3FVTA

Crystal structure of acetyl xylan esterase from bacillus pumilus, monoclinic crystal form ii
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
318
structure length
318
Chain Sequence
MQLFDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEAEPTLESYDYPVKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDGGIHDIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYYYRGVYLDAVRALEVIQSFPEVDEHRIGVIGGSQGGALAIAAAALSDIPKVVVADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEKAFETLSYFDLINLAGWVKQPTLMAIGLIDKITPPSTVFAAYNHLETDKDLKVYRYFGHEFIPAFQTEKLSFLQKHLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of Bacillus pumilus acetyl xylan esterase
rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
molecule keywords Acetyl xylan esterase
total genus 114
structure length 318
sequence length 318
chains with identical sequence B, C, D, E, F, G, H, I, L, M, N
ec nomenclature ec 3.1.1.6: Acetylesterase.
pdb deposition date 2009-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fvtA00
1ODSA 4AMZA 3AJAA 3C45A 4GI1A 3IUNA 1XROA 4C87A 1W4LA 1VZ2A 1ZICA 3NOXA 1XZDA 1XRLA 5IVIA 3WK7A 3V1KA 1QONA 5LZ8A 3F9CA 4C4XA 1XRNA 5CT4A 2OPHA 3H19A 2HU5A 1JT2A 1MNQA 3V48A 4ROTA 4OPMA 2CJPA 4H7EA 5HF6A 4HRYA 4M0MA 1OXMA 1DWPA 4FFVA 4P92A 2VQ6A 5AI8A 3FCXA 1K8QA 2HU8A 4J0CA 5SYMA 3FSGA 3BWXA 4GECA 5A7HA 4B6GA 4UBMA 2C0QA 1LPAB 1X2BA 2XE4A 4H7DA 3R3YA 2WHQA 4PV7A 4G8BA 5HKBA 1H23A 1AX9A 5D3KA 5AM1A 7YASA 4O08A 4MEAA 5CT5A 3NWOA 4D9JA 4Y2TA 2OQIA 2QZPA 1LZKA 3V1LA 2X8BA 3KSRA 3DYVA 3R41A 4AX4A 4ZWNA 3O4IA 4B85A 3LIIA 3M81A 2GYUA 3ZV7A 1ZJ5A 3T52A 4PO3X 2QKYA 4Q3LA 5EI5A 3B5EA 1LPSA 5ALHA 2OCGA 2XQFA 4EB0A 5KWIA 1BEZA 2WU3A 4H77A 1CUGA 4OB6A 1LZLA 1MJ5A 4WFKA 2Y6VA 1IZ8A 2LIPA 3KWFA 1UFOA 3S2ZA 2RGUA 1E5TA 4QDZA 5A62A 5K3BA 2JGKA 2Y2VA 3FNBA 3PF8A 2OGSA 4GW3A 5CTAA 4Y2XA 2V9ZA 5K3DA 1QIMA 1QIDA 3ANTA 1MTZA 2WUDA 1QIEA 3A2MA 1FFCA 1PFQA 2Y2UA 3PUIA 4BDTA 3E0XA 3JWEA 2Z8XA 4EY5A 4BVKA 4KE7A 5LZ4A 2C58A 1EX9A 4RE6A 3NUZA 1QTIA 1JJIA 4X00A 5I7UA 4BAZA 3PI6A 1EDDA 5HZGA 3F96A 3OM8A 5JD6A 4PW0A 3RLIA 3HC7A 2RONA 4H7HA 5JAOA 1CLEA 1IMJA 1U65A 2XQIA 1ZD3A 4BTVA 3H1AA 4HXEB 4BCDA 1EA5A 5ALJA 4LXHA 1WHTA 5AIBA 4X6YA 4CCYB 3H2HA 4JYMA 2PX6A 4UBNA 2HA2A 2XB6A 1H2ZA 5HFAA 5ALKA 1EI9A 4NZZA 5D6OA 4W1PA 4HZGA 5DTJA 1TAHA 4HTAA 1EDEA 4BRZA 4XIIA 4KAJA 2WJ4A 2VJAA 4LHEA 3ZWQA 1AQLA 4YX9A 4FFWA 5FPQA 1YCDA 3D59A 3VJMA 4B80A 3A6ZA 5CXXA 2BKLA 2XQJA 4QE3A 2WFLA 1G4HA 3WKAA 4JNCA 5K3AA 4Q1VA 5FDFA 3MGAA 5BOVA 5JAHA 3QM1A 4AQDA 1ISPA 4QEKA 4BVLA 1YSCA 1H2WA 3DEAA 2J4FA 3I28A 2H7XA 4J0DA 1VA5A 2IX9A 2X5XA 1CUIA 5ALDA 4YASA 1VE7A 1WB6A 3A2NA 4QWWA 1TCBA 4ARAA 3FOBA 2CBGA 1W76A 2K2QB 3PUHA 3FVRA 4J0IA 5T4FA 3UMJA 2WHPB 1DINA 3F98A 2EEPA 2XUFA 1KU0A 1OCEA 1R1DA 2PM8A 4UFOA 2HFJA 2XUJA 2ZJ7A 4RNCA 3HXKA 4HVTA 5KREA 3OPMA 3IULA 4UUQA 5KBYA 2HFKA 4W1QA 2VSQA 2JBWA 2DQZA 3D4LA 1QFMA 3U1TA 4L3WA 5CRIA 3AZPA 3C6ZA 4L72A 1TK3A 3G0GA 5EHXA 3ICWA 2QUBA 1L7RA 3KD2A 5AKYA 1Q84A 1BROA 1K63A 3RK4A 3SWWA 1IVYA 4AN0A 3C70A 4ZREA 5DYYA 1ZGCA 3VVLA 2WUEA 3W9BA 1BN6A 3OC0A 4B0OA 4BZZA 5IVKA 5T4HA 2ORYA 1SFRA 4MYDA 1WCYA 1CEXA 2WILA 3PE6A 1SCQA 5AO9A 5E2IA 1GT6A 1TRHA 5AK5A 4WY8A 3V1MA 4OUKX 1QZ3A 2BCEA 3QMMA 1XZLA 3FYUA 4XVCA 3D2CA 3C5VA 2WFMA 1BEEA 4OCZA 1RYYA 1R9NA 4UBJA 5ALOA 4EY8A 2WJ3A 2C5GA 3DYIA 2HA4A 1DT3A 2GZSA 2VA9A 1BS9A 1AKNA 2XMGA 3PDCA 3DS8A 2I3ZA 4G8DA 5ALVA 3WYDA 2WFZA 2V97A 3MUNA 2HRQA 4B83A 1DX6A 5LKRA 5A7FA 1A88A 5JALA 4N8SA 3B12A 2ZYSA 4CI9A 5DJ5A 2VTVA 4QLOA 5JYCA 3DD5A 1O6GA 1ACLA 2CUTA 2B9VA 3GFFA 1E8MA 2HA0A 4P08A 2OG1A 4ETWA 4UFPA 2G63A 3GA7A 4EZIA 4KAFA 1CUCA 3D3NA 1CRLA 3M82A 3H1BA 2EDCA 3ESBA 4LKOA 4IH9A 4G4GA 4JYPA 2E3JA 4PF1A 3WWEA 3IDAA 4XX1A 1E8DA 2JEZA 2G4LA 1JJFA 4DNOA 3WWPA 4LYEA 3I2FA 1WHSA 4QDUA 3VXKA 5CT6A 1UOPA 5AKKA 3L1IA 2Y1KA 5AM5A 5D7BA 3WL7A 4EY7A 1EH5A 3BXPA 1DQZA 1CR6A 4KYVA 1J2EA 3LCRA 5AKIA 2XUPA 5CMLA 3FLEA 1P0MA 2QR5A 3D5EA 4FHZA 5FLKA 4IHAA 1XFDA 4L9AA 1QE3A 2H9YA 1AZWA 2OQVA 4I19A 1MN6A 5EIEA 2J3QA 4GXNA 1N8SA 5JATA 4X3CA 2JGLA 4UBOA 3IIIA 1A8SA 3HI4A 1R4ZA 4KRXA 4UBLA 5AJHA 4ZV7A 3EBLA 5HF5A 1N5MA 3IVMA 2G5PA 5FXMA 5D3ZA 5IH7A 4BZWA 4Q34A 5FKJA 2WIJA 4F21A 1J07A 3G8YA 5DNWA 2GBFA 4N8EA 5ALUA 2OLEA 5JD5A 3FLBA 4FLFA 1UOOA 3Q8WA 5C8VA 5ALSA 3F97A 3KOOA 5EHQA 3TJMA 4FLEA 1GXSA 4OU5A 3MUOA 2ACKA 5CH3A 4TVKA 1AURA 5JZ9A 3I1YA 3M3DA 1LNSA 1FFBA 2VJBA 3CCBA 4Y2PA 6YASA 2WG0A 1QTRA 4OB7A 3BF8A 5ALYA 5AKLA 2VJCA 3N2ZB 4DM7A 3WLAA 2Z5GA 3H0CA 4FNGA 4PQEA 1JKMA 4OYYA 2RAUA 1EHYA 4KE8A 4F0JA 1JI3A 3EQ7A 1WM1A 1R50A 3ICVA 4AXBA 3DLTA 2DCMA 2XLBA 5LIPA 1TIBA 4A23A 1XLUA 1ZI8A 2OCLA 1XZMA 1CUVA 5AK6A 2HADA 2RHWA 2H1IA 5AKHA 2O2HA 1LPNA 1UZAA 1ZD4A 2DQYA 3FCYA 4FOLA 1CUHA 4ITVA 3STYA 1UXOA 4DNFA 2XMDA 1Q0ZA 1LGYA 4MXDA 4Y9SA 3G02A 5AH0A 2PSFA 2PSJA 5SYNA 1DTEA 3AILA 1MX5A 1T2NA 4EY4A 1XLWA 2ZSHA 3P2MA 2WG2A 1LPBB 5JAUA 5A7GA 2PUHA 4U2FA 3D2BA 3QMVA 1TQHA 4DNQA 2CMFA 4X91A 4XJVA 3OOSA 1WPRA 4H7JA 5DLPA 2QM0A 2JGEA 4ZI5A 4KE6A 2J4CA 3FSGD 4BDSA 1E89A 4ARBA 5JANA 2HHAA 3QPAA 2AXEA 3W04A 4AB1A 5AICA 4C6HA 3WL5A 2WIKA 1KU6A 2OXEA 3AZQA 4YPVA 1JMKC 3GBSA 4S0XA 1CUXA 1IZ7A 1N5RA 5E4JA 1TCAA 2DFPA 1EVQA 3F67A 1ORVA 1YAJA 2GBIA 3VDXA 1EB8A 2XQGA 2ZYHA 1SOMA 1AMNA 3E4DA 4DMFA 2XQKA 1EINA 4IQ4A 3HLKA 1ZJ4A 1VJ5A 2HM7A 4RPCA 3RARA 5H3HA 4OD0A 5ALMA 5LYYA 2FJPA 5JZSA 1EXWA 5HQ3A 2EDAA 2ZVDA 4X90A 4EY6A 2XUHA 4M0FA 4B9EA 2WFLB 4GDMA 3EIOA 5ALNA 4KR0A 1U8EA 3AFIA 2BGRA 1VOTA 3K2IA 4J0JA 2AJDA 2FJ0A 1M33A 1XLVA 1YASA 2YXPX 5I9IA 3STXA 4WCVA 1J1IA 4W63A 4Q3OA 3JYHA 3CN9A 2OAGA 3EQ9A 1HPLA 1J06A 4N8DA 2OCIA 1RWQA 1QOZA 3MVEA 1CUBA 1E8NA 1XRRA 4GBGA 3E3AA 5AI4A 2XMCA 2QUAA 3RM3A 3V9AA 3SC2A 1QIJA 1XQVA 1ZD5A 5ALFA 3WA7A 3AIMA 3KXPA 1GZ7A 1LPOA 1ETHA 3C87A 3WMRA 5CURA 1XZFA 4HXFB 3KDAA 1CQWA 2DHEA 3WK9A 3O4HA 4M0EA 3LLCA 3BDIA 4BAUA 5A6VA 1XRQA 1YA4A 4RGYA 1ZOIA 1UOQA 3H17A 1CV2A 2PSEA 1I6WA 2OCKA 4G4IA 3WL6A 4UHCA 2Q0XA 5K3EA 2H7CA 1CUYA 5JZBA 1GPKA 2Y6UA 2B20A 2DHDA 4EBBA 2GBGA 4EUSA 3FYUC 2JGJA 2XMBA 4BB0A 3ESDA 3O95A 4E46A 1YAHA 3QVMA 1OILA 2DR0A 1SCIA 4LYDA 4CCWA 1ZI9A 3AIOA 3DOHA 5C8XA 5FP0A 1W1IA 1G66A 4G4JA 1JJBA 1XZHA 4ZGBA 1K4YA 2P8SA 2B4KA 1HQDA 3I2IA 2XUIA 2BUBA 1Y7HA 1QIKA 1QFSA 3LP5A 3D7RA 2I03A 4KACA 1CVLA 3ANSA 2UZ0A 1UK6A 1XZKA 5EGNA 1DT5A 4WFIA 2D0DA 2ZYIA 4MJ3A 2QXUA 2HIHA 4EA6A 5FRDA 5ALEA 1R88A 4G9GA 5AI6A 2X76A 4DIUA 5AI0A 3WI7A 3GZJA 3WK4A 1GPNA 1PJAA 4DMKA 4HXGA 1UT6A 1CFJA 5JIBA 3G9XA 5EHZA 5AKEA 1JU4A 2XI4A 1VXRA 2O2IA 4X85A 4CG3A 4UBIA 3AIKA 4Y2RA 3HYSA 2QJRA 1XZAA 4J0HA 2HDWA 4QNNA 3CCCA 1EVEA 4AZ3A 1UKAA 3FWHA 3U0VA 4H18A 1LBTA 1ODCA 1G42A 4BYMA 1F8UA 4WY5A 3FLAA 3X3HA 1N1MA 2B61A 2WG1A 4MWSA 5E4TA 2PBLA 4B84A 1XZIA 5FV4A 4B81A 4Q82A 1YS2X 5HK9A 4X97A 5FOQA 3VVMA 3CXUA 4U2CA 4Y2VA 2XUKA 1USWA 4C4YA 3I2HA 3WK6A 5HQ3B 5K3FA 4Z49A 2PU7A 2D5LA 3ZLTA 1QIGA 5K3CA 5JARA 3DNMA 2V96A 4Y2QA 5AI5A 3RKSA 1NU6A 4FKBA 4F60A 4KRYA 2YH2A 5T4BA 1Y7IA 3EF3A 3H18A 1RP1A 4X92A 1MAHA 5ALXA 1EK1A 2YYSA 5KWJA 3QMWA 4G5XA 3ZI7A 1VA4A 5AM3A 1ZD2P 2HL6A 2GYVA 2ROQA 1HL7A 1GQSA 4X95A 1MU0A 3C6BA 5CW2A 4FLMA 5AKGA 3I6MA 5E4YA 4H7KA 3QYJA 3S8YA 1MX9A 1HKHA 2HRRA 5T4EA 4B7ZA 2XUDA 4CG2A 4BP9A 3GUUA 5HF9A 2WKWA 5HK8A 4DYHA 4IH4A 5AKXA 5CBKA 4H35A 4F5ZA 5AOCA 4UFNA 4Y7DA 3FVTA 4Y2UA 4C88A 3H2GA 5ALQA 5DYWA 3BL8A 2C4HA 4LXGA 4CFSA 4J7AA 3TGLA 4BCBA 5C7YA 1D07A 1QO9A 3TRDA 2JGFA 4QLAA 4BVJA 3E1GA 1W75A 2JEYA 3WWDA 2WHPA 5JAPA 3A70A 1H2XA 4DSZA 4HRXA 1P0QA 1X2EA 4UHHA 4A5SA 2R8BA 4C89A 3HACA 3WKBA 1AC5A 5AKZA 2XMZA 3D2AA 5HKAA 2Z8ZA 2BFNA 3ILSA 3V1NA 4U2DA 1JU3A 5AM2A 1XRMA 4K6HA 4X93A 1QJ4A 5ESRA 2FUKA 5ALTA 2XMQA 4AZ0A 1YB6A 4K6GA 5A71A 3LS2A 3G9UA 4IH1A 1VXOA 2HA5A 5DWDA 1QO7A 2XUGA 3G0CA 5BV7A 1JFRA 4H7IA 4ZRDA 1E3QA 2PKYX 1BRTA 3HABA 4QDOA 4BTLA 5FPPA 1DX4A 2JGIA 4J0KA 3C6XA 3WKDA 4BP8A 5EHNA 1W6RA 4K2AA 1UKCA 2CEKA 1LPPA 4BCCA 4CG1A 3GELA 4QZVA 4GWLA 3STWA 1NX9A 4FNMA 1A8UA 2PSDA 5CH8A 2HA7A 1EK2A 4TGLA 3WJ2A 3I1IA 5CT8A 1R3DA 5CT9A 2XMRA 2BGNA 2QRUA 4UHEA 3K6KA 4EHBA 1UK9A 2VJDA 2QOEA 4AO6A 4MQMA 2VEOA 4C01A 3WQHA 2WUFA 3R3WA 1ZIXA 5ALWA 1FFAA 1LPMA 5CXUA 3ZPXA 4WDQA 5ALPA 4H0CA 3TEJA 3IUJA 4JEIA 4B9AA 3R3UA 4UHBA 1GKKA 2HA3A 3WIOA 3FAKA 4BC0A 1IUOA 2W22A 1Q0RA 5EIHA 1NU8A 1F0PA 1XQWA 1FFEA 5K5EA 5FUMA 4PNZA 1W52X 2QS9A 4KE9A 4BE4A 2WQZA 4XWGA 3ESCA 3PFCA 1QLWA 2VT6A 2QMQA 2XMSA 4B82A 4KAAA 4Y2JA 3QPDA 4OYLA 4OSEA 1MO2A 2ZSIA 3I6YA 5LZ7A 4X71A 1Y37A 1Q83A 1Z68A 3QZUA 2BUCA 2H7YA 3M83A 3G7NA 2ZJFA 3ZLVA 2IIVA 5IVDA 1E66A 3AUKA 4J3JA 2XDWA 2WM2A 4X6XA 1SC9A 3QBJA 3DKKA 1WOMA 1HBJA 3DKRA 3YASA 2ZJ6A 5LZ2A 1WPXA 1BE0A 4QA9A 1QIHA 3AINA 1THTA 1MAAA 3L1HA 3O0DA 5K3FB 4JUIA 2XLCA 1CUUA 4X7BA 5ALRA 4DNPA 1CQZA 2RI6A 1BCRA 5AHXA 3G0BA 1ACJA 3F8SA 4NS4A 3HRHA 3G9TA 1XZJA 1DQYA 2W6CX 3BF7A 4DLNA 2XUOA 4PSUA 1S8OA 2Z3ZA 4MQLA 4P93A 4G1FA 2AJLI 4GHWA 3WZMA 3I6ZA 3CN7A 4W9RA 4J03A 4WDRA 3QITA 1WB5A 1ZGBA 2WJ6A 5ISMA 3C43A 4CCYA 3WJ1A 1B6GA 3ZLUA 4K5QA 5EIAA 2O2GA 3AZOA 2OGZA 1ZIYA 4BRSA 4E11A 4WJLA 5EFZA 4CIBA 2OAEA 4DSAA 1BN7A 4LIPD 4C4ZA 3R40A 3BDVA 3W2TA 3DCNA 1CUFA 2WIGA 1CUSA 2QJWA 1FSSA 1AUOA 4U2EA 3QH4A 3B3QA 1QIFA 2AJ8A 3SK0A 5ALZA 4FTWA 1FJ2A 4CIAA 3STVA 3OTQA 1EDBA 5LP1A 1XRPA 1C7JA 1YA8A 4IO0A 3IBTA 2ACEA 2O7VA 3O9VA 3KWJA 2AJBA 4Q05A 3R3ZA 1THGA 3LIPA 5AOBA 2VAXA 3K9BA 1MX1A 2JGMA 4E14A 1P0IA 4PSCA 2RIPA 2GYWA 3WK5A 1KEZA 5AKJA 4DGQA 5HF8A 2GBCA 3WL8A 1CUWA 3VKFA 1VE6A 2BAGA 1P0PA 1WB4A 1TKRA 4I3FA 3I2GA 2BUAA 3HEAA 3G0DA 5AI9A 5DYTA 4W1RA 3QPCA 3H2KA 4GEGA 3DL4A 1T4MA 2V98A 3BJMA 4X94A 4FMPA 1XZGA 2RHTA 3FYUB 4PSDA 1C7IA 2VATA 4BAGA 1L7QA 5JD4A 2QXTA 4JH0A 1JMYA 2XUAA 1C4XA 3ESAA 2R11A 1VZ3A 2NW6A 2WIFA 3DJYA 3L1JA 4N5HX 3T4UA 3N0TA 4BBZA 2HA6A 1XZCA 4WFJA 3A2LA 1XZBA 4W1SA 3SX4A 4MYSA 1L7AA 2PU5A 2PL5A 3DL7A 2PSHA 1A7UA 3WKCA 3BIWA 4ZV9A 2WSLA 2WU4A 3BIXA 4B0PA 1IUPA 4LXIA 5BWCA 2PVSA 1ORWA 2CKMA 3G9ZA 3NGMA 4YK7A 1DWQA 2XT0A 3HJUA 2PUJA 5F4ZA 1K5PA 2OGTA 1FFDA 2JF0A 3O9MA 2ZYRA 4RE5A 5IKXA 3HSSA 1CUDA 4Y2SA 4Y2YA 3WIBA 4E15A 4FDMA 1YB7A 3Q0TA 4MEBA 3ED1A 4UBKA 1XQXA 1VKHA 1CUJA 3WK8A 2FX5A 3FBWA 4KJXA 4P9NA 1LBSA 2QTBA 2XUQA 2O7RA 4QWMA 1H22A 2YASA 4N5IX 4FBMA 1EB9A 3WA6A 3O4JA 5A2GA 2HU7A 3DQZA 1XQYA 1IUNA 2ES4A 4I4CA 1CUAA 4MWTA 1ZI6A 5C8ZA 1XKLA 3DDUA 5ALIA 2ONCA 1XZEA 2I78A 2VAVA 1U2EA 4TPKA 2JIDA 2G5TA 5AM0A 4NVRA 1GQRA 5IVHA 2VT7A 2WTNA 5LKAA 3VJLA 4UHDA 4AMYA 4FBLA 1DU4A 3IUQA 3PF9A 3H2IA 1MNAA 4UPDA 3UUEA 2WTMA 1H2YA 3WWCA 3R0VA 1DWOA 1GKLA 2DSNA 1AGYA 3WWOA 1ODTC 3PFBA 3BE8A 1X70A 5AK3A 1UWCA 3IURA 4K6KA 3R3VA 3JW8A 4Q3KA 2C0PA 1U4NA 4V2IA 1PV1A 1HDEA 5AM4A 1F6WA 5JADA 1VLQA 3HZOA 5LLSA 4H7FA 2AJCA 4KEAA 5CH5A 4G8CA 2Z3WA 1YR2A 5J3JA 1GGVA 1UK8A 4OU4A 4AO7A 2WHRA 5AK4A 3H2JA 3UUFA 1BCSA 2WLSA 1B41A 4AN1A 3H04A 4L0CA 5AOAA 2J3DA 3C8HA 5HCUA 5LZ9A 3VISA 1UKBA 3O4GA 4QDTA 3OURA 1UK7A 1XKTA 4HAIA 1YS1X 1MPXA 1A8QA 3I2JA 1O6FA 2WUGA 4DMCA 1HLGA 5I8PA 3W05A 4INZA 4QDXA 3I2KA 4DMHA 5LZ5A 2DHCA 1LLFA 4U2GA 4UHFA 1QGED 3WYNA 5DNVA 4X6UA 2CB9A 4NMWA 4BATA 3G0IA 4BE9A 2C7BA 3IB3A 5AIAA 2BJHA 4J0GA 5BWBA 2QT9A 3OG9A 3FYTA 3VJKA 3STUA 4DTCA 3D0KA 5ALGA 2PPLA 3EQ8A 1BU8A 1CUZA 3IUMA 5HFNA 5YASA 1GPLA 2IITA 4OB8A 2ECFA 4U2BA 4AO8A 3C5WP 1K6EA 4ZXFA 3C6YA 5ALLA 2VF2A 3WZLA 4HS9A 1QIIA 3PICA 5AP9A 1TCCA 5DNUA 2GZRA 3GROA 1R9MA 2WIDA 3DOIA 1CUEA 5JASA 3BJRA 1F0NA 3R3XA 4G9EA 3IA2A 3STTA 3W9UA 4BC1A 3WKEA 2CZQA 3C8DA 5DTIA 2QVBA 4GLBA 5C81A 1CIJA 1CPYA 4A16A 1G5FA 1SCKA 3W06A 2I3DA 2C5FA 4FWBA 1MT3A
chains in the Genus database with same CATH superfamily
4AMZA 1C3EA 4HOYA 2NO5A 1JG6A 3C45A 3X2EA 2ID7A 3UGKA 2YHSA 1GADO 3A6JA 4P5EA 1O94C 4C87A 2DRIA 1W4LA 3KQMA 1VZ2A 2BZSA 1XZQA 3NOXA 1DEAA 1M6NA 3HSYA 4Q02A 1XRLA 3D6TB 4BO1A 3G7SA 1WEKA 3RUDA 1FDSA 5LP6B 3V1TC 4BL5A 5JRJA 2QRVB 3WK7A 1DQSA 3QUAA 1NIJA 2ZR0A 4HDMA 1MJGM 3PDWA 1YZFA 1KH1A 2M98A 3I6IA 4IM7A 4C4XA 1NV8A 3Q6IA 2OPHA 3DEHA 4B7XA 3TXXA 3TKLA 1QGAA 2R6AA 2YL2A 4IMJB 3SC3A 1MQ8B 1RRVA 3BA1A 3RAFC 5TR9A 4Q9DA 4QJIA 4X20A 2IUEA 1NMEA 1VJRA 2D4AA 5HF6A 3S2GA 2GLXA 3AI3A 4HRYA 1QK4A 5CFQA 4URYR 1E3MA 4HT3B 4KIWA 2JLBA 2PD4A 4FFVA 1FXWA 1QVAA 3K92A 4P92A 2ECKA 1BO6A 3RHTA 3FR7A 1PLJA 1V3VA 2GWHA 1G98A 5DHTA 4O63O 4MVJM 1QHSA 1G5HA 3FCXA 1CQJB 1T3GA 1NUPA 4N0QA 4BFXA 1K8QA 2HU8A 2ZZNA 3CPHA 5SYMA 3U4AA 1B0AA 2JLSA 4KPGA 3ANXA 3FSGA 3DE2X 3F78A 4J1QA 1WU8A 3QVOA 1MG0A 3IKMB 3OJOA 1DKQA 3NIGB 4GECA 4ASUD 2I9KA 3QKSB 4NNOA 4P7BA 4IXMA 5A7HA 4H3VA 2ODQA 1Q12A 1JKIA 2EW2A 1SC3A 4UBMA 5DHUA 4OHWA 3LL4A 4LV8B 2W2KA 1HK7A 2FPGA 3ILVA 4DV6B 3SZ3A 1LPAB 1JPJA 1OYVA 3EOZA 3GEDA 4DA8A 2EX4A 3COPA 3HY3A 1MXHA 5A4DA 4RQUA 4P86A 5HKBA 1U7HA 1V16A 1P7VA 1HE8B 1BYIA 1G20A 4ZZ2A 3ZKAA 2R6HA 5F64A 3TZQA 1NUUA 3WYAA 4EGSA 3U37A 3T1VA 1IYZA 2XVXA 4QQNA 5LWHA 1K92A 4XVQA 3MN1A 2VUSA 4MEAA 1PWZA 2G6BA 4U9HS 4QVGA 4D9JA 3AFHA 4A03A 4Y2TA 5L4SA 2QT1A 4XGIA 2MDTA 1DAFA 2O6HA 2OQIA 4X63A 1N6OA 4EF6A 4B2PA 2A88A 2P9CA 1TM3E 3OUUA 3GU3A 5DYNA 2VZEA 4QPPA 4YRDA 4RVHA 5DE3A 4ZEMA 5CLLA 1TPYA 1PCXA 1UKZA 2HI0A 4JJ8A 4DRXB 2R7NA 1E7MA 1VKJA 3PVZA 5HS6A 3V55A 1NTRA 1W1WA 3L0BA 4RFVA 1TGVA 1G9XA 3H84A 3N28A 3RT9A 4B85A 3WGVA 2JC3A 2PX5A 1ECJA 4ZJPA 5CFLA 3MNFA 2OUIA 4RY2A 1JR4A 3M81A 5KQMA 1TLTA 3T9FA 4JC4A 1LW6E 4DMGA 1IQ0A 4PO3X 4AJIA 3H4TA 2QKYA 3NFYA 5EI5A 2ZCJA 2COEA 5I9NA 1ONPA 4L16A 1PZMA 1U8ZA 1SBIA 4CM7A 3NIWA 5ALHA 2OCGA 2AZTA 4V0OA 1PEKE 1S3SA 2NO7A 3ZHOA 2XQFA 4ENVA 1A9QA 1OA0A 2ZUDA 3LPCA 4KAXA 5D1NA 5U4XA 3LQQA 4EB0A 4RVGA 4MA0A 4L6CA 2PA3A 4BQFA 4H77A 5IDVA 2VYVD 2D3WA 5IAGA 1AGRA 4JHLA 3WMGA 1KOGA 3HDHA 1TU3A 4IIDA 4OB6A 2GLUA 2IVFA 2Q2VA 4I8XA 1KS9A 1VPVA 2ODEA 2VZ9A 3R5KA 1FTGA 2Y6VA 4WFKA 3J81A 3H5LA 4HHEA 1KPGA 3ASVA 5FTLA 5EZ5A 1U2GC 4YO7A 1DVRA 2WJAA 1X1SA 1OLOA 4Q3NA 1QLHA 1S3GA 3IAXA 2QNIA 2N9UA 1OLUA 5DHPA 2O2YA 3VYUB 4BNHA 4Z1MD 2E2WA 2ODAA 2QTLA 2RGUA 3C7AA 3DO5A 4K0RA 1FSZA 1V5IA 5JNVA 4OMDA 1BWSA 5H16A 3G0OA 1XTJA 4C76A 2VBIA 5SY4A 1KYYA 2Z8YM 3D3WB 4JBHA 5IYZA 2E5WA 2ZIWB 1IMOA 3TNYA 3LA8A 2V45A 3CTPA 1GAQA 4KR9A 1GRRA 1Q7EA 1Y34E 4YPOA 2Y2VA 3FNBA 3H5OA 1I01A 3Q5DA 4GW3A 4JJIA 3L8MA 4QHYA 3RS5A 3WYEA 1N5KA 4Q66C 2JGAA 4HX9A 3UA4A 1PT9A 4UPEA 1O5OA 1KK0A 2Y92A 1QP4A 1BC5A 3TBKA 3OZDA 3ANTA 5B6JA 2P3LA 4WD3A 5AVYA 2WUDA 4XM2A 1QIEA 2GN2A 3VU8A 4AF6A 3QE3A 5J2TB 5I7FA 3IV6A 2Y2UA 2EF1A 4F91B 3ZDXB 2BHLA 3KRTA 3S7TA 1HM5A 4BDTA 3JWEA 1NZDA 1CHNA 2Z4SA 1DAHA 2Z8XA 3PHIA 4RK7A 1HOXA 2GVDC 3C14C 3O83A 4KN5A 4ZVRA 5HVNA 5K3OA 3C4VA 3PNLA 5J47A 3V8BA 1DWUA 1G2IA 3AI1A 4RE6A 1F06A 3AFNA 3D7LA 1KNXA 2WF5A 4KO4S 4AF8A 6CHYA 4OXNA 3E22A 2GZ3A 3R3HA 2YOFA 3GLFE 1QTIA 2Y68A 4JVLA 2BHRA 3RVMA 2PYIA 3N74A 2J7PD 3WRWA 1E9AA 1AO3A 2DFKB 3I64A 4BNLA 1EDDA 5AW4A 3TRKA 1WO8A 2WD7A 4O2AA 4I0WB 2OBFA 4ZVNA 3TTWA 3DTTA 1O8BA 2J6IA 1Z56C 5JD6A 2DFDA 3I8SA 4FW8A 2YS6A 2H52A 2Y1GA 4GPEA 1VB5A 2Q9AA 3ORHA 1QRTA 1URPA 4JBLA 5AVRA 3L7CA 1KYXA 1L4MA 2R4UA 4XSHA 1TZKA 1Y48E 1N7IA 5DGTA 3TLGB 4BNIA 1GL6A 1G8AA 1T4CA 4MX8A 3FXAA 2XW6A 3GUZA 4D4HA 3N0WA 3CLSC 4S24A 4UUPA 5G53C 4XYEA 4RV5A 3VTFA 5B64A 1ZD3A 2ODNA 1P1CA 1ZNYA 4PYKA 5K2MA 2YNMC 1OTYA 4XOIA 3REFA 1JKJB 3SYLA 4HXEB 4JSRA 4BKQA 1EXDA 4MV3A 1XXHE 1HNZB 4XPIA 3RD5A 1A82A 5C1IA 4PNPA 5DB4A 5ITWA 3FNHA 2EP7A 1W36B 4NK5A 1T0UA 4NEQA 5HE8A 2FFAA 2L42A 1WHTA 1YOVB 2ZSDA 2K4MA 3LWDA 1T0IA 5GJVC 2NU7B 4GPIB 1QAOA 3NPMA 5IBRA 5A3QA 3OIUA 4L5JA 4AJPA 4CLRB 4JYMA 2DTDA 1KJNA 1NWHA 4WMLA 3ZV3A 4ALMA 2ZTVA 2JAHA 2DH5A 2ONKA 4EARA 1OH7A 4M7PA 4ZZ1A 2XB6A 3FTCA 3RADC 2H5JA 2ZJBA 3KP1A 1PI3A 1EI9A 1FXUA 2VDKB 3VYWA 2PT9A 4YLYA 3QRWA 1YTLA 2VHUA 1OC2A 5IKPA 3M89A 4HPJB 2O52A 1PR5A 2Q1YA 1FS4A 2EGGA 3KUUA 1OXKB 2NUAA 3FTDA 4PAMA 4Q9NA 3HYTA 2Y77A 5FUYA 1SKYE 1QF7A 1UAGA 2R8ZA 2YQ4A 4TRRA 4YAWA 3L4BC 1UC5B 3M6MD 3TSOA 4DR3B 1TQ6A 1KS2A 1GUYA 1QVVA 2QMYA 4G67A 2IFTA 4C04A 2ORIA 1SQSA 2X0JA 2JA1A 2RAPA 4Y1FA 4JL6A 2FETA 1FJHA 3GQBA 2W8ZA 4D9CA 1PKEA 3T3OA 5JT1A 1DBWA 2YW2A 1MVOA 1YJCA 1G21E 4OO3A 4RV9A 1BWPA 2WYOA 3SZRA 3THSA 4XZ3A 4CT5A 4IDEA 1R0ZA 5BOVA 1LSJA 1JEJA 4CM8A 4MCIA 4BNFA 4ZALA 5A4MS 5F35A 2ZIVB 3ZS9A 1IBKB 1R5BA 1EQAA 1UBNA 3GF4A 2DCUA 3Q7RA 2L0XA 2B5VA 3FI0A 3KNZA 3N7AA 4B43A 1C14A 3EXAA 2HLPA 2Z56A 4BVLA 5BQPA 1SUBA 5KCZA 3TH5A 3NX4A 2D1RA 1F1BA 3NS7A 1PR3A 3DEAA 4MKHA 2A9PA 4KO3S 1QO0D 2FX3A 2ZQ5A 3MTQA 4R7ZA 2YR0A 5BPFA 5C7IO 4TZKA 3O8OB 3NKVA 1T5TA 1WQ4A 4I50A 3RU7A 3I9FA 4OHPA 4WTOA 1KYWA 1X1AA 5DRYA 1R3UA 3QUTA 5FI0B 1XA0A 5ITVA 5ECYA 4IDDA 2FPLA 2XVYA 4FPXA 3N9IA 4YMTA 3QWFA 1LTQA 5ALDA 1WB6A 2XH8A 3A2NA 3NIBA 4EOGA 1LW7A 5ENZA 4OA5A 1JYFA 4ARAA 1OXUA 1B15A 2J0SA 3AVQA 5ITSA 3LLMA 3LUKA 5FV7A 2ILVA 5A5EA 4N9QA 1QTQA 3TCKA 1TTTA 3I45A 1JDTA 2WFAA 4KUGA 1XU7A 3E18A 2EEPA 2PGLA 3VNBA 4ANFA 5KTNA 1ZQ1A 2Y4OA 3DNFA 4UFOA 4LY9A 4X1IA 1IPEA 5REQA 4X3OA 4DPKA 4EPTA 4KQHA 4W82A 5TMEA 1A5ZA 1G8FA 5IBQA 3LOPA 1Z6YA 1TIKA 3O92A 3T3MB 2XTNA 4OQZA 4BY9E 3G79A 1JTFA 4C2BA 2PYDA 3R0XA 1ZJZA 4C03A 3UXMA 1O89A 3BE5A 3PUKA 1DUIA 1X19A 1QP8A 4RJ2A 3TECE 2HFKA 4W1QA 2ZJZA 3KS9A 3ZZMA 2JBWA 4E94A 2PLAA 4MZXA 1PVOA 2JKZA 3I0ZA 4S1NA 4OHVA 1VHJA 1QFMA 1N1DA 1ZOSA 4OXXA 3VR5H 2A0XA 2YOGA 3HK2A 3B3AA 3C6ZA 3SF0A 2R6FA 2G77B 3CUEF 3EA0A 4RUKA 3ZBQA 3S99A 4ZPXA 1A8IA 2BM8A 3B6KA 2X0EA 4O1HA 1XNQB 3CBGA 3WHPA 4JI7B 2WTEA 5AKYA 5IJZA 2BKVA 1K63A 2GPTA 4ENWA 4J49A 1MIHA 1AV7A 2AI3A 3MLAA 4BO3A 4RTPA 1FYFA 2PZ8A 4EAAA 4WLFA 2FSHA 3ROPA 3TIXB 4UUBA 4AN0A 5KQPA 3DCYA 3C70A 4ZREA 3VU1A 1ZGCA 2ADOA 4ZCTA 3SKXA 2WUEA 4HNHA 2PIAA 3W9BA 3E70C 1BN6A 3ETNA 2C3PA 1V7QA 1PZGA 4QG3A 1ZDMA 2CNLA 1EXMA 5EEGA 2X3YA 5CXQA 3EPHA 2W2QA 3G8AA 3KTDA 3EWIA 1QRRA 1SG6A 2B4AA 2ORYA 3NANA 4N9WA 4WEOA 2C1EA 3L93A 4DM3A 5ICEA 1VFPA 4BMZA 5AW6A 1L7DA 1X86B 4IXWA 3USES 2ATIA 1TA9A 3GP5A 3DCIA 4BNJA 1AB6A 2Q1SA 5I45A 4FINA 1SPBS 3TCXB 3TIGA 5C7OO 2Z98A 5AK5A 5JRZA 4WY8A 1IK6A 3DXFA 3DC7A 3U13A 2GM4A 2BCEA 3I9LA 1KJ9A 3TLBA 1Z9BA 2HUPA 1WKCA 3R4CA 3DXZA 3D9QX 1LBHA 1XZLA 2HYIC 1T5HX 2OCAA 4XVCA 2H6EA 2P9QA 3D2CA 2Q0HA 4H6VA 2WFMA 1BEEA 1UPTA 3O93A 4OQLA 3UQZA 4K3VA 3WGIA 2ERCA 2OESA 4QFDA 2X5KO 5TY0A 1RYYA 5BXQC 5ALOA 3LHFA 3OLZA 4EY8A 3K4PA 2UUCB 3MCZA 3G2NA 4Q4JA 4BFSA 4CFYA 2XSZA 1DT3A 2JGDB 4IGFA 3NC4A 2F9FA 2GZSA 3CUYA 3EVGA 2F3PA 4MJXA 5I7WA 1AKNA 2Q45A 3IDFA 3P32A 5E7MA 5THQA 2P1RA 2F1IA 4KX3A 4LZNA 4EKIA 3CW8X 3D6NB 5ALVA 5JMWA 4RKYA 4D4IA 3GAZA 3MUNA 2HRQA 4M98A 3I76A 3OZFA 1MZVA 3KKQA 5C5IA 2IF0A 3DP9A 1P75A 2PZAA 4KUHA 2M1ZA 2X19A 1A77A 1J21A 5GVRA 4Y2HA 1VMEA 4B71A 1C81A 1WTCA 3FYDA 5HRAA 2H1FA 2ZTUA 4H3SA 4IHJB 1U6JA 4CI9A 1EWVA 1V8FA 1WABA 2VTKA 5KVQA 1PS0A 5KJ6A 2XX3A 1U7TA 3SAJA 1XTTA 2VTVA 1IJKA 3E8SA 1BXRB 3I92A 3IQDB 3OJCA 5EVJA 1VSTA 2Q7DA 5JS2A 5AVTA 4G0NA 1KP9A 2QI9F 2GM3A 3MT0A 1SB8A 2IQIA 4DILA 5GZ6A 2J0UB 1EE2A 2RGYA 1ONSA 2VDOB 1SXGA 4QXPA 1JXMA 4REMA 3VR5A 3H3JA 1KY4A 2ZUUA 1S0UA 3KFXA 4BLUA 1Z45A 3P9PA 4GH5A 5DLEA 5FL3A 4B4WA 2BMFA 3ZDQA 2DLCX 1ND5A 1R0CA 3ACCA 1H8ED 4KQJA 3T94A 4CEJA 2AE1A 4MROA 1JDZA 4WNAA 5DMHA 2G63A 5FWDA 4KK4A 2XTZA 4EBFA 4POOA 1QCZA 5A3VA 1CUCA 4D43A 3SS9X 2OLJA 4UAGA 2R1UA 4OBXA 4R2XA 3H1BA 3F5DA 4AZ0B 2YWGA 1R5NA 2EP5A 2J0VA 4UE6A 5ERYA 2GHIA 3ESBA 3UG7A 3GN2A 4F72A 3ADDA 1KZ1A 5TF4A 1YMQA 4P81A 1R5OA 1O94D 1A2KC 2PUTA 3UV7A 5ITZB 3HJNA 4LJYA 4A2QA 5JECA 1GG8A 2HY7A 5D86A 4XDHA 1C7RA 4EVSA 1WZNA 4JP3A 1ZBQA 1IXRC 2WHXA 2C8VA 4PF1A 1V96A 1Z5NA 1QGDA 4XX1A 2OZLA 4XJXA 3RRFA 5I8WA 3O82A 5GP1A 2VPZA 4C06A 1U11A 4Q7KA 3HVJA 1FBTA 4FEYA 3I2YX 1PFUA 4E1VA 1QP7A 4Z9BA 2AX3A 1MGPA 1VP3A 3AVWA 3H87A 5AKKA 1QH9A 3AO0B 3UPDA 3W9YA 5B6PA 2IYNA 2X9NA 1DL5A 2DVMA 3F49S 4GC9A 2HCTA 2Y1KA 3V3KA 2H57A 3AHGA 1FYWA 1NDUA 2AN3A 2EW1A 3WL7A 3T3NA 4FUQA 3GAAA 3TZ6A 1TTPB 3NHRA 4HGYA 4NBSA 4Y1RB 3THYA 1BD4A 1LTKA 2ZYAA 4LJ8A 2H1CA 4BO0A 1Q2XA 1TXGA 1J2EA 4XLLA 4R4JA 4PLZA 3WOHA 2I0FA 3THWB 3LCRA 1SCDA 4UREA 1T6NA 4NMHA 1U7PA 2YUIA 5EERA 3BXOA 4FEGA 2C4NA 4MI6A 3OJXA 5IEBA 2D5BA 4AP5A 2W98A 3JWPA 2ZAIA 4IVPA 4N0DA 2IOFK 2C7OA 3ZWXA 4NJEB 3Q3EA 1B42A 3UMRA 1N0WA 3ROTA 4QXRA 3B5JA 4TMXA 5D51S 1NV9A 4C3ZA 1MQAA 3TIIA 3CZQA 6ADHA 3SNHA 3HDQA 2FZ4A 5FLKA 2Q4TA 5AUPB 1KEVA 5FLEX 4FDLA 2CZCA 2RKOA 2CJXA 4GIBA 3IA7A 3LGXA 3QPUA 1EG7A 3BAFA 2B83A 3M5DA 1BFKA 1FK8A 4WESA 2NTEA 2VJQA 4JC5A 1Z25A 2Z43A 2PUAA 1HORA 6ABPA 3ND9A 3QKIA 2P90A 5E1MA 5AVXA 2QTVA 1N8SA 1E9CA 4MUBA 4X3CA 2WKPA 3UHJA 4BIMA 1GPJA 1HEIA 3CH5A 1PTJC 1EXVA 1HZZA 4KLZA 3IIIA 2FPMA 2WJYA 3B1KA 4IIJF 2WWYA 3UJ9A 3AWIA 1PJTA 4WXRA 1UBJS 4BQSA 4UBLA 4BFYA 3UUWA 3JWGA 1X94A 3EBLA 4OQEA 5HF5A 2FPWA 4DM4A 4X54A 3N70A 2JFYA 4JN6B 4KTTE 5JCJA 5IH7A 1I7NA 1VPLA 4KMMA 4P7KA 4HEJA 2Z6UA 1N32B 1V9LA 4I50B 2GF2A 3DBOB 3G8YA 5DNWA 2GBFA 1NUHA 2B1RA 5DBIA 4ZPJA 4C7KA 3JXEA 2F90A 1UCFA 4QAQA 5TQ2B 5ALUA 1AKQA 1ST2A 2XRMA 4EG7A 4HVCA 3FLBA 3ROEA 3GLGB 4KR6A 3KHTA 3ESRA 3ROKA 3IJEB 1DEHA 4N5DA 4PG5A 1QGUB 5ALSA 2B1JA 2QPAA 5FLYA 4YECA 3RRZA 2X6RA 1MEJA 1TVKB 4HDNB 721PA 4MJ7A 2MSLA 3KSAC 3ZOKA 3SZMA 1XFAA 1Z0IA 4GNKA 3IQFA 1QDLB 4NNPA 4I5EA 1X3SA 1OXXK 4YV0A 1I6MA 4GMHA 1PD0A 4NYMR 2WNHA 1KSFX 4HQ0A 4RLQA 4OHMA 2VJBA 4RESA 3VR6A 4EYEA 1E1RD 4IFTA 3G6KA 4PFQA 5I4CA 5JS7A 2BFBB 2FEKA 4E4RA 1JWBB 4I4TA 2C2ZA 4MS3A 4H0FA 1E5VA 1SB9A 4HQFA 1Z0KA 2ZIZA 3GBPA 3N2IA 3HU3A 4ZOCA 5AKLA 4D9MA 2Z1DA 1KH3A 4R84A 5EYPB 3PXUA 1B23P 1UKVY 2OR3A 3VV3A 3QUBA 1VMAA 1FFHA 2Z5GA 2YJ5A 1L4LA 3EEIA 3IAEA 3Q98A 4CI0B 2Y0EA 4ETIA 5K6TA 5DWVA 4C0WA 4DKJA 2FSUA 3FZGA 2HJGA 3G85A 4KE8A 3E7PA 3KV1A 4HQLA 3EQ7A 1WM1A 3RT7A 3O8DA 2O57A 4B87A 2ZYDA 4MLZA 2GDJA 5L3RA 1X7HA 4OHYA 3PVCA 4A8TA 1XL1A 2C82A 3NBXX 4TXJA 4ZYYA 2PQMA 3QOXA 1AS0A 1TIBA 3KQHA 3DHEA 4S05A 1XLUA 1ZI8A 1H2HA 1DC5A 3FUXA 4TV9F 3ZY2A 1U8CB 4CQMA 2P9JA 2AKYA 4O2LA 4EATA 4K2HA 1YUBA 1ZH0A 3O74A 4X1YA 3LE8A 3TTYA 5JJ5A 4BWYA 3GP8A 5BN3A 3FYSA 4UQOA 4MPTA 2ZVQX 2IOQA 2VJKA 2XDQA 2BBWA 2O2HA 4KKXB 4N0EA 1AF7A 1E1QD 3O0TA 1LPNA 4RMNA 3WBKA 3HJFA 1HG1A 2HN9A 4LC1A 2E4ZA 1YV9A 1DJPA 1TF2A 1YT5A 1X7GA 1GTZA 1ZD4A 5E7JA 1CQPA 3OEHD 1IAVA 2B69A 2VDVE 4HAXA 1G291 1USGA 3DR5A 3R09A 4H59A 3U26A 1PTJA 3EOAI 3LYLA 2G72A 1G5IA 4GI3A 2JI4A 3QX9A 2CVPA 4EI8A 3CLUD 4FOLA 2XWBF 3UV3A 4CMIB 1XDBA 4NK4A 1FSPA 1VJCA 1SUDA 2Q3LA 4CM9A 3ZYCA 5G40A 4LF4B 2AUMA 1TD9A 1Q0ZA 2I5PO 2ZBQA 3PLAE 1ORRA 1WOYA 3X44A 2G5CA 1JFFA 2BFDA 2Q5HA 4MJLA 3R5HA 4MXDA 3G02A 3OT5A 4MUIA 2DWUA 4DVJA 1GRQA 4IIJA 1L5GB 2PSFA 3GJ4A 4LGVA 2PT6A 5BSFA 2B94A 4H2DA 4IX1A 2FDXA 3KEOA 1DTEA 4HFJA 3H8SA 7ABPA 1ZMOA 3I04A 3S81A 3V1UA 3X1JA 2CHVA 1T2NA 3I04M 1XLWA 2ZSHA 4HDMB 2VNSA 4K1XA 2LE0A 3PNSA 1KBZA 3C3KA 5JAUA 2P0AA 3D8TA 4CTKA 3V8PA 4Q93A 2C9DA 1CG6A 1RU3A 5A7GA 3O8RA 3BMCB 3KZ1E 1JAYA 1FPMA 3ZJYA 1DPGA 3P1JA 2V7QA 3D2BA 4R51A 4U2FA 4ALNA 2A33A 1ZUHA 5KYGA 4ISBA 3ENWA 3MHPA 1Z4QA 4DQXA 1U99A 3KL4A 4JVMA 1IQPA 4WI1A 1PX0A 3DQPA 4YRCA 2PWZA 1FUUA 4K9RA 3RREA 4X91A 3L6BA 5JMPA 5EE9A 4JI0B 1EM8A 3N6XA 1A4XA 4B75A 4DJDC 4XPZA 1FP6A 4YREA 4IIBA 4ZOQI 4DCMA 3HCDA 3KQWA 3M2TA 4EVIA 1ENPA 4PZUA 4YCCA 4C0AC 1UT8A 2XZDA 4PG6A 3LY8A 3Q40A 1JEDA 1E1RA 2RGDA 1F5NA 5L3ZA 3TZEA 3Q2KA 4KE6A 2R1TA 3R7SA 1DJOA 1LWNA 4HPXB 4YGYA 2K7ZA 3FGNA 1WETA 4L51A 3DFUA 2ZPTX 4ARBA 4QPCA 4IHKA 4FK8A 1M75A 2ZI6A 3WG9A 2X9LA 1I4WA 2WB4A 2PBRA 3WL5A 1GUZA 2O8VA 3D4OA 2ZRLA 5KTTA 1I4TD 3WYGA 3NTOA 2BSAA 3K9HA 1AKEA 1LK7A 3MBOA 3PWSA 4YPVA 2J08A 4DDTA 1RKUA 1W5TA 3GCZA 2D2VA 2ZIAA 4BO9A 1B1CA 1ZNZA 4CEHA 1LY1A 1OJ7A 2NUTB 2P4HX 4YMLA 1D4ZA 4L08A 5JS6A 1N5RA 3OY2A 3CRRA 3FZYA 5JYDA 1KY3A 3HSKA 1EG2A 1QHIA 1ORVA 5FPTA 2GBIA 1JGTA 3R5FA 1D5CA 4IIYA 4CM6A 1LLUA 3BB1A 2V5VA 3B8HA 5EY5B 1Y1KE 2FXIA 2ZYHA 5LLDA 3UJNA 3U44A 1YDMA 4GM4A 1SOMA 1I5OA 2IBSA 3VYTB 1D2AA 2ZRNA 1O77A 1TVKA 4NYIQ 4UHJA 1VQ1A 2Q3HA 3ZK7A 3NZEA 1VJ5A 2HD4A 2YC2C 5M7EA 4D0NA 4MV9A 3UW3A 1V8ZA 2HUNA 1U6KA 3S2EA 2JBHA 3UPUA 1UPAA 1YUMA 3QFHA 4BGVA 2HQBA 3HFJA 3M6UA 4BO7A 4ND1A 4KN9S 3H16A 1ADGA 5TEVA 4JBNA 3DUFB 4IDOA 4QOHA 4YMWA 1QB7A 2W2LA 3DC2A 3K72B 5B55A 2FZGA 1EXWA 4KH0A 4NJMB 4LHXA 5JZSA 3QW2A 3IIJA 4V0KA 1ZW1A 4P0PB 4BWVA 2MCFA 5LJLA 3EVZA 5EXPA 2X1HA 5HHTA 2PLRA 3UYKA 1PL8A 1DB3A 2QY6A 1SD2A 1SKYB 2VJOA 4GDMA 4W4TA 2ZLBA 3DULA 2NTVA 1XJ0A 3A8TA 3H5NA 5ALNA 5JAIA 4QARA 5E6UB 4BB5A 4ZDJA 3ZE1B 3BRWD 3DXXA 1XA3A 2BGTA 3WE7A 5MF6A 5ICFA 2XNDA 3K2IA 2ZBGA 4A1FA 1RXVA 3EIQA 5JXHA 1AXRA 2BEVB 3F0TA 4ZAZA 1MRZA 2FJ0A 3LY9A 4LOKA 5H68A 4TL9A 3ANMA 3OUZA 1FDRA 1D1TA 5ECWA 4GR4A 3AEYA 4YDHB 1X74A 2H2HA 2NP7A 2H4FA 1VDMA 4CTNA 3FFBA 4BHTA 2DC1A 3STXA 4A4DA 1AK9A 2PANA 3IE0A 2PX0A 4MUNA 1LLQA 1JSCA 5TGTA 3JYHA 1I7SB 3HJAA 4I2VA 1RWXA 3VNRA 4ETMA 5LFAA 4EUKA 3NNDA 2QY9A 3CF4G 3ENNA 3I30X 3M7IA 4KYTA 4DPMA 1Y3BE 3EIWA 1CQJA 4ZOLB 4ILEA 2GD6A 3IMKA 5CVEA 3K0CC 2O8DB 1KI6A 1HPLA 3E5NA 3E4CA 3ZGZA 1GVHA 1VIDA 2X42A 2ZBPA 4N8DA 5FOSA 1Q0TA 2OCIA 1KO8A 2CHEA 1NN5A 2VRBA 1T3LA 1JHUA 1Q57A 2C2YA 1U4SA 1UODA 1XN4A 1CUBA 5LA6B 2BMEA 3FYHA 4JX9A 1H5QA 3PHJA 1XRRA 1I24A 1HDXA 1ZD8A 4BPBA 3DT8A 4X24A 5AI4A 1L5VA 5IXJA 1SC1A 1KYVA 2QUAA 4QRIA 2OMKA 1ZC4A 4GVLA 4ZICA 2C3YA 1PL0A 2HF7A 2ZU6A 2PN1A 3V9AA 3WLLA 1P7ZA 1ZO8A 2YJ3A 4Q6BA 5F21A 1JFSA 1ECLA 5ALFA 1YI8A 3AIMA 1RNLA 4ZEXA 3B9RA 3SC4A 4LK2A 1ETHA 1R0XA 2PGIA 3Q15C 4YJHB 5LYJF 2WAAA 1ESDA 5CURA 4K6FA 1ZVJA 4QELA 1NKSA 1XZFA 2PKCA 3EUWA 2VPQA 1LU9A 3PGLA 3ZZUA 1E2BA 5EIBC 4MITA 4R05A 5CFPA 3U7FB 2IHTA 3M6WA 1JR3A 3MJFA 1F0KA 4N6GA 4QEZA 2BMVA 8OHMA 1SXJE 1ESMA 4KX5A 5A6VA 4IXDA 4OI1A 2O3TA 2PH5A 1UOQA 3U60B 1D2CA 1I6WA 3GLGA 2G0TA 1L5MA 3GJZA 1XEXB 1K97A 3WL6A 2XMPA 3PD0A 4GMGA 5AJXA 4GZMA 2W6PA 2Q0XA 3A1WA 4LJ7A 1CE8A 4NBRA 4DLRA 5KNBD 3IQEA 5FUQA 3THXA 3H2BA 2DQ4A 3NOVA 5K8IA 1F7VA 1VC2A 1FC0A 1SBTA 1VI2A 2FGJA 3LX6A 4D2IA 2Y6UA 4EB6B 5U9CA 4IICA 2UXCB 2B20A 5EIXA 2PKRA 4IZHA 1O54A 4L9SA 3VHQA 1E18A 2GBGA 3H0KA 3HBJA 4M2LA 5CVTA 2ZJ4A 3TUIC 4DSTA 3ESDA 5EP1A 1WW8A 3ESXA 4FQ8A 3LUFA 4QUDA 1C1DB 1DJMA 5BV8A 2IK8A 1T8SA 1DPFA 3QVMA 3NP9A 1E0SA 3V2IA 2DR0A 3EY4A 1GNSA 2AZDA 3FGPA 3GW8A 1CZUA 1OX5A 1PGNA 2OSVA 2PJDA 1HEUA 1DQRA 1KJQA 3P5SA 4U3JB 1KK1A 3AIOA 2RBEA 4XR4A 4A2PA 1NXQA 1OJLA 2J3KA 1W1IA 5J63A 5F78A 2FLKA 4ZZ0A 1E62A 1QKKA 3DMGA 3K3PA 5LC1A 2YIJA 3T54A 2JJ1D 4ZGBA 1K4YA 2WSIA 3EASA 3HFGA 1IZYA 2PBZA 3FAZA 3DD1A 1HQDA 3HXLA 4TUYF 3JQCA 1JEYB 4JB8A 3ICEA 5DP1A 3GUYA 3HB7A 3EAQA 7MHTA 3D5TA 3LP5A 1DUSA 1B2LA 2XEDA 3PPYA 3W90A 1E9RA 3M4XA 4I9HA 4ZEWA 3ROGA 5IT5A 4X66B 2QTHA 4UZSA 1XZKA 1ZK1A 1VIYA 3DZDA 5EGNA 5G1NA 3G17A 3D1LA 3FN4A 4OQNA 4P80A 2CXOA 1AM4D 4WFIA 3ZHQA 5JI3E 5JXGA 2DYKA 2H2IA 2X4GA 2ZIXB 4R2MA 3IP7A 5DCYA 5KYXB 4ZAVA 1ZR4A 4ABYA 3L49A 4MJ3A 4PC7A 4BZXA 1EX6A 1M2OA 4EA6A 4HGZA 1MQSA 4C7MA 5FRDA 1W4CA 2JIRA 3O2QB 4CHTA 5JSQA 5ALEA 1P0CA 1R88A 5AI6A 5HOQA 5B2FA 4IOJA 5AI0A 1S4QA 2PL9A 4P22A 3WI7A 4PLYA 3FTEA 2J9GA 1GPNA 1Z63A 2FG5A 2AQHA 4II7A 4DMKA 1C9DB 1PO7A 3CG0A 4XVUA 3WAJA 2NXCA 4DW8A 5JIBA 5DH9A 1ESEA 2NO0A 1UWVA 3T9DA 4OV6B 3ICQB 1JU4A 2JAXA 1EP9A 3PDHA 4O4LF 4CR6A 2I66A 2XI4A 5LMZA 3GHYA 2X6TA 1RHQA 4X85A 1DS6A 2Q2WA 5CGQB 4UBIA 5H3CA 1JQ3A 3SN6A 4H1TA 3TTVA 1V8PA 1UMCB 3EMKA 3G2QA 2OT3B 4JUFA 4CDRA 1NQOA 1UJCA 1T29A 3JPYA 2F8LA 2QJRA 5CJ2A 4J0HA 4HXYA 5F33A 5IMBA 3CCCA 3EFHA 4PN7A 1Y63A 2Q8QA 1MVLA 4PLGA 1TJ3A 1JR3D 3PS9A 5K6RA 5CBPB 3AKZA 4LJSA 4GX5A 3DG9A 4O3MA 3GVCA 3TVDA 3B6JA 4FGJA 1CP3A 2R48A 1Z0UA 3PT9A 4XUEA 2VYND 3PTAA 4IHQA 5A4IS 3P52A 1ECBA 4ZA2A 4MWSA 1OU4A 4UEKA 1XZIA 1XC7A 3LFTA 1C0IA 3V4VB 3DTNA 3AMVA 4A3SA 4QECA 2YWXA 3UNXA 2HT6A 4IW3B 4CVNA 1PUXA 1U3VA 3DBHB 4D4KA 2I6TA 2FR8A 1JQKA 3GEPA 3WMFA 1BJKA 5K8UA 3C0KA 4DEYA 5LOVF 3QKRB 4F4CA 3RKUA 1P5ZB 2FOLA 3AUTA 4XQGA 4E51A 3IMCA 2FMTA 5EWJB 1I3NA 4TTAA 3ZE8A 4BNKA 3AVYA 2HW8A 5EJMA 5AVJA 1X14A 2YFYA 4CLDA 3JAMA 4X97A 4JV5B 4KHPB 1BA2A 5FOQA 4RENA 4AJ2A 5DW3A 4JDPA 3U7RA 1JIVA 4U2CA 2YVUA 4JIGA 2BFFA 2CW5A 4O8ZA 4LOIA 3BRQA 3I2HA 3SHFA 3WK6A 4A8HA 1HDOA 4F38A 4DDUA 1DQPA 3JR3A 4DN6A 3C5HA 5ES4B 3ESZA 2FE1A 1QIGA 1T5IA 4K3UA 4D79A 4QD3A 1FMCA 5K0TA 1OKKD 1S7CA 4J90A 1W5SA 4AG6A 2V96A 1SWVA 2OM2A 2QGFA 4IQGA 2VRNA 3ZIAA 2F64A 3EFOA 4UNRA 5KJFA 4FKBA 4MKGA 5GZ3A 5KTRA 3U5TA 4FFBB 3RTCA 4BN4A 1Y4AE 4O1MA 1ODKA 4DWWA 1GZ6A 5KOHB 1KGDA 3P0HA 1M34E 2QUZA 3F2VA 2XF2A 1WNFA 2ENUA 4LZWA 4U00A 4B6SA 4JOQA 4XQ0A 1A9RA 4DWVA 5IJ9B 1W88B 2JLYA 3QMWA 2COKA 3BRWA 1Q7TA 1DE0A 3HZRA 3RASA 1L6RA 4NV1A 4BNWA 1PFYA 2NYRA 4XWKA 5C4IA 3LKZA 1D4OA 3MXTA 5KOYA 5B1HA 3A6FA 2ROQA 3TLAA 3F4LA 2EG5A 3ZTTA 1EFRA 3HCPA 1FE8A 1GQSA 2OENG 2DBQA 1JBQA 3OJLA 4QYSA 5E1BA 3TTTA 2ZWOA 1FDIA 2ZTHA 2F67A 4X95A 4XASA 1L5ZA 2Z04A 3GT0A 4DR2B 2RH9B 3EF0A 4HGPA 4XARA 3C6BA 1CY1A 5A04A 3OPYA 5CW2A 1LRJA 1V8BA 3RHZA 5E4YA 4Z86A 2PXHA 3AX6A 5JU6A 2PMKA 4R40A 1XPRA 1WEHA 3K15A 4DQLA 5EXDA 1P45A 1NJSA 5CM2Z 2YWCA 4P7JA 2IU6A 5AR1A 1HKHA 4C3VA 1BSVA 1JECA 1RQ2A 5T4EA 5KYYB 2KLHA 3PXBA 4A73A 4B7ZA 1QHYA 2C4MA 3A4MA 4TROA 2PMDA 1RMQA 1PQUA 3P0FA 4D6YA 6Q21A 1PSWA 4FCCA 3COYA 3BTVA 4BP9A 1WZEA 1Z2DA 4QHSA 5HF9A 5CG2A 3CH7A 3OQOA 2BOVA 5HK8A 2CWDA 1G1MA 3G3EA 4HH1A 5AW9A 5CBKA 4C0HA 4YHBA 5LCXA 1UJNA 3CF6R 2V7UA 1L5YA 2H31A 4QASA 2F55A 2BSQA 1KYIA 5CJPA 1KDRA 2CE2X 1X80A 2XKJE 3H2GA 3MTBA 3Q7PA 3UFBA 2PGAA 3ZCXA 4D80A 4CLRA 1GO2A 1QFZA 5DYWA 3BL8A 3NNNA 4BB6A 5ICGA 1LC0A 4CFSA 3OLCX 3VAYA 4BLVA 5DGCA 1UAAA 4QFBA 2C8JA 2W0MA 1QC5B 4F6LA 2Q5QA 4M8NE 2CV1A 3MWFA 2NUBA 4TV9B 5CCDA 5C7YA 1CP2A 2ZYWX 3O1JC 3ELBA 3TRDA 1C9NA 4J2HA 4QXMA 2JGFA 4EABA 1PEYA 1C3XA 1ABEA 3IBYA 4P3OA 4F46A 4MQUA 1G60A 1PR4A 1UM8A 3CGGA 2CCJA 3AKEA 4C0LA 1E3WA 4GYWA 4AMBA 4HRVA 4FKMA 1W75A 3RIXA 1UDWA 4F3NA 3UTCA 2HKIA 1UBLS 2GETA 2QMUA 3DMFA 4KW7A 3WWDA 3DO6A 4B6PA 2VP0A 4Y0AA 5SZIA 1UEJA 2VAMA 4K9OA 4BMOB 3KAJA 7AT1A 4YDRA 4EPVA 4HRXA 2GF9A 1Z74A 1MB4A 4LTMA 4UUNA 4AJ1A 5BY2A 4UHHA 1YQ9A 3CJRA 3HP4A 2WD7B 2D7CA 3P8ZA 3UOWA 4Q0MA 2JI6A 4KNVA 3AUSA 3ZJVA 3HJHA 3TYXA 4MYRA 3VKUA 4EG4A 1BWQA 1XCOA 4ZVTA 1FCJA 4ZO4A 4TZ6A 3WLOA 1VHWA 4Q7JB 3D2AA 4BLSA 1BVUA 2E4WA 2Z8ZA 3R6WA 1CQIB 1O9BA 1CDDA 4RZSA 2I67A 3QSGA 1Y8QA 2AEFA 3BZWA 4FNOA 1QUEA 4GXTA 1J00A 4LY0A 4Y2GA 4Y9UA 4MQFA 5AM2A 1U9IC 2BHTA 4JUCA 5JG7A 1RJGA 2C9CA 2J3IA 3IOEA 1NXXA 5ESRA 1HEYA 4FGZA 4IDQA 4W8GA 4XDYA 4LVCA 1M2VA 4OHOA 4JD5A 2LKCA 3JQ7A 3ZW8A 4DIFA 3SXPA 4IF6A 2VPTA 3HYLA 4N01A 3ZBTA 5HKKD 2E85A 5A71A 5FI1B 4DA0A 5FTMA 2QENA 3ESQA 2E4VA 3ORSA 2Z6QA 2X4DA 3RPEA 4HUQB 5FNZA 2VQEB 3J7AC 2X7HA 3H11A 3PQ2A 4XA8A 3SY8A 3QVUA 1EP1B 2JJ1A 3KO8A 2CXRA 3L1UA 3G0CA 4XWOA 1RLTA 1F6DA 3IP6A 1GZSA 2EVWX 2HHCA 4YMGA 3RJMA 1QCDA 4ZRDA 4KLAA 4DV2B 1QV6A 2PKYX 1ZJYA 3A05A 1RFLA 4QC2A 1D4AA 4TMFA 4ZVKA 2QQFA 2GRUA 3ONDA 3EYAA 5AJYA 2FPIA 5F7ZA 1GN9A 2CNNA 1L7PA 1PJ4A 4JUDX 1Q1AA 2FSGA 3UK7A 1KWKA 1EFTA 2C94A 4B6OA 4BP8A 1W6RA 5HIJA 2Q62A 1WDWB 2F00A 1UKCA 3KLMX 3N75A 4JL5A 3I1FA 2V7EA 2CEKA 1P1JA 1J22A 3NWPA 4FYKA 4QPNA 3W1WA 4BCCA 1Z22A 3W2EA 4ZEVA 3TZBA 3K96A 4A0FA 4G56A 4GWLA 4QBHA 3STWA 2ZJ2A 2AYYA 1Q0HA 2P2LA 4FNMA 1J8FA 1JYEA 1TO1E 3HKCB 1W25A 1NW4A 1A8UA 1N8KA 2HSJA 2OBNA 1V47A 5FPSA 3WOVA 1GZ3A 4D7AA 5CH8A 3W5HA 3TKAA 4DBLE 4FFBA 5CLFA 1EK2A 2AVDA 3FDIA 4TGLA 2XBMA 1DAGA 4AKSA 5KC9A 2HHHB 4JR1A 3EG9A 1K86A 3P0RA 3UGJA 3KLBA 2IYPA 2ZVJA 3B2EA 2QP9X 1D9ZA 4DADA 5CT8A 1R3DA 3AIIA 3HKBA 5CT9A 2JFQA 3P9KA 3RE1A 4ARSA 4FN5A 4WXMA 1B3BA 3G49A 2H4YA 1K7SN 2ONJA 3N8NA 1YBAA 4OKSA 4M9RA 4OHKA 5FUXA 2GNOA 1IOWA 2RG7A 3DF9A 3C3JA 1T8UA 5BT8A 4DB2A 3ITKA 2EKLA 4DARA 3UEOA 5IU6A 5ANRB 1IXSB 3OJEA 4P4UA 3K6KA 1LRKA 1KVSA 2HMTA 4KQGA 4PQGA 1MMFB 1UK9A 3F1LA 4TWJA 1QRUA 1ZRHA 3A26A 4X62B 3HUEA 2VEOA 1WBJB 5FBWB 4ZOBA 2XA9A 4C01A 3K0AB 2O5EA 3GUHA 3R3WA 1E3DA 4A2CA 4RPLA 5E4FA 1NJ6A 1YFZA 4EG8A 5KO2A 3ZPXA 1IOLA 5GQSA 4BVHA 5FFFA 4C5AA 3CIFA 2XGJA 1ODLA 3FIJA 3GDHA 4JGBA 4LZJA 4H0CA 4PO9A 2L69A 2BDUA 2NU6B 3OKFA 3UBMA 3BD9A 4E7PA 1FQWA 2PRJA 3VDNB 4II2A 4RY9A 5H02A 5J9FA 2ON6A 1GKKA 2FPGB 4KQIA 4RZXA 1KQOA 2HDNB 2QVYX 1W35A 5FORA 3KZKA 5TEWA 4YRBA 3RYIA 2TMDA 3IBSA 3VPDA 3EXHB 3RRNA 4BC0A 4NAVA 4AC9A 5TE9A 5J59A 5L8VA 5EIHA 1XE3A 3IHWA 4J0QA 2W83A 5DX0A 4Q4CA 4I99A 3GPCA 2FR8C 1H2AS 2G1UA 4GQIA 3QBVA 4HC4A 1KZ9A 2W2NA 1W0KA 4Z4CA 3CNBA 4C0XA 2CXTA 4O4JF 1W8IA 1G63A 3ET4A 4QUJA 3WYBA 3OQBA 4KE9A 1RI5A 3DZ8A 2NLOA 2WQZA 2CFTA 3GV0A 1NBMA 3VR4A 3B52X 4PWYA 3I73A 4TKZA 1GAWA 3CB2A 3DLPX 3OIDA 4UNPA 3K31A 4NYMQ 1QLWA 3AERB 3AGPA 2VT6A 1A9SA 2BD0A 3S27A 1YI1A 1CB0A 2QMQA 4JJZA 3ZGNA 5L4LA 4X7PA 4XX0A 4EI9A 2LTAA 3PUYA 3TSWA 1B00A 4YT4A 2Q21A 3AR9A 4Y2JA 4G0UA 2ZWPA 3VBCA 1HE5A 1IHUA 1VYHA 4OSEA 3A11A 4Q18A 4Z9FA 1MO2A 3I6YA 4L1KA 2QD2A 1Q1NA 4NFLA 4W9NC 5LZ7A 3MJHA 2XCQA 1Q83A 1QU2A 1U5BA 5A03A 1YR6A 2BWJA 3KYBA 1Z6QA 3GEMA 5B5SA 3IX7A 3SQXA 3N0RA 4KYUA 3VHLB 2JLQA 3GLIA 2CMDA 2B78A 1E77A 1XVUA 4BX2A 1NY6A 2HK6A 3M83A 5A4KA 3C2QA 4R2LA 2OY0A 4B6EA 1E2NA 5IVDA 1IPHA 2P4EA 2BE7A 4RK0A 3Q5EA 4J3JA 4RCYA 4PGAA 4RD2A 1BRMA 5A5GA 3AKDA 4FFNA 1RWNA 1Q50A 3QW4B 1T9ZA 1O8CA 1CDOA 4G23A 2HSZA 2A3RA 4KVGA 2POQX 3FUTA 3A37A 3DLIA 2IUTA 4DIMA 2R2AA 1QKIA 3R1IA 4IVRA 3P2EA 1KAGA 4PLPA 3QBJA 1IN5A 4TMWA 3VC3A 4UUMA 2WVJA 1WOMA 2JFPA 3DKRA 3M1IA 4FBGA 1EZ4A 1QOPB 2ZJ6A 3MILA 1ENYA 4CUZA 2ACVA 1BDMA 3HXPA 5F3RA 3FSJX 3HBAA 2RGGA 3L8YA 3S1SA 1WPXA 4NIMA 3GRKA 4Z1MA 2NU8B 4EPRA 2GXAA 4V1CA 4G0XA 2GPAA 2RHMA 5AYVA 4BO6A 3CEJA 3TK1A 2G5GX 1MAAA 1J20A 1Y9JA 3O0DA 1F2VA 3N8DA 1PL6A 2PZEA 4MUHA 4OREX 3N07A 4IDHA 5K3FB 3W4JA 5HZMA 1NDQA 3JQPA 5ALRA 4G5GA 4DNPA 5HPYB 3ZD6A 2RI6A 3MRTA 3AVUA 1S5PA 3SICE 3O4FA 5DBHX 2QZZA 1RKQA 1JIIA 1VSBA 3DLCA 3R5JA 5JY1A 3ZU5A 4DCGA 1N3YA 1RHRA 2Y1EA 4BPRA 2ZTSA 5CYGA 5BSVA 2GEBA 1GITA 1RZVA 2P9HA 2IYOA 3R0ZA 4KC0A 3AHDA 1DQYA 1U4OA 4FYWA 4CMKA 4NENB 1RQXA 1XJQA 2A9KA 1Z8DA 2JGRA 2R66A 5EYPA 4FFOA 2IS4A 3P4XA 4L75A 2HCFA 4F1WA 1M8GA 3AOGA 4OHXA 3ZQ4A 5B3JC 4MQLA 4G1FA 3M0EA 2ORED 3OA2A 4PWZA 3VGPA 1E1DA 1IZZA 2WF8A 3GLTA 3PQCA 4LDJA 5CNIA 3RS2A 4MRAA 4Q47A 1X38A 2CZGA 3IEUA 4M9CA 4W9RA 4R1OA 1G4AE 1YE5A 2DE0X 4J6EA 2O59A 1SK9A 1KVTA 1XZ8A 4WDRA 2PZLA 3QITA 2NO6A 5HDQA 1ZGBA 2D74A 2E87A 5BR8B 1IRIA 1FQJA 2YVLA 3CQ9A 3C43A 4I8IA 4L07A 1N1GA 1Y6ZA 4CCYA 3LUGA 1NVMB 1M2VB 4M8SA 1JZQA 3EZXA 1U2SA 5HJ7A 5SICE 2O2GA 3HN7A 2I1LA 2A8YA 1ZIYA 2OGZA 2UKDA 2O7QA 4JI1B 4BRSA 2HMVA 2BE9A 4F45A 1I5RA 4PR3A 4YQFA 4E31A 2OBMA 3EQ2A 1GDTA 5EFZA 4ZYVA 2WB2A 1EKXA 1P1IA 2CLCX 2OAEA 3DDZX 5K3SA 2BH9A 5JBIA 1JUDA 4IJMA 1RAAA 2HTFA 4BV3A 5K0GA 4L50A 2QLBA 3BGOS 1N2CE 1SVMA 2DKOA 1N92A 3WX0A 1AKRA 2X5JO 1K3FA 2XYPA 2IGBA 1WHSB 5E0OA 5I3ZA 1CJTC 1L8XA 4Q01A 4L4XA 1YQEA 2F3QA 1CUSA 1OD6A 1OWPA 3QWAA 4JROA 4OQYA 4RGQA 4RWEA 5EUQB 2YXLA 3AERA 4TKUB 4M37A 4I3HA 1QG2A 5I4BA 1FSSA 4N7JA 1AUOA 1QU3A 3GFQA 1M8KA 3GRAA 1DO0A 1XR3A 2BKAA 4O4LB 2XSZD 3LW7A 1FTNA 3B3QA 4UCFA 4OUDB 1GNLA 3LUDA 2VBGA 4ZT6A 3AJEA 7MDHA 1GM5A 2PYZA 1WL8A 2PWAA 4WLVA 4MVJP 5EMMA 1RIIA 4ZI7B 4CMGA 1KIAA 1P1BA 1TJPB 2O8FB 1NVFA 3ZCTA 4CIAA 3D7SA 3NIDB 1RVV1 5C2JB 2HNAA 1DC7A 4D25A 4NOKA 1G3IA 3OTQA 4QJ4A 5LJIA 5C1PA 1B7GO 2CVZA 5EESA 2P62A 1Z5VA 3K9LA 4TZTA 3QENA 4CQMD 1KZYC 5LP1A 1RWVA 4JP5A 2RCNA 1Y8CA 2CLEB 4GOMD 1TM1E 4K40A 1H8HD 1P4RA 3GC6A 2PQ0A 4ZCSA 2DPYA 1SC6A 3KWJA 3PPIA 2VR1A 1H0RA 4Z4IA 4KGXA 2AD5A 1XAGA 1XWFA 2R62A 1Q7BA 1WMSA 4H6PA 4EW1A 3NYIA 4Q05A 2AOXA 5IMSA 4GL2A 4JI4B 1ZUIA 4GG1A 1NVEA 1XK7A 3IO5A 4PCAA 5EJEA 1U9YA 4J16C 2WP8J 1Z7YA 5CX4A 1Z4NA 1X0XA 4ZO6A 4KR3A 3TQHA 5L7WA 5A5DA 4OL0A 3J81k 1YDWA 1UAYA 3OE4A 3T9CA 5CB0A 1KEZA 5JWOA 3TKYA 2H1OA 4DGQA 4ZI2A 4FGKA 3LMKA 2GBCA 2H4WA 2UDPA 3ORYA 3DMHA 1VB3A 4D4LA 1U7ZA 3COWA 2B6HA 4P6VF 3NHAA 1L5OA 4B76A 1VE6A 4TKVA 1Q1GA 3WGGA 2IBTA 1PQYA 1EFUA 1KZGB 3SGLA 4F92B 1T9GR 2XVMA 1P0PA 3CX3A 1KE2A 1WB4A 2BI7A 3A14A 3OOJA 5THKA 4CG0A 5L3SB 2VXCA 3OQNA 2CXHA 2F1JA 3QJGA 1F2UA 2C1ZA 4E5NA 4F9EA 1LF5A 5CLJA 3PE3A 5BSWA 1RM3A 2FMHA 2V7QD 4L02A 2C2WA 4UCQA 3HEAA 2ZRQA 4NZNA 3ZK8A 1CIVA 3IC5A 1M1XB 3ITEA 5FUVA 4W1RA 1P2GA 3H2KA 2PG3A 3TSAA 2CLLB 1ZG3A 3CURA 4ID9A 4E5KA 1MZPA 3BJMA 1PJLA 1XZGA 1N8NA 4GEKA 2ZE7A 4ZAGA 2BFPA 2KX7A 3P2OA 5G4KB 1Y82A 3SF8A 4PSDA 2O0HA 3P4YA 4J6FA 3UGTA 3FTFA 1UUFA 2VATA 1PK7A 3S0JA 4EMUA 2HF9A 3F3MA 4MB2A 1HO3A 3DMRA 4JH0A 4QGBA 1P8AA 4UU1A 2JBAA 2V9CA 1B4DA 1CHDA 2PKWA 4Q19A 3ESAA 2WTUA 3LCJA 5JC1A 1XG5A 2NW6A 3OU7A 3IPYA 4ND3A 5DM1A 5KX5A 2GCNA 1UOEA 2LNDA 1VSVA 5CA0F 4J1TA 5AVWA 3C41J 3CKLA 4N18A 4HJXA 5KCMA 3V8RA 4CV3A 4DXHA 2XZTA 2AUTA 3N0TA 3ZW9A 3VU3A 1BWRA 3KFLA 2QZ4A 3SHQA 2IE8A 4AWAA 1G38A 2JFZA 2ZTMA 1BHO1 3H99A 3KPWA 3N5CA 3RVDA 1OFUX 1OC4A 4LXYA 1K9VF 1E0DA 2Q3BA 1L7AA 2PL5A 4BU0A 4L5YA 4NQZA 5LWQA 3E2MA 2FSVA 2F9LA 1JHRA 3BIWA 3ZC3A 3Q3CA 4MOWA 2WSLA 1FSFA 3VO8A 2CSXA 1RQGA 4FEAA 2R84A 5D8DA 1X7YB 4GYJA 3RFVA 4BNTA 3P7MA 3HP1A 1J99A 5KEIA 2GN9A 1J25A 4LXIA 1RSZA 4CUJA 3OQPA 4TSFA 5FNVA 5TJ9A 1FLAA 2PVSA 3IVXA 1Y98A 3HUDA 5JV5A 5D3QA 3SFVA 1J0XO 4AT1A 5BN5A 2CKMA 1QPGA 1YB2A 2HF8A 1A9ZA 3G9ZA 4PU0A 4PVDA 3NGMA 2JK0A 4BVFA 3LBIA 1D2NA 5D6NA 1E6MA 3X1ZA 2FEWB 4RTOA 3OQMA 5AW8A 1EX7A 5F4ZA 2D4HA 4MCJA 4E6EA 2JF0A 3E82A 3MYYA 5KVAA 5K4GA 3HSSA 1CUDA 1CJKC 3AWDA 4Y2YA 4KODA 2Y67A 3A3NA 1JDSA 3NBZC 2UZAA 3CPEA 3LU1A 5A5FA 5IZ4A 2OFXA 3HO8A 2ZI9A 1II8A 3DVAB 3RVNA 2F1OA 1AUVA 5IFKA 3K71B 1CZHA 1FL9A 1U8FO 3AHHA 3VV2A 3KELA 1PZEA 5JFOA 3PC7A 4D02A 3JTMA 4RMIA 1VCIA 4MV8A 4X61A 1LLCA 3R7WB 1TU4A 1XQXA 2JLVA 3LUPA 2WJWA 4M54A 3D5QA 4XGNA 2FX5A 3AQ4A 2QUHA 5CTJA 3ZJUA 2P35A 1LCIA 5CIYA 3MTDA 1XUOA 4YHHB 3M3PA 2ZYTX 1EQUA 3F3YA 4GPAA 1GT91 1R6DA 2AOUB 2J30A 4P9NA 4DIBA 2EWVA 1UZMA 2GJ9A 1Y9ZA 4G85A 4PGMA 4RELA 3T06B 4BMYA 1ZRNA 1SM4A 4WOPA 2FFQA 2ADFA 2IZ1A 3IH5A 3NEAA 4O4HA 5EQTA 2YASA 4N5IX 4DMRA 2C4TA 4FBMA 4G09A 3H4VA 3CF4A 5MHTA 2RHLA 4J0EA 1DUVG 3EGIA 1J2YA 3RANA 1CS0A 2XDQB 3DFZA 1FRVA 5ARCA 2FRXA 4CL3A 1U9ZA 1T8YA 1Q2UA 3ZDFA 4QOFA 1IB6A 5D3MA 3AG5A 4AG5A 3M6LA 1T2VA 1ESZA 2EEZA 2A1TR 4PYLA 3ZIUA 3D6JA 4RKFA 3QA3E 1PL7A 4BNVA 1RR6A 2XZPA 3JD4A 4NS1A 4TPKA 2JD2A 4MPPA 2VAVA 1PJZA 1GGNA 1U2EA 2OGUA 1S7GA 2Y0BA 4ID3A 5BQFA 3IPAA 2O3QA 1DXHA 3B82A 4N03A 1GQRA 2NSYA 4WECA 1TVMA 3SOPA 2VT7A 4FCVA 2WTNA 1U3WA 2Z58A 4MPRA 1E61A 4KWTA 1RIFA 4FQ7A 1P18A 4AMYA 4YUVA 4FBLA 4XTRA 4AAYA 4EF5A 1TM5E 4LE0A 3PF9A 5T6MA 4MDFA 3E5HA 3P0IA 3H2IA 5AVKA 1EUCB 1Q17A 1LV8A 1M1YA 4JLDA 4BNYA 3QUSA 4CLXA 2WTMA 3QU5A 2J6BA 4XFJA 5JISA 1FNNA 1YU6A 1KRXA 3MC1A 3WLJA 4EZEA 1O2DA 2GRJA 2BZ1A 1F3OA 3ZIDA 3ZWCA 5GV7A 1NOJA 2OCBA 3OTWA 3GDOA 3FZEA 2XNHA 3HN2A 4IDBA 1P4AA 3QE4A 4EKGA 3BE8A 5HRCA 2YDYA 2X5NA 3O84A 1D1PA 1X70A 1W85A 1ZRMA 3QHPA 4ND8B 1TE2A 3OJWA 4LY6A 3OH8A 5BWNA 3VYVA 3PZRA 4HX2A 5D5HA 3R3VA 1U3FA 1G3RA 3A06A 2QVLA 4NONA 4PYIA 4V2IA 2B34A 3COJA 4PBSA 1PV1A 4Q1AA 2O48X 3PITA 1XEXA 5AM4A 4CWAA 2X58A 1RTTA 3FTNA 1VLQA 4O2BA 3HZOA 3L7NA 5F3DA 1RD4A 2IP2A 5LLSA 3WP0A 4YMUA 5K6AC 2XRZA 4WRRA 1P1RA 1K27A 4B7CA 4JXZA 4BQRA 3DE0X 1SURA 2AJCA 1PYOA 4KEAA 1T2EA 1CQIA 2DY0A 4DE5A 3MTJA 5EZYF 4A82A 4HNTA 3SJBA 5EIBD 5IJXA 4WE3A 4DCVA 2VSYA 8GPBA 5IM4F 3LPLA 1Q1EA 2R2GA 5E3HA 2QLNA 3E1SA 1UMDB 1WB9A 4MDYA 2DT5A 2GNAA 1Y4UA 4YP1A 3A36A 1NF9A 1JLLA 2RG1A 3WV5A 3OX2A 3SC2B 4ER7A 4BNMA 2PZJA 2R8EA 1PE0A 4ZCIA 7GPBA 1ZH6A 1W8DA 1XT6A 1B41A 5KB3A 3K35A 3E27A 2IY8A 1XCLA 4WN9A 3BXZA 1OBFO 4PZDA 4QBTA 4AN1A 3O7MA 5LBUA 4XCQA 4F4DA 4UVDA 2VH5R 2RBKA 4PFKA 2O3SA 3UWMA 5LA6A 3FB1A 5F98A 3NJ8A 4PEVA 1SU7A 2DUWA 1D09A 1U0RA 4QPZA 5DXJA 1I4OA 3HMKA 1EJ2A 4TMVA 3TNDA 1T8TA 4YJ2A 1N0HA 1ODFA 1C9KA 3DE3X 4QYXA 4RFLA 4DCPA 4FYMA 5LZ9A 1RZRA 2B4YA 4BVGA 1RXSA 1UKBA 2QLMA 3O4GA 5JSFA 1GAJA 3NT4A 2CVFA 3LXXA 4UTZA 4X64B 5DDIP 3PCXA 5TXGA 4O25A 2FFRA 4EEZA 4FB5A 3OT1B 1UF9A 2CLKB 5FFMA 4B4DA 3BMQB 3MWEB 1MPXA 2Q6OA 3IBCA 1ZY2A 1KVUA 3I2JA 4GI7A 1BMDA 1GGKA 2QRHA 5BQXA 1OAAA 1J0BA 3AETA 2QK4A 2POCA 1GGMA 1X7XA 3PRYA 1IXKA 1Z62A 1QR6A 2PJZA 1MTOA 5JQGB 1TW3A 3VMMA 4CT0A 1Q22A 3CNLA 4QDXA 5LD2C 4DMHA 1TM7E 3FKSA 1Y3DE 2YXNA 1J90A 1XMVA 3TJRA 2QE7D 5REQB 1YI0A 2QTGA 3LDFA 4E13A 4HNVA 2B6NA 2QZJA 3UWPA 1XNGA 2X1VA 2KM1A 2C04A 4CQJA 1MENA 4PZLA 2OBLA 1OAOA 3MLBA 2OYSA 2OD2A 4DS3A 3KBOA 3A1NA 1CZLA 1D2GA 1T10A 1JIUA 2AG1A 1AA9A 4L7QA 4G0VA 1SVSA 4OP3A 4NMWA 2VQDA 3G0IA 2C7BA 2J45A 1NL3A 1TPZA 3IB3A 4P83A 5AIAA 5G0SA 2EL7A 4J0GA 3JRWA 2A78A 4JFRA 4MP8A 3ZS8A 1NONA 4C08A 5JLAA 1XD8A 1T25A 2AA3A 2Z9DA 4ZGGA 3PKIA 2APJA 4ZARA 1DAMA 3LF1A 4EDFA 4FGUA 1G18A 1AKVA 4ALJA 4AM8A 3VR4H 1IL0A 1FBNA 3A9WA 3CF2A 1ZVQA 3FYTA 2Y66A 3G1UA 1MB3A 2E9SA 2NAFA 5EMLA 4ZQIA 3SPXA 2Q1XA 2GKSA 4BO4A 4K8RB 1I1OA 1NW5A 5B3KA 1N2HA 3HE3A 4MUAA 3ZNOA 4BS9A 1N36B 4TL7A 4XB1A 3HB1A 4M0PA 2HRDA 2ZUBA 3TBHA 3TLCA 3UV6A 4CMEC 1V1RA 5TPWB 2CL0X 1GPLA 4C6RA 4RD4A 4B8ZA 2EFJA 2VSNA 2OXCA 1E7QA 2HQSA 2XY4A 3U3KA 3GEGA 2H5EA 2JVJA 4OATA 1JF8A 3C5WP 3X1DA 2LRHA 3C6YA 5CDTA 1W0CA 5IM4A 4XCXA 5FTJA 3F90A 1P3JA 1XDGA 3EDCA 3BH0A 3FVQA 4HFNA 3VVBA 3O5AA 4IZIA 2FY8A 2VHVA 2VT3A 3U80A 2ZBUA 4XYBA 4EFMA 2WJZB 2H51A 2AFVA 3JQRA 3EZ9A 1AKWA 5BNFA 1CT9A 1UP6A 3EH2A 3KUCA 2CDCA 3VPSA 1ZZEA 2YKGA 4PS0A 5F9HA 3OBBA 4QX6A 1VHQA 4C43A 3W5AA 1PHPA 1J09A 2CGEA 3OI7A 1OH5A 3HLYA 3QX3A 2ZYVX 4RYLA 3EXG2 3EBOA 3NDPA 4K28A 1H9AA 1S01A 1UM9A 2FMIA 1C2YA 1LQTA 4FHEA 4FXOA 4L3VA 5DTIA 4EYKA 2Z2IA 4LRQA 4JYAB 4B46A 1X8JA