB 1HKHA 1N5DA 1TK2A 5LP6F 5CT6A 1A1VA 4Q15A 2C95A 5KJEA 3GEGA 3Q8XB 1E3WB 4N41A 2I2XB 4GVXA 4BV2A 2LIVA 4GOXA 1EHYA 1LV7A 3MTBA 2PR2A 4CQMB 1T8RA 3NUZA 4MUFA 3O1LA 3WQQA 4ONEA 5IAAA 2OAP1 3UPUA 2BLNA 3A25A 3FBTA 3L7JA 1EB8A 1UXJA 3BRQA 4FFLA 4FQ5A 3OSUA 3VHXB 4BQNA 4ABTA 5I01A 4KNYA 3RNOA 1SWVA 3E5NA 4WKOA 2C5SA 1DZIA 1LBEA 3QITA 1YL6A 3RTGA 1DS6A 1PRYA 2HQOA 4CCAA 3EGVA 1NXXA 4AP5A 4D0RA 4WA8A 1ID8A 2PGIA 3GFVA 1C0LA 4C3OB 2PMKA 1WDMA 4BTEA 4K05A 4CPDA 3CURA 3LUHA 5A5FA 3DOOA 5ALVA 3CKMA 3MS7A 4UM7A 4DXDA 2A35A 4MUAA 2D8MA 5EMKA 2A9PA 3MCVA 1P44A 2ADMA 4UVEA 4B73A 4P3OA 3AEUB 4E4TA 1JIJA 2DGDA 1R5OA 4FT2A 4JBGA 2EG9A 421PA 1U4SA 3Q3CA 3OJEA 3G6KA 3OE1A 3EXIB 1YFKA 4I4TA 4OXXA 4Y9UA 5COQA 3R3ZA 3EX7C 5KMGA 4PZPA 4WN3A 3KOXA 2IW3A 1F8GA 1V3VA 4JYBA 4JBYA 4Q82A 5K8VA 3L79A 2PO5A 1JSZA 2VHTA 4JEIA 4EF4A 3IAM6 1RWBA 4YMGA 3KWLA 1EE9A 2EJCA 2LKCA 3IAS6 3A9RA 3RVBA 5H59A 3PNQA 1FRZA 1IPEA 3EOBI 1KZ7B 3KELA 1O0BA 3WLJA 1JDVA 4UAUA 3NPMA 1P60A 4K9OA 1YRYE 2IHNA 1O57A 1E1RA 3AU8A 3LX6A 4P3NA 3DCYA 3I76A 3ROGA 5I7OA 4JITA 3DEFA 4R16A 3BIOA 4TT3A 4AI6A 2J5RA 2QZ9A 4KDFA 1DJNA 2Y1CA 2A1TS 5DK6A 2ZS8A 3ONDA 3QMWA 2Z30A 1TO1E 1CYDA 1I4OA 5ED0A 3E70C 1OLSA 1VJ1A 1U3DA 3ECAA 3PUKA 2A9FA 4QVGA 2RARA 2ISSD 4KX3A 1JKJB 1JPJA 1JL3A 2ZIWB 2IQ5A 1Z7YA 4IQ4A 4NYJQ 5DTIA 2NZ2A 3PNBA 2Y8EA 3IP7A 5GQSA 3RTBA 1UXOA 1KYZA 3IQEA 3VKVA 5ALUA 5AI4A 2HA3A 1M8JA 2Y1WA 4M1OA 1PBNA 3UMJA 2GCEA 4MJLA 1DLIA 2Z95A 1WUIS 4FFBA 4PLFA 1SXJA 3GEHA 3UJCA 5L7TA 4DWWA 4TTAA 2ZR7A 1KMNA 1NONA 3V7YA 5F78A 2HLDA 2OO5A 3VAAA 3ZQUA 4GXQA 3CQ9A 4HAOA 3KXDA 3DE1X 5K0LA 3ESXA 4RVUA 2FMHA 1HEYA 1XD8A 1DRKA 1YZKA 5TF4A 4MUMA 1CZLA 2QLTA 3C8UA 4XIGS 4XKJA 1XNQB 1KJJA 2GCNA 3BN3A 1KI2A 1Z4JA 1GR1A 1VCMA 3NHSA 1JKXA 3DCNA 3I04M 1U2GC 3OUUA 1O6ZA 1X8JA 2AZMA 4K9RA 4TQGA 2WU4A 3QU7A 5JDCC 1YU9A 2BFBA 1I7QB 4YXWD 3AH8A 4FN5A 5LOVA 4IWNA 1IZ9A 4KWIA 1E0JA 4NZNA 1GN8A 2XBLA 4MAAA 1RHRA 2YVLA 3UMFA 2H1VA 4IO0A 3T0GA 4EDFA 4GZ6A 5LNK1 2PSEA 2HBZA 3D8RA 3A1DA 4DQKA 3VR3A 5THQA 3KX2A 3VI4B 4EG5A 5EZYB 2VZ9A 1JIQA 1W93A 2XXJA 2X0KA 2QLMA 4MQ5A 1T2EA 3UW3A 3F98A 4BUCA 1ZBQA 1AGNA 2PSDA 2ZTSA 3BCRA 2OUIA 3LQQA 1QIHA 2A67A 1IZ7A 2WW8A 3CBQA 3Q9UA 2AGVA 4S35A 4CM4B 1B0AA 4Y1EA 4TXJA 4BMPB 3ET4A 3I6ZA 1M67A 1A9RA 2H06A 1YULA 2IF2A 1P77A 5H3LA 4LF9B 4FVTA 2BEVA 2VJCA 2DHRA 3PWTA 5K6AA 4L6IA 4CJXA 3G8AA 1DKNA 3FJYA 1M6EX 4HATA 4Q9AA 2F64A 4CV1A 5C7IO 1GSAA 1J24A 5DXJA 5JBIA 5AXCA 5J5CA 2PNJA 1ZK2A 2QQEA 3HRIA 3OA0A 3SLRA 4LISA 3DD5A 1JECA 3OOSA 2V3VA 4HYYA 3WKEA 2G9NA 2WG2A 1E4EB 4FC6A 4LDQA 2DKFA 2BEJA 1B2LA 3CVUA 5E1BA 1Y7IA 5LJIA 3AVYA 1BKYA 4O2BB 4LC1A 4UNSA 1WUKS 2Y1DA 3KYCA 5ER6A 1PZXA 3NNDA 1JJVA 4YLGA 5LCXA 4XYEA 3U1VA 3OE7A 3LTNC 1S4MA 3A58B 1E1MA 2QXUA 5C8YF 4OQQA 4XSHA 1E9AA 2PXHA 2ZIXB 3GF4A 4JLKA 5DVZA 4L5JA 1S2DA 3AU9A 4M36A 4V0RA 4QQ8A 5C34B 4INAA 4HEQA 1NZDA 1ZC4A 4BQRA 3DBHA 3GP5A 4MS4B 4I9UA 5CM2Z 3GVXA 1UBCA 4N65A 3AGPA 2E87A 3NEPX 1Q17A 3NTQA 4LJ4A 3PQ3A 1UJ4A 3T4XA 4AJ4A 5FA6A 1QRDA 5BVHB 5SZKB 1QF7A 4YV7A 1COZA 5LP6B 4J1QA 4KMSA 5TPWA 4C1NA 4BX3A 4E08A 2ZI5A 4ILEA 4DZTA 3KQSA 3J7AC 4LXTA 4EA9A 1LLCA 4LJKA 2ZUDA 3TYXA 4EPWA 2X8AA 4ZK2A 3AI2A 1YI8A 1U7DA 1QZ3A 4OB7A 5ALWA 2BFEA 1PQYA 3D8BA 1MB9A 2BFMA 3E1KA 1EEXB 1N8TA 3PITA 4YDHB 2WYHA 2FOXA 2XGGA 3LDAA 3LY8A 4HDNB 3BTOA 1R0ZA 3I2FA 2GZRA 4DMHA 5C5DA 1OH7A 1OWMA 2ZJBA 4QDXA 2W83A 5DN6D 1TF7A 3RVSA 3GLGA 5CHYA 1SULA 1CS0A 1VE9A 2G88A 4HADA 1AA9A 5D3MA 4Q1BA 5L8VA 1MGOA 3RHSA 4LF7B 5FA5A 2Q2NA 4R01A 2NQ2C 1VRCA 2HXYA 3LBNA 4WEQA 3Q3JB 4MH0R 2KMLA 4W7IA 5GGXA 1KEEB 5BR4A 1PK7A 4IXTA 2OCGA 2VJOA 4EJ6A 4F85A 1FSPA 3E3OA 4HDRA 4TS1A 4UQOA 5K6TA 4LNAA 1TM1E 2DPHA 4QA9A 4R68A 1XZBA 2YMLA 5CLIA 5EWMA 4BMZA 1WOYA 2BMEA 2YVQA 5HJ2A 5E8RA 4KQCA 4FD3A 5CNMA 5B1YA 5M29A 5MFZA 4P7FA 2GKOA 1I01A 1DBPA 3N2GA 3WLIA 4BEVA 1KBOA 1YOVA 2QTWB 2C94A 2FN7A 3IQIX 4JQOA 3IUMA 4BNTA 1FVHA 1C3OA 1NVKA 4JVNA 5CTAA 4QASA 3LYAA 5EC8A 2Y1XA 4LI0A 3CZRA 4WY2A 3UZUA 4LX0A 3MRXA 5CDHA 4M37A 5AJHA 4URFA 4HOYA 5BV8A 2FUCA 5TJHA 5T5QA 4QVIA 4Q7QA 4NH4A 1U0SY 1CETA 1L4FA 1XROA 4JVLA 1OZGA 2DR0A 4NESA 4QYWA 1ISGA 1FUYB 1XD2A 2GZ2A 2HWXA 4OP3A 4AJJA 5B6PA 1PUIA 1QPGA 2OCKA 1SXJC 2QVBA 2Y2UA 3HB5X 2O50A 3OWHA 5CVCA 4QLBA 3JAKA 2D0IA 3TLKA 1TLLA 3FSEA 3BGWA 3FFTA 2OE2A 2PGOA 4XASA 4RF5A 3VU3A 1T2FA 1K5GA 2VLIA 5IT5A 1L7EA 1Y8CA 1XMQB 2FPSA 4RLFA 3P9PA 1BEZA 4H7IA 3IIEA 3C3MA 1AURA 1G5IA 3VR4H 1Z37A 2WWXA 3DA8A 5C32A 1U0HC 2JZOA 4QOSA 1AQIA 1EI9A 2OR3A 4ASUD 1HYGA 4HVAA 3K2EA 3OIVA 3DTNA 2WWYA 1CQPA 5AOCA 3MFYA 4HB4A 4YRLA 3FRHA 1YKFA 4B34A 3R5FA 4TTJA 4DRXA 1A8QA 3CRNA 3IT0A 4RY0A 2C98A 1S3FA 1ECLA 3A3PA 3ZPXA 4DCNA 4H4DA 5HQJA 4GX0A 2ACKA 3NHRA 5IH7A 1ISSA 3W6PA 4QULA 2RMKA 3PQ4A 4HLQB 4KQXA 3RRFA 4ZALA 3QXJA 4PYJA 2WSMA 2CNNA 2EYQA 1XG5A 4RSHA 3JR3A 3R2JA 3VOTA 3H1TA 2A5LA 3W04A 3LVBA 3ERCA 4OKNA 3FHLA 2X3UA 3DMRA 4I08A 4R69A 3M1IA 1O97C 1N5IA 1E3QA 4LKOA 5TQ0B 4ALJA 4E1AA 3INTA 2B1RA 4GL2A 2VI5A 1NE7A 1BVYF 1NVFA 4TKLA 4X66B 3KZCA 3OPXA 3MWDA 2YBEA 2A5JA 2YINC 4C0AC 3PQFA 4KH1A 4LJLA 3RU3A 2HN9A 4M7PA 2ZRJA 2ECFA 1SA0A 3NC0C 4J07A 4D4MA 3ADPA 4KIFA 1O77A 2PYDA 5JDIC 3W9SA 4TKZA 4QBHA 3CUKA 3TEJA 2BGKA 2FX5A 2NU6A 4IMIB 2PZJA 1YBFA 2HC9A 4UMFA 4B0OA 5AW8A 1JDJA 1Y5LA 1NUTA 2FQQA 1JSRA 2VN8A 3ZVLA 3DXXA 5FLEX 5KDDA 4Q3OA 4Q4HA 1SKUA 1W2WB 2BZSA 2YRWA 3PFHA 4NDAA 4XUGB 3TBKA 4TTQA 3C5VA 4DSZA 5BQ3A 3ELWA 3VTAA 5ADHA 3ASVA 3BT7A 3ZY2A 1C9DB 2WY2D 3D1JA 1NY5A 3FI9A 2H1SA 2GS9A 5FEUA 4J2TA 1I6LA 1L7PA 1NSYA 5DLEA 3TH5A 5AM4A 1GWNA 1O0SA 1OWPA 2A2ZA 2IEIA 2Y1EA 3LDHA 5HR5A 1VSUA 3OY2A 1IN7A 1ZOPA 1NXVA 2OLEA 4R9UC 4B81A 4I4NA 4EAQA 2QBYA 2OB2A 1QZXA 5FHRA 4BIMA 3TPFA 2Q99A 3CMMA 1BS1A 3FNGA 1IVSA 3GJRA 5FUWA 4JOQA 1NQTA 3KOUA 4HR7A 1MFZA 3LL4A 2C4HA 3UT0A 4ZZ3A 2EZ8A 4OH7A 1ZHHA 3VGPA 4M9UA 1AVTA 2REQA 1XRJA 2GJ9A 2R6GA 5HEKA 5C8YB 4JFRA 4TV9A 2VHQA 2VWHA 5KREA 4UW9A 2FPRA 1LV8A 1R9MA 3G5LA 3K35A 3QE4A 1AS0A 5DGCA 4GI1A 1VL8A 3EPRA 4J16A 1YQ9A 3AEQA 4E13A 3ZD7A 2Z1MA 4J0CA 5CB4F 3FPEA 1NAHA 4U7FA 3KQKA 2RHMA 4I6EA 1LBIA 5JISA 4YRFA 1E3WA 3B8HA 2FMXA 3BQMB 1JYFA 3ZLBA 3IKJA 2F2TA 1Y98A 4IWYA 3ST7A 4BN0A 4CQMA 1AX9A 1I2CA 4A03A 4F9EA 1T9DA 2YXEA 4TL7A 4UAGA 5F9MA 4PEVA 3VHXA 5JRZA 3ABOB 5HUJA 2JH8A 1QE0A 4DEVA 2X77A 2Z4TA 5LWQA 2L18A 1XQYA 3GN2A 4PR0A 1UFKA 1T5SA 3ZU4A 4KFTA 2ZYHA 4PBRA 5C51B 5BSHA 1JU3A 5HYVA 4PG5A 3VGJA 3EFOB 5ED4A 10MHA 5ECGC 4DDKA 4KYTA 4TQAA 3TPZA 3WE7A 1VHLA 4UBMA 4WWHA 3WGUA 5J4VA 2FX3A 1M34E 3ILYA 5FWAA 4RTKA 3EN0A 1D09A 2Z8YA 1Z6YA 3GQVA 4OH1A 5ABPA 3K6SB 1HDRA 5GV7A 3UG7A 1SC6A 4A6EA 4E1BA 1PZFA 4FYHA 1IK4A 4YT5A 2B8TA 4H0CA 4MIOA 3B1WA 4X8LA 4BVEA 4R2JA 2VDMB 1W46A 2R8ZA 3DHEA 4OG2A 4F3KA 1KTIA 3C3CA 2O54A 2CBGA 1BU5A 5BV7A 3W9UA 1P18A 4QXMA 1CQXA 4R9VA 4X7MA 3LQRA 4DW8A 2ZP1A 1HQKA 3NCTA 4DR7B 1LFDB 1I30A 1YRWA 3X3HA 5C8DA 5IDWA 4NYMQ 2TMDA 2Q4TA 1TGVA 3ES9A 1G8PA 3BMCB 2JD1A 3GLIB 4GKKB 4UMEA 5K0ZA 3BJZA 3FMPB 1SJ9A 4RIHA 3IYLW 4ZV9A 3RIYA 4AZSA 1JVSA 1QH1B 2OCXA 2NUPA 3EW7A 2M98A 3MFQA 1G5QA 5LB2A 3QV2A 1VSQA 3QUCA 4JEUA 1QV9A 2IY8A 1IY8A 4UUMA 5JHGB 4DR4B 3ZKAA 1GRRA 2BDUA 2PZ8A 2EL7A 2V1XA 1R4AA 2X1MA 3H04A 4LCBA 3CNQS 1P1KA 2HU2A 4KGXA 1PR3A 4P58A 4YR9A 5A4FS 5B55A 4JKYA 5CEFA 3B5JA 2OHVA 1ZNQO 2CMFA 2JCBA 2QN6A 1JKJA 4XFDA 3R7SA 3ZV7A 3GZJA 1SKQA 5LMCA 3CXRA 1GTSA 1KY3A 1UBSB 1YMQA 5IPFA 1KVQA 5CX4A 3PWSA 3K2BA 4N03A 1RLMA 2J0SA 1Y3DE 3ORHA 3A4NA 2WYWA 3WB2A 3CINA 4BVKA 4LDRA 4ZODA 1JMKC 3WWOA 2KPOA 4BX2A 5GY7A 3SXUA 2H1RA 3WA7A 1CULC 4R51A 3KUUA 1M7HA 1GGFA 4PYIA 1HY3A 1SK8A 1N6KA 3FCAA 3CNLA 3WNVA 4OQFA 5HX7A 5DGDA 1I6KA 2WNHA 3L4EA 2P9QA 2ALJA 1YF3A 4UDYX 2R6ZA 3HJGA 2EFCB 3NP9A 5ALDA 5KWSA 1TJPB 1ZNXA 2XUGA 4OI4A 1HYBA 1IDN1 2GD2A 1GFIA 1E79D 4GO1A 3JWIA 3LBIA 4FMBB 1SC1A 1JAXA 3AKCA 4JQYA 2WT8A 3FUVA 4DCOA 1G3MA 4L3WA 3GDOA 5BPFA 5E3IA 4ALNA 1C7RA 4ZRDA 4B31A 2JARA 3IV7A 5SY6A 4L4YA 3DNFA 1PUJA 2ZE5A 4CLDA 3GDFA 2FUEA 1ZHOA 1DWUA 4IH1A 4DY4A 3RUPA 4EKNB 1IG3A 4H1VA 4M49A 2NZYA 2QKYA 1KQPA 2XTNA 4JLBA 3S44A 4KAXA 5JMPA 3ZD6A 3RUDA 3OHSX 4B33A 1ONSA 1Z47A 1EAYA 4DLRA 3DM9B 2OV1A 3K1YA 4LS3A 4U8GA 3RABA 4JKIA 5B7PA 1NQXA 6ABPA 4OX9Y 3MGCA 1KAMA 1MORA 2ZRNA 5EZYA 1N0WA 1OWOA 4Q1CA 1CQJB 1NVMB 4NEGA 1P7CA 3U4DA 3TRJA 2HGZA 5TMPA 1IMJA 3JZIA 1YI0A 1LPNA 3UGKA 5KTPA 1ONPA 2G07A 3PWZA 4IIEA 1IXKA 3A3YA 1AO0A 4CM4A 1L5MA 3TFOA 2ANCA 3TQSA 5BWBA 4X85A 1IFXA 3PA6A 4IHQA 2VYQA 2WLTA 1YZLA 3M89A 2ACVA 4HDOB 3VHRA 2PQ6A 3C45A 3D7RA 4XDZA 1LJUA 2GN6A 1XA4A 2B3DA 13PKA 3LK6A 3NAZA 4G9BA 4HXFB 4J0HA 2YOFA 3MJ4A 2YZKA 5IFLA 3TECE 1Q3HA 1M1UA 1XB2A 3FB4A 4JMPA 2JFZA 3G17A 4ZP1A 4CMHA 1J0AA 1KL7A 1QKJA 3O2SB 4RK5A 2FEKA 4G25A 4K9DA 2D6FA 1I36A 1J5PA 1NUUA 1Q7CA 3DBRA 1E4EA 1T34A 4GRDA 3H1AA 4EL0A 3KQWA 2YH2A 2QXTA 3DMGA 5DCWA 2OV4A 1VI2A 3UWOA 3SC4A 4O2BA 4ZOEA 2R00C 4D9HA 1O6FA 5BN1A 4FJ1A 4DL9A 8OHMA 4MP3A 2QQ0A 1U7OA 4JNCA 4C0QC 2I4TA 2ZRGA 5JWOA 1PX2A 5EYPB 4GMDA 4J16C 2P1ZA 3WG9A 3IOMA 3N74A 2P9CA 2EV9A 4FHZA 1J5XA 2ZIXA 3KDAA 2QR2A 2ZAGA 1A5AB 2ORWA 2RHCA 4YACA 1HE8B 2VPWA 2VBFA 3AUSA 4MS4A 4JLPA 1FJGB 1NQVA 1NOJA 4DB2A 3G2HA 2I2FA 5GZ1A 3OX4A 2Y3IA 1DEKA 3HVJA 4G89A 2BGGA 1JR3D 1NW9B 4K87A 3C3WA 1I7SB 5BVHA 4MHSA 3RV4A 3EDOA 3L8EA 5CB4B 1GAWA 3D02A 5LP6A 3HBNA 1BU8A 4MRAA 1TQ8A 3B3QA 2I0FA 2NW6A 3T3HA 4DLKA 2HCFA 3DPIA 3EQ7A 3F8SA 3O2NA 5EJ6A 4ZCIA 2XUFA 3FOFC 2X9VA 3HHPA 4BYGA 2JAUA 2LDBA 4E14A 4OGFA 1EGHA 2R2AA 2ZPUA 1IZYA 3E03A 4IS2A 3IQZA 4PO1A 3OM9A 4LMAA 4I3GA 2QYHA 4PG6A 4ZVPA 1LLQA 2I7TA 3KLPX 4M1YA 2XCTB 3K73O 1P9NA 4UNNA 1ML3A 2WUFA 2ZQZA 3HZRA 4HDNA 2C2MA 2UVDA 2QZZA 2VHEA 5M2QA 2ZBPA 5D1NA 1GCUA 2ODWA 2GUGA 2OA0A 3UBMA 3L7DA 1SZPA 4DCUA 3E9NA 1RLOA 3HHEA 2PUVA 4UFNA 2HTFA 4OB8A 2AMLA 1ID1A 5IZCA 1FS4A 5KSOA 2YWXA 5KU1A 3ZWDA 4WKBA 1KDZA 4BN5A 3T7KA 1KDTA 3OAAA 4CETA 5I9IA 3QKSB 4B8YA 1KEEA 1VLHA 1VFPA 2HLNA 3RFVA 4F1WA 3WLEA 1NYQA 3KSBC 5JNSA 1PE0A 1KI6B 1LLUA 2IX9A 1LWOA 3N0VA 2IFTA 4N3BA 4OHBA 4D92A 1Q0TA 1JEYA 4H77A 1XYGA 4KMRA 5EN4A 3K9FC 3WLLA 5GJCA 2VHXA 3D8NA 1YRAA 2AL7A 2XQGA 3ILSA 2QNRA 5GTDA 5A03A 1PJ8A 1B3BA 3TSWA 1EXNA 5J47A 2IGBA 4TT8A 3V5NA 1Y7TA 3K0AB 5P21A 3KLBA 1ZXLA 2BR3A 1Z36A 1HRKA 2B36A 2FSSA 3E3LA 1N3IA 4NOKA 1P2TA 3VSDA 4O3MA 4Z9AA 1CKEA 4E2FA 5KQMA 4K0RA 1UANA 1J22A 4Y8VA 1WB5A 3I1FA 5IT9A 2J48A 3UT5B 5JNRA 1QNFA 2BC9A 3IOEA 1YGPA 5IX8A 2DSNA 4QU0A 1W8IA 3UMRA 4F04A 2QD3A 3T95A 5BQFA 2CLSA 3L8GA 3JQRA 1HE3A 2H2AA 1UJBA 2C8LA 1JPUA 3ELUA 3ORSA 1D1QA 1L4HA 1U0TA 4RBNA 5KC8A 4C89A 2C31A 3D3WB 3N0TA 4V0OA 3I4FA 3ICQB 1KNXA 1XQVA 3CO0S 1PN3A 1DAEA 4O6VA 2Q7OE 1GCIA 7AT1A 2ZUTA 1A8SA 5F64A 2NV6A 3IEPA 4LXIA 3GLHE 3N8NA 2R87A 2EOAA 2M6RA 3KOZA 2GI4A 3GR6A 2FSPA 5JXIA 2QYSA 5JJBA 1PG0A 3HH8A 1N3BA 5K0NA 4ZICA 1ZUD1 2WABA 2W6NA 1YCHA 2R96A 3P8ZA 5FOUA 1SCKA 3QV1A 1WXDA 5DM60 1CUXA 1GADO 4PLZA 1N2CB 4UM8B 3UWDA 4E5SA 5I45A 4YMIA 1YK0A 4FD2A 1N34B 1CUYA 2GM3A 5T7BA 2O5EA 2J5KA 5FEMA 1T2VA 3ENKA 1EWKA 5LXTF 1KE1A 3CW9A 2AE2A 2ZRHA 4DM3A 1F8FA 4F38A 1W4BA 3RJMA 5TQ0A 4HX9A 1PU2A 2JI7A 5TRTA 2D0DA 2I71A 3N05A 3SC6A 4PZAA 4AU1A 2P5YA 1DQSA 2XYRA 3LC0A 3WGIA 2A8YA 3LHKA 4F5DA 3F4KA 7YASA 2VDUE 2DQYA 5EWLB 1CJCA 1PNRA 1BXGB 2ZTHA 1E77A 3BXFA 1E32A 3ZTYA 5B7NA 2HH9A 2YV5A 1QDUA 1J9ZA 3CRW1 3NIFB 4M8SA 2G17A 3UF0A 5CH3A 1T0JB 2JPDA 3QUBA 1MF7A 2I6SA 1BN7A 1EFPB 1PV1A 4OREX 4MQMA 5AW1A 2P2ZA 3I6QA 1EP1B 2QX9A 3F74A 2PBFA 3O4HA 4K6MA 5E9JA 5HG0A 1IHUA 4PAMA 4DYVA 1QFJA 1N25A 1OFUX 2H1HA 2VT6A 3H2JA 3H2IA 3F8TA 4CNBA 5SYAA 3O2QB 2HHAA 4HWTA 3KPWA 5THKA 3TMYA 2GWHA 2ZJ8A 2V7BA 4F93B 4DA8A 1KDPA 3AFHA 3SBEA 4N3AA 4E6EA 2WUEA 5TS3A 2OOSA 4ZT2A 1V96A 5ALOA 5KJ1A 2VF8A 1ATZA 1EK0A 1SUPA 2NSJA 2XCOA 5H80A 4OBBA 2D06A 3A3OA 3N0RA 4M54A 4XRRA 5CXSA 2CK3A 4ZV7A 4TS4A 5CXUA 3SC3A 3RBXA 5GZ3A 3V7WA 2IOQA 2Z3WA 2WP0A 4M9SA 1XZPA 2P9JA 1Y6FA 4E4RA 5C5CA 5C8YA 1RBYA 3FGZA 2D5LA 3F49S 4Z4FA 4DKJA 2DBVO 3PJDA 1L5GB 1XMVA 4F5WA 3MUOA 1JA9A 2PX8A 1E60A 2EZ4A 5K0BA 4P98A 3BCSA 3U60B 1TFRA 3H2HA 4U7DA 5BYKA 3AINA 3B1JA 2ZANA 2P0EA 3FMFA 1OHHA 4G5GA 1ABBA 1K7EB 4HVLA 1AK1A 3V7FA 3B52X 1DAIA 2HX1A 4G5HA 3TGPA 1AS2A 1WUYA 4MPPA 4Y2XA 3SOZA 4X7PA 2EFYA 1PL0A 1OXSC 3ZOKA 3BSFA 2OFPA 4OLBA 3BD7A 2HDNB 1FDRA 5HBRA 2YDYA 5BRJA 3LKVA 3OPQA 3EZ6A 3QPUA 5F7ZA 3N8KA 3CHYA 4Z49A 3H9JA 2HAEA 3BWBA 1TM2A 5BN4B 2CT8A 3KTDA 1X7YB 3O9ZA 4IZ6A 3K71B 3J81A 5IZCC 1JYSA 2JD0A 5LD2B 1VOTA 4F1JA 4EY7A 2JFBA 1CQZA 1FS5A 2H5EA 3ECSA 3EFOA 3IJ5A 2J41A 1SG0A 3OURA 1HE2A 5H4GA 3GCWA 5KNBA 2VKTA 3U7GA 4C78A 1E2QA 4TV8F 1YR3A 2VDPB 6LDHA 4IUYA 4CEIA 3AY3A 4ZAXA 5LQRA 5HILA 4Q4LA 2GEUA 2C92A 3WNBA 3OTQA 3K6SA 1A71A 4KWCA 1GA6A 3NHLA 2WU0A 3O4GA 3PGJA 4YVFA 5HIJA 3MS2A 4JR1A 3T52A 2W2LA 2C2OA 1KU6A 3WYGA 2X4DA 1AQYA 1G19A 1PCXA 2C9ZA 3I1IA 4R31A 3RAGA 3T7CA 4ZU1X 3PGKA 4ZO6A 2PCLA 3IA2A 1J56A 1L7QA 1N7HA 3LFUA 3E82A 2P5SA 4DJEC 1FUEA 3TDKA 1C7ZA 4JZYA 1QUEA 3WQBA 2UDPA 3P9YA 2XD9A 3WYAA 5JSHA 1SC3A 3GLKA 4UFOA 3S5UA 2XZLA 1BHO1 1GN9A 3EXG1 1PIWA 4IIJF 1BYIA 5BV0A 4JC4A 4D46A 4KR6A 3AHJA 1SD2A 4I8IA 4N0QA 4URYR 3ZDXB 1NDQA 1BGVA 5G2OA 4ZOBA 1QH1A 1QTNA 2E4WA 3UQYS 3W79A 2VLBA 3UVEA 4WOCA 4DLLA 1GZVA 2QN8A 4P5EA 1F0PA 4KQHA 4IDEA 3CVWA 1L1EA 2CKMA 1E6WA 1RAHA 2JIPA 2R1TA 5EUMA 3VH3A 1UBRS 2VQ3A 4FKZA 1C0IA 1IQUA 4N7RA 4MI1A 2ZR8A 4CCWA 2X8JB 2I3AA 2C5BA 3GRCA 3C1TA 1NNEA 4HSGA 1HZZA 4UPVA 2XCQA 2V9PA 4DABA 1J1ZA 1LQ2A 2GRAA 4RIEA 3PPWA 4YJDA 1AUPA 4HDKB 2HGSA 2MOKA 4GZ5A 5B7GA 3Q2KA 1FUIA 1G42A 1DELA 3PTZA 4NIMA 4NZMA 4DMFA 3HE3A 4NBWA 1PWHA 5LQJA 3I12A 1E2DA 1TAHA 2O2IA 3FSGA 2IOHA 3KYJB 4H08A 4IPTA 3VC7A 6NULA 2CXHA 1WTCA 5CVJA 5GOTA 5SYNA 3PK0A 4CIDA 2XE4A 1ZVVA 4XIJA 2WM8A 4E5YA 4CZ2A 2VNSA 2PL5A 3KZMA 4AD8A 1G2PA 4M1EA 4DCSA 1J4AA 1OXXK 1ZN9A 1HYHA 2JLUA 1DQPA 1KY4A 2JLVA 3HXQA 4G0PA 1P9LA 1UKEA 4LYAA 4MZDA 5AVZA 2VHVA 4K6HA 1AN9A 2BI4A 3AZOA 1KI8A 1LSOA 1TD1A 1CVRA 5KYYA 1GPMA 3IKVA 5P8WA 1V71A 3LE8A 4Q4DA 1DBIA 3OP4A 1POXA 1P80A 4EKYA 3ZWVA 1VMDA 1NG1A 3HEMA 2XNCA 2FCRA 3BVPA 3V4VB 5IMSA 3RHTA 2IXFA 3N8HA 4XQEA 1USGA 1WZCA 1T9GR 3QYPA 5F21A 5E7IA 3WRYA 4LSZA 4DR6B 4EVSA 5GM2A 2YKGA 5LXTB 4DIMA 3GGJA 3L05A 3QX9A 3K4QA 4G1UC 5WRFA 3KLMX 3EIFA 1CNFA 3TTXA 2AJBA 1DG1G 1U94A 1UPBA 1YA4A 2W2NA 3FJ1A 3MTJA 3QPWA 3R6TA 4NCKA 1JIUA 4PYRA 1LVHA 4LWOA 2O4CA 5ULLA 4XXHA 3ZCTA 2IF0A 4FS3A 5T4BA 1CQJA 3D7MA 3TCNA 2HA7A 1SCAA 3DLAA 3KB2A 1UK9A 5IP5A 1Q44A 1EFUA 2EJUA 2MSLA 4UNPA 3AL0C 1Z16A 3S2FA 1CHNA 1ISHA 4DQDA 2FI1A 3QWAA 5JYBA 1Z17A 1ZMRA 1DOZA 2VJYA 2PUWA 1NVGA 3FW1A 1KAOA 4L8VA 3IEVA 3GJTA 1ADGA 3LV8A 1IPHA 2AR7A 1FDTA 1PQ4A 4XGRA 4EHJA 3K2IA 3KJXA 3R5SA 3RNLA 3VR5A 2VRWA 4CR6A 1CXZA 4F2WA 1KH2A 5CCXA 5ENZA 4LUCA 1P2GA 4F2GA 4D26A 4WX2B 5AHRA 2Y05A 5JO9A 3DL7A 1N0VC 1XA0A 3DDHA 3OHMA 3R75A 2C3YA 3EIWA 1PO7A 1X14A 3HKCB 4YFYA 3GX1A 5LQDA 1MC1A 3LCJA 3PL1A 3LM8A 3LY5A 5JZMA 1GFSA 5K20A 3OKAA 4FOOA 1N3LA 1XEXB 4NYIQ 1T5LA 1VJTA 5F7JA 4BVAA 1CJSA 3KL4A 4R9RA 4EO4A 4F7WA 1NFFA 4FYMA 1J8FA 3D6VA 2GAFA 3ZC3A 2GHIA 4L8WB 4KMMA 5EYPA 5AUNB 1IN8A 1V7ZA 2RH5A 4FEEA 1NN3A 4R5HA 1PD0A 2TMGA 4UXIA 2Y99A 3RI3A 3RJZA 2CWWA 4YUZA 1ITZA 2B82A 1YRQA 1Z6ZA 2FZEA 2GH1A 4O08A 4J0GA 4GP9A 1U98A 4BO1A 1PUXA 4EMBA 1BGXT 3EUAA 3UXYA 4BNMA 1CZUA 4J2OA 2JA1A 1QRUA 4O25A 3STYA 3CZ4A 2C1EA 4RMIA 5CFOA 4PX5A 5CB4A 4P08A 2R6JA 3B7GA 4QGHA 3RANA 5FUVA 3FHCB 1RZRD 3MSCA 5IKPA 2CCKA 3G9UA 1SU4A 1JG2A 3PR3A 4CLRB 3PQ5A 5LDGA 2RC6A 4QGBA 1U04A 2WTAA 2HTEA 4E70A 2H7CA 4Y2HA 4S2UA 4DDUA 5DEIA 3AOEA 1WTAA 3RIEA 4G0OA 3ZDZB 1EXDA 3H97A 2YWFA 3DE5X 3R77A 1RWPA 3VDQA 1A98A 5KVVA 5MN6A 2FPWA 4EPTA 3Q6NA 3ITDA 1ORTA 2J3JA 3BKXA 3DWIA 3EGXB 4QWMA 5AW2A 3QG5A 4AURA 1EWVA 3WWZA 5LNK6 2ZSHA 4FLEA 3ZHVA 4QDJA 5B2EA 1QFXA 3DB2A 4V0ME 2UKDA 4EM6A 2XHEA 4M2LA 2I8AA 2YMQA 2P6UA 3ETGA 3PVSA 2FUG1 2K2WA 4OBWA 4R1SA 3W1WA 4M46A 1E2LA 1JX6A 1Z12A 3NX4A 4EYQA 3BGSA 3Q9SA 2GB4A 2CL0X 1Z5PA 4MAFA 4MICA 3VPCA 1Z8FA 1M3SA 2Y0CA 3GIWA 4A36A 1UOQA 1PDWA 1FOEB 1QIFA 3NEYA 3GA0A 1KPGA 1NVXQ 2GTPA 2HK8A 3B1KA 4J4BA 4TWIA 3D5QA 4XFJA 5EZ5A 1KI6A 1AQNA 4RMNA 1RHKA 2CLDX 3KT8A 1RPAA 4DANA 2CFTA 3CX3A 3DBLB 3OKFA 5DISB 1IHDA 1RPZA 5FCDA 4MIYA 1G20B 2GTHA 1IHPA 1H5NA 3ZG6A 4B44A 2VHCA 3DLTA 4GBED 1REQB 2XUJA 3VMMA 3K0AA 2VC2B 4Q9JA 2HSJA 3DE6X 4AS2A 2AMFA 2BKLA 1Z4LA 1YQUA 4IIJB 1G6KA 3UFBA 1VZ2A 1JPVA 4FR5A 3KNZA 4PSAA 4HDCA 4LSGA 3EGDA 4A0QA 2IBSA 5ELXA 1Z6GA 2Z57A 3EK2A 3PFNA 2CJWB 2CYCA 1DXYA 4IUBS 3UT5A 1RYZA 2J9FA 5C4IA 2Y0PA 1ZJ4A 1WXFA 3LYUA 2JAOA 2BGNA 4IHKA 4AJLA 4G85A 4BMVA 1RRVA 4MW2A 4PSVA 5JJIA 4TTTS 2QSYA 4BOYA 4MNTA 4IDGA 3Q8WA 3GFQA 1PJBA 2NPOA 3QVLA 4UTXA 1MGPA 2GEDA 1COWA 4R1LA 4C01A 3D3WA 1Z5UA 1E0AA 3GMTA 3RRXA 1QH0A 1UOPA 4HWGA 4JUDX 3IR7A 4V38A 2R25B 1PFYA 3V8VA 5KVAA 3W77A 2G83A 2GAAA 2ZUCA 3NT5A 3AZQA 1KOLA 2FF5A 3VPSA 5DWVA 4B47A 1ZONA 1AMNA 2O07A 2ZJ2A 5HIMA 2QG9A 1IY9A 1I51A 3KWMA 4IXNA 2V55B 1DC3A 5H68A 4G01B 1VFNA 3GRAA 1ODTC 2FDCA 2YWEA 4KYUA 3R8CA 3CNNA 3VVCA 1ISRA 3E9RA 2HA2A 4WLNA 4IIUA 1XK7A 4LVUA 3Q7RA 4NE9A 1JMVA 4XDHA 1Z4NA 2IXGA 1OPXA 2C3OA 3CU5A 2Z56A 3CT4A 3QU2A 1N2CA 4FFNA 1TAUA 8ABPA 1YBVA 3HP4A 3IP3A 1YS9A 5AKYA 3WQHA 4KAAA 4TTIA 4CCYB 2QHXA 2XF2A 3ICVA 5CK5A 4OJQA 4ARIA 5JD3A 1PAUA 3VZRA 3TX2A 2BHNA 3QBTA 3O8NA 4DAEA 3ZU6A 3P4UA 1OLUB 4Z4IA 4MJXA 1V48A 2PXAA 3SQXA 1ACLA 2RGXA 1UIRA 2AUNA 3I9OA 1C7EA 1TA4A 3KVRA 4FM9A 1TKAA 1JFRA 2Q1YA 5ALJA 1GYPA 1YACA 4KQEA 4RHTA 1MOSA 3ZIAD 1FU7A 5EWLA 3SPXA 1OOEA 1BXGA 4KQJA 1AGYA 3Q3IA 4NV3A 3FCOA 1ZM4A 5F98A 2CWDA 3KAKA 3P0JA 4HNSA 1CJKC 3CLVA 4M22A 4YRPA 4ARUA 4B6PA 4KTVE 5FHQA 4EMUA 4O2AF 3R6DA 4YUVA 2DAPA 4F2HA 1OX6A 5IAEA 1KDVA 1GSIA 5FPQA 5JCXA 4FEGA 1EFPA 1LTHR 1TMYA 2EP7A 4H1TA 3QBJA 2XKAA 4U63A 2F3PA 4B3FX 1CUIA 3ITNA 1SVOA 2XSZD 2FZ5A 3ZE8A 4TSFA 2YOHA 3RRMA 3TR0A 2JVJA 2YNMC 1ZI9A 2P2DA 1JLHA 2H65A 4H6VA 3B6EA 4YDQA 1EB9A 4HFNA 1ADBA 2XZPA 4QSHA 4PG8A 3JQ9C 4KO1S 5AQEA 4YRSA 1W85B 4WI1A 3IB6A 1DUVG 3Q41A 1QJCA 3KQUA 1HE5A 1WSBA 3HDGA 2OV8A 2G9ZA 3KTFA 4IF6A 3BEDA 1US8B 4M87A 4N48A 3CGWA 3GH1A 4H16A 3QY9A 4GF5A 4OQNA 1K9SA 1NHWA 3A2MA 3ROTA 3DAFA 1G8AA 1SPXA 3REGA 2H4WA 2P7IA 1SRRA 2B34A 3P7MA 3DE0X 3PQDA 1QKKA 2YV4A 1KJZA 2FSUA 4HL6A 1MX5A 1CDDA 4DJDC 2FQWA 2GK3A 2F3SA 2PD3A 5K01A 4R9SA 4DE5A 1JE1A 2DFDA 2YZ7A 3NKVA 4N82A 4D44A 1Z88A 1WMAA 1O94D 4M53A 3MMNA 4L4ZA 4YO8A 1FDOA 1OQAA 5K4GA 4UPEA 3I73A 3JD3A 1C1XB 4MVJI 2WZDA 4L27A 4PU0A 4R71A 4E3WA 2D5CA 1C8BA 3U7RA 1OZ0A 1U7HA 3FYUA 4NMWA 3TUZC 4Y2VA 1X6VA 2G08A 3ZVMA 1G5PA 1HYEA 4WAUA 3DWFA 5KNCH 5BNIA 3K4PA 3C5HA 3FY4A 3CKKA 5LZ5A 1G6HA 3W1EA 5BN4A 4C87A 2JIZA 1V5IA 1RTTA 2ET6A 3H3XA 2VCYA 4RPCA 4DQXA 1KXZA 3GJ6A 3E6AA 1SUWA 3QVTA 3WOVA 1E3IA 3P9RA 4BV9A 1W52X 1FDIA 3UY4A 2QV0A 1ODJA 2RDMA 4IINA 4BGIA 4CLOB 2ZJOA 5C3UA 1I14A 2O2CA 1TFUA 3HN2A 4FR0A 2EGGA 3FBWA 3ZCSA 5GONF 3X2EA 3KRTA 5K51A 4FEYA 3PF8A 1QTRA 4IDAA 2AQ8A 1GTL1 5DYGA 1OIWA 1V9SA 3V1TC 4BVJA 4D56A 5IW8A 4W8OA 2RGUA 3IP1A 2AF4C 4X3CA 3Q6IA 2G6TA 2NXNA 5CEEA 1W5AA 4JT2A 4NBRA 1VRWA 1YFLA 3NVDA 3RT1A 4CTNA 3QOXA 3VYSB 4LE1A 3HZOA 3TIGA 3PLAE 3I62A 2WWWA 1D5CA 5CCDA 3QM1A 1IN6A 1R8JA 2DT5A 4FNGA 4I36A 4CR8A 1BW9B 2PJZA 4M8IA 1HDEA 3IPCA 4MQ6A 4DCCA 5IKMA 1L2TA 3ND6A 4EB8A 3QX3A 3G8CA 1NAIA 2VDNB 5DHQA 1TM5E 1U8ZA 1K1EA 3DTYA 1IEXA 1SUFA 3QJYA 3C6MA 3R7DA 4G86A 1T6BY 4GI2A 1G3RA 1XK6A 3G7UA 2O05A 5BSVA 4E21A 1ZNWA 1KI1A 2E4ZA 2H52A 4M9CA 1RFLA 5SV2A 4C05A 1QV6A 3F9IA 3JD1A 1FTWA 5I9LA 4KREA 1NMSA 5BURA 4MVJP 3RCBA 5LUAA 3OQJA 5I8ZA 3GFBA 3JX9A 3MWJA 4QT4A 5GIOE 1XEAA 3ID6C 3TEFA 3DNMA 2QRMA 3GG9A 1OSNA 1DV2A 1USVA 3GYGA 4W1PA 2X8JA 2A0KA 4C4ZA 3AFMA 3DE3X 1XDSA 2WJ6A 1R4MB 4C3ZA 1GKUB 3LS2A 2QT1A 4EITA 2J7PA 1WF3A 4BFSA 2RK3A 4REQB 3NCHA 3TVDA 3DAOA 4JS0A 3OU6A 5CVVA 4CT5A 1YHNA 2DTDA 4CIBA 1FYFA 2H5IA 3LW8A 3OPMA 1ZH2A 4QOGA 4YRCA 3W4JA 2QM3A 4CKZA 4EH1A 2DLCX 2X5XA 1CEXA 2YIDA 3C8MA 1EYZA 1Q11A 1YJBA 1N77A 4UBNA 1YIOA 3R9KA 4RDIA 3IJRA 4JNKA 2QF7A 1A8HA 2HSZA 2V45A 1PJAA 3OZUA 1G8SA 2GCIA 3V4ZA 4BRUA 4NU8X 4D74A 2AZXA 3FN4A 3EH1A 3FPKA 1B23P 1GITA 3AEYA 1J8DA 2Z0MA 2OD7A 3GMDA 3DOIA 1XPJA 1SQ5A 5AI8A 2A0WA 2AQHA 3AR6A 3G0CA 3HUTA 3UV3A 1OTYA 1PFWA 3D0OA 1TLFA 4AJKA 2UUOA 2B1IA 1R8SA 3F7NA 1H3NA 5CA1F 1R74A 1NQOA 1ZIOA 1PGQA 4ZI7A 4E5NA 2XADA 3OBIA 3A1UA 1LK0A 1A04A 2RG7A 3LY9A 5K6RA 4P93A 3B5IA 7GPBA 3QWHA 3NUQA 2ZDGA 4IFEA 4K9SA 5AVOA 4BMOB 1XVUA 1OZAA 5LXTA 1CW2B 1T5TA 1ZUHA 3G0GA 1V4NA 2ZCUA 3VSEA 4RK7A 4C0SA 1V8ZA 2NSHA 4K88A 1W6UA 3AR2A 4JD5A 2G5GX 4HAUA 3LBHA 3TLAA 3E9CA 4ZZ0A 2FDRA 5GMOA 3H19A 4X1YB 5FI3A 4IRXA 1OY1A 2AA3A 2W2XA 4WLEA 4C76A 3R0ZA 2C4UA 4QOJA 3QG1A 4WH0A 3W5DA 2GEBA 2GWRA 2I6GA 3AF1A 3COYA 2GLUA 4HS9A 1OILA 5DM70 1E1LA 2ZUUA 2HF8A 2QYTA 2JHAA 5BR7A 3L18A 3PFBA 1H4QA 4OOEA 4ZYVA 1GLVA 3MD9A 3O4IA 4J0QA 2ZETA 3GUUA 3N3AC 3NJ4A 4DYHA 3DTVB 5JO0A 4Q5IA 2GJ8A 5IWAB 4F3TA 1SOVA 1U1IA 4MYRA 3KPVA 5AW6A 2WB2A 3HA2A 4MTLA 3TXYA 1E1QA 1N5MA 5CFRA 4DBLE 1E5TA 1PFVA 2I6UA 5G53C 3H0EA 2QW1A 1JFVA 3HKCA 4ZQBA 3ZY6A 2I4LA 1GYQA 1DUIA 1WMEA 1XEXA 3ZQKA 2V7UA 3KXIA 5FL3A 3RBAA 2NUBA 4G97A 2GXQA 5KDLA 5C2JB 1CVLA 2I3DA 3OESA 4HRXA 5AVJA 3PJRA 1WX1A 4EA8A 4OK6A 2JGRA 2ZBGA 1G3UA 2GJKA 2V8BA 3LUGA 4NCNA 3R5XA 3E4CA 2Q3DA 3S29A 4MKFA 4QLAA 5DP2A 3ITEA 4ICIA 3ZYZA 2LCIA 4LQLA 4GYYA 1FFYA 1KETA 5TX7A 1E20A 5IMBA 2J3KA 3QYFA 3MWGA 3TNDA 1JZTA 5IBQA 2QAGA 1EM8B 4K2AA 1VL0A 3CG4A 3HL0A 4COKA 5BWMA 3SSMA 1WDWB 4HZGA 1WXXA 2Y71A 1PYGA 5FUMA 3BRCA 4HS4A 3SDSA 4YAGA 3O9VA 3NHZA 1DO8A 4CLRA 3O7MA 2BHLA 5IXYA 5JS6A 4BHTA 1U3GA 1I2BA 1RAIA 4CVNA 2TSYB 3FKSD 2YJ5A 2ZCVA 3ZGOA 1IN4A 5EVCA 1Q0UA 4HBGA 5LD2C 3C0KA 4KQGA 3TIIA 3ZD9A 2EBUA 1XZCA 4R1OA 2PIDA 5C18A 3CB2A 2E4YA 5LKAA 1KTVA 2Y4OA 4YJ3F 3LXUX 4U2BA 1J23A 2HJSA 4MYUA 3ZVKA 2Q9CA 1SVUA 4BV3A 1O95D 4PG4A 3VNRA 4TMZA 3HJNA 3C7CB 1VKNA 1O0CA 4MRRA 3ORYA 4TYWA 1U2PA 2K5UA 2WA2A 1JKMA 3PEWA 2AMYA 1FXUA 1SM4A 4TV8A 2AC2A 2BTQB 4P22A 2CYBA 1CLEA 3SI7A 3QPAA 4H7KA 4EGCB 3DLIA 4EJSB 4ARCA 2YXPX 3EFBA 4W5QA 1EVZA 3Q1KA 1N2ZA 2VTDA 5I5GA 5CGZA 3I09A 3U37A 3EYWA 3HA3A 3NV7A 4G4GA 4IVNA 3LDGA 1BE8A 1ESMA 2ONYA 4LDAA 4OMCA 1JTVA 1KVUA 1PR0A 3RK1A 4B3HA 1I1NA 1VGVA 2HJGA 3QIAA 2GCPA 4JASB 1G20A 3AR9A 3WMFA 4DGSA 3WAJA 1U7WA 4J43A 3GO4A 4Q1DA 3ASUA 2EWMA 2PJUA 1REQA 4NK5A 1YJAA 1RQ2A 1XCBA 2CW5A 4IIJA 2FGKA 1TK9A 5DMXA 2P67A 3C24A 5CFLA 3LHSA 3EBOA 4P3XA 4OU4A 4QXQA 4PX3A 3FHTA 1JEEA 3P2KA 2IVZA 1GUAA 3QEAZ 2CJWA 4F0JA 2QJFA 3TZEA 1J09A 5E4TA 3T5PA 3VPAA 2JFVA 4QGGA 2DHQA 2HJHA 2FFAA 3O1JC 1Z15A 1Q0PA 4LRUA 4Y2TA 1HNWB 3T7AA 3WGMA 2FEPA 5EXSA 3KBBA 3F6RA 3GT3A 4BEBA 2GNOA 3R0XA 3W2TA 1J6UA 4E22A 1E0KA 1FYDA 3BIWA 1FBTA 1SCIA 2PX0A 3M81A 4JIMA 4LNUB 4L22A 3RUAA 1NRJB 1TMKA 2VF4X 2DU8A 1RU3A 1ND6A 2POCA 3GEPA 4G1CA 4DDVA 2B37A 1P8JA 5KVQA 4XR4A 1D4AA 1Y9DA 2N47A 2QV7A 3MINB 3LU1A 4JLMA 1AO3A 5AJZA 4DNXA 2R6HA 2YYAA 4CF3A 1U1FA 4FNAA 4RA9B 4DWOA 3LP8A 3VOAA 1A3CA 3FMIA 2JLYA 3ME5A 3I52A 1SO8A 1GVHA 3IO5A 4FE4A 4KYIB 4EHIA 5JCZA 1NN0A 1VXOA 1MO4A 4XI9A 1BFUA 1GPLA 4W9MC 4PGGA 2AK2A 3ZLUA 2EWVA 1YC5A 2GEKA 1BCSB 2QY6A 4PYMA 3WLOA 3IUYA 4HNHA 1ENZA 1N75A 2EGUA 4RENA 4WXRA 3OPVA 3P4XA 4R7ZA 2CFCA 4QT0A 3U4CA 4YFVA 5MGNA 2NZ8A 4CCYA 3FPBA 3TQFA 3K0FA 5KPDA 1GP2A 1UMCB 2C7PA 2FG6C 4B3GA 5GJBA 4R2HA 4RE5A 1AGPA 2Z83A 5F1KA 3RU2A 3AEXA 2WG0A 1OLUA 4BJ6A 1WULS 4JXJA 1V6AA 2HOQA 2P91A 5EPOA 2FW7A 4YP7A 4G0QA 2KJQA 3K9NA 4BGDA 4R1UA 5D00A 4BU0A 4CL3A 3RJ9A 4YBRA 2P5UA 4UBJA 3T5BA 1E7SA 5EJFA 4E5KA 3AXTA 4IOKA 5C4GB 4YMSA 1RHMA 3RHZA 1CRZA 3KB8A 4MVJG 5DE3A 4IX1A 1H9AA 3PXDA 4NEHB 5CMLA 1NC1A 3KKEA 1NSFA 2ZYVX 1VLMA 3TK1A 4KR7A 1LX6A 2WZQA 4KX5A 1MNAA 1WP4A 3I3SR 1YASA 2JLAA 5L51A 3I4CA 3U7EB 1R9NA 4XGQA 2ZJ5A 2XGOA 1SOUA 2JLZA 3FNQA 4E7OA 4MKIA 3F78A 4L7VA 4EG6A 1RXUA 3RSQA 4WD3A 1UAAA 4OCZA 5AWFC 4GOLD 4I5FA 2FMIA 3EASA 4IEIA 1KYYA 3DV0B 5KYXB 1W35A 3FNIA 3LQ4A 1W85A 3WK7A 1NMYA 1SU7A 2ID8A 4G0ZA 1XELA 3QQPA 5M5BA 4P32A 4GSLA 2PRJA 4I66A 4WXHA 3IMKA 3AVUA 3L5OA 3LT5A 1US8A 2XODA 3IDAA 2NXCA 2AYZA 5FUYA 4LKRA 1P7WA 3VKGA 1IJEA 2NQTA 3UATA 2Z6AA 4WVLA 1NVVR 1AG9A 4PS0A 2LCQA 3ILHA 4M0MA 4AX4A 3FCUB 3WHPA 5JNLA 1SBTA 4RTJA 5IH3A 1E4OA 4BJ3A 2J3IA 1JXAA 4UDOA 1WABA 1XMSA 2DQZA 3IBGA 3MUNA 3RWMB 5FTJA 4YAIA 1M83A 2OSBA 2RHGB 2Q0QA 4NTZA 4OGLA 1U02A 2XEDA 2YN4A 3G2LA 1C1XA 3GLUA 5EIOA 1U6IA 3CR8A 3NHFA 1L5QA 3SZOA 2X8WA 4ZHSA 2JGIA 2I4MA 1W2GA 2EKZA 2HPHA 4DLXA 1OROA 1XTKA 2ZBQA 4ROTA 4ILKA 3A32A 1SRQA 4JWTA 3R7NA 1QHYA 1C1YA 4CUKA 3HB9A 2ZB2A 1FNDA 3QFCA 3ZHZA 2NO4A 3T9FA 3B6MA 4NONA 2VEDA 3AONB 3PGA1 3VMFA 3DCJA 4BMCA 3DZCA 3AETB 4ENQA 4LSWA 5BMVF 1IC6A 1ZM2A 3BAFA 3GFFA 4OYYA 5JWRA 3ANLA 1VKZA 2OBNA 2BJVA 5E6SA 3WNZA 1USUA 1FYEA 1H6CA 2IUTA 2HLDD 1XRRA 4QXAA 4CLOA 2O8CB 2NLOA 3AB7A 3V8MA 1K75A 2VTEA 4F4JA 1I10A 2C7VA 2N3ZA 2PAFA 1MCZA 1VPEA 1Y8QB 2DX7A 2JCXA 3CLSC 3HC7A 3R3SA 4HGZA 2BF4A 2OAQ1 1ETUA 1FNNA 3HDJA 4JK3A 4OHRA 3WGHA 1ZDMA 5KO2A 2GKSA 5ESDA 2CNDA 3DE4X 3CZ5A 1WM1A 1T0IA 1T3ZA 1U0EA 1XKQA 3UOGA 4HUTA 3UGJA 3SFVA 2ZRQA 2B2CA 5L3VA 2G5CA 3PE6A 3E23A 4J0DA 3KQLA 4R1PA 1BA2A 1UKYA 4RD6A 3SCZA 3DXZA 3ZHQA 2FPOA 4E94A 1P33A 3PGLA 1QQBA 4IIDA 1BW9A 2YIMA 2OKGA 3Q0TA 4B6QA 4YAWA 3M6LA 2O3SA 2OHFA 3SFTA 5KIAA 1A72A 3N5CA 4I1IA 4V39A 3VR3D 4F2DA 2QD1A 1TCAA 2DTXA 1PD1A 4BP3A 3N1UA 5CVDA 2NZVG 4INPA 4I7EA 1EUCB 2MSWA 3P2OA 1N1GA 3UUEA 2IYXA 1AHPA 4O1MA 4CT4B 3UJ9A 3G5TA 1X1DA 3QMPA 4R0NA 3I58A 3SHWA 3W7BA 3Q40A 1P4GA 3I64A 1RMTA 2HMYB 2HRCA 3R6GA 3WMRA 2RONA 1WKVA 5HP4A 2A94A 4IV5A 3G68A 1IJBA 3EIQA 3TI7A 2IWRA 1GG5A 1OI3A 1YT5A 1GGHA 2G9UA 4ZEWA 1XQ9A 1D8AA 3MS4A 5BNFA 1XQWA 3VAZA 4N76A 5SICE 5DHPA 1ISJA 4XOUA 5F52A 4REQA 3WLAA 4CDGA 4XGIA 3TSZA 4AG5A 2EFDB 2I54A 2IHJA 4QJ5A 4EGAA 2BRUA 2RCYA 2X4LA 4MVJA 4Q19A 5ALMA 2P4UA 5U4QA 4S24A 2VWPA 1I2AA 3A6LA 1Y9EA 2CXRA 1ULBA 3L6CA 2I91A 2WD7B 2DC1A 3A9UA 3UHFA 3RRNA 3OCUA 4PYLA 2A5DA 3OJWA 4ITRC 1G7RA 5E0OA 4AZ0B 1MC8A 1Y7HA 3IS3A 1HE4A 4U7GA 1A69A 1J8YF 5A3VA 1HLDA 4Q9NA 4RH3A 1AKYA 4NKRA 3T41A 4CL8A 3A36A 3OE7D 5DGIA 5EQJB 1R0BA 1U7TA 1A4UA 1U2DA 4FYYA 2JZNA 2LE0A 4H3VA 4UXJA 3G9XA 2PBRA 3U7QB 3VR0A 2O8FB 3O8QA 2IYYA 3PIDA 5HVNA 3BXOA 1NPTO 3FFBA 1XZJA 2P5TB 4Q4JB 2JLBA 4IIFA 4A73A 1N3YA 2C5LA 2DP4E 5JYDA 2Y6UA 3VSBA 5IASA 1BFDA 1DPFA 2C8JA 4NPHA 3DPUA 3WTBA 3LY7A 1GTJ1 4RTPA 3UHJA 3WGZA 2QM8A 3CX8A 4NLLA 1A9XB 2HF2A 2ZQYA 3V6LA 4MKXA 1QVAA 5I9BA 1T5IA 4N8EA 1MC4A 1WSAA 4HMPA 4X1YA 3W7AA 2HR1A 1UUFA 1T4CB 4D8VA 2QTTA 3PE3A 1TTPB 4N4AA 3MNFA 4XJTA 4AB1A 5EP2A 1T0UA 1VI5A 4HB3A 4ZVOA 5JS2A 4GX1A 4YCAA 1JHQA 4BNJA 4QBGB 3LLCA 3TTUA 4LV5B 4CF5A 4DDHA 2HWKA 2PK3A 3FVVA 2ONKA 3DTVA 4G8BA 1LKZA 4N0DA 3RC7A 4L8GA 4XZ3A 4EG0A 2R79A 1KAQA 3FUTA 4M0UA 4FX5A 1UPFA 4M0KA 1BS9A 1DJPA 1MLDA 4JXKA 1DMSA 1GSOA 1QM5A 3EC2A 2UVPB 4ZFNA 5HQTA 4TYNA 2VJMA 4BB0A 2C2YA 3HCRA 4MV6A 1WAMA 4L7QA 1G5RA 4A2PA 2Q46A 1YMUA 3LDUA 3AVQA 4ALMA 3MJFA 2E1RA 3OFKA 3ECCA 1HFKA 1S3GA 1SZJG 1VE7A 2EZUA 2V5UA 2HO4A 1UJ5A 4XGKA 4GE3A 1AUQA 3F3KA 3QYJA 1F06A 4V0LA 3V1KA 3ZI7A 4LF6B 1YFJA 3FZYA 4ZMRA 4FFVA 2IDMA 5IVDA 2W6MA 1SXHA 3U16A 4CDNA 1RJGA 3FOAA 2RKWA 5FULA 3EF3A 2B20A 1WOMA 4FW9A 4OHVA 4QVKA 3V4LA 1G4AE 1SN7A 1BNCA 2IEYA 2NSLA 3TUIC 1RWQA 2BGUA 2JLXA 4LMPA 4JZKA 2RI0A 1U9CA 1WBDA 1Z4KA 2CV0A