3FWCC

Sac3:sus1:cdc31 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
87
structure length
87
Chain Sequence
QLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESTNFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 31
publication title Sus1, Cdc31, and the Sac3 CID region form a conserved interaction platform that promotes nuclear pore association and mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle, transcription
total genus 33
structure length 87
sequence length 87
chains with identical sequence D, G, H, K, L, O, P
ec nomenclature
pdb deposition date 2009-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF10163 EnY2 Transcription factor e(y)2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.140 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 3fwcC00
4MBEC 4WA6B 4DHXB 4FJCB 3KJLA 3MHSB 3FWBC 4C31B 3FWCC 4ZUXV 3KIKA 4FIPB 4FK5B 4W4UB 3MHHB 3M99C
chains in the Genus database with same CATH superfamily
2K0NA 2XSIA 4GG2A 3NVKA 5ID7A 4ZUXV 2I30A 3WHRA 4LA0A 2QHBA 4TQ1A 1E7EA 1UORA 2BXKA 2AJEA 3KJLA 1HK4A 1HA2A 3UIVA 4ZBRA 2XVWA 1E78A 2BXBA 4HGKA 4OTTA 3VQIA 1E7FA 1MIVA 5GHKA 4JK4A 4NAWB 3H37A 2BXGA 2LXTA 2DBWA 1GNJA 2LQIA 4DM0A 2KBZA 1GNIA 4I9OA 4LUHA 1J7EA 2DBXA 3LU8A 1KW2A 2YDFA 3LU6A 1AO6A 4C31B 4ZBKA 1NT2B 3MHHB 2EFDA 2KWFA 2LXSA 3W1SA 2BXCA 1MM8A 5IIUA 4L9KA 1VZSA 1LOTA 4J2VA 4W4UB 3JQZA 4F5UA 1E7IA 1E7GA 4G03A 4TQ0A 2VDBA 2VUFA 1H9ZA 1J78A 1KXPD 2XVQA 1BKEA 4M70B 4OR0A 4GDLB 4FIPB 2BXOA 5BPKA 1MUHA 3NVIA 1JNBA 4BY9C 1HK5A 3ICXA 4S1YA 5GIPA 2Z8JA 2BXHA 2XW0A 4GDKB 3WHQA 2BXAA 2EFEA 2I2ZA 2XMOA 2E0YA 1MUSA 2BXIA 4IW2A 5IJFA 4ZCGA 1TF0A 2BXEA 4EMXA 1N5UA 2GUTA 4K71A 2VUEA 4IW1A 2XVUA 4LB9A 2V36A 3B9MA 3V09A 2Z8KA 3GA9L 4L8UA 2Z8IA 3G9KD 2OZBB 3H3AA 4ZBQA 1SB0A 2DG5A 2DYOA 2JUHA 2XVVA 3FWBC 3FWCC 4G01A 3KIKA 1IJGA 3NVMA 2BXDA 1HK1A 2BXFA 1E7CA 3M99C 5GIOA 5B5TA 4Z9OA 1BM0A 3A73A 3CX9A 1E7HA 3A75A 5IJEA 2CKXA 1MIWA 4LUFA 3B9LA 2EFHA 3V08A 5IIXA 4HGMB 4F5SA 1H5WA 2E0XA 4L9QA 2BXNA 4MBEC 5GINA 4FJCB 2NQOA 2LOQA 3GQXA 3BPJA 1LNSA 2EFCA 4BKEA 5DQFA 2OT3A 2BXPA 4K2CA 4N3ZA 4GDXA 5IFOA 2BXLA 1KDXA 4N0UD 5IIHA 1BJ5A 4WA6B 3MHSB 2DBUA 5HOZA 2AGHB 1MIYA 3GQUA 4G04A 3LU7A 4PO0A 4F5VA 4LB2A 5IJ5A 2BX8A 1TXUA 2QMCA 5D7GA 4N0FD 1VFIA 2BXQA 2BXMA 5DBYA 3V03A 4E99A 4OTUA 1FOUA 3WHSA 4F5TA 1HK2A 1MA9A 3TDLA 4Z69A 1E7BA 5FUOA 1HK3A 1O9XA 4D7XA 3SIUB 2NNWA 4ZC6A 1E7AA 3SIVB 4OT2A 2QM6A 3JRYA 5ID9A 3ECPA 3NMUA 3PLAA 4DHXB 2LQHA 3SQJA 2DYMA 4FK5B 2XW1A 2ROHA 3FNMA
chains in the Genus database with same CATH topology
2XSIA 4GG2A 3NVKA 5ID7A 4ZUXV 2I30A 3WHRA 4LA0A 2QHBA 4TQ1A 1E7EA 1UORA 2BXKA 2AJEA 3KJLA 1HK4A 1HA2A 3UIVA 4ZBRA 2XVWA 1E78A 2BXBA 4HGKA 4OTTA 3VQIA 1E7FA 1MIVA 5GHKA 4JK4A 4NAWB 3H37A 2BXGA 2DBWA 1GNJA 2KBZA 1GNIA 4LUHA 1J7EA 2DBXA 3LU8A 1KW2A 2YDFA 3LU6A 1AO6A 4C31B 4ZBKA 1NT2B 3MHHB 2EFDA 3W1SA 2BXCA 5IIUA 4L9KA 1VZSA 1LOTA 4J2VA 4W4UB 3JQZA 4F5UA 1E7IA 1E7GA 4G03A 4TQ0A 2VDBA 2VUFA 1H9ZA 1J78A 1KXPD 2XVQA 1BKEA 4M70B 4OR0A 4GDLB 4FIPB 2BXOA 5BPKA 3NVIA 1JNBA 4BY9C 1HK5A 3ICXA 4S1YA 5GIPA 2Z8JA 2BXHA 2XW0A 4GDKB 3WHQA 2BXAA 2EFEA 2I2ZA 2XMOA 2E0YA 2BXIA 4IW2A 5IJFA 4ZCGA 1TF0A 2BXEA 4EMXA 1N5UA 4K71A 2VUEA 4IW1A 2XVUA 4LB9A 2V36A 3B9MA 3V09A 2Z8KA 3GA9L 4L8UA 2Z8IA 3G9KD 2OZBB 3H3AA 4ZBQA 2DG5A 2DYOA 2JUHA 2XVVA 3FWBC 3FWCC 4G01A 3KIKA 1IJGA 3NVMA 2BXDA 1HK1A 2BXFA 1E7CA 3M99C 5GIOA 5B5TA 4Z9OA 1BM0A 3A73A 3CX9A 1E7HA 3A75A 5IJEA 2CKXA 1MIWA 4LUFA 3B9LA 2EFHA 3V08A 5IIXA 4HGMB 4F5SA 1H5WA 2E0XA 4L9QA 2BXNA 4MBEC 5GINA 4FJCB 2NQOA 2LOQA 3GQXA 1LNSA 2EFCA 4BKEA 5DQFA 2OT3A 2BXPA 4K2CA 4N3ZA 4GDXA 5IFOA 2BXLA 4N0UD 5IIHA 1BJ5A 4WA6B 3MHSB 2DBUA 5HOZA 4G04A 1MIYA 3GQUA 4PO0A 3LU7A 4F5VA 4LB2A 5IJ5A 2BX8A 1TXUA 2QMCA 5D7GA 4N0FD 1VFIA 2BXQA 2BXMA 5DBYA 3V03A 4E99A 4OTUA 1FOUA 3WHSA 4F5TA 1HK2A 1MA9A 3TDLA 4Z69A 1E7BA 5FUOA 1HK3A 1O9XA 3SIUB 2NNWA 4ZC6A 1E7AA 3SIVB 4OT2A 2QM6A 3JRYA 5ID9A 3NMUA 3PLAA 4DHXB 3SQJA 2DYMA 4FK5B 2XW1A 2ROHA 3FNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MBE C;  4WA6 B;  4DHX B;  4FJC B;  3KJL A;  3MHS B;  3FWB C;  4C31 B;  3FWC C;  4ZUX V;  3KIK A;  4FIP B;  4FK5 B;  4W4U B;  3MHH B;  3M99 C; 
#chains in the Genus database with same CATH topology
 2K0N A;  2XSI A;  4GG2 A;  3NVK A;  5ID7 A;  4ZUX V;  2I30 A;  3WHR A;  4LA0 A;  2QHB A;  4TQ1 A;  1E7E A;  1UOR A;  2BXK A;  2AJE A;  3KJL A;  1HK4 A;  1HA2 A;  3UIV A;  4ZBR A;  2XVW A;  1E78 A;  2BXB A;  4HGK A;  4OTT A;  3VQI A;  1E7F A;  1MIV A;  5GHK A;  4JK4 A;  4NAW B;  3H37 A;  2BXG A;  2LXT A;  2DBW A;  1GNJ A;  2LQI A;  4DM0 A;  2KBZ A;  1GNI A;  4I9O A;  4LUH A;  1J7E A;  2DBX A;  3LU8 A;  1KW2 A;  2YDF A;  3LU6 A;  1AO6 A;  4C31 B;  4ZBK A;  1NT2 B;  3MHH B;  2EFD A;  2KWF A;  2LXS A;  3W1S A;  2BXC A;  1MM8 A;  5IIU A;  4L9K A;  1VZS A;  1LOT A;  4J2V A;  4W4U B;  3JQZ A;  4F5U A;  1E7I A;  1E7G A;  4G03 A;  4TQ0 A;  2VDB A;  2VUF A;  1H9Z A;  1J78 A;  1KXP D;  2XVQ A;  1BKE A;  4M70 B;  4OR0 A;  4GDL B;  4FIP B;  2BXO A;  5BPK A;  1MUH A;  3NVI A;  1JNB A;  4BY9 C;  1HK5 A;  3ICX A;  4S1Y A;  5GIP A;  2Z8J A;  2BXH A;  2XW0 A;  4GDK B;  3WHQ A;  2BXA A;  2EFE A;  2I2Z A;  2XMO A;  2E0Y A;  1MUS A;  2BXI A;  4IW2 A;  5IJF A;  4ZCG A;  1TF0 A;  2BXE A;  4EMX A;  1N5U A;  2GUT A;  4K71 A;  2VUE A;  4IW1 A;  2XVU A;  4LB9 A;  2V36 A;  3B9M A;  3V09 A;  2Z8K A;  3GA9 L;  4L8U A;  2Z8I A;  3G9K D;  2OZB B;  3H3A A;  4ZBQ A;  1SB0 A;  2DG5 A;  2DYO A;  2JUH A;  2XVV A;  3FWB C;  3FWC C;  4G01 A;  3KIK A;  1IJG A;  3NVM A;  2BXD A;  1HK1 A;  2BXF A;  1E7C A;  3M99 C;  5GIO A;  5B5T A;  4Z9O A;  1BM0 A;  3A73 A;  3CX9 A;  1E7H A;  3A75 A;  5IJE A;  2CKX A;  1MIW A;  4LUF A;  3B9L A;  2EFH A;  3V08 A;  5IIX A;  4HGM B;  4F5S A;  1H5W A;  2E0X A;  4L9Q A;  2BXN A;  4MBE C;  5GIN A;  4FJC B;  2NQO A;  2LOQ A;  3GQX A;  3BPJ A;  1LNS A;  2EFC A;  4BKE A;  5DQF A;  2OT3 A;  2BXP A;  4K2C A;  4N3Z A;  4GDX A;  5IFO A;  2BXL A;  1KDX A;  4N0U D;  5IIH A;  1BJ5 A;  4WA6 B;  3MHS B;  2DBU A;  5HOZ A;  2AGH B;  1MIY A;  3GQU A;  4G04 A;  3LU7 A;  4PO0 A;  4F5V A;  4LB2 A;  5IJ5 A;  2BX8 A;  1TXU A;  2QMC A;  5D7G A;  4N0F D;  1VFI A;  2BXQ A;  2BXM A;  5DBY A;  3V03 A;  4E99 A;  4OTU A;  1FOU A;  3WHS A;  4F5T A;  1HK2 A;  1MA9 A;  3TDL A;  4Z69 A;  1E7B A;  5FUO A;  1HK3 A;  1O9X A;  4D7X A;  3SIU B;  2NNW A;  4ZC6 A;  1E7A A;  3SIV B;  4OT2 A;  2QM6 A;  3JRY A;  5ID9 A;  3ECP A;  3NMU A;  3PLA A;  4DHX B;  2LQH A;  3SQJ A;  2DYM A;  4FK5 B;  2XW1 A;  2ROH A;  3FNM A; 
#chains in the Genus database with same CATH homology
 2XSI A;  4GG2 A;  3NVK A;  5ID7 A;  4ZUX V;  2I30 A;  3WHR A;  4LA0 A;  2QHB A;  4TQ1 A;  1E7E A;  1UOR A;  2BXK A;  2AJE A;  3KJL A;  1HK4 A;  1HA2 A;  3UIV A;  4ZBR A;  2XVW A;  1E78 A;  2BXB A;  4HGK A;  4OTT A;  3VQI A;  1E7F A;  1MIV A;  5GHK A;  4JK4 A;  4NAW B;  3H37 A;  2BXG A;  2DBW A;  1GNJ A;  2KBZ A;  1GNI A;  4LUH A;  1J7E A;  2DBX A;  3LU8 A;  1KW2 A;  2YDF A;  3LU6 A;  1AO6 A;  4C31 B;  4ZBK A;  1NT2 B;  3MHH B;  2EFD A;  3W1S A;  2BXC A;  5IIU A;  4L9K A;  1VZS A;  1LOT A;  4J2V A;  4W4U B;  3JQZ A;  4F5U A;  1E7I A;  1E7G A;  4G03 A;  4TQ0 A;  2VDB A;  2VUF A;  1H9Z A;  1J78 A;  1KXP D;  2XVQ A;  1BKE A;  4M70 B;  4OR0 A;  4GDL B;  4FIP B;  2BXO A;  5BPK A;  3NVI A;  1JNB A;  4BY9 C;  1HK5 A;  3ICX A;  4S1Y A;  5GIP A;  2Z8J A;  2BXH A;  2XW0 A;  4GDK B;  3WHQ A;  2BXA A;  2EFE A;  2I2Z A;  2XMO A;  2E0Y A;  2BXI A;  4IW2 A;  5IJF A;  4ZCG A;  1TF0 A;  2BXE A;  4EMX A;  1N5U A;  4K71 A;  2VUE A;  4IW1 A;  2XVU A;  4LB9 A;  2V36 A;  3B9M A;  3V09 A;  2Z8K A;  3GA9 L;  4L8U A;  2Z8I A;  3G9K D;  2OZB B;  3H3A A;  4ZBQ A;  2DG5 A;  2DYO A;  2JUH A;  2XVV A;  3FWB C;  3FWC C;  4G01 A;  3KIK A;  1IJG A;  3NVM A;  2BXD A;  1HK1 A;  2BXF A;  1E7C A;  3M99 C;  5GIO A;  5B5T A;  4Z9O A;  1BM0 A;  3A73 A;  3CX9 A;  1E7H A;  3A75 A;  5IJE A;  2CKX A;  1MIW A;  4LUF A;  3B9L A;  2EFH A;  3V08 A;  5IIX A;  4HGM B;  4F5S A;  1H5W A;  2E0X A;  4L9Q A;  2BXN A;  4MBE C;  5GIN A;  4FJC B;  2NQO A;  2LOQ A;  3GQX A;  1LNS A;  2EFC A;  4BKE A;  5DQF A;  2OT3 A;  2BXP A;  4K2C A;  4N3Z A;  4GDX A;  5IFO A;  2BXL A;  4N0U D;  5IIH A;  1BJ5 A;  4WA6 B;  3MHS B;  2DBU A;  5HOZ A;  4G04 A;  1MIY A;  3GQU A;  4PO0 A;  3LU7 A;  4F5V A;  4LB2 A;  5IJ5 A;  2BX8 A;  1TXU A;  2QMC A;  5D7G A;  4N0F D;  1VFI A;  2BXQ A;  2BXM A;  5DBY A;  3V03 A;  4E99 A;  4OTU A;  1FOU A;  3WHS A;  4F5T A;  1HK2 A;  1MA9 A;  3TDL A;  4Z69 A;  1E7B A;  5FUO A;  1HK3 A;  1O9X A;  3SIU B;  2NNW A;  4ZC6 A;  1E7A A;  3SIV B;  4OT2 A;  2QM6 A;  3JRY A;  5ID9 A;  3NMU A;  3PLA A;  4DHX B;  3SQJ A;  2DYM A;  4FK5 B;  2XW1 A;  2ROH A;  3FNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...