3FW5A

Crystal structure of siderocalin (ngal, lipocalin 2) complexed with ferric 4-methyl-catechol
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
175
Chain Sequence
b'TSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil gelatinase-associated lipocalin
publication title Iron traffics in circulation bound to a siderocalin (Ngal)-catechol complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 40
structure length 175
sequence length 175
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3fw5A00
3HK1A 1I05A 4MVLA 1I06A 3NADA 2CZUA 2X46A 4A1HA 3CR6A 4YKMA 4BOEA 1DZJA 2Q4NA 1S7DA 3FELA 5LJHA 2HLVA 4LKPA 2NP1A 3D95A 5HTEA 2JU3A 1IW2A 4HPAA 3VG2A 5B29A 3APVA 4GE1A 1B8EA 1KT4A 4IBAA 1GKAA 1GT4A 4OS8A 3P6HA 3WJGA 1X89A 4IB7A 1LIEA 3NX2A 3VG5A 2KTDA 3PEDA 1LF7A 4EEJA 3EBWA 1YWAA 4EDEA 3WJBA 4GKCA 5HAEA 1EW3A 1SA8A 2FT9A 4YKOA 5F6ZA 1X8PA 2RA6A 2XKLA 3AKNA 1LICA 3STKA 3TF6A 1ZNLA 3QKGA 1FTPA 2YG2A 1YP7A 5DG4A 1HMTA 4ZH9A 1IFCA 1ERBA 2A2GA 2QO6A 3TGBA 1OEEA 1OPAA 5EEDA 3FA9A 1ACDA 4YDBA 1QWDA 1U17A 1A3YA 3P6CA 5D4AA 4LZUA 3DTQA 4OMWA 5HZ8A 1KOIA 1CBRA 3F8AA 5HZ6A 2K23A 1SXXA 4ORRA 1G74A 1KGLA 4YFQA 5H8TA 1YP6A 4NNSA 4ZHFA 2A2UA 1KZXA 4IB8A 4NLIA 4AZOA 4TKHA 2CZTA 3BU1A 1LNMA 4MVKA 1JYJA 2CBRA 4GRJA 1AB0A 4AW8A 4MVIA 4YCHA 3IFBA 5EZ2A 5H9KA 1CBIA 3FW4A 3KFFA 1KT7A 1SY0A 4TKBA 1QFTA 1TW4A 2Q2PA 5EEEA 5KIDA 1L6MA 1D3SA 3FEKA 3JSQA 3CMPA 5HZ9A 3WBGA 5LKEA 3CBCA 4ORXA 2LB6A 2JN3A 5EDBA 4LKTA 4O9SA 2PY1A 2E4JA 3FR2A 3KFHA 4Y0QA 3WJEA 4PSQA 4HPBA 4XMEA 4TQ2A 4R0BA 2WUTA 1O1UA 2GC9A 5CE4A 4GNYA 4AZQA 4ZHGA 3EM0A 3Q6LA 1BWYA 4YH0A 1SY2A 2W2BA 3D97A 1I4UA 2FLJA 3ZUOA 1DF3A 3UEXA 3ZQ3A 3HWGA 2CBSA 1KZWA 2R74A 2AMMX 4I9SA 4ORSA 2WQ9A 3CQNA 3FW5A 3BX7A 3ELZA 2RCQA 1AELA 2OVAA 3WJCA 3FA6A 1EQDA 1BLRA 4ZR2A 1X71A 1CBQA 1GKAB 2AH7X 1T68X 4HPDA 4YGZA 4ES7A 1YWDA 4IMOA 5JR8A 1O8VA 3MVFA 3PP6A 1HMSA 4N7CA 4UU3A 5L8IA 3P6FA 3PPTA 4XMFA 1D2UA 4ZHCA 1GT5A 4EXZA 4ZH6A 1G85A 1TXLA 4QYNA 5H9NA 3BU9A 1R0UA 3TGCA 5HBSA 3KFGA 3CWKA 1NP1A 4Y0PA 3VG3A 3MBTA 4QZTA 4HPCA 2X45A 1YWCA 2WR6A 3UEUA 1HQPA 1HBQA 3SAOA 4A60A 4ZGUA 2HMBA 1X8QA 2Q9SA 5FAZA 4D6BA 1KT5A 3O22A 1JYDA 5LJDA 2L5PA 3STMX 2ACOA 3WVMA 2O62A 2FS7A 4UU2A 2JU7A 5IO7A 1DZKA 2AL0X 3B2LA 1S2PA 4YBUA 2OVDA 2W2FA 5HA1A 1T8VA 3PECA 2QO4A 1FELA 2MM3A 2XSTA 1EUOA 1LIDA 1KT6A 1XCAA 4NYQA 2LBVA 3BX8A 4ORYA 1EPBA 3U03A 4NLJA 3UEVA 5HZQA 1VPRA 1G7NA 1BSYA 1GM6A 2HYSA 3CBSA 3L4RA 4OS3A 5F6BA 2A0AA 5HCDC 1BBPA 5LJGA 1X8UA 3VG7A 1FE3A 4IAXA 1OPBA 2RCTA 1BJ7A 5AQ6A 4ZHHA 1HN2A 4TJZA 4XMDA 5FENA 2R56A 2ACPX 3B2HA 3C77X 4RUUA 1ZNDA 2MJIA 2POAA 5D45A 4YMYA 1NP4A 1PM1X 1BSQA 1OEJA 5D8JA 4AYHA 2NNQA 1QY0A 1MUPA 1KQWA 4A1YA 4YFPA 1ICMA 1H91A 2LFOA 1MDCA 3FENA 3VG4A 1PEEA 5L8OA 1JV4A 1PMPA 1AVGI 3FMZA 2G7BA 1HMRA 2AT0X 5D47A 3I0AA 2OVEA 1GXAA 1S44A 3APWA 1OBUA 3B2JA 4TNNA 3RZYA 4ALBA 2WQAE 2F73A 3O2YA 1LIBA 5LJEA 1LFOA 4TLJA 4AZNA 2CM9A 2FTBA 1DV9A 5BVQA 2AKQA 5C0NA 5F7GA 2FS6A 2FWVA 4DQ3A 1CRBA 2IFBA 4BVMA 1U18A 2HNXA 2NNDA 1SY1A 3NP1A 1UREA 4IB9A 3GAQA 3G7XA 4GNWA 2OZQA 3NPOA 2OFMX 1LPJA 4BQUA 5LKFA 2AT8X 4ALOA 2DM5A 1IIUA 1GX9A 4ZJ0A 3NR3A 2N93A 5DPQA 4Y0RA 2R73A 5F1EA 4K19A 1LKEA 1MX7A 3FLLA 1RLBE 2HZRA 3PH5A 1PBOA 3EMMA 2QOSC 1I04A 2GJ5A 3BRNA 3U9PC 3I17A 1MX8A 3FR5A 4XMGA 4A8ZA 5LJKA 3FEPA 1JJXA 2Q39A 1TOUA 3OJYC 1U0XA 5HZ5A 1UZ2X 3P6DA 2AT5X 2G78A 1LIFA 4ODDA 1P6PA 5B27A 1OBQA 1YWBA 3WJFA 3C78X 2OFRX 5LJCA 3STNA 1IFBA 4NP1A 1ADLA 1EALA 2HZQA 5BVSA 1VYGA 4QYPA 4WFVA 4ZCBA 4XMHA 5IO5A 2LKKA 1OEKA 4N7DA 1DZMA 3B2KA 4AZRA 4IAWA 5H9LA 3BLGA 3NQ9A 1RBPA 1T0VA 4QZUA 4LZVA 1DFVA 2L9CA 4OMXA 3VG6A 2WEXA 1X8NA 2WSJA 1CJ5A 1AQBA 1JBHA 4RUNA 1B0OA 4DQ4A 2ANSA 2L67A 4I3DA 1ML7A 3K3LA 1KQXA 3BDRA 3EYCA 1QABE 2RQ0A 1GGLA 3S26A 1IKEA 1IKJA 2GTFX 2EU7X 4I9RA 1ZNEA 2BLGA 4ORUA 5HCCC 1ZRYA 1OBPA 1ICNA 3FIQA 3KQ0A 4TKJA 3UEWA 1JZUA 1TVQA 2MO5A 4I3BA 2A3FX 2L68A 3CQRA 4YGHA 4NNTA 4QGXA 1YIVA 1E02A 3RSWA 2FRSA 3B2IA 3U0DA 2FR3A 4XMCA 2JOZA 3D96A 1BSOA 4YGGA 1E06A 1X8OA 1DC9A 5K06A 4AZPA 3FA8A 4WFUA 1EXSA 1QG5A 1ALBA 2JU8A 4ZHDA 1EIOA 4GH7A 5KHPA 1SXYA 4QAEA 2QM9A 3P6GA 1VYFA 1QY1A 5F58A 1FENA 3BY0A 3ELXA 5EPQA 2NNEA 1NGLA 3APUA 1FEMA 2K62A 3NQ3A 5FFHA 1SXWA 3NX1A 3BS2A 1SXUA 1SY3A 1ERXA 4KIIA 5KICA 1JJJA 2G79A 2W2AA 4IB6A 3WJDA 3WXQA 1G5WA 5HA0A 4AZMA 1DZPA 3IA8A 4YCEA 4EFGA 1QY2A 4YFRA 1TOWA 1EIIA 3KFIA 4ZFXA 1N0SA 4I3CA 1B56A 1EPAA 1KT3A 2FR2A 2WWPA 1O1VA 2A13A 2LBAA 4CK4A 1ZNHA 1GT1A 1GT3A 3F9DA 3FR4A 1HBPA 5EDCA 4ARHA 1KXOA 2P8GA 3TGAA 3AKMA 1E5PA 5L8NA 3TZSA 1QQSA 3EBKA 4QGVA 1A2DA 1QFVA 4M6SA 4Y0SA 2CM4A 3KZAA 5D48A 1A57A 3P6EA 3BSZE 2KT4B 2AT3X 1E00A 3PH6A 2WEWA 4ORWA 1MVGA 1GX8A 4HFOA 5HCEC 3HWDA 1Z24A 5BVTA 3HWFA 1A18A 1BEBA 1CBSA 4YDAA 3C76X 3DSZA 4GETA 3O19A 5H9AA 4M7MA 4QGWA 5HWZA 3FA7A 4YBPA 4NYRA 5IO6A 3JS1A 1ZNGA 4WBKA 1BM5A 3T1DA 5LJBA 1FDQA 1B4MA 2Q2MA 2ASNX 1XKIA 1BRQA 2ALLX 1BRPA 2QO5A 3APXA 4IMNA 1YUPA 2RD7C 3HWEA 3ZUIA 5HTDA 4D6AA 4OS0A 1ZNKA 2AT6X
chains in the Genus database with same CATH superfamily
3HK1A 1I05A 4MVLA 5B5GA 1I06A 3RDMA 4MVEA 3NADA 1SLFB 2CZUA 2X46A 4A1HA 3ZZVA 3CR6A 3RDXA 1VWGB 1STPA 4YKMA 1DZJA 2KD2A 1S7DA 2MF6A 2Q4NA 3EW1A 3FELA 3T2WA 1SWKA 3AUMO 1AVDA 5LJHA 2HLVA 4LKPA 2NP1A 2RTGB 3D95A 4ZGFA 5HTEA 2JU3A 1IW2A 4HPAA 3VG2A 5B29A 2RTDB 3APVA 3MM0A 4GDAA 1VWNB 3VHMA 1W4TA 4GE1A 1B8EA 1KT4A 3VE1A 1RSUB 3EC5A 1GKAA 4IBAA 1GT4A 4OS8A 3P6HA 3WJGA 1X89A 2BSZA 4IB7A 1LIEA 4JNJA 3NX2A 3VG5A 2KTDA 3PEDA 1KL4A 4KC8A 3EBWA 1YWAA 4EEJA 1NQMA 4EDEA 3WJBA 4CPHA 4GKCA 4HWMA 5HAEA 1EW3A 1SA8A 2FT9A 4YKOA 4EQAC 5F6ZA 1LCZA 2IZBA 1X8PA 1KL3A 2QMIA 2RA6A 1LICA 2XKLA 3AKNA 1ZNLA 4FBVA 3STKA 1MOYA 3TF6A 3QKGA 4U9CA 1FTPA 2YG2A 3RDUA 5IXGA 1YP7A 4ID2A 5DG4A 1HMTA 1VWKB 4ZH9A 1IFCA 1ERBA 2A2GA 2QO6A 3WZNA 1RSTB 4I95A 3TGBA 4GGRA 1OEEA 4O3ZA 1OPAA 4O3XB 1STSB 3WYQA 2QCBA 5EEDA 3FA9A 1ACDA 4YDBA 1QWDA 2RTNB 3S5VA 1U17A 1A3YA 3P6CA 4GGZA 4LZUA 1HXLA 3DTQA 4OMWA 2LA7A 5D4AA 5HZ8A 1KOIA 1CBRA 3RKGA 3WOVA 3F8AA 3P02A 3PQUA 2RTKA 5HZ6A 2IZKA 3LV4A 2K23A 1SXXA 4ORRA 1G74A 1KGLA 4YFQA 5H8TA 4NV7A 1YP6A 1SRJA 4NNSA 4ZHFA 2A2UA 1KZXA 4IB8A 4NLIA 4AZOA 2C1QA 4TKHA 2CZTA 3BU1A 1LNMA 4MVKA 1JYJA 2CBRA 4GRJA 1AB0A 4AW8A 4MVIA 2IZGB 4YCHA 5BYPA 3IFBA 5EZ2A 5H9KA 1CBIA 4FGIB 3RY1A 1VWDB 2JW1A 3FW4A 3KFFA 1KT7A 3QQ2A 1SY0A 4TKBA 1QFTA 1RAVA 1TW4A 2Q2PA 1SWNA 4GK9A 1L6MA 2X34A 4WHIA 5EEEA 5KIDA 1D3SA 3FEKA 1VWOB 3JSQA 3CMPA 5HZ9A 3WBGA 3LTWA 5LKEA 3CBCA 4ORXA 2OY5O 3Q34A 2FHLA 2LB6A 4BX7B 1Y9TA 4Z27A 2JN3A 5EDBA 4LKTA 4O9SA 1RXJA 2PY1A 1VWPB 2E4JA 3FR2A 3KFHA 4Y0QA 3WJEA 4PSQA 4CV7A 2C1SA 4HPBA 4IABA 4XMEA 1E2TA 4TQ2A 4R0BA 4QQ1A 2KW1A 1I78A 2Z4HA 2WUTA 1O1UA 2GC9A 1N9MA 4O49A 4GNYA 3GE2A 4AZQA 3EM0A 3Q6LA 3SOTA 4ZHGA 2HKDA 4YH0A 1BWYA 1RXHA 1SY2A 3VHIA 1K24A 3CKGA 2W2BA 2RTCB 3D97A 1I4UA 1SRFA 2FLJA 1N7YA 3ZUOA 5B2AO 3VU1A 1DF3A 3UEXA 3ZQ3A 3HWGA 2CBSA 1KZWA 2R74A 2YMSA 1UYNX 3EW2A 2AMMX 4I9SA 4ORSA 2WQ9A 4ON1A 3CQNA 3HOEA 3RBYA 3FW5A 3BX7A 3ELZA 2RCQA 3WYPA 2OVAA 3WJCA 3FA6A 1AELA 1EQDA 1BLRA 4ZR2A 1X71A 1CBQA 1GKAB 4CDDA 2AH7X 1GX3A 1T68X 4HPDA 4YGZA 4ES7A 3X00A 3CKFA 1YWDA 2AT6X 1VWQB 4IMOA 2OY1O 1O8VA 3MVFA 3PP6A 1HMSA 4O4UA 4N7CA 1SWEA 5AJBA 4CPHB 2RN4A 1JIWI 2X55A 4INNA 4UU3A 5L8IA 3P6FA 3PPTA 4GU8A 3HOLA 4XMFA 1D2UA 3NBXX 4ZHCA 1GT5A 4EXZA 4ZH6A 1G85A 1TXLA 4QYNA 1FJ1E 2LBVA 5H9NA 3BU9A 1R0UA 3TGCA 1KFFA 5HBSA 3KFGA 3CWKA 1NP1A 5CSEA 4Y0PA 3VG3A 3MBTA 4QZTA 4HPCA 2VDFA 4COTA 2X45A 4U8UM 1YWCA 2WR6A 3UEUA 1HQPA 1HBQA 1PBYA 3SAOA 4A60A 3T6LA 4ZGUA 4ML7B 2HMBA 1X8QA 2Q9SA 5FAZA 4CPEA 1KT5A 1VWEB 1JYDA 3O22A 4U46A 5LJDA 2L5PA 2F09A 3STMX 1Y9LA 1SLEB 2ACOA 3WVMA 2O62A 2FS7A 2UYWA 2AF5A 4UU2A 4GD9A 2JU7A 5IO7A 2UZ2A 1DZKA 2AL0X 3B2LA 1S2PA 4O4XA 4YBUA 2OVDA 2W2FA 5HA1A 1T8VA 3PECA 5JR8A 2QO4A 4MIRA 1FELA 2MM3A 3WZOA 2XSTA 1EUOA 1LIDA 1KT6A 1LUQA 1XCAA 4U8UO 4NYQA 1NC9A 3BX8A 4KH8A 4ORYA 1EPBA 4OELA 2ZAGA 5K68A 2VFCA 4NLJA 3PK2A 3U03A 3UEVA 5HZQA 1SLGB 1VPRA 2BS5A 4GJVA 1G7NA 2IZCB 3ZW0A 1BSYA 4YVBA 1GM6A 2HYSA 3CBSA 3L4RA 4OS3A 2CAMA 5F6BA 3RDSA 4BOEA 2A0AA 1NBXA 1HY2A 5HCDC 1BBPA 5LJGA 1X8UA 3VG7A 1FE3A 4IAXA 1OPBA 2RCTA 4JO6A 4EKVA 1BJ7A 3PQSA 2BC3A 5AQ6A 5IRAA 4ZHHA 1HN2A 2QOMA 2IZDB 4TJZA 3S5XA 4DCBA 5K06A 4KC7A 4XMDA 5FENA 2R56A 2ACPX 2RTPB 3B2HA 3C77X 4RUUA 2OFAA 1ZNDA 1AVEA 2MJIA 2POAA 5JD2A 5D45A 4YMYA 1NP4A 1PM1X 3VHHA 1BSQA 1OEJA 1SRHA 5D8JA 1LDQA 1STRB 2X56A 2RTFB 4AYHA 2NNQA 4CDCA 1QY0A 1MUPA 1KQWA 2G5LA 2IZJA 4YFPA 4A1YA 3OBLA 1ICMA 1H91A 2LFOA 2KTSA 1MDCA 4O4SA 4QRLA 3T2XA 3FENA 1HXZA 3VG4A 2RTJA 1PEEA 1I9HA 1SWOA 5L8OA 1JV4A 1PMPA 2DJGA 1AVGI 3FMZA 2G7BA 4GZVA 2OYBO 1HMRA 1JMZA 2AT0X 5D47A 3I0AA 1MM9A 1SRIA 1GXAA 2OVEA 4BX5B 1S44A 4OKAA 3APWA 1OBUA 3B2JA 3WZQA 4TNNA 3RZYA 4ALBA 2RTLA 2WQAE 2Y3EA 3KVNA 1Y53X 2F73A 3O2YA 1LIBA 3RDOA 5LJEA 1NQNA 1LFOA 4TLJA 5B3MO 4AZNA 1SWGA 2CM9A 2FTBA 4BX6A 1LELA 1DV9A 1SWUA 5BVQA 2AKQA 5C0NA 2IZHB 5F7GA 4CPIA 2X8TA 4D6BA 2FS6A 4CDFA 2FWVA 1SWDA 3N91A 4L1NA 4FBOA 4NW4A 1CRBA 1Y52X 4DQ3A 2IFBA 4BVMA 1U18A 2HNXA 2NNDA 1SY1A 4PJ2A 3WZPA 3NP1A 1UREA 4IB9A 4QNIA 1SRGA 3GAQA 3G7XA 4GNWA 4JHQA 1SWSA 1SWRA 1JQPA 2OZQA 3NPOA 2OY7A 1LCVA 5B11O 2OFMX 2MHDA 2A5CA 2IZFB 4IRWA 1LPJA 2IZAA 5FQ7E 3PDFA 4BQUA 2GTLN 4MEEA 5LKFA 2AT8X 4ALOA 3MG5A 2DM5A 1IIUA 1GX9A 2IZEB 4ZJ0A 3NR3A 4Z28A 2N93A 3RY2A 5DPQA 4Z2OA 4Y0RA 3MX7A 2R73A 5B5FA 2GH7A 5F1EA 3ZW0B 3F6ZB 1LKEA 1MX7A 3FLLA 4K19A 1RLBE 2HZRA 3PH5A 1PBOA 2I5ZO 3EMMA 5CE4A 1I04A 1WUBA 2QOSC 1LCWA 2GJ5A 3BRNA 3HTYA 2JGSA 3I17A 3U9PC 3VE2A 1MX8A 3FR5A 4XMGA 4A8ZA 1VWCB 5LJKA 4I60A 3FEPA 1W6FA 1JJXA 1SWBA 1VWHB 5CHKA 5IRUA 3FYFA 1W5RA 2Q39A 2Y3FA 2OL6O 3E3CA 1TOUA 3OJYC 1U0XA 4CPFA 1UZ2X 3P6DA 4BCSA 5HZ5A 2AT5X 2G78A 1LIFA 4ODDA 3V8UA 1P6PA 4BBOA 5B27A 1OBQA 2RTBB 1YWBA 4Z2PA 2A8GA 3WJFA 3C78X 1SWJA 2WPUA 2OFRX 5LJCA 1VWBB 2Z4IA 3ZW1A 3STNA 1IFBA 4NP1A 3AEHA 1ADLA 1EALA 1SMPI 2HZQA 1UYOX 1VYGA 4QYPA 4WFVA 4XMHA 4ZCBA 2LKKA 5BVSA 3OD9A 5IO5A 1OEKA 4N7DA 1DZMA 1EI5A 1SWHA 3B2KA 4AZRA 1VWFB 1SWTA 4FBRA 4IAWA 5H9LA 1OSPO 3BLGA 3NQ9A 4MISA 1NDJA 3RE5A 1RBPA 1T0VA 4QZUA 4LZVA 1DFVA 2L9CA 4OMXA 3VG6A 2WEXA 1X8NA 1SWAA 2WSJA 1CJ5A 2F01A 1AQBA 1Y0GA 4Z2VA 1N4JA 4CSBA 1JBHA 1PTSA 4Y5DA 4RUNA 3SZIA 1B0OA 4DQ4A 1SWPA 2VFBA 2ANSA 2G8CO 2L67A 4OEMA 2OL8O 2RTHB 4I3DA 1KL5A 1ML7A 4CDEA 3K3LA 3FIDA 1KQXA 3BDRA 3EYCA 4C5PA 4BX6B 1VWMB 1QABE 3ZW2A 2RQ0A 1GGLA 3S26A 3ZWEA 1IKEA 1IKJA 2GTFX 2EU7X 4I9RA 1ZNEA 3RE6A 2BLGA 4ORUA 2OL7A 5HCCC 1ZRYA 1OBPA 1ICNA 3FIQA 3KQ0A 4TKJA 2OFBA 3UEWA 1JZUA 3D4RA 1VYOA 1TVQA 1VWAB 2MO5A 2RTRB 4I3BA 2A3FX 2L68A 3CQRA 4YGHA 4NNTA 4QGXA 2RTMA 1YIVA 4DNEA 1E02A 3RSWA 2A5BA 2FRSA 3VPJE 3B2IA 3U0DA 4LQZA 2FR3A 1MK5A 4XMCA 2JOZA 3D96A 1BSOA 4KT5A 4YGGA 5B10O 4U3QA 1E06A 1X8OA 1DC9A 2X8FA 3D9WA 4JGLA 3FA8A 4AZPA 2AVIA 4WFUA 1EXSA 1QG5A 1SWFA 1ALBA 2JMBA 2JU8A 4ZHDA 1EIOA 1WBIA 4GH7A 5KHPA 2RTEB 1SXYA 3OE3A 2QM9A 4QAEA 3P6GA 1Y55X 4GJSA 3NQKA 1VYFA 1HQQA 1QY1A 5F58A 1FENA 3BY0A 4Y59A 3T6FA 3SLJA 3ELXA 5EPQA 2NNEA 1NGLA 3APUA 1JJUA 1FEMA 2K62A 1N43A 3NQ3A 2FGSA 5FFHA 1MEPA 3H3IA 1SXWA 3NX1A 3BS2A 1RXKA 2I5VO 1SXUA 1SY3A 3LHNA 1ERXA 2OVSA 4KIIA 4L3RA 4NV8A 2RTQB 1SWCA 3SLTA 5KICA 2G79A 1JJJA 2OF9A 2W2AA 4IB6A 3WJDA 3WXQA 1G5WA 5HA0A 5L3YA 1DF8A 4AZMA 1DZPA 3SZHA 3IA8A 4YCEA 4EFGA 1QY2A 1VWRB 4YFRA 1TOWA 2RTAA 1EIIA 3KFIA 4ZFXA 1K3BA 2BT9A 2IZIA 2ZSCA 1N0SA 4I3CA 1IJ8A 1B56A 1EPAA 1KT3A 2FR2A 2MWHA 2WWPA 1O1VA 3SZJA 4Z6JA 2A13A 2LBAA 3ZW1B 5F2BA 1ZNHA 5FQ8E 4CK4A 4GGTA 2BS6A 5IRWA 1GT1A 4KCAA 1GT3A 3F9DA 3FR4A 1HBPA 5EDCA 4ARHA 1KXOA 2P8GA 3TGAA 3AKMA 1E5PA 3RDQA 2X32A 5L8NA 3TZSA 1LDOA 1QQSA 2DJFA 3EBKA 3VGWA 4QGVA 1A2DA 1QFVA 4M6SA 4O4OA 4Y0SA 2RTOB 2X8SA 2CM4A 3KZAA 2C4IA 4GUZA 5D48A 1A57A 4B55A 2FHNX 3P6EA 2OF8A 4FQBB 3BSZE 2KT4B 2AT3X 3JQOA 3RWXA 2GTLM 3ZI8A 1E00A 3SLOA 2M4LA 4BGFA 3PH6A 2OY8A 2IZLB 2WEWA 4ORWA 1MVGA 1GX8A 2ZAIA 1SWLA 4HFOA 5HCEC 1N9YA 3HWDA 1Z24A 5BVTA 1SREA 3HWFA 1A18A 1BEBA 1CBSA 3FDCA 4YDAA 4BX5A 3C76X 3DSZA 4GETA 3O19A 5H9AA 4M7MA 4QGWA 5HWZA 3FA7A 3HPEA 4YBPA 3S60A 4NYRA 5K67A 5IO6A 3JS1A 1ZNGA 4WBKA 5AEOA 1BM5A 3T1DA 2PI3O 5FQ6E 1FDQA 5LJBA 2X4MA 1B4MA 3P24A 2BHVA 2GTLO 2Q2MA 4U8UN 5CYBA 2ASNX 1SLDB 1XKIA 4GDZA 5AJCA 3UAQA 2FKGA 1BRQA 4BX7A 4O3WA 2ALLX 1BRPA 1SWQA 2QO5A 3APXA 2RTIB 1YUPA 2RD7C 1VWLB 4IMNA 4O3YA 4BJ8A 3HWEA 2Y32A 3ZUIA 1VWJB 4I6SA 5HTDA 2FKJA 4D6AA 1JMXA 4OS0A 1ZNKA 1LF7A 1VWIB
chains in the Genus database with same CATH topology
3HK1A 1I05A 4MVLA 1I06A 4MVEA 3NADA 2CZUA 2X46A 4A1HA 3ZZVA 3CR6A 4YKMA 4BOEA 1DZJA 2KD2A 1S7DA 2Q4NA 3FELA 5LJHA 2HLVA 4LKPA 2NP1A 3D95A 4ZGFA 5HTEA 2JU3A 1IW2A 4HPAA 3VG2A 5B29A 3APVA 4GE1A 1B8EA 1KT4A 3VE1A 4IBAA 1GKAA 1GT4A 4OS8A 3P6HA 3WJGA 1X89A 4IB7A 1LIEA 3NX2A 3VG5A 2KTDA 3PEDA 1LF7A 4KC8A 3EBWA 1YWAA 4EEJA 4EDEA 3WJBA 4GKCA 4HWMA 5HAEA 1EW3A 1SA8A 2FT9A 4YKOA 4EQAC 5F6ZA 1X8PA 2QMIA 2RA6A 2XKLA 1LICA 3AKNA 4FBVA 1ZNLA 3STKA 3TF6A 3QKGA 4U9CA 1FTPA 2YG2A 1YP7A 4ID2A 5DG4A 1HMTA 4ZH9A 1IFCA 1ERBA 2A2GA 2QO6A 3TGBA 4I95A 1OEEA 4O3ZA 1OPAA 4O3XB 5EEDA 3FA9A 1ACDA 4YDBA 1QWDA 3S5VA 1U17A 1A3YA 3P6CA 5D4AA 4LZUA 3DTQA 4OMWA 5HZ8A 2LA7A 1KOIA 1CBRA 3RKGA 3WOVA 3F8AA 3P02A 3PQUA 5HZ6A 3LV4A 2K23A 1SXXA 4ORRA 1G74A 1KGLA 4YFQA 5H8TA 1YP6A 4NNSA 4ZHFA 2A2UA 1KZXA 4IB8A 4NLIA 4AZOA 4TKHA 2CZTA 3BU1A 1LNMA 4MVKA 1JYJA 2CBRA 4GRJA 1AB0A 4AW8A 4MVIA 4YCHA 5BYPA 3IFBA 5EZ2A 5H9KA 1CBIA 4FGIB 2JW1A 3FW4A 3KFFA 1KT7A 1SY0A 4TKBA 1QFTA 1TW4A 4WHIA 2Q2PA 4GK9A 5EEEA 1L6MA 5KIDA 1D3SA 3FEKA 3JSQA 3CMPA 5HZ9A 3WBGA 5LKEA 3CBCA 4ORXA 2LB6A 1Y9TA 2JN3A 5EDBA 4LKTA 4O9SA 2PY1A 2E4JA 3FR2A 3KFHA 4Y0QA 3WJEA 4PSQA 4CV7A 4HPBA 4IABA 4XMEA 4TQ2A 4R0BA 4QQ1A 2KW1A 2Z4HA 2WUTA 1O1UA 2GC9A 4O49A 5CE4A 4GNYA 3GE2A 4AZQA 3EM0A 3Q6LA 3SOTA 4ZHGA 1BWYA 4YH0A 1SY2A 2W2BA 3D97A 1I4UA 2FLJA 3ZUOA 3VU1A 1DF3A 3UEXA 3ZQ3A 3HWGA 2CBSA 1KZWA 2R74A 2YMSA 2AMMX 4I9SA 4ORSA 2WQ9A 4ON1A 3CQNA 3HOEA 3RBYA 3FW5A 3BX7A 3ELZA 2RCQA 1AELA 2OVAA 3WJCA 3FA6A 1EQDA 1BLRA 4ZR2A 1X71A 1CBQA 1GKAB 2AH7X 1T68X 4HPDA 4YGZA 4ES7A 1YWDA 4IMOA 4O4UA 5JR8A 1O8VA 3MVFA 3PP6A 1HMSA 4N7CA 5AJBA 2RN4A 1JIWI 4INNA 4UU3A 5L8IA 3P6FA 3PPTA 4GU8A 3HOLA 4XMFA 1D2UA 3NBXX 4ZHCA 1GT5A 4EXZA 4ZH6A 1G85A 1TXLA 4QYNA 5H9NA 3BU9A 1R0UA 3TGCA 5HBSA 3KFGA 3CWKA 1NP1A 4Y0PA 3VG3A 3MBTA 4QZTA 4HPCA 4COTA 2X45A 4U8UM 1YWCA 2WR6A 3UEUA 1HQPA 1HBQA 3SAOA 4A60A 4ZGUA 4ML7B 2HMBA 1X8QA 2Q9SA 5FAZA 4D6BA 1KT5A 3O22A 1JYDA 5LJDA 2L5PA 2F09A 3STMX 1Y9LA 2ACOA 3WVMA 2O62A 2FS7A 4UU2A 2JU7A 5IO7A 1DZKA 2AL0X 3B2LA 1S2PA 4O4XA 4YBUA 2OVDA 2W2FA 5HA1A 1T8VA 3PECA 2QO4A 4MIRA 1FELA 2MM3A 2XSTA 1EUOA 1LIDA 1KT6A 1XCAA 4U8UO 3ZW2A 4NYQA 2LBVA 3BX8A 4KH8A 4ORYA 1EPBA 3U03A 2ZAGA 4NLJA 3UEVA 5HZQA 1VPRA 2BS5A 1G7NA 3ZW0A 1BSYA 1GM6A 2HYSA 3CBSA 3L4RA 4OS3A 5F6BA 2A0AA 5HCDC 1BBPA 5LJGA 1X8UA 3VG7A 1FE3A 4IAXA 1OPBA 2RCTA 1BJ7A 3PQSA 5AQ6A 4ZHHA 1HN2A 3S5XA 4TJZA 4KC7A 4XMDA 5FENA 2R56A 2ACPX 3B2HA 3C77X 4RUUA 2MJIA 1ZNDA 2POAA 5D45A 4YMYA 1NP4A 1PM1X 1BSQA 1OEJA 5D8JA 4AYHA 2NNQA 1QY0A 1MUPA 1KQWA 4A1YA 4YFPA 3OBLA 1ICMA 1H91A 2LFOA 2KTSA 1MDCA 4O4SA 4QRLA 3FENA 3VG4A 1PEEA 5L8OA 1JV4A 1PMPA 1AVGI 3FMZA 2G7BA 4GZVA 1HMRA 2AT0X 5D47A 3I0AA 2OVEA 1GXAA 1S44A 3APWA 1OBUA 3B2JA 4TNNA 3RZYA 4ALBA 2WQAE 2F73A 3O2YA 1LIBA 5LJEA 1LFOA 4TLJA 4AZNA 2CM9A 2FTBA 1DV9A 5BVQA 2AKQA 5C0NA 5F7GA 2X8TA 2FS6A 2FWVA 3N91A 4L1NA 4DQ3A 4FBOA 4NW4A 1CRBA 2IFBA 4BVMA 1U18A 2HNXA 2NNDA 1SY1A 4PJ2A 3NP1A 1UREA 4IB9A 4QNIA 3GAQA 3G7XA 4GNWA 2OZQA 3NPOA 2OFMX 2MHDA 1LPJA 5FQ7E 4BQUA 2GTLN 5LKFA 2AT8X 4ALOA 2DM5A 1IIUA 1GX9A 4ZJ0A 3NR3A 2N93A 5DPQA 4Y0RA 3MX7A 2R73A 5F1EA 3ZW0B 3F6ZB 1LKEA 1MX7A 3FLLA 4K19A 1RLBE 2HZRA 3PH5A 1PBOA 3EMMA 1I04A 2QOSC 3HTYA 2GJ5A 3BRNA 3U9PC 3I17A 3VE2A 1MX8A 3FR5A 4XMGA 4A8ZA 5LJKA 3FEPA 1JJXA 3FYFA 2Q39A 3E3CA 1TOUA 3OJYC 1U0XA 5HZ5A 1UZ2X 3P6DA 2AT5X 2G78A 1LIFA 4ODDA 3V8UA 1P6PA 5B27A 1OBQA 1YWBA 3WJFA 3C78X 2OFRX 5LJCA 2Z4IA 3ZW1A 3STNA 1IFBA 4NP1A 1ADLA 1EALA 1SMPI 2HZQA 1VYGA 4QYPA 4WFVA 4ZCBA 4XMHA 5BVSA 2LKKA 5IO5A 3OD9A 1OEKA 4N7DA 1DZMA 1EI5A 3B2KA 4AZRA 4FBRA 4IAWA 5H9LA 3BLGA 3NQ9A 4MISA 1RBPA 1T0VA 4QZUA 4LZVA 1DFVA 2L9CA 4OMXA 3VG6A 2WEXA 1X8NA 2WSJA 1CJ5A 1AQBA 4CSBA 1JBHA 4RUNA 1B0OA 4DQ4A 2ANSA 2L67A 4I3DA 1ML7A 3K3LA 1KQXA 3BDRA 3EYCA 1QABE 2RQ0A 1GGLA 3S26A 3ZWEA 1IKEA 1IKJA 2GTFX 2EU7X 4I9RA 1ZNEA 2BLGA 4ORUA 5HCCC 1ZRYA 1OBPA 1ICNA 3FIQA 3KQ0A 4TKJA 3UEWA 1JZUA 3D4RA 1TVQA 2MO5A 4I3BA 2A3FX 2L68A 3CQRA 4YGHA 4NNTA 4QGXA 1YIVA 1E02A 3RSWA 2FRSA 3VPJE 3B2IA 3U0DA 4LQZA 2FR3A 4XMCA 2JOZA 3D96A 1BSOA 4KT5A 4YGGA 4U3QA 1E06A 1X8OA 1DC9A 2X8FA 4JGLA 4AZPA 3FA8A 5K06A 4WFUA 1EXSA 1QG5A 2JMBA 1ALBA 2JU8A 4ZHDA 1EIOA 4GH7A 5KHPA 3OE3A 1SXYA 4QAEA 2QM9A 3P6GA 3NQKA 1VYFA 1QY1A 5F58A 1FENA 3BY0A 3ELXA 5EPQA 2NNEA 1NGLA 3APUA 1FEMA 2K62A 3NQ3A 5FFHA 3H3IA 1SXWA 3NX1A 3BS2A 1SXUA 1SY3A 3LHNA 1ERXA 2OVSA 4KIIA 4L3RA 5KICA 1JJJA 2G79A 2W2AA 4IB6A 3WJDA 3WXQA 1G5WA 5HA0A 4AZMA 1DZPA 3IA8A 4YCEA 4EFGA 1QY2A 4YFRA 1TOWA 1EIIA 3KFIA 4ZFXA 2BT9A 1N0SA 4I3CA 1B56A 1EPAA 1KT3A 2FR2A 2MWHA 2WWPA 1O1VA 2A13A 2LBAA 3ZW1B 4CK4A 1ZNHA 5FQ8E 2BS6A 1GT1A 4KCAA 1GT3A 3F9DA 3FR4A 1HBPA 5EDCA 4ARHA 1KXOA 2P8GA 3TGAA 3AKMA 1E5PA 5L8NA 3TZSA 1QQSA 3EBKA 4QGVA 1A2DA 1QFVA 4M6SA 4O4OA 4Y0SA 2X8SA 2CM4A 3KZAA 5D48A 1A57A 3P6EA 4FQBB 3BSZE 2KT4B 2AT3X 3JQOA 3RWXA 2GTLM 3ZI8A 1E00A 2M4LA 3PH6A 2WEWA 4ORWA 1MVGA 1GX8A 2ZAIA 4HFOA 5HCEC 3HWDA 1Z24A 5BVTA 3HWFA 1A18A 1BEBA 1CBSA 4YDAA 3C76X 3DSZA 4GETA 3O19A 5H9AA 4M7MA 4QGWA 5HWZA 3FA7A 4YBPA 3S60A 4NYRA 5IO6A 3JS1A 1ZNGA 4WBKA 5AEOA 1BM5A 3T1DA 5FQ6E 5LJBA 1FDQA 1B4MA 3P24A 2BHVA 2GTLO 2Q2MA 4U8UN 5CYBA 2ASNX 1XKIA 4GDZA 5AJCA 3UAQA 1BRQA 4O3WA 2ALLX 1BRPA 2QO5A 3APXA 4IMNA 1YUPA 2RD7C 4O3YA 3HWEA 3ZUIA 4I6SA 5HTDA 4D6AA 4OS0A 1ZNKA 2AT6X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HK1 A;  1I05 A;  4MVL A;  1I06 A;  3NAD A;  2CZU A;  2X46 A;  4A1H A;  3CR6 A;  4YKM A;  4BOE A;  1DZJ A;  2Q4N A;  1S7D A;  3FEL A;  5LJH A;  2HLV A;  4LKP A;  2NP1 A;  3D95 A;  5HTE A;  2JU3 A;  1IW2 A;  4HPA A;  3VG2 A;  5B29 A;  3APV A;  4GE1 A;  1B8E A;  1KT4 A;  4IBA A;  1GKA A;  1GT4 A;  4OS8 A;  3P6H A;  3WJG A;  1X89 A;  4IB7 A;  1LIE A;  3NX2 A;  3VG5 A;  2KTD A;  3PED A;  1LF7 A;  4EEJ A;  3EBW A;  1YWA A;  4EDE A;  3WJB A;  4GKC A;  5HAE A;  1EW3 A;  1SA8 A;  2FT9 A;  4YKO A;  5F6Z A;  1X8P A;  2RA6 A;  2XKL A;  3AKN A;  1LIC A;  3STK A;  3TF6 A;  1ZNL A;  3QKG A;  1FTP A;  2YG2 A;  1YP7 A;  5DG4 A;  1HMT A;  4ZH9 A;  1IFC A;  1ERB A;  2A2G A;  2QO6 A;  3TGB A;  1OEE A;  1OPA A;  5EED A;  3FA9 A;  1ACD A;  4YDB A;  1QWD A;  1U17 A;  1A3Y A;  3P6C A;  5D4A A;  4LZU A;  3DTQ A;  4OMW A;  5HZ8 A;  1KOI A;  1CBR A;  3F8A A;  5HZ6 A;  2K23 A;  1SXX A;  4ORR A;  1G74 A;  1KGL A;  4YFQ A;  5H8T A;  1YP6 A;  4NNS A;  4ZHF A;  2A2U A;  1KZX A;  4IB8 A;  4NLI A;  4AZO A;  4TKH A;  2CZT A;  3BU1 A;  1LNM A;  4MVK A;  1JYJ A;  2CBR A;  4GRJ A;  1AB0 A;  4AW8 A;  4MVI A;  4YCH A;  3IFB A;  5EZ2 A;  5H9K A;  1CBI A;  3FW4 A;  3KFF A;  1KT7 A;  1SY0 A;  4TKB A;  1QFT A;  1TW4 A;  2Q2P A;  5EEE A;  5KID A;  1L6M A;  1D3S A;  3FEK A;  3JSQ A;  3CMP A;  5HZ9 A;  3WBG A;  5LKE A;  3CBC A;  4ORX A;  2LB6 A;  2JN3 A;  5EDB A;  4LKT A;  4O9S A;  2PY1 A;  2E4J A;  3FR2 A;  3KFH A;  4Y0Q A;  3WJE A;  4PSQ A;  4HPB A;  4XME A;  4TQ2 A;  4R0B A;  2WUT A;  1O1U A;  2GC9 A;  5CE4 A;  4GNY A;  4AZQ A;  4ZHG A;  3EM0 A;  3Q6L A;  1BWY A;  4YH0 A;  1SY2 A;  2W2B A;  3D97 A;  1I4U A;  2FLJ A;  3ZUO A;  1DF3 A;  3UEX A;  3ZQ3 A;  3HWG A;  2CBS A;  1KZW A;  2R74 A;  2AMM X;  4I9S A;  4ORS A;  2WQ9 A;  3CQN A;  3FW5 A;  3BX7 A;  3ELZ A;  2RCQ A;  1AEL A;  2OVA A;  3WJC A;  3FA6 A;  1EQD A;  1BLR A;  4ZR2 A;  1X71 A;  1CBQ A;  1GKA B;  2AH7 X;  1T68 X;  4HPD A;  4YGZ A;  4ES7 A;  1YWD A;  4IMO A;  5JR8 A;  1O8V A;  3MVF A;  3PP6 A;  1HMS A;  4N7C A;  4UU3 A;  5L8I A;  3P6F A;  3PPT A;  4XMF A;  1D2U A;  4ZHC A;  1GT5 A;  4EXZ A;  4ZH6 A;  1G85 A;  1TXL A;  4QYN A;  5H9N A;  3BU9 A;  1R0U A;  3TGC A;  5HBS A;  3KFG A;  3CWK A;  1NP1 A;  4Y0P A;  3VG3 A;  3MBT A;  4QZT A;  4HPC A;  2X45 A;  1YWC A;  2WR6 A;  3UEU A;  1HQP A;  1HBQ A;  3SAO A;  4A60 A;  4ZGU A;  2HMB A;  1X8Q A;  2Q9S A;  5FAZ A;  4D6B A;  1KT5 A;  3O22 A;  1JYD A;  5LJD A;  2L5P A;  3STM X;  2ACO A;  3WVM A;  2O62 A;  2FS7 A;  4UU2 A;  2JU7 A;  5IO7 A;  1DZK A;  2AL0 X;  3B2L A;  1S2P A;  4YBU A;  2OVD A;  2W2F A;  5HA1 A;  1T8V A;  3PEC A;  2QO4 A;  1FEL A;  2MM3 A;  2XST A;  1EUO A;  1LID A;  1KT6 A;  1XCA A;  4NYQ A;  2LBV A;  3BX8 A;  4ORY A;  1EPB A;  3U03 A;  4NLJ A;  3UEV A;  5HZQ A;  1VPR A;  1G7N A;  1BSY A;  1GM6 A;  2HYS A;  3CBS A;  3L4R A;  4OS3 A;  5F6B A;  2A0A A;  5HCD C;  1BBP A;  5LJG A;  1X8U A;  3VG7 A;  1FE3 A;  4IAX A;  1OPB A;  2RCT A;  1BJ7 A;  5AQ6 A;  4ZHH A;  1HN2 A;  4TJZ A;  4XMD A;  5FEN A;  2R56 A;  2ACP X;  3B2H A;  3C77 X;  4RUU A;  1ZND A;  2MJI A;  2POA A;  5D45 A;  4YMY A;  1NP4 A;  1PM1 X;  1BSQ A;  1OEJ A;  5D8J A;  4AYH A;  2NNQ A;  1QY0 A;  1MUP A;  1KQW A;  4A1Y A;  4YFP A;  1ICM A;  1H91 A;  2LFO A;  1MDC A;  3FEN A;  3VG4 A;  1PEE A;  5L8O A;  1JV4 A;  1PMP A;  1AVG I;  3FMZ A;  2G7B A;  1HMR A;  2AT0 X;  5D47 A;  3I0A A;  2OVE A;  1GXA A;  1S44 A;  3APW A;  1OBU A;  3B2J A;  4TNN A;  3RZY A;  4ALB A;  2WQA E;  2F73 A;  3O2Y A;  1LIB A;  5LJE A;  1LFO A;  4TLJ A;  4AZN A;  2CM9 A;  2FTB A;  1DV9 A;  5BVQ A;  2AKQ A;  5C0N A;  5F7G A;  2FS6 A;  2FWV A;  4DQ3 A;  1CRB A;  2IFB A;  4BVM A;  1U18 A;  2HNX A;  2NND A;  1SY1 A;  3NP1 A;  1URE A;  4IB9 A;  3GAQ A;  3G7X A;  4GNW A;  2OZQ A;  3NPO A;  2OFM X;  1LPJ A;  4BQU A;  5LKF A;  2AT8 X;  4ALO A;  2DM5 A;  1IIU A;  1GX9 A;  4ZJ0 A;  3NR3 A;  2N93 A;  5DPQ A;  4Y0R A;  2R73 A;  5F1E A;  4K19 A;  1LKE A;  1MX7 A;  3FLL A;  1RLB E;  2HZR A;  3PH5 A;  1PBO A;  3EMM A;  2QOS C;  1I04 A;  2GJ5 A;  3BRN A;  3U9P C;  3I17 A;  1MX8 A;  3FR5 A;  4XMG A;  4A8Z A;  5LJK A;  3FEP A;  1JJX A;  2Q39 A;  1TOU A;  3OJY C;  1U0X A;  5HZ5 A;  1UZ2 X;  3P6D A;  2AT5 X;  2G78 A;  1LIF A;  4ODD A;  1P6P A;  5B27 A;  1OBQ A;  1YWB A;  3WJF A;  3C78 X;  2OFR X;  5LJC A;  3STN A;  1IFB A;  4NP1 A;  1ADL A;  1EAL A;  2HZQ A;  5BVS A;  1VYG A;  4QYP A;  4WFV A;  4ZCB A;  4XMH A;  5IO5 A;  2LKK A;  1OEK A;  4N7D A;  1DZM A;  3B2K A;  4AZR A;  4IAW A;  5H9L A;  3BLG A;  3NQ9 A;  1RBP A;  1T0V A;  4QZU A;  4LZV A;  1DFV A;  2L9C A;  4OMX A;  3VG6 A;  2WEX A;  1X8N A;  2WSJ A;  1CJ5 A;  1AQB A;  1JBH A;  4RUN A;  1B0O A;  4DQ4 A;  2ANS A;  2L67 A;  4I3D A;  1ML7 A;  3K3L A;  1KQX A;  3BDR A;  3EYC A;  1QAB E;  2RQ0 A;  1GGL A;  3S26 A;  1IKE A;  1IKJ A;  2GTF X;  2EU7 X;  4I9R A;  1ZNE A;  2BLG A;  4ORU A;  5HCC C;  1ZRY A;  1OBP A;  1ICN A;  3FIQ A;  3KQ0 A;  4TKJ A;  3UEW A;  1JZU A;  1TVQ A;  2MO5 A;  4I3B A;  2A3F X;  2L68 A;  3CQR A;  4YGH A;  4NNT A;  4QGX A;  1YIV A;  1E02 A;  3RSW A;  2FRS A;  3B2I A;  3U0D A;  2FR3 A;  4XMC A;  2JOZ A;  3D96 A;  1BSO A;  4YGG A;  1E06 A;  1X8O A;  1DC9 A;  5K06 A;  4AZP A;  3FA8 A;  4WFU A;  1EXS A;  1QG5 A;  1ALB A;  2JU8 A;  4ZHD A;  1EIO A;  4GH7 A;  5KHP A;  1SXY A;  4QAE A;  2QM9 A;  3P6G A;  1VYF A;  1QY1 A;  5F58 A;  1FEN A;  3BY0 A;  3ELX A;  5EPQ A;  2NNE A;  1NGL A;  3APU A;  1FEM A;  2K62 A;  3NQ3 A;  5FFH A;  1SXW A;  3NX1 A;  3BS2 A;  1SXU A;  1SY3 A;  1ERX A;  4KII A;  5KIC A;  1JJJ A;  2G79 A;  2W2A A;  4IB6 A;  3WJD A;  3WXQ A;  1G5W A;  5HA0 A;  4AZM A;  1DZP A;  3IA8 A;  4YCE A;  4EFG A;  1QY2 A;  4YFR A;  1TOW A;  1EII A;  3KFI A;  4ZFX A;  1N0S A;  4I3C A;  1B56 A;  1EPA A;  1KT3 A;  2FR2 A;  2WWP A;  1O1V A;  2A13 A;  2LBA A;  4CK4 A;  1ZNH A;  1GT1 A;  1GT3 A;  3F9D A;  3FR4 A;  1HBP A;  5EDC A;  4ARH A;  1KXO A;  2P8G A;  3TGA A;  3AKM A;  1E5P A;  5L8N A;  3TZS A;  1QQS A;  3EBK A;  4QGV A;  1A2D A;  1QFV A;  4M6S A;  4Y0S A;  2CM4 A;  3KZA A;  5D48 A;  1A57 A;  3P6E A;  3BSZ E;  2KT4 B;  2AT3 X;  1E00 A;  3PH6 A;  2WEW A;  4ORW A;  1MVG A;  1GX8 A;  4HFO A;  5HCE C;  3HWD A;  1Z24 A;  5BVT A;  3HWF A;  1A18 A;  1BEB A;  1CBS A;  4YDA A;  3C76 X;  3DSZ A;  4GET A;  3O19 A;  5H9A A;  4M7M A;  4QGW A;  5HWZ A;  3FA7 A;  4YBP A;  4NYR A;  5IO6 A;  3JS1 A;  1ZNG A;  4WBK A;  1BM5 A;  3T1D A;  5LJB A;  1FDQ A;  1B4M A;  2Q2M A;  2ASN X;  1XKI A;  1BRQ A;  2ALL X;  1BRP A;  2QO5 A;  3APX A;  4IMN A;  1YUP A;  2RD7 C;  3HWE A;  3ZUI A;  5HTD A;  4D6A A;  4OS0 A;  1ZNK A;  2AT6 X; 
#chains in the Genus database with same CATH topology
 3HK1 A;  1I05 A;  4MVL A;  5B5G A;  1I06 A;  3RDM A;  4MVE A;  3NAD A;  1SLF B;  2CZU A;  2X46 A;  4A1H A;  3ZZV A;  3CR6 A;  3RDX A;  1VWG B;  1STP A;  4YKM A;  1DZJ A;  2KD2 A;  1S7D A;  2MF6 A;  2Q4N A;  3EW1 A;  3FEL A;  3T2W A;  1SWK A;  3AUM O;  1AVD A;  5LJH A;  2HLV A;  4LKP A;  2NP1 A;  2RTG B;  3D95 A;  4ZGF A;  5HTE A;  2JU3 A;  1IW2 A;  4HPA A;  3VG2 A;  5B29 A;  2RTD B;  3APV A;  3MM0 A;  4GDA A;  1VWN B;  3VHM A;  1W4T A;  4GE1 A;  1B8E A;  1KT4 A;  3VE1 A;  1RSU B;  3EC5 A;  1GKA A;  4IBA A;  1GT4 A;  4OS8 A;  3P6H A;  3WJG A;  1X89 A;  2BSZ A;  4IB7 A;  1LIE A;  4JNJ A;  3NX2 A;  3VG5 A;  2KTD A;  3PED A;  1KL4 A;  4KC8 A;  3EBW A;  1YWA A;  4EEJ A;  1NQM A;  4EDE A;  3WJB A;  4CPH A;  4GKC A;  4HWM A;  5HAE A;  1EW3 A;  1SA8 A;  2FT9 A;  4YKO A;  4EQA C;  5F6Z A;  1LCZ A;  2IZB A;  1X8P A;  1KL3 A;  2QMI A;  2RA6 A;  1LIC A;  2XKL A;  3AKN A;  1ZNL A;  4FBV A;  3STK A;  1MOY A;  3TF6 A;  3QKG A;  4U9C A;  1FTP A;  2YG2 A;  3RDU A;  5IXG A;  1YP7 A;  4ID2 A;  5DG4 A;  1HMT A;  1VWK B;  4ZH9 A;  1IFC A;  1ERB A;  2A2G A;  2QO6 A;  3WZN A;  1RST B;  4I95 A;  3TGB A;  4GGR A;  1OEE A;  4O3Z A;  1OPA A;  4O3X B;  1STS B;  3WYQ A;  2QCB A;  5EED A;  3FA9 A;  1ACD A;  4YDB A;  1QWD A;  2RTN B;  3S5V A;  1U17 A;  1A3Y A;  3P6C A;  4GGZ A;  4LZU A;  1HXL A;  3DTQ A;  4OMW A;  2LA7 A;  5D4A A;  5HZ8 A;  1KOI A;  1CBR A;  3RKG A;  3WOV A;  3F8A A;  3P02 A;  3PQU A;  2RTK A;  5HZ6 A;  2IZK A;  3LV4 A;  2K23 A;  1SXX A;  4ORR A;  1G74 A;  1KGL A;  4YFQ A;  5H8T A;  4NV7 A;  1YP6 A;  1SRJ A;  4NNS A;  4ZHF A;  2A2U A;  1KZX A;  4IB8 A;  4NLI A;  4AZO A;  2C1Q A;  4TKH A;  2CZT A;  3BU1 A;  1LNM A;  4MVK A;  1JYJ A;  2CBR A;  4GRJ A;  1AB0 A;  4AW8 A;  4MVI A;  2IZG B;  4YCH A;  5BYP A;  3IFB A;  5EZ2 A;  5H9K A;  1CBI A;  4FGI B;  3RY1 A;  1VWD B;  2JW1 A;  3FW4 A;  3KFF A;  1KT7 A;  3QQ2 A;  1SY0 A;  4TKB A;  1QFT A;  1RAV A;  1TW4 A;  2Q2P A;  1SWN A;  4GK9 A;  1L6M A;  2X34 A;  4WHI A;  5EEE A;  5KID A;  1D3S A;  3FEK A;  1VWO B;  3JSQ A;  3CMP A;  5HZ9 A;  3WBG A;  3LTW A;  5LKE A;  3CBC A;  4ORX A;  2OY5 O;  3Q34 A;  2FHL A;  2LB6 A;  4BX7 B;  1Y9T A;  4Z27 A;  2JN3 A;  5EDB A;  4LKT A;  4O9S A;  1RXJ A;  2PY1 A;  1VWP B;  2E4J A;  3FR2 A;  3KFH A;  4Y0Q A;  3WJE A;  4PSQ A;  4CV7 A;  2C1S A;  4HPB A;  4IAB A;  4XME A;  1E2T A;  4TQ2 A;  4R0B A;  4QQ1 A;  2KW1 A;  1I78 A;  2Z4H A;  2WUT A;  1O1U A;  2GC9 A;  1N9M A;  4O49 A;  4GNY A;  3GE2 A;  4AZQ A;  3EM0 A;  3Q6L A;  3SOT A;  4ZHG A;  2HKD A;  4YH0 A;  1BWY A;  1RXH A;  1SY2 A;  3VHI A;  1K24 A;  3CKG A;  2W2B A;  2RTC B;  3D97 A;  1I4U A;  1SRF A;  2FLJ A;  1N7Y A;  3ZUO A;  5B2A O;  3VU1 A;  1DF3 A;  3UEX A;  3ZQ3 A;  3HWG A;  2CBS A;  1KZW A;  2R74 A;  2YMS A;  1UYN X;  3EW2 A;  2AMM X;  4I9S A;  4ORS A;  2WQ9 A;  4ON1 A;  3CQN A;  3HOE A;  3RBY A;  3FW5 A;  3BX7 A;  3ELZ A;  2RCQ A;  3WYP A;  2OVA A;  3WJC A;  3FA6 A;  1AEL A;  1EQD A;  1BLR A;  4ZR2 A;  1X71 A;  1CBQ A;  1GKA B;  4CDD A;  2AH7 X;  1GX3 A;  1T68 X;  4HPD A;  4YGZ A;  4ES7 A;  3X00 A;  3CKF A;  1YWD A;  2AT6 X;  1VWQ B;  4IMO A;  2OY1 O;  1O8V A;  3MVF A;  3PP6 A;  1HMS A;  4O4U A;  4N7C A;  1SWE A;  5AJB A;  4CPH B;  2RN4 A;  1JIW I;  2X55 A;  4INN A;  4UU3 A;  5L8I A;  3P6F A;  3PPT A;  4GU8 A;  3HOL A;  4XMF A;  1D2U A;  3NBX X;  4ZHC A;  1GT5 A;  4EXZ A;  4ZH6 A;  1G85 A;  1TXL A;  4QYN A;  1FJ1 E;  2LBV A;  5H9N A;  3BU9 A;  1R0U A;  3TGC A;  1KFF A;  5HBS A;  3KFG A;  3CWK A;  1NP1 A;  5CSE A;  4Y0P A;  3VG3 A;  3MBT A;  4QZT A;  4HPC A;  2VDF A;  4COT A;  2X45 A;  4U8U M;  1YWC A;  2WR6 A;  3UEU A;  1HQP A;  1HBQ A;  1PBY A;  3SAO A;  4A60 A;  3T6L A;  4ZGU A;  4ML7 B;  2HMB A;  1X8Q A;  2Q9S A;  5FAZ A;  4CPE A;  1KT5 A;  1VWE B;  1JYD A;  3O22 A;  4U46 A;  5LJD A;  2L5P A;  2F09 A;  3STM X;  1Y9L A;  1SLE B;  2ACO A;  3WVM A;  2O62 A;  2FS7 A;  2UYW A;  2AF5 A;  4UU2 A;  4GD9 A;  2JU7 A;  5IO7 A;  2UZ2 A;  1DZK A;  2AL0 X;  3B2L A;  1S2P A;  4O4X A;  4YBU A;  2OVD A;  2W2F A;  5HA1 A;  1T8V A;  3PEC A;  5JR8 A;  2QO4 A;  4MIR A;  1FEL A;  2MM3 A;  3WZO A;  2XST A;  1EUO A;  1LID A;  1KT6 A;  1LUQ A;  1XCA A;  4U8U O;  4NYQ A;  1NC9 A;  3BX8 A;  4KH8 A;  4ORY A;  1EPB A;  4OEL A;  2ZAG A;  5K68 A;  2VFC A;  4NLJ A;  3PK2 A;  3U03 A;  3UEV A;  5HZQ A;  1SLG B;  1VPR A;  2BS5 A;  4GJV A;  1G7N A;  2IZC B;  3ZW0 A;  1BSY A;  4YVB A;  1GM6 A;  2HYS A;  3CBS A;  3L4R A;  4OS3 A;  2CAM A;  5F6B A;  3RDS A;  4BOE A;  2A0A A;  1NBX A;  1HY2 A;  5HCD C;  1BBP A;  5LJG A;  1X8U A;  3VG7 A;  1FE3 A;  4IAX A;  1OPB A;  2RCT A;  4JO6 A;  4EKV A;  1BJ7 A;  3PQS A;  2BC3 A;  5AQ6 A;  5IRA A;  4ZHH A;  1HN2 A;  2QOM A;  2IZD B;  4TJZ A;  3S5X A;  4DCB A;  5K06 A;  4KC7 A;  4XMD A;  5FEN A;  2R56 A;  2ACP X;  2RTP B;  3B2H A;  3C77 X;  4RUU A;  2OFA A;  1ZND A;  1AVE A;  2MJI A;  2POA A;  5JD2 A;  5D45 A;  4YMY A;  1NP4 A;  1PM1 X;  3VHH A;  1BSQ A;  1OEJ A;  1SRH A;  5D8J A;  1LDQ A;  1STR B;  2X56 A;  2RTF B;  4AYH A;  2NNQ A;  4CDC A;  1QY0 A;  1MUP A;  1KQW A;  2G5L A;  2IZJ A;  4YFP A;  4A1Y A;  3OBL A;  1ICM A;  1H91 A;  2LFO A;  2KTS A;  1MDC A;  4O4S A;  4QRL A;  3T2X A;  3FEN A;  1HXZ A;  3VG4 A;  2RTJ A;  1PEE A;  1I9H A;  1SWO A;  5L8O A;  1JV4 A;  1PMP A;  2DJG A;  1AVG I;  3FMZ A;  2G7B A;  4GZV A;  2OYB O;  1HMR A;  1JMZ A;  2AT0 X;  5D47 A;  3I0A A;  1MM9 A;  1SRI A;  1GXA A;  2OVE A;  4BX5 B;  1S44 A;  4OKA A;  3APW A;  1OBU A;  3B2J A;  3WZQ A;  4TNN A;  3RZY A;  4ALB A;  2RTL A;  2WQA E;  2Y3E A;  3KVN A;  1Y53 X;  2F73 A;  3O2Y A;  1LIB A;  3RDO A;  5LJE A;  1NQN A;  1LFO A;  4TLJ A;  5B3M O;  4AZN A;  1SWG A;  2CM9 A;  2FTB A;  4BX6 A;  1LEL A;  1DV9 A;  1SWU A;  5BVQ A;  2AKQ A;  5C0N A;  2IZH B;  5F7G A;  4CPI A;  2X8T A;  4D6B A;  2FS6 A;  4CDF A;  2FWV A;  1SWD A;  3N91 A;  4L1N A;  4FBO A;  4NW4 A;  1CRB A;  1Y52 X;  4DQ3 A;  2IFB A;  4BVM A;  1U18 A;  2HNX A;  2NND A;  1SY1 A;  4PJ2 A;  3WZP A;  3NP1 A;  1URE A;  4IB9 A;  4QNI A;  1SRG A;  3GAQ A;  3G7X A;  4GNW A;  4JHQ A;  1SWS A;  1SWR A;  1JQP A;  2OZQ A;  3NPO A;  2OY7 A;  1LCV A;  5B11 O;  2OFM X;  2MHD A;  2A5C A;  2IZF B;  4IRW A;  1LPJ A;  2IZA A;  5FQ7 E;  3PDF A;  4BQU A;  2GTL N;  4MEE A;  5LKF A;  2AT8 X;  4ALO A;  3MG5 A;  2DM5 A;  1IIU A;  1GX9 A;  2IZE B;  4ZJ0 A;  3NR3 A;  4Z28 A;  2N93 A;  3RY2 A;  5DPQ A;  4Z2O A;  4Y0R A;  3MX7 A;  2R73 A;  5B5F A;  2GH7 A;  5F1E A;  3ZW0 B;  3F6Z B;  1LKE A;  1MX7 A;  3FLL A;  4K19 A;  1RLB E;  2HZR A;  3PH5 A;  1PBO A;  2I5Z O;  3EMM A;  5CE4 A;  1I04 A;  1WUB A;  2QOS C;  1LCW A;  2GJ5 A;  3BRN A;  3HTY A;  2JGS A;  3I17 A;  3U9P C;  3VE2 A;  1MX8 A;  3FR5 A;  4XMG A;  4A8Z A;  1VWC B;  5LJK A;  4I60 A;  3FEP A;  1W6F A;  1JJX A;  1SWB A;  1VWH B;  5CHK A;  5IRU A;  3FYF A;  1W5R A;  2Q39 A;  2Y3F A;  2OL6 O;  3E3C A;  1TOU A;  3OJY C;  1U0X A;  4CPF A;  1UZ2 X;  3P6D A;  4BCS A;  5HZ5 A;  2AT5 X;  2G78 A;  1LIF A;  4ODD A;  3V8U A;  1P6P A;  4BBO A;  5B27 A;  1OBQ A;  2RTB B;  1YWB A;  4Z2P A;  2A8G A;  3WJF A;  3C78 X;  1SWJ A;  2WPU A;  2OFR X;  5LJC A;  1VWB B;  2Z4I A;  3ZW1 A;  3STN A;  1IFB A;  4NP1 A;  3AEH A;  1ADL A;  1EAL A;  1SMP I;  2HZQ A;  1UYO X;  1VYG A;  4QYP A;  4WFV A;  4XMH A;  4ZCB A;  2LKK A;  5BVS A;  3OD9 A;  5IO5 A;  1OEK A;  4N7D A;  1DZM A;  1EI5 A;  1SWH A;  3B2K A;  4AZR A;  1VWF B;  1SWT A;  4FBR A;  4IAW A;  5H9L A;  1OSP O;  3BLG A;  3NQ9 A;  4MIS A;  1NDJ A;  3RE5 A;  1RBP A;  1T0V A;  4QZU A;  4LZV A;  1DFV A;  2L9C A;  4OMX A;  3VG6 A;  2WEX A;  1X8N A;  1SWA A;  2WSJ A;  1CJ5 A;  2F01 A;  1AQB A;  1Y0G A;  4Z2V A;  1N4J A;  4CSB A;  1JBH A;  1PTS A;  4Y5D A;  4RUN A;  3SZI A;  1B0O A;  4DQ4 A;  1SWP A;  2VFB A;  2ANS A;  2G8C O;  2L67 A;  4OEM A;  2OL8 O;  2RTH B;  4I3D A;  1KL5 A;  1ML7 A;  4CDE A;  3K3L A;  3FID A;  1KQX A;  3BDR A;  3EYC A;  4C5P A;  4BX6 B;  1VWM B;  1QAB E;  3ZW2 A;  2RQ0 A;  1GGL A;  3S26 A;  3ZWE A;  1IKE A;  1IKJ A;  2GTF X;  2EU7 X;  4I9R A;  1ZNE A;  3RE6 A;  2BLG A;  4ORU A;  2OL7 A;  5HCC C;  1ZRY A;  1OBP A;  1ICN A;  3FIQ A;  3KQ0 A;  4TKJ A;  2OFB A;  3UEW A;  1JZU A;  3D4R A;  1VYO A;  1TVQ A;  1VWA B;  2MO5 A;  2RTR B;  4I3B A;  2A3F X;  2L68 A;  3CQR A;  4YGH A;  4NNT A;  4QGX A;  2RTM A;  1YIV A;  4DNE A;  1E02 A;  3RSW A;  2A5B A;  2FRS A;  3VPJ E;  3B2I A;  3U0D A;  4LQZ A;  2FR3 A;  1MK5 A;  4XMC A;  2JOZ A;  3D96 A;  1BSO A;  4KT5 A;  4YGG A;  5B10 O;  4U3Q A;  1E06 A;  1X8O A;  1DC9 A;  2X8F A;  3D9W A;  4JGL A;  3FA8 A;  4AZP A;  2AVI A;  4WFU A;  1EXS A;  1QG5 A;  1SWF A;  1ALB A;  2JMB A;  2JU8 A;  4ZHD A;  1EIO A;  1WBI A;  4GH7 A;  5KHP A;  2RTE B;  1SXY A;  3OE3 A;  2QM9 A;  4QAE A;  3P6G A;  1Y55 X;  4GJS A;  3NQK A;  1VYF A;  1HQQ A;  1QY1 A;  5F58 A;  1FEN A;  3BY0 A;  4Y59 A;  3T6F A;  3SLJ A;  3ELX A;  5EPQ A;  2NNE A;  1NGL A;  3APU A;  1JJU A;  1FEM A;  2K62 A;  1N43 A;  3NQ3 A;  2FGS A;  5FFH A;  1MEP A;  3H3I A;  1SXW A;  3NX1 A;  3BS2 A;  1RXK A;  2I5V O;  1SXU A;  1SY3 A;  3LHN A;  1ERX A;  2OVS A;  4KII A;  4L3R A;  4NV8 A;  2RTQ B;  1SWC A;  3SLT A;  5KIC A;  2G79 A;  1JJJ A;  2OF9 A;  2W2A A;  4IB6 A;  3WJD A;  3WXQ A;  1G5W A;  5HA0 A;  5L3Y A;  1DF8 A;  4AZM A;  1DZP A;  3SZH A;  3IA8 A;  4YCE A;  4EFG A;  1QY2 A;  1VWR B;  4YFR A;  1TOW A;  2RTA A;  1EII A;  3KFI A;  4ZFX A;  1K3B A;  2BT9 A;  2IZI A;  2ZSC A;  1N0S A;  4I3C A;  1IJ8 A;  1B56 A;  1EPA A;  1KT3 A;  2FR2 A;  2MWH A;  2WWP A;  1O1V A;  3SZJ A;  4Z6J A;  2A13 A;  2LBA A;  3ZW1 B;  5F2B A;  1ZNH A;  5FQ8 E;  4CK4 A;  4GGT A;  2BS6 A;  5IRW A;  1GT1 A;  4KCA A;  1GT3 A;  3F9D A;  3FR4 A;  1HBP A;  5EDC A;  4ARH A;  1KXO A;  2P8G A;  3TGA A;  3AKM A;  1E5P A;  3RDQ A;  2X32 A;  5L8N A;  3TZS A;  1LDO A;  1QQS A;  2DJF A;  3EBK A;  3VGW A;  4QGV A;  1A2D A;  1QFV A;  4M6S A;  4O4O A;  4Y0S A;  2RTO B;  2X8S A;  2CM4 A;  3KZA A;  2C4I A;  4GUZ A;  5D48 A;  1A57 A;  4B55 A;  2FHN X;  3P6E A;  2OF8 A;  4FQB B;  3BSZ E;  2KT4 B;  2AT3 X;  3JQO A;  3RWX A;  2GTL M;  3ZI8 A;  1E00 A;  3SLO A;  2M4L A;  4BGF A;  3PH6 A;  2OY8 A;  2IZL B;  2WEW A;  4ORW A;  1MVG A;  1GX8 A;  2ZAI A;  1SWL A;  4HFO A;  5HCE C;  1N9Y A;  3HWD A;  1Z24 A;  5BVT A;  1SRE A;  3HWF A;  1A18 A;  1BEB A;  1CBS A;  3FDC A;  4YDA A;  4BX5 A;  3C76 X;  3DSZ A;  4GET A;  3O19 A;  5H9A A;  4M7M A;  4QGW A;  5HWZ A;  3FA7 A;  3HPE A;  4YBP A;  3S60 A;  4NYR A;  5K67 A;  5IO6 A;  3JS1 A;  1ZNG A;  4WBK A;  5AEO A;  1BM5 A;  3T1D A;  2PI3 O;  5FQ6 E;  1FDQ A;  5LJB A;  2X4M A;  1B4M A;  3P24 A;  2BHV A;  2GTL O;  2Q2M A;  4U8U N;  5CYB A;  2ASN X;  1SLD B;  1XKI A;  4GDZ A;  5AJC A;  3UAQ A;  2FKG A;  1BRQ A;  4BX7 A;  4O3W A;  2ALL X;  1BRP A;  1SWQ A;  2QO5 A;  3APX A;  2RTI B;  1YUP A;  2RD7 C;  1VWL B;  4IMN A;  4O3Y A;  4BJ8 A;  3HWE A;  2Y32 A;  3ZUI A;  1VWJ B;  4I6S A;  5HTD A;  2FKJ A;  4D6A A;  1JMX A;  4OS0 A;  1ZNK A;  1LF7 A;  1VWI B; 
#chains in the Genus database with same CATH homology
 3HK1 A;  1I05 A;  4MVL A;  1I06 A;  4MVE A;  3NAD A;  2CZU A;  2X46 A;  4A1H A;  3ZZV A;  3CR6 A;  4YKM A;  4BOE A;  1DZJ A;  2KD2 A;  1S7D A;  2Q4N A;  3FEL A;  5LJH A;  2HLV A;  4LKP A;  2NP1 A;  3D95 A;  4ZGF A;  5HTE A;  2JU3 A;  1IW2 A;  4HPA A;  3VG2 A;  5B29 A;  3APV A;  4GE1 A;  1B8E A;  1KT4 A;  3VE1 A;  4IBA A;  1GKA A;  1GT4 A;  4OS8 A;  3P6H A;  3WJG A;  1X89 A;  4IB7 A;  1LIE A;  3NX2 A;  3VG5 A;  2KTD A;  3PED A;  1LF7 A;  4KC8 A;  3EBW A;  1YWA A;  4EEJ A;  4EDE A;  3WJB A;  4GKC A;  4HWM A;  5HAE A;  1EW3 A;  1SA8 A;  2FT9 A;  4YKO A;  4EQA C;  5F6Z A;  1X8P A;  2QMI A;  2RA6 A;  2XKL A;  1LIC A;  3AKN A;  4FBV A;  1ZNL A;  3STK A;  3TF6 A;  3QKG A;  4U9C A;  1FTP A;  2YG2 A;  1YP7 A;  4ID2 A;  5DG4 A;  1HMT A;  4ZH9 A;  1IFC A;  1ERB A;  2A2G A;  2QO6 A;  3TGB A;  4I95 A;  1OEE A;  4O3Z A;  1OPA A;  4O3X B;  5EED A;  3FA9 A;  1ACD A;  4YDB A;  1QWD A;  3S5V A;  1U17 A;  1A3Y A;  3P6C A;  5D4A A;  4LZU A;  3DTQ A;  4OMW A;  5HZ8 A;  2LA7 A;  1KOI A;  1CBR A;  3RKG A;  3WOV A;  3F8A A;  3P02 A;  3PQU A;  5HZ6 A;  3LV4 A;  2K23 A;  1SXX A;  4ORR A;  1G74 A;  1KGL A;  4YFQ A;  5H8T A;  1YP6 A;  4NNS A;  4ZHF A;  2A2U A;  1KZX A;  4IB8 A;  4NLI A;  4AZO A;  4TKH A;  2CZT A;  3BU1 A;  1LNM A;  4MVK A;  1JYJ A;  2CBR A;  4GRJ A;  1AB0 A;  4AW8 A;  4MVI A;  4YCH A;  5BYP A;  3IFB A;  5EZ2 A;  5H9K A;  1CBI A;  4FGI B;  2JW1 A;  3FW4 A;  3KFF A;  1KT7 A;  1SY0 A;  4TKB A;  1QFT A;  1TW4 A;  4WHI A;  2Q2P A;  4GK9 A;  5EEE A;  1L6M A;  5KID A;  1D3S A;  3FEK A;  3JSQ A;  3CMP A;  5HZ9 A;  3WBG A;  5LKE A;  3CBC A;  4ORX A;  2LB6 A;  1Y9T A;  2JN3 A;  5EDB A;  4LKT A;  4O9S A;  2PY1 A;  2E4J A;  3FR2 A;  3KFH A;  4Y0Q A;  3WJE A;  4PSQ A;  4CV7 A;  4HPB A;  4IAB A;  4XME A;  4TQ2 A;  4R0B A;  4QQ1 A;  2KW1 A;  2Z4H A;  2WUT A;  1O1U A;  2GC9 A;  4O49 A;  5CE4 A;  4GNY A;  3GE2 A;  4AZQ A;  3EM0 A;  3Q6L A;  3SOT A;  4ZHG A;  1BWY A;  4YH0 A;  1SY2 A;  2W2B A;  3D97 A;  1I4U A;  2FLJ A;  3ZUO A;  3VU1 A;  1DF3 A;  3UEX A;  3ZQ3 A;  3HWG A;  2CBS A;  1KZW A;  2R74 A;  2YMS A;  2AMM X;  4I9S A;  4ORS A;  2WQ9 A;  4ON1 A;  3CQN A;  3HOE A;  3RBY A;  3FW5 A;  3BX7 A;  3ELZ A;  2RCQ A;  1AEL A;  2OVA A;  3WJC A;  3FA6 A;  1EQD A;  1BLR A;  4ZR2 A;  1X71 A;  1CBQ A;  1GKA B;  2AH7 X;  1T68 X;  4HPD A;  4YGZ A;  4ES7 A;  1YWD A;  4IMO A;  4O4U A;  5JR8 A;  1O8V A;  3MVF A;  3PP6 A;  1HMS A;  4N7C A;  5AJB A;  2RN4 A;  1JIW I;  4INN A;  4UU3 A;  5L8I A;  3P6F A;  3PPT A;  4GU8 A;  3HOL A;  4XMF A;  1D2U A;  3NBX X;  4ZHC A;  1GT5 A;  4EXZ A;  4ZH6 A;  1G85 A;  1TXL A;  4QYN A;  5H9N A;  3BU9 A;  1R0U A;  3TGC A;  5HBS A;  3KFG A;  3CWK A;  1NP1 A;  4Y0P A;  3VG3 A;  3MBT A;  4QZT A;  4HPC A;  4COT A;  2X45 A;  4U8U M;  1YWC A;  2WR6 A;  3UEU A;  1HQP A;  1HBQ A;  3SAO A;  4A60 A;  4ZGU A;  4ML7 B;  2HMB A;  1X8Q A;  2Q9S A;  5FAZ A;  4D6B A;  1KT5 A;  3O22 A;  1JYD A;  5LJD A;  2L5P A;  2F09 A;  3STM X;  1Y9L A;  2ACO A;  3WVM A;  2O62 A;  2FS7 A;  4UU2 A;  2JU7 A;  5IO7 A;  1DZK A;  2AL0 X;  3B2L A;  1S2P A;  4O4X A;  4YBU A;  2OVD A;  2W2F A;  5HA1 A;  1T8V A;  3PEC A;  2QO4 A;  4MIR A;  1FEL A;  2MM3 A;  2XST A;  1EUO A;  1LID A;  1KT6 A;  1XCA A;  4U8U O;  3ZW2 A;  4NYQ A;  2LBV A;  3BX8 A;  4KH8 A;  4ORY A;  1EPB A;  3U03 A;  2ZAG A;  4NLJ A;  3UEV A;  5HZQ A;  1VPR A;  2BS5 A;  1G7N A;  3ZW0 A;  1BSY A;  1GM6 A;  2HYS A;  3CBS A;  3L4R A;  4OS3 A;  5F6B A;  2A0A A;  5HCD C;  1BBP A;  5LJG A;  1X8U A;  3VG7 A;  1FE3 A;  4IAX A;  1OPB A;  2RCT A;  1BJ7 A;  3PQS A;  5AQ6 A;  4ZHH A;  1HN2 A;  3S5X A;  4TJZ A;  4KC7 A;  4XMD A;  5FEN A;  2R56 A;  2ACP X;  3B2H A;  3C77 X;  4RUU A;  2MJI A;  1ZND A;  2POA A;  5D45 A;  4YMY A;  1NP4 A;  1PM1 X;  1BSQ A;  1OEJ A;  5D8J A;  4AYH A;  2NNQ A;  1QY0 A;  1MUP A;  1KQW A;  4A1Y A;  4YFP A;  3OBL A;  1ICM A;  1H91 A;  2LFO A;  2KTS A;  1MDC A;  4O4S A;  4QRL A;  3FEN A;  3VG4 A;  1PEE A;  5L8O A;  1JV4 A;  1PMP A;  1AVG I;  3FMZ A;  2G7B A;  4GZV A;  1HMR A;  2AT0 X;  5D47 A;  3I0A A;  2OVE A;  1GXA A;  1S44 A;  3APW A;  1OBU A;  3B2J A;  4TNN A;  3RZY A;  4ALB A;  2WQA E;  2F73 A;  3O2Y A;  1LIB A;  5LJE A;  1LFO A;  4TLJ A;  4AZN A;  2CM9 A;  2FTB A;  1DV9 A;  5BVQ A;  2AKQ A;  5C0N A;  5F7G A;  2X8T A;  2FS6 A;  2FWV A;  3N91 A;  4L1N A;  4DQ3 A;  4FBO A;  4NW4 A;  1CRB A;  2IFB A;  4BVM A;  1U18 A;  2HNX A;  2NND A;  1SY1 A;  4PJ2 A;  3NP1 A;  1URE A;  4IB9 A;  4QNI A;  3GAQ A;  3G7X A;  4GNW A;  2OZQ A;  3NPO A;  2OFM X;  2MHD A;  1LPJ A;  5FQ7 E;  4BQU A;  2GTL N;  5LKF A;  2AT8 X;  4ALO A;  2DM5 A;  1IIU A;  1GX9 A;  4ZJ0 A;  3NR3 A;  2N93 A;  5DPQ A;  4Y0R A;  3MX7 A;  2R73 A;  5F1E A;  3ZW0 B;  3F6Z B;  1LKE A;  1MX7 A;  3FLL A;  4K19 A;  1RLB E;  2HZR A;  3PH5 A;  1PBO A;  3EMM A;  1I04 A;  2QOS C;  3HTY A;  2GJ5 A;  3BRN A;  3U9P C;  3I17 A;  3VE2 A;  1MX8 A;  3FR5 A;  4XMG A;  4A8Z A;  5LJK A;  3FEP A;  1JJX A;  3FYF A;  2Q39 A;  3E3C A;  1TOU A;  3OJY C;  1U0X A;  5HZ5 A;  1UZ2 X;  3P6D A;  2AT5 X;  2G78 A;  1LIF A;  4ODD A;  3V8U A;  1P6P A;  5B27 A;  1OBQ A;  1YWB A;  3WJF A;  3C78 X;  2OFR X;  5LJC A;  2Z4I A;  3ZW1 A;  3STN A;  1IFB A;  4NP1 A;  1ADL A;  1EAL A;  1SMP I;  2HZQ A;  1VYG A;  4QYP A;  4WFV A;  4ZCB A;  4XMH A;  5BVS A;  2LKK A;  5IO5 A;  3OD9 A;  1OEK A;  4N7D A;  1DZM A;  1EI5 A;  3B2K A;  4AZR A;  4FBR A;  4IAW A;  5H9L A;  3BLG A;  3NQ9 A;  4MIS A;  1RBP A;  1T0V A;  4QZU A;  4LZV A;  1DFV A;  2L9C A;  4OMX A;  3VG6 A;  2WEX A;  1X8N A;  2WSJ A;  1CJ5 A;  1AQB A;  4CSB A;  1JBH A;  4RUN A;  1B0O A;  4DQ4 A;  2ANS A;  2L67 A;  4I3D A;  1ML7 A;  3K3L A;  1KQX A;  3BDR A;  3EYC A;  1QAB E;  2RQ0 A;  1GGL A;  3S26 A;  3ZWE A;  1IKE A;  1IKJ A;  2GTF X;  2EU7 X;  4I9R A;  1ZNE A;  2BLG A;  4ORU A;  5HCC C;  1ZRY A;  1OBP A;  1ICN A;  3FIQ A;  3KQ0 A;  4TKJ A;  3UEW A;  1JZU A;  3D4R A;  1TVQ A;  2MO5 A;  4I3B A;  2A3F X;  2L68 A;  3CQR A;  4YGH A;  4NNT A;  4QGX A;  1YIV A;  1E02 A;  3RSW A;  2FRS A;  3VPJ E;  3B2I A;  3U0D A;  4LQZ A;  2FR3 A;  4XMC A;  2JOZ A;  3D96 A;  1BSO A;  4KT5 A;  4YGG A;  4U3Q A;  1E06 A;  1X8O A;  1DC9 A;  2X8F A;  4JGL A;  4AZP A;  3FA8 A;  5K06 A;  4WFU A;  1EXS A;  1QG5 A;  2JMB A;  1ALB A;  2JU8 A;  4ZHD A;  1EIO A;  4GH7 A;  5KHP A;  3OE3 A;  1SXY A;  4QAE A;  2QM9 A;  3P6G A;  3NQK A;  1VYF A;  1QY1 A;  5F58 A;  1FEN A;  3BY0 A;  3ELX A;  5EPQ A;  2NNE A;  1NGL A;  3APU A;  1FEM A;  2K62 A;  3NQ3 A;  5FFH A;  3H3I A;  1SXW A;  3NX1 A;  3BS2 A;  1SXU A;  1SY3 A;  3LHN A;  1ERX A;  2OVS A;  4KII A;  4L3R A;  5KIC A;  1JJJ A;  2G79 A;  2W2A A;  4IB6 A;  3WJD A;  3WXQ A;  1G5W A;  5HA0 A;  4AZM A;  1DZP A;  3IA8 A;  4YCE A;  4EFG A;  1QY2 A;  4YFR A;  1TOW A;  1EII A;  3KFI A;  4ZFX A;  2BT9 A;  1N0S A;  4I3C A;  1B56 A;  1EPA A;  1KT3 A;  2FR2 A;  2MWH A;  2WWP A;  1O1V A;  2A13 A;  2LBA A;  3ZW1 B;  4CK4 A;  1ZNH A;  5FQ8 E;  2BS6 A;  1GT1 A;  4KCA A;  1GT3 A;  3F9D A;  3FR4 A;  1HBP A;  5EDC A;  4ARH A;  1KXO A;  2P8G A;  3TGA A;  3AKM A;  1E5P A;  5L8N A;  3TZS A;  1QQS A;  3EBK A;  4QGV A;  1A2D A;  1QFV A;  4M6S A;  4O4O A;  4Y0S A;  2X8S A;  2CM4 A;  3KZA A;  5D48 A;  1A57 A;  3P6E A;  4FQB B;  3BSZ E;  2KT4 B;  2AT3 X;  3JQO A;  3RWX A;  2GTL M;  3ZI8 A;  1E00 A;  2M4L A;  3PH6 A;  2WEW A;  4ORW A;  1MVG A;  1GX8 A;  2ZAI A;  4HFO A;  5HCE C;  3HWD A;  1Z24 A;  5BVT A;  3HWF A;  1A18 A;  1BEB A;  1CBS A;  4YDA A;  3C76 X;  3DSZ A;  4GET A;  3O19 A;  5H9A A;  4M7M A;  4QGW A;  5HWZ A;  3FA7 A;  4YBP A;  3S60 A;  4NYR A;  5IO6 A;  3JS1 A;  1ZNG A;  4WBK A;  5AEO A;  1BM5 A;  3T1D A;  5FQ6 E;  5LJB A;  1FDQ A;  1B4M A;  3P24 A;  2BHV A;  2GTL O;  2Q2M A;  4U8U N;  5CYB A;  2ASN X;  1XKI A;  4GDZ A;  5AJC A;  3UAQ A;  1BRQ A;  4O3W A;  2ALL X;  1BRP A;  2QO5 A;  3APX A;  4IMN A;  1YUP A;  2RD7 C;  4O3Y A;  3HWE A;  3ZUI A;  4I6S A;  5HTD A;  4D6A A;  4OS0 A;  1ZNK A;  2AT6 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...