3FWPA

X-ray structure of uridine nucleoside phosphorylease from salmonella typhimurium complexed with phosphate and its inhibitor 2,2'-anhydrouridine at 1.86 a resolution
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
251
structure length
248
Chain Sequence
b'KSDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIETMKQTESHAVKIVVEAARRLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uridine phosphorylase
molecule tags Transferase
source organism Salmonella typhimurium
publication title The X-ray structure of Salmonella typhimurium uridine nucleoside phosphorylase complexed with 2,2'-anhydrouridine, phosphate and potassium ions at 1.86 A resolution.
pubmed doi rcsb
total genus 87
structure length 248
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fwpA00
4ECEA 4TXHA 4P54A 2AI2A 1K27A 4F3KA 1ODJA 5CYGA 3KVYA 4TXMA 1ODLA 3DP9A 3MMSA 1JYSA 1N3IA 1NW4A 3GGSA 4OJTA 5C80A 2QTTA 4L5YA 3NM4A 4OY3A 3MB8A 3UAZA 4QARA 1YBFA 5B7PA 5KB3A 4QEZA 2OC9A 4QASA 1FXUA 1Z35A 5JPCA 1V2HE 4DAEA 4GLFA 4E1VA 1ULAA 1Z33A 4D8VA 5EUBA 1Y1RA 4LNHA 1RSZA 4DANA 3NM5A 5CXQA 1RXUA 4TXNA 4JP5A 4L5AA 1A9SA 4G41A 1PR5A 5DK6A 3DPSA 3KUKA 4TTIA 4YO8A 1A69A 4OGKA 4I2VA 4OF4A 5F76A 3ENZA 2BSXA 4DABA 1JDUA 1PR0A 3IEXA 4JOSA 5IU6A 1RR6A 4DA8A 4PNPA 1A9QA 1B8NA 3OPVA 1V45E 1V41E 4L0MA 1LV8A 3LBAA 1OV6A 4G8JA 4PR3A 1VHJA 2AC7A 4F1WA 4D8XA 3BL6A 4D98A 3KHSA 1A9OA 1JDTA 1LVUA 4R2WA 4WKNA 1JDSA 4D9HA 1ZOSA 3ODGA 4UC0A 1PR6A 3GB9A 3OCCA 1JDZA 1YQUA 1VFNA 1RT9A 5EPUA 2P4SA 5F7JA 4NY1A 1QE5A 1WTAA 3OZBA 1ECPA 4K6OA 2PGAA 1A9TA 3P0FA 1CG6A 5F7ZA 1B8OA 1OTXA 3UT6A 3K8QA 1LX7A 2AI3A 1K3FA 5CYFA 2I4TA 1M73E 3SCZA 1OUMA 2QPLA 1OTYA 4H1TA 3LGSA 1Y1SA 1YQQA 1ODKA 4JWTA 3OOEA 1Y6QA 2GUWA 3NBQA 3BGSA 4GLJA 1YRYE 4TYMA 1PK7A 1U1EA 1RFGE 1T8YA 1TCUA 3PNSA 1Z37A 1PF7E 2QSUA 2OC4A 5EFOA 2OECA 3TL6A 4YNBA 1TD1A 4BMZA 4TS3A 4G89A 2ISCA 1ULBA 4F2PA 3EEIA 2IQ5A 4GKAA 4TTJA 4OGLA 4BN0A 3FB1A 3QPBA 1V3QE 4FFSA 2HN9A 1RXCA 1PR2A 4EB8A 3OZCA 1Y1QA 1ODIA 4WKOA 1PR1A 1Z34A 1XE3A 1Z5PA 5ETJA 1U1DA 1Z5OA 3BJEA 2QDKA 3INYA 3FUCA 3LA8A 2HWUA 3C74A 1JE1A 4QATA 1I80A 5F7XA 3OZDA 4QAQA 1Z5NA 1JP7A 1SQ6A 2XRFA 3U40A 1CB0A 4YMLA 3P0EA 1A9PA 4D8YA 4BMXA 1Y6RA 1NC1A 4R31A 1SD1A 4R2XA 4QFBA 1OVGA 5F7OA 3O4VA 1YR3A 3EMVA 3UAXA 5B7QA 2ON6A 1T8RA 4F3CA 4M7WA 3EUEA 3IOMA 3K8OE 1RXSA 2A0WA 1PWYE 1C3XA 1PBNA 3OZEA 2H8GA 4U2KA 5I3CA 2AI1A 5B7NA 3FWPA 2QTGA 1Y1TA 1JPVA 5F77A 2A8YA 4GMHA 5CXSA 3PNPA 2Q7OE 4MCHA 3DJFA 2B94A 5IFKA 4KN5A 2HSWA 3T94A 1TGVA 1V48A 3OF3A 3ONVA 1PK9A 1RXYA 4IP0A 1JDVA 1RYZA 4MARA 3EUFA 3FNQA 2OXFA 1Z38A 3FOWA 1ZL2A 4DA0A 4L5CA 1U1FA 4WKCA 4YJKA 1PKEA 3KVRA 1VMKA 4NSNA 1A9RA 5FAKA 3F8WA 4M1EA 1V4NA 4DA6A 3DF9A 3DDOA 4TTAA 3BSFA 4TS9A 4BMYA 5F73A 1U1GA 4DAOA 1TCVA 5K1ZA 4LDNA 2I8AA 1Q1GA 4TXJA 3UAVA 4MCIA 4F2WA 3E0QA 1Z36A 4L6IA 1VHWA 3KVVA 1Z39A 3FAZA 3D1VA 5B7GA 1T8SA 3NM6B 4RJ2A 4WKPA 5F78A 1T8WA 3PHCA 4LKRA 1TGYA 1JE0A 3E9ZA 1K9SA 4LNAA 1NC3A 1PW7A 3E9RA 2A0XA 3OOHA 1SD2A 4DARA 3KU4A 3UAYA 3UAWA 4OEHA 1PR4A 2RJ3A 4WKBA 1SJ9A 4LZWA 3PHBE 1T0UA 1U1CA 1OU4A 4M3NA 2A0YA 4NS1A 4DA7A 5CCEA 4TXLA 5CCDA 4X24A 4EARA 3O6VA 1RCTE 1G2OA 2HRDA
chains in the Genus database with same CATH superfamily
1DLJA 1OJ7A 1SWWA 5LXTF 3PHIA 5IN4A 2JAOA 2WKWA 3PFKA 5AT1A 4ND7A 1K75A 1LD3A 1ECBA 3ETLA 1XTRA 3V4SA 4PAMA 4J4BA 1ZXXA 2RHBA 1NOKA 3BGDA 4QGGA 3V8MA 4I1UA 1SD5A 5CYGA 1EXNA 4B8ZA 1ST2A 4WZBB 1DRUA 4QQKA 1KI2A 2NU7B 3U1VA 2PJUA 2WU0A 1M6WA 4YCBA 2IEDA 3DEHA 4ZP1A 1XMOB 3NWEA 1F5NA 2AYXA 2GXQA 1FBNA 2QQ0A 2WUVA 1K3TA 4HDOB 4KO8A 4UD2A 3WMXA 4BCDA 2P2CA 3NR2A 2CL6X 2Z98A 1MUUA 4INAA 5AW7A 3FTFA 3IYLW 1SGWA 1AXGA 4DCJA 4UOZA 1PG0A 3ESQA 2ZVPX 4GNRA 1V5FA 4DDKA 3UQZA 4B3CA 3GBVA 1OFHA 2JA1A 1FA9A 3R3XA 2I3ZA 1N5LA 3CT6A 4A4DA 2JD2A 2IUEA 4JVSB 2YJTD 2W0MA 4OY3A 3UAZA 1Z73A 1JKJB 4FDAA 4MRPA 3VV3A 4II2A 4R2LA 2PJZA 1AK9A 3GCXA 3AHEA 4IJMA 2FEKA 2PL9A 3HC7A 2AG5A 2EGUA 3H99A 2J9RA 5KAPA 3A1SA 1TZCA 1CZLA 5JAZA 4FYPA 2J5BA 2NZJA 4XRRA 4R71A 2P8JA 5BQPA 2W6JD 4NULA 1JU4A 2PRYA 4N7BA 1FFHA 1X87A 2HWWA 2J9YB 2XMDA 4P34A 3RUAA 5A03A 3KJQA 3EGCA 1AS2A 3EXHA 4ZVOA 3PA8A 1XCMA 4K9QA 1FRQA 4TKVB 1JEOA 1BEZA 2JI7A 3VHLB 1WAMA 4DDWA 3IIIA 3L8FA 4J0JA 5BRNA 1JHRA 1E7WA 3RASA 3K53A 4W9RA 2JLXA 4ONEA 1QAQA 3OLQA 2XCRB 1RSZA 5BMVB 1EVIA 2OSVA 2IZ7A 3KDAA 3WJAA 4D57A 4Z7QB 3ZUGA 4TXNA 4IWNA 2OMEA 4I6GA 4NK4A 2OA0A 4QT4A 5JH7A 3HDGA 5JZBA 1KARA 4CIYA 2PRZA 2IITA 2QPTA 5LD2B 4NWIA 1WDLA 1VL2A 2N1BA 2B4AA 3U48A 4W5HA 5EYPA 3WLOA 1N2IA 5AW6A 1DBSA 1RM5A 2R8PA 4OAPA 3LBHA 2JLUA 5IYZF 1FSPA 3SQLA 5BQ5A 3GP5A 2O54A 3SDBA 3JCZA 3PXAA 1VL1A 2FF5A 4UW9A 1TRKA 1M66A 2FRVA 4XGQA 2FI1A 5DFAA 5G3ZA 2PLAA 3KKNA 1QV9A 4AUMA 1OGYA 1WSWA 2Q49A 3KYBA 4J0CA 4BX9A 1L8OA 2N9UA 4IDNA 5BNZA 1OXTA 3WWZA 3L3BA 1R9MA 4IPTA 3ILSA 1GPJA 1ZITA 4IHJF 1YFZA 3VYUB 2ZBRA 5THQA 2C61A 4ZQFA 1E6EA 4P7BA 1HK7A 2HLNA 4BKQA 1VBMA 3AWIA 3O7WA 3PUKA 5ALFA 3N2LA 2GJ4A 4IDPA 1AQNA 3O82A 2GZSA 4G1EB 5K3SA 3OM9A 4ETMA 5ELXA 1KJWA 2CE2X 3HFRA 2PUGA 3ZWCA 2BKLA 3H9GA 3BEOA 4MRSA 1YUBA 3KEOA 5INTA 1VIDA 2QE7D 3WIEA 1BVUA 1OLUB 3A3KA 3BL6A 3I1JA 3AHDA 3IVRA 3KYIB 4L4SA 5JBNA 3EOAI 1P0PA 2G04A 2Y0EA 3GT4A 4HZIA 1J1UA 1P6UA 3FKSD 1KK3A 1HT2E 4L4YA 4LDRA 3ABQB 5GWXA 1E9CA 4QXQA 3V97A 1JQ3A 1N77A 1F51E 1HQCA 1GYPA 1BD3A 3F2IA 2B35A 1JIUA 1PQPA 2IYUA 5KQRA 4HAXA 3Q0EA 1E6LA 4PYKA 2OHFA 3MJRA 5EZYA 3ZLBA 4EI8A 2AQHA 2IIPA 3AHFA 3ODGA 1I4OA 4LKOA 3E61A 3OJCA 3W4IA 3ABIA 1RLOA 2XYPA 3E9MA 1QTRA 4NK5A 1HNNA 3DBHA 1RT9A 4ZI7A 1XO1A 2HSJA 1WHTB 1EIWA 3AFOA 3H0KA 3UA3A 2IXFA 2JLAA 1VLQA 4JHLA 1U99A 4Q7JB 2VDNB 2WFMA 3OE7A 1NW9B 4KXYA 5CLJA 1UC5B 3ZLTA 2F43A 3MT0A 1N7JA 4MWTA 3WK8A 1L5HA 1FYWA 4HWGA 4K6OA 2ZPUA 3P0RA 4XDGA 3ZWNA 3QF4A 3P0FA 9ATCA 3BILA 2AR9A 3PRJA 3G3EA 4UNSA 1JG7A 1ZOOA 4MV5A 4DG9A 4Y18A 9ABPA 1GPDG 2F4NA 2G07A 2AEMA 4CLRA 4JYBA 1H69A 5AOCA 4RTSA 5T5QA 5CYFA 1YQWA 1XK6A 1ONOA 2OMKA 3ND8A 2AR7A 4UDNA 1V25A 1ID1A 2FPKA 3LQ4A 3RFFA 1VJCA 2P6UA 1XMQB 1OB2A 3DEAA 1J2RA 3O4RA 3BHJA 3WYCA 3CKKA 5BYJA 3RSFA 5AI4A 1SKUA 1UPTA 3R7WB 3C3PA 5ISMA 5B1DA 4ZEXA 1OXXK 3JVDA 2X0DA 2FFBA 1FL9A 1XTBA 3P9NA 5E8JA 2B9VA 2QAGB 1TT7A 4JNCA 1XN1A 1UFRA 4XA8A 4X6LA 4YRZA 5C5CA 5GONF 1LJ8A 1V35A 3MS2A 5SY6A 2B1GA 3RK4A 5H82A 3HKDB 4IXMA 4MP8A 1L7BA 4ZU1X 1P2SA 2C9ZA 3JWPA 3UWDA 5BVHA 3ZU5A 2XE7A 1JG1A 1P45A 1UBRS 1LC0A 4D4IA 5ARBA 1OBCA 4L78A 5DHUA 2DWUA 3A4LA 1XDDA 2WIGA 1OI3A 4AP6A 2PZLA 5DI3B 4UCQA 3GN1A 3GLQA 4JI7B 3PQFA 4JBWA 4JBNA 3WQHA 3FCEA 2EZTA 2VHCA 3JRXA 1UMDA 4KQXA 3TOCA 3W9SA 4IS2A 5DNUA 3UB2A 1GPWB 4F2HA 5E4TA 2YV1A 4CGYA 3ZY3A 4RADA 4E33A 1ZUNB 2J7KA 4BP3A 2H1IA 3NHFA 3F9IA 4NOKA 3WRXA 4PF1A 1IBKB 4I4TA 3R3UA 5K09A 3T7DA 3BQNB 5ANRB 3I1FA 2OFPA 1JB1A 3QKTA 1HC7A 1W4ZA 2J9XB 2QZSA 4B3SB 4G81A 5JS2A 4EAAA 4M0CA 4YHBA 4MB0A 2BFCB 2X9GA 2ABWA 1HTTA 1E4OA 1DRVA 1XZFA 2APJA 2A5FA 2FHPA 2MDTA 3DT9A 3IXLA 4DA9A 2WP8J 2LKDA 2O2ZA 1AH2A 3GROA 4UVGA 3T4UA 5FUVA 1I32A 1KJ8A 1J8YF 1P0IA 1PWXA 3CJQA 4TQ9A 3TVYA 5LD2C 2JJ2A 3CV3A 1U31A 2P7IA 1AB6A 3VHXB 4XDYA 4DDMA 5H0IA 1QPBA 3G8BA 1GSIA 3W4KA 1PX0A 3IPCA 1MO6A 3CNEA 3WYGA 5KREA 3MUNA 3ANTA 3IIKA 3R0JA 1KWKA 3AUKA 3NHJA 4D82A 1YVDA 4KQIA 1PJTA 1DAFA 5LZ5A 3G2QA 4DJEC 2R8RA 3DO5A 4D3SA 4WKOA 1RRKA 5EZ6B 3EQ9A 1K2WA 1Z34A 2A9PA 3HXLA 3Q7IA 2ORED 2DT5A 3CLSC 1Z5PA 1XZCA 2K2QB 1EHIA 2XI4A 2Y0PA 4I46A 4EJ6A 3N86A 3Q5EA 1F38A 1Y63A 2I34A 2PKQP 4JA0A 4MQEA 3SZLA 4BJ3A 5HFAA 1E4VA 1YNSA 5IM4A 1JWLA 3R6WA 1XG5A 4F6CA 3KQNA 4BWYA 1XKQA 3AP3A 2Q4EA 1Z4PX 3K72B 3QUQA 4PFJA 4HMPA 4C0HA 4DRYA 1Q0PA 5FOVA 4WOBA 5KOJA 3T3NA 1W4LA 4DMCA 1PHPA 3MTDA 1YMQA 3OZIA 1G9SA 3LKDA 5E6SB 4FLMA 3CLKA 2FWIA 4FONA 4OKIA 2J5RA 3A1UA 1XQVA 4A0FA 2FW6A 2ZM5A 2ONKA 3A70A 2BKUA 2OILA 2CDCA 3EIHA 4LSWA 1OFUA 5IK2A 1F3LA 1LDNA 1OX5A 1TU3A 2E4WA 2XQGA 5CNMA 3DMFA 4YH1A 2YZ2A 1B1CA 5U1PA 6REQB 2DETA 4WUTA 1JHAA 3DL2A 1U1IA 2NGRA 2DX7A 1QGUB 1JR4A 2GWRA 2R7KA 3EOZA 1SXJE 1Z16A 1V3TA 4MVJA 3SYKA 4R2XA 3D7LA 1KQGA 4B34A 3A06A 3OTWA 1ADGA 1I2BA 2HA7A 2OSBA 4GMFA 1WZUA 2EQBA 3QLUA 1NVWQ 4X7RA 3V4FA 3PK0A 3WKEA 4BO4A 4UVEA 4CDRA 4DS3A 5HYVA 1MN6A 1MVNA 5EP1A 3TINA 4YJ3B 2IWHA 2XUGA 4XSVA 3BWXA 2FZWA 4EPYA 5CU7A 3RC3A 1ST3A 3PA6A 4KMMA 4RF2A 3TD2A 3ON5A 3PQ3A 5AJZA 6ADHA 3V9PA 1P81A 3G0DA 5FL7A 2V55B 5IXYA 5BT9A 5FKJA 3G6KA 1X80A 1H2YA 2VHEA 2YHSA 4HDQB 3T0IA 3SM3A 1RE0A 3LWBA 3E35A 5EHXA 3UUGA 3FOZA 2DY0A 2VTBA 2QLMA 3NAZA 1Q74A 1GQOA 1XA3A 5IS2A 2G71A 2A0WA 2CJFA 4ZALA 1UBOS 2PD3A 1ULUA 3V7YA 1YHZA 4R4JA 4RK1A 2UUBB 1AQLA 1YS7A 3MK31 5CH3A 4U2KA 2ZJ2A 3A7EA 3OZTA 4OA8A 1E1DA 2VNJA 2PFKA 3GOHA 4FVTA 4DV0B 2P0YA 1XTKA 4MUBA 5CFMA 1KDPA 3N2KB 3R2JA 5F5NA 4N01A 4AY5A 1TYZA 3NAQA 2BWJA 3OTIA 4ZPXA 3LM8A 3C6KA 4LXHA 3TN7A 3CUKA 5ITVA 1TM4E 1YNOA 5UKDA 1XZLA 2LDBA 3GUUA 5J2UB 1USIA 2ZSDA 4Q1BA 1DKRA 1QTIA 4DIEA 1JA9A 3CLRC 3RVJA 3RRBA 2EARA 2ZJZA 4PZLA 4JC0A 2ECFA 2VYVD 3Q2OA 5E7JA 2Q7OE 4DBLC 4YMHA 1EU1A 3GP3A 3AXSA 4NHEA 4CPDA 1V48A 2QG4A 1KXZA 1C4OA 1Y48E 3H2GA 1B76A 3ROTA 1D7AA 2CVOA 4KXFB 3O5AA 3NGLA 3V80A 3K32A 3QLVC 3SXUA 1PYGA 2QT0A 2C3OA 3CLTC 2GESA 4GRDA 4MJ7A 1Z38A 4PSCA 2EX0A 5ALJA 2WFZA 4C5BA 1M1ZA 1XXHA 1SCJA 1SUSA 2VEOA 3GJXC 1IULA 4H7DA 3VBCA 5JS8A 3B1JA 3CMMA 1V43A 4K40A 4BZZA 3EISA 2A9FA 4Z54A 5K4HA 3T1QA 3DXZA 2XUZA 1JJAA 2JEOA 3KZMA 1G8YA 2BFBA 2R6JA 5LZ4A 1UM8A 1LBTA 5P8WA 1DAGA 1FNMA 3Q9LA 4LI3X 3AF1A 3WLQA 5AW3A 4NAVA 5DSZA 4EY6A 1TNDA 1JHZA 5JVDB 2O8EB 3AX6A 4S35A 3ZQKA 4ER0A 5IVIA 5IDXA 2QW0X 1ZQ9A 1KH2A 1FVFA 1H5NA 2A2ZA 4FGKA 1H8HA 4GS5A 1Y4ZA 3TYXA 3COZA 1X1TA 2OO3A 1IJBA 2BL4A 3GHYA 2VZ8A 4IXTA 4FZ3A 1UADA 1HT1E 1ZGJA 3BSFA 3GN2A 2NU7A 5D5PA 3T94A 1NLYA 1QE0A 2R00C 3CR3C 3P9IA 2PKQO 4GD3Q 3LBYA 4TKLA 3RSGA 4AS3A 1UCFA 3AI7A 3RJ5A 5LP6A 4MV7A 4X95A 2PMKA 5EY5B 3T3EA 5TLSA 1FDOA 3BMCB 1R4ZA 1NVVR 3UFXB 4WZAE 1EZZA 1BCRA 1EFCA 4BRZA 3TCNA 3FDXA 2WILA 3AYZB 4IIBA 2VNAA 3D7SA 1E9RA 1G1MA 1M75A 2WF8A 4BIMA 2ZUCA 1R16A 4DIOA 2R8BA 4LCBA 3HXMA 1ADCA 3ICEA 1RYMA 1USVA 3ND7A 3ME5A 3MMZA 4RHFA 3V1LA 3IP9A 1C5KA 3A9UA 3D6TB 4ESOA 1MB2A 3TQTA 1BH2A 2FUG1 2O2SA 3DCJA 4K6FA 4A8HA 4QL3A 1JLLA 5DP1A 4UCFA 2WQ7A 4ZFNA 3I9OA 1Q5PA 4G1UC 1ZGCA 3KUDA 4ID3A 4BTEA 4JSRA 1LPMA 3FFBA 3IBYA 4KE7A 3X1JA 3W79A 2O7RA 5TGTA 1O2DA 4HWOA 4YP6A 2XIQA 3K6JA 3M70A 5G4LA 3WLIA 3FPFA 4LNAA 1ADYA 1J24A 1GTJ1 2Y68A 1YR1A 4BLWA 4UUPA 1VJGA 1GFSA 3KU1A 4R1NA 3WJ2A 2VH1A 1V1RB 2FMFA 4ZYUA 4YQZA 1FP2A 5FYDA 5FJJA 4KACA 5C4MA 4JLDA 3OOHA 2HA4A 2VN8A 5DYGA 2ZUEA 3G5LA 1YDMA 4WY8A 2C7PA 1KZGB 2ZYGA 1Z47A 3OUTA 4NEQA 5DU2A 4A82A 2XGOA 4PSUA 3A1DA 1L5MA 2YYYA 2QORA 2I4LA 4ME6A 4DCGA 4AQ7A 1WUYA 3AKCA 3M5CA 1CJBA 2IUTA 3NHLA 4G5XA 3O8CA 4GG1A 4LZWA 3V2HA 4M8SA 3KWLA 2REOA 2E0IA 1XJWA 2IYEA 3B48A 1OT3A 1NWHA 3TF5A 4LRTB 3E53A 3FPLA 1WD5A 3GRYA 3KAKA 4HQNA 4AF8A 3D64A 4FMDF 3WOHA 4CKCA 1GG5A 3D3JA 3VDXA 4CI0B 3L43A 2GLTA 1UJBA 4BPRA 5KSWB 2PT9A 4ZV9A 3GUVA 1EDDA 1R12A 5CNJA 3T3DA 1L5RA 1T0JB 4ZIRB 1PVOA 4NEGA 3IAEA 4LRWA 4QICA 5CT9A 2DUWA 2EQ5A 1ISJA 5EHZA 2WYVA 1AJEA 2AQIA 3MTAA 4UU0A 2X5KO 2VJPA 3O4IA 1UPXA 2PO5A 4LXGA 5DM1A 3RS8A 2CJWB 4DM4A 4U8GA 2YS6A 4JUBA 1V9LA 2AN9A 5ALEA 5E7QA 1E3LA 4MPPA 1WDTA 1IU9A 1ODJA 2O4CA 1X2EA 2WTNA 3ETHA 3QW2A 4ND1A 5B1IA 3ZZNA 1Z4QA 5IASA 4AYWA 3E6AA 3GFQA 1V1MB 2H4YA 4DF3A 1PZMA 3PGKA 2ZYIA 4WDRA 2QV0A 5YASA 1AE1A 2HSEA 2WHYA 3DD5A 1SXJB 4HXFB 1B14A 1WMAA 3S2IA 3TLYA 1XWWA 3C6QA 3GLGA 1JNYA 3T3GA 2UXBB 4KR3A 4OSOA 4CF5A 5IABA 1CUDA 1FC0A 4LJ6A 5F1YA 3L7DA 4MP6A 2WU1A 3ZKWB 2EAUA 3ICWA 3ELBA 3L5OA 3EXEA 3P9KA 3LDAA 1L1RA 3LO5A 2XQJA 5AK0A 4WBXC 4CF3A 3STWA 4M83A 3E9DA 3RVMA 1L1QA 1KC3A 1RAGA 4NV1A 4WERA 2G40A 2H48A 3MBKA 2CNWD 4MDYA 3W4JA 4OQZA 4AN1A 4BTVA 7YASA 4FDMA 4ZYZA 3REQA 1Z4OA 4IMRA 2DHRA 3UANA 4M22A 2PANA 1ZK4A 2PWPA 2Q0SA 2VPTA 3CW9A 1XVUA 5CM9C 4DUGD 2BGWA 1FRZA 1Z22A 2AMYA 2VJAA 5FL7D 1JJIA 3RNOA 4M1QA 2HJVA 1B6SA 2GI4A 1S96A 3LSTA 3P9SA 1QFZA 1U2ZA 1KP9A 5KWVA 1A4UA 4FDVA 4MV6A 4F8YA 4O2RA 4H31A 1VCOA 5H1YA 5F51A 3EG5A 4BLVA 3QVGB 2QTZA 2Z3ZA 4DJJA 4E70A 2BF4A 3C7KA 1BD4A 3CSUA 5CNIA 1UBTS 5D1HA 2XYHA 4MIEA 1TCCA 1ZFNA 4N54A 4IHKA 4M76B 2J4FA 1QK5A 5TSDA 1VKNA 3TXXA 2WMDA 2YHBA 3L0IB 4N5NA 4W4TA 1RRMA 2C94A 3JATB 3MINA 4TMVA 1G6Q1 4TKUB 5E6RA 3RAEC 2PG3A 4H3KB 4ZVKA 3IAM1 3QE0A 3JYLA 2IZZA 5JMWA 2WSIA 2D3WA 1T25A 3HB5X 2RGYA 3RE1A 1R6UA 2ZDQA 5EN4A 4BE7B 3PJRA 3ZX5A 3B1WA 3AEQA 4EY5A 4I8DA 1UBJS 3B3QA 4B2YA 1G66A 4LSMA 4XD7D 4ZV4A 3MHTA 1CUHA 1DQRA 1Y8RB 1GFIA 2GWHA 3LGAA 2FFQA 1J8MF 1UWCA 2G72A 2II6A 4HN2A 2A30A 3ETGA 3SP1A 5A3VA 4MYUA 1A72A 3IOBA 3JRWA 3P97A 4TKMA 3ZXUB 3EARA 4P98A 1GPLA 1X8LA 2NZUG 4U7TB 4QELA 2A5JA 5AXAA 4B3FX 2QZJA 2DB3A 1UPFA 1CJUC 3LCVB 4DDHA 3U3RA 3A37A 5LIRA 1Z5GA 2HBZA 4TLAA 3RSCA 1H2RS 4YT2A 4R40A 3R9WA 1YS6A 3R9XB 2ZUFA 2OHXA 3B85A 2BAGA 4DLKA 2RBEA 3EQ8A 5K5EA 3VR3A 3OD5A 1UAAA 2V1UA 4QE3A 3RNLA 2CDAA 4Y1RA 2Z5FA 2WYHA 2JI8A 3VU3A 3L07A 3HVJA 4DYVA 1G9XA 3I4FA 4PX9A 3L8CA 2AV6A 1DDIA 4JJ8A 1FNBA 3OC6A 4PXSA 3V3KA 5F3WB 5L7TA 1TUIA 3FCXA 2IEYA 3O8LA 3Q7SA 4GP7A 2W2LD 1HO3A 3C8UA 3CGWA 3GT3A 4KX5A 4XQEA 2IWRA 5HQTA 1ZBQA 3PLAE 4LNUB 3ZJ5A 3C24A 1BXKA 5BPHA 1QWOA 2NXCA 4RE6A 4BHTA 1H4SA 2AJDA 3GUZA 1P9WA 3PNOA 3Q8XB 4RH0A 1XC7A 1KAOA 3HCPA 2FE1A 2HCRA 2VRWA 5FQOA 5IUKC 1L7XA 2BIFA 2XDAA 2F4VB 4KPYA 3D6NB 2YV3A 1P0CA 3ICVA 4IV0A 4YAOA 3OLCX 3EUAA 1LFAA 1LLFA 4N0DA 2PGAA 4A0GA 4EABA 1ES9A 1H3NA 2V7PA 4C4TA 1DBIA 4F5YA 2W8ZA 5JO9A 3JR3A 3FCUB 4J16C 4NU8X 2ODNA 3ABRB 3DDWA 3E5NA 3DBRA 5DYYA 3RV3A 4YAKA 1EYZA 5BWOA 1EVLA 4JDPA 3ZZ1A 2QM8A 3L9WA 1VFPA 4BU0A 4F06A 3RC8A 3IP1A 3JAWA 1BXGB 1CEYA 3A11A 1EBFA 1N3LA 2GM5A 2JGDB 4HB4A 4JROA 5ENVA 1R0BA 4YUXA 1T34A 3V48A 1KO8A 4WINA 1BZYA 2QE6A 1A77A 2YWXA 4BV8A 1PV2A 3PXCX 5B1EA 4XGIA 4Y2XA 2E48A 3HO8A 4NBWA 3EXEB 4IOKA 4XKJA 2F1JA 1PNVA 1J06A 4GXQA 3D02A 4P3OA 4UTVA 3CTPA 3L7MA 2QX7A 4AF7A 2K2WA 3BCRA 3KO8A 1LRKA 2DPGA 5DTEA 3UKJA 3BBLA 4YFYA 3QVWA 2I7CA 4H3HB 4OL9A 3YASA 1CZUA 1GQRA 2NOAA 3MRVA 2E21A 1KEEA 3QG5A 3UJNA 4L9AA 5IRCD 2JLBA 4EHFA 3BXFA 2DE0X 1E0JA 2I1QA 4WSOA 1RHQA 3H5NA 3MWLA 3PFBA 5B58T 3VR4H 1H6BA 3CZRA 5JEDA 1USKA 1FZTA 3R5HA 4YRBA 3MOIA 2JGRA 1T2CA 4DV2B 1QGED 2VBCA 1TTTA 3DZDA 4YFVA 5JSYA 2ATVA 4A0RA 4TV9A 4ZEWA 4OVKA 2GNPA 4IZIA 1K4KA 1S7GA 4LJKA 4QZVA 3EC2A 4Q1EA 2P9FA 2Q1YA 1ZAYA 1B6RA 4E15A 1C1YA 4WEOA 1PV1A 1AKMA 1Y5NA 1QVAA 3WYAA 4NZNA 3OEEA 2KM1A 2QZZA 3GW8A 4XVCA 4RGYA 3IUPA 2F8MA 1P33A 1V7ZA 1MC4A 1JGTA 1Z15A 1I7NA 3DR3A 4ZD6A 3UWOA 3ZC3A 3CF4G 4N6OA 1NY6A 5CAEA 4RKWA 2X41A 16PKA 1O6CA 2IQ5A 3WKDA 1M2JA 3P71T 2O0MA 4TTVA 2OAEA 1S8AA 1DJPA 2W6MA 1OZ0A 3NTRA 2J0QA 4MWDA 5IDYA 4FYYA 1UM9B 3LTEA 3DC7A 2CUKA 2YY7A 1Y4SA 4L74A 2OZLB 3L46A 2ATCA 1J6UA 2O2DA 4KSYA 4DNFA 4Z1MD 2YHIB 5KS2A 1CR6A 1ORTA 1SOVA 1WVIA 1CRZA 1Z6YA 2W37A 2WHPA 1V37A 1UFVA 5B6PA 1UZMA 2KMLA 3IAAA 3QVMA 2ZSEA 4FNAA 4QECA 3RM3A 3N59A 2WKSA 1TK3A 3N0XA 5AVJA 3SX0A 3W8NA 4CKBB 4BNUA 1VP9A 2X7HA 3ZHSA 1XNHA 5GP1A 4BV3A 1N2XA 1QVVA 4QUEA 4XAQA 3UJ8A 4DCMA 3K9GA 1E69A 3I61A 1AKUA 5TS3A 1CDDA 2VWQA 4FZ5A 2PX3A 3PGXA 3AZOA 1E2JA 2IS2A 3O8OA 2EX4A 3EQ2A 4LIPD 1BXZA 1LBEA 3ETEA 1M1XB 1OZFA 4MH0R 5SZJA 5BR1A 3ZR4B 5CFPA 3VDMA 3CR8A 1IZ7A 4QUGA 4YASA 4L2IA 1UWVA 2WWXA 1YR2A 1GSHA 1ORHA 2A9JA 5FPSA 1D0SA 1XN4A 3HKCA 3KT0A 1KYVA 2XSZD 1U28C 4I14A 1JT2A 1KEWA 3JZFA 4QU9A 4P6VF 4RXTA 4C3OB 4ENVA 2ZZKA 3SZMA 2WAXA 3O94A 1YB5A 2J4CA 5K8CA 1K8XB 2IPNA 5C8YB 3NKLA 5B57C 1JDNA 1MTZA 5A62A 1C41A 1EZ1A 2ACWA 2LIPA 5EXEA 1L7MA 1XJ5A 3B1ZA 3ZLUA 3E3OA 4EDFA 4R31A 4FCVA 3T4XA 4ZHQB 1OLSA 1MABA 3B1KA 3LC0A 1JBEA 4KREA 1U5CA 3NH6A 2NU8B 4EKNB 3Q1KA 2FGKA 4FSHA 4G8BA 4CLXA 1KFBB 3NEYA 4IBOA 1WCXA 2EZ8A 1IK6A 4NCKA 3ZGOA 2V4UA 1X15A 4OHPA 2LRHA 3TNDA 1XZPA 2IGTA 2QN6A 4GO1A 4DQKA 5GOZA 5A9RA 3P94A 2DLDA 2BELA 1YR3A 1KH1A 4KI0A 4MVXA 1CDZA 2DWOA 1FP1D 2UVDA 3WWPA 2X14A 3SJCA 2B61A 4G0QA 2H08A 5DKFA 3W6ZA 1Y9ZA 4EJSB 5KYXB 3GLKA 4YEDA 5DEOA 3RFUA 4TZ0A 4LRYA 5DWVA 1NF2A 3FB4A 3O3OB 4Q82A 2WFLB 1JEQA 3OHPA 2XXBA 4MRNA 1XAIA 2FH5B 2HNBA 1D1QA 5AUQA 3UH1A 2OGZA 3K0FB 4U00A 1C3XA 3IHLA 1MT3A 1TYCA 3QKSB 1KSGA 5JRZA 3PS9A 2BGUA 2EGHA 2V7BA 1KU6A 1ZVKA 4PEVA 5EQTA 1NUSA 4JVOA 2WIJA 1TQ6A 2DHQA 3P2YA 3R3JA 2BFWA 1MT0A 1ZIDA 1OI2A 1N57A 4IGIA 4KE6A 2XA9A 4US1R 2AK3A 2KS6A 4O59O 2DM6A 2XEXA 4IIJF 4QSMA 4PYOA 1MAWA 2LR0A 2A3RA 1UBLS 2PVSA 5HOEA 4NHOA 1TEZA 1GRQA 3NFRA 1VSTA 2EFDB 3LO8A 4UPEA 3I4CA 2PWAA 1KKUA 5B3LA 4PIMA 5CXSA 4FR2A 2GTPA 5HFJA 1TIKA 4V3BA 4HLDA 5CB4B 3BHNA 2K87A 3A0RB 2EBHX 5HBRA 3INTA 3OQ6A 1L5NA 4MR8B 4AIRA 4PPNA 4RQAA 5CCXA 2VT7A 2FQWA 3HU3A 3CS3A 3RSQA 1EHYA 1E3JA 2VDRB 2OYSA 1I1QB 2WTBA 5ALMA 4KIJA 4BFZA 1M83A 2BCEA 2AD1A 4RENA 5KX5F 1RXYA 2A58A 2JFNA 3BICA 3IX7A 4YBRA 2CVFA 1OWOA 3DL4A 3G2KA 3WICA 1M5UA 3EUFA 3C98A 1SVIA 3F67A 3LJKA 2RG7A 4H6XA 1IRXA 2WD7A 3HLKA 4OLHA 4A8JA 5AD1A 3OQBA 3HJFA 5KAMA 4PYLA 4LJ8A 5THXA 1E9BA 4TWRA 1ORDA 2CLOB 4JNKA 1NJFA 4BOYA 4X8OA 1IONA 1P9OA 1COWA 1U1FA 2NTJA 2VNSA 4JLSA 1KE2A 4WXYB 2V9ZA 2BBWA 5CDFE 1SU6A 3LXMA 2Z1NA 1DIOB 2EZ4A 4GQBA 5H83A 3K7EA 4IDEA 1V11A 1W4BA 4EP1A 3B12A 4PE5B 4ZT6A 2ZJ0A 4CKEA 5C81A 4S3MA 3ER8A 1H2FA 4Q9NA 3TKYA 3GCWA 1ETHA 1LK7A 2A9QA 3F6EX 4EHAA 2AXPA 1ONSA 4CEJA 4ZRNA 3DDOA 1PT9A 5IN5A 2ZJBA 1IHPA 3C6YA 3IEUA 1X7DA 4HS4A 4O4HF 4YY3B 4V38A 2XGMA 2XZLA 1NQ5A 4ZCMA 1E2NA 1YZTA 4BP9A 1VLVA 1WEHA 5EIWA 1L1EA 1VP3A 4KWCA 3ELDA 2JFWA 1S2NA 4FD3A 2I4OA 5K1ZA 3VHQA 3WGJA 2VQFB 3OIUA 2MT9A 1OOEA 5BSTA 3UT5B 1CZKA 1FRNA 3U5TA 4GX5A 4RCVA 2D1SA 3G0BA 2CN1A 2YJ5A 2BKXA 4NF2A 4YN3A 4DR7B 3HA5A 1UP7A 1XYYA 4NNOA 4Z4QA 4GVLA 1HZZA 1L5ZA 1ZN7A 1WW3A 2WU8A 1GXSB 1LNQA 3AW8A 2BD0A 3E1SA 3MOSA 3U7RA 5FULA 1THTA 3SVZA 1N33B 2RHMA 4RIEA 4BGEA 1XRPA 2QLTA 3ZWMA 3VSCA 2A1IA 4KRYA 4BVJA 2C78A 3HV0A 3FLBA 2ZETA 2FAXA 1J1IA 1D4AA 4PR0A 1L5LA 1UK9A 2C7QA 5LYJA 2W2VA 1E5VA 3NM6B 4LOAA 4F2DA 4MA0A 2Y93A 1AGYA 5ALPA 1G0NA 4V02A 3UT5A 1ZJ5A 1RP7A 3M6IA 4LCJA 1Y3FE 1Z7YA 4RD0A 2V6FA 5IZCA 1SIOA 3PWZA 5TS2A 3WBJA 1MVOA 3QVKA 2I2DA 3CKYA 4TLCA 3BQ9A 1WCV1 3PTLA 1Y9JA 2D54A 3K8ZA 1PQUA 1SXIA 2ZYRA 4HVTA 3WRYA 1W73A 3E9RA 4GLOA 7ADHA 2R1TB 1EX6A 1AB5A 4C21A 4UUMA 3KNZA 5CHEA 3EASA 4GSKA 4HH1A 3EFEA 3TM4A 3S44A 4LMPA 2H85A 5B37A 2G76A 1W4RA 2G82A 4S1OA 5ENDA 4AZWA 2O9JA 1EFVB 2H5EA 4QAJA 4MKIA 1HFKA 2ANBA 3W5SA 3T5TA 1ECGA 2WWTA 4F3RA 3EPHA 1I24A 4V2IA 4QOSA 2VPWA 3KQQA 5EJ7A 3WKCA 2GN2A 1BS1A 2BUBA 3EVTA 1IOZA 1F5SA 4M87A 4GP9A 4ZJZA 1L5GB 1YB6A 2AW3A 4H4EA 3CBGA 5FWDA 4BO8A 1E3EA 2FLWA 5HZMA 5J4VA 1DC5A 3MB5A 4Y2VA 1IB6A 2ZIXB 1LBSA 2BFEB 2OAGA 3C14C 4JN6B 4O2LA 5AO9A 1U6KA 1PTJA 3RGWS 4DLBA 3C2QA 4HGOA 3IVCA 3R5SA 2QX6A 4ECEA 1TUEA 2MYPA 4RZQA 4GI3A 3ZTWA 2WC1A 5EI5A 2IYWA 2PL5A 3K5PA 3EGDA 3X44A 5I51A 4IIJA 4EH1A 2ZM6B 1UEJA 1TF5A 4MGEA 5CVDA 1ATZA 3DYVA 4Q7EA 5EKDA 4C87A 2GXAA 4K6MA 4JH0A 3R8CA 3NLLA 4E1AA 5E9WA 5AW1A 4ARCA 2P30A 3O8BA 5LLDA 1GCOA 3TLEA 3U31A 4CDNA 3R40A 2PUEA 2WA1A 1K63A 4MYHA 3VVCA 3ZE2B 1KWGA 2F8TA 4AJPA 4Z9BA 1GRNA 3OA2A 3T06B 3UICA 2H0AA 4EZBA 3JVEA 1I7SB 3W7VA 4UXHA 3P20A 1ZM9A 1HNXB 2WWRA 4RSMA 4AB1A 4MV4A 5FD8A 3KT3A 3LUGA 1SC9A 1L5SA 3KX2A 1IJFA 4HWRA 4Y2QA 4JBYA 5E0KB 5HGJA 4EGCB 5KYUB 4O1MA 2BTQA 1XALA 1Q2XA 4IF4A 1B0ZA 1AXEA 3LQFA 2OAQ1 1U80A 5AXBA 5B36A 5AIBA 1P3DA 4ZI2A 1X9GA 4QASA 3AQIA 1ZD5A 3OQOA 4N76A 3RVDA 4CQJA 1P74A 4BQQA 5JADA 4OJMX 5B6IA 1O9HA 3D1LA 2GILA 3OT5A 2CYBA 3VNSA 2D8MA 4U6NA 4DCSA 1EFRA 3AM4A 2EJWA 2TYSB 2C4UA 4U1RA 2DFKB 2WQZA 4TL9A 5FIUA 2O5RA 1U98A 1P1IA 5JD3A 5KPJA 3F97A 3KL4A 4ZQCB 1EEXB 2V74B 3NM5A 4M0LA 4TX1A 4KXUA 4YO7A 3S7TA 5JS7A 2IHNA 1M74A 3R0XA 2X0JA 2XZTA 2OBMA 3GJSA 4BVAA 4Z9AA 4DCCA 2VP4A 2H18A 4LPKA 4DQLA 2YVAA 2QXTA 4Y2UA 1E2BA 3TBKA 4ZHQA 3MSCA 1V26A 2F59A 1Y4AE 2J31A 5LMZA 1D07A 1KS9A 4DSNA 3P2KA 3EF3A 4I08A 4LJLA 1OXSC 3MG9A 4Q4AA 4DNQA 2OKGA 2I1LA 1W59A 2PGDA 4C43A 3KB8A 2UZAA 3LVBA 1QGDA 1F2UB 4YRQA 4BS9A 2XNSA 1VCIA 1WX1A 4YLGA 5F76A 1AO0A 1XJQA 1Z4LA 2OXEA 4MWEA 4BMYA 1R8JA 3A10A 3KYDA 4R8RA 2K7ZA 1VPEA 4QBIA 1W85B 4QJ3A 1DARA 1MQSA 2J33A 3E9CA 2FF7A 2HNAA 1QV7A 2YVUA 2Y99A 4I5IA 5DGIA 4B6QA 4HDNA 4X7MA 2FQQA 2Y66A 4M1KA 3V5NA 1RQ7A 4O4IB 3B1XA 4HEA6 1LUAA 3UJBA 3LY8A 2DKOA 1YZQA 2EW2A 1E3IA 4BLRA 4WN3A 4XI9A 2FWAA 1LV8A 5DIZA 1UK8A 4B79A 1DT5A 2HHLA 3CRRA 1MDBA 3NXSA 1Z0ZA 4IH4A 2Q5HA 3KHTA 2J5KA 2VI5A 3UJHA 1OAAA 3HFJA 3LUPA 3LX4A 4A2WA 3AL3A 2HA3A 3JQRA 4UQLA 3FXAA 3SD7A 1UDBA 2FQYA 4KQMA 4CLEA 4PO1A 4NFHA 3FDZA 4IEFB 4B48A 4I36A 1KVRA 1G21A 3GEMA 5GJBA 1W4AA 2IK8A 3LXRA 4LWZA 2AFHA 3P0IA 1CUCA 4EYGA 1GZSA 4ZYVA 2X8WA 5A06A 1C30A 1M2HA 4GHWA 2P6RA 1XA0A 1KQOA 4A2QA 1YBAA 2GYYA 5EPUA 1CUSA 2CNLA 3OSZA 4QU5A 4BBPA 5KJFA 5IDVA 3L7NA 3NHAA 4J2TA 1EMDA 1SUBA 1PJ3A 4AY4A 4GH5A 3SS7X 2PT7A 1DO2A 4TN1A 1DWQA 5CEFA 1ECLA 3V6LA 4UBNA 1JIIA 2HFJA 3BE5A 1AZSC 1IWBB 1TT5A 2JGLA 2JGIA 4RDXA 5KTSA 4LDJA 1JVBA 2BZ0A 4MR8A 2RB4A 3QM1A 3CQ9A 4W1QA 1BDJA 3K8QA 2XUQA 5DT9A 1RAIA 4BLOA 1DELA 2OENG 2PWYA 3VTFA 1UBSB 4XGKA 1KTIA 3RDPA 1OUMA 3RABA 3ZCXA 3V7WA 4BATA 4UPVA 1D4FA 4EYKA 4H1TA 3JV7A 2Q8NA 5CDHA 3ONWA 4KLRA 2C4WA 4H2DA 2CY0A 3DWEX 2OTCA 2Q8PA 1AT1A 4LRXA 4RGBA 3W05A 5JBIA 2EKZA 4LWOA 3D0RA 4ENWA 2HSZA 3DAPA 2VRCA 5ALLA 1G59A 4D9FA 1Z9BA 4JEMA 3U62A 5K8LA 5KYTA 4AJJA 4C1NA 1I30A 4OGFA 1RM0A 2FJUA 3JQGB 3QOYA 4HLQB 4JJEA 4MQUA 1EPUA 4TV9F 4L7QA 1M5RA 2ZZNA 1QC5B 3ZJVA 3KPWA 3FPGA 4N65A 3EZYA 4Y8VA 1FXWA 2YASA 1S6YA 3VTAA 7MHTA 3IEMA 2RGEA 5EZYF 3WRWA 1U1EA 4X90A 2X19A 5LQMA 3T12A 1YT5A 1MIOA 1U65A 2VNKA 3FGNA 5DCYA 4M9QA 3WP1B 3FA2A 2GOYA 2JIBA 3H1PA 2VDPB 5FQNA 4XRGA 2FR1A 3N28A 3KKLA 1HSZA 1SC6A 4CKXA 4DM3A 4EX6A 2XXAB 3WJ1A 3MLAA 2HOQA 1WUIS 3C4VA 1T5DX 4KLNA 1GSAA 1QCZA 3UUEA 5C0OE 3ZK8A 2OCPA 2VBFA 2Z30A 3PHGA 1ETUA 1JN0A 3FHJA 4GL4A 3G2HA 3BDAA 1FMLA 3CVXA 5G02A 1EP3B 1QX4A 1U2TA 3E3LA 4UZEA 1RMYA 1NW7A 1QGAA 1OREA 1TAQA 1FX1A 3Q5GA 5I9TA 4U0KA 1DBWA 4LMAA 1AS3A 1DAKA 2FSHA 1SBTA 3NYRA 3UHJA 4I9FA 4R7TA 3RKUA 5BUZA 4IICA 4MICA 3CE9A 3WISA 3QEBZ 2GYUA 4OHCA 1EVEA 1K4MA 2VR1A 1W0CA 1USUA 3DR5A 4IIGA 2COUA 2OG2A 2VUTA 4QC2A 4TL6A 3ZHUA 2OKCA 1ZMRA 2B37A 3C5VA 2R8ZA 4P7GA 5K8VA 1Z4JA 1VKRA 5EQJB 4HEQA 3OPXA 3FSGA 1FDTA 3PBKA 4UHBA 1W30A 1XOIA 3V2GA 5ICGA 3FB1A 3GCDA 4FLEA 3SC2A 1ISSA 1ZW1A 4A6PA 1B0PA 1YDGA 1LJUA 1ZGZA 3VSBA 3EODA 2QS9A 3H7AA 4MS4A 3MMPA 4BVGA 4ENRA 2QUKA 1GGKA 1PR2A 4EM6A 4MLZA 2EFCB 2JHCA 2WWHA 4X85A 1PGJA 3AFMA 1TF7A 3G0IA 3IV6A 4EB8A 3DVAA 3OU7A 3IILA 3NS7A 1F7UA 1A7JA 2QTBA 3OZWA 3O92A 1JF8A 2IXTA 2XD4A 4PZDA 4QU8A 5EKUA 3A4IA 2R8EA 4B5LA 1DAIA 3PWKA 5ETJA 2W6OA 1U94A 3HRKA 1JIJA 4R83A 4YCSA 4MUKA 3MN1A 3DTVB 1P2TA 5TT1A 1OH8A 1GG9A 1ZJWA 2NQ2C 3TLBA 2P65A 3MGGA 1D8AA 2FPPB 3F4KA 3LFTA 5ED0A 5ICMA 1ZN8A 3EYAA 5CH8A 3VHXA 3JWGA 4EPXA 1M6YA 1FUUA 1XKTA 2O8CB 2HWUA 3TRDA 3TXAA 3SVLA 4Y0VA 4M7PA 4QATA 4JYPA 4I99A 3ZY5A 3D6VA 1RJWA 4EG8A 5F7XA 5D86A 4D6YA 3GDWA 1E92A 2HA6A 3BRWA 4CWAA 1CERA 2G06A 3AY6A 1T8PA 4JI1B 1ID8A 3MWEB 2MU1A 5EWLB 4B33A 3GJ3A 4TTTS 2X2EA 3CXRA 4R6XA 1DAEA 4DCNA 3TL3A 2JJYA 2QUHA 3P1JA 3BBPA 2VT6A 3PB3A 5IAJA 2PZEA 3UJDA 2AFVA 2NSLA 3VZCA 1ZUWA 5ARCA 1OXKB 1JRLA 1MIOB 1XP5A 1QRDA 1BGWA 2WUEA 3H7IA 4ZQBA 4ZMRA 2BT4A 1IXRC 3LZCA 3JYOA 1J99A 4P86A 5C7YA 4ZTUB 2WD9A 2ZIVB 5JD4A 1W25A 3HACA 1N32B 1ISMA 1I0ZA 1VG8A 2ZQYA 3EEBA 3GR6A 4B4OA 1UH5A 1TKBA 9LDTA 3B2QA 3QFRA 1KOLA 3WL7A 3ZV7A 3AESB 3U1TA 4HTFB 3HCOA 3BX1A 2FVXA 1FP4A 3M6MD 4LK3A 2C2YA 2J9ZB 2ZRHA 4P3XA 4WRRA 3OAAD 5CB4F 5C31A 2EYQA 2BLNA 4RETA 2AKAB 2FPIA 2EL7A 3C8ZA 2CNKA 3LHSA 2V3CC 1F17A 1Q6ZA 4RLHA 3G1UA 4ZO6A 1JMYA 1VMDA 3CRW1 3FUWA 5EJ8A 5A7GA 2HEGA 1KA9H 4XR9A 2XB9A 3IE2A 3ZCVA 5FBQB 2G83A 1XWIA 4ZVLA 1I3LA 2ZRPA 1Y3HA 3DE2X 3G23A 4FW8A 1RQLA 2HNKA 1NFFA 4PGFA 2AOVA 1U7OA 3OZUA 4B44A 1IMOA 2AI1A 4G3XA 1POXA 2XHZA 4XCQA 3HCAA 3VR1A 3EVGA 3HK2A 3TLCA 3HJAA 1PS0A 2FLVA 2ZI3A 4AP5A 3RTDA 1GSOA 2QTGA 1K97A 3RREA 4Z49A 4HB3A 4OGGA 3BB1A 2UZ3A 5AJXA 5LYYA 3ZH9B 4PRLA 4A91A 3RVOA 3AIKA 3VKHA 4NZOA 1JVSA 3R6LA 4A92A 4HDCA 2BEJA 3BSSA 4BO9A 3ZIDA 2AHRA 2I5PO 1NLUA 4BC1A 2WM8A 5C37A 1MW8X 1J2EA 3VR6D 5DTRA 2F3UA 4I4CA 1JT9A 3LC2O 4MX8A 4LDZA 1T91A 3GI1A 3DCNA 4LXUA 3OTHA 4PC1A 2B94A 2WG2A 3IUEA 1ZHHA 4JY7A 1V71A 4OMUA 4O6VA 3OF3A 2SHKA 3CURA 3SYTA 4YPFA 3UB4A 3RS3A 2CNDA 1NG9A 3JWIA 5JQGA 4IP0A 2IX9A 2C3YA 1GZ3A 1CLUA 2JIZA 2WJPA 1KJQA 2B82A 3DZ8A 4FOLA 3HLTA 1ZJ6A 4G01B 4J0QA 5LIPA 1YULA 2QLJA 3RUDA 2Z6UA 3ESAA 3JQEA 4WCFA 3KE9A 2DECA 4H0NA 4XVRA 4BE4A 5CBKA 3ECCA 3AL2A 1BAPA 1JW9B 1O6BA 3BXOA 1YACA 1NYLA 3MYYA 4UAJA 4BEVA 4D02A 1G291 2Z2JA 2CLFB 1OH6A 1YRBA 2ZW9A 1LBIA 3DOFA 3NBZC 3LLMA 4BC0A 1DCFA 5EPEA 2VIIA 2FWMX 4MQ6A 3GDOA 1EUZA 1QDUA 4ZOAA 5DRYA 2QVLA 2YWEA 4RDCA 3NO4A 4NSNA 3EN0A 2JLSA 3TQFA 4UNRA 3OETA 4NYMQ 5REQA 3I9JA 2G5PA 1CE8A 3EVNA 4QGFA 3X1KA 4DUGA 4O2AF 1KP3A 2VFAA 4MJLA 1T4CB 1OBOA 1G17A 2YYZA 3QH4A 2BP7B 3G2JA 2VVTA 2PD4A 4HBGA 4LJAA 5AOBA 2HWYA 1C3LA 3A4MA 2AW5A 1AIPA 3UWPA 2CV2A 2FYTA 4MUJA 1XZDA 4BN4A 3VYRB 4UXIA 1FFGA 4TUYB 1X19A 1NHWA 4DC1A 1TTHA 2C0QA 3I9NA 1I33A 2KBFA 5EQFA 5JUWA 1NXXA 3VYWA 2O7VA 4CG3A 3QBTA 4CR7A 2BGNA 3CW8X 3LWNA 3HBLA 3INRA 1FLDA 1QZ3A 2GMWA 2QN8A 3KVOA 2AEEA 2QQFA 3DHEA 3RC9A 3JAKB 3VU9B 5KWIA 3OJ0A 3LP5A 2QR3A 4RUKA 1VHWA 1IRIA 1KVSA 2AA3A 3W3AD 5A6VA 4LSGA 4AECA 3FAZA 4EECA 4NJEA 4GOOD 3SFVA 2IH5A 4UXJA 2DHEA 3G79A 3BFKA 1BRMA 2EKPA 4JB2A 5AKGA 5FCDA 1TAHA 3CZ9A 1Y5RA 3IBCA 3HYRA 3KJFA 2FU5C 4R8KA 2M6LA 1CY8A 5FHQA 1RYNA 3BMCA 4PO8A 1NBMD 1NF3A 3U39A 2Y6UA 4H7FA 1XDUA 3HWX1 1XJ0A 4MV8A 3TSYA 4LRUA 2XRZA 3IEVA 1BNCA 3IBGA 3BCUA 1Z2CA 1MJNA 4PU0A 3W8DA 4TMFA 3DWIA 4JLKA 5J23A 3OQNA 2X6TA 1LDYA 1NVEA 3FGZA 1O6GA 3RTCA 1FMFA 3WQRA 3VC3A 3KXIA 5AW5A 4GVPA 5KKCA 3FBWA 3KKQA 3P2OA 2PUCA 4DZTA 1QRUA 1LK0A 3ICPA 2PCLA 1VTKA 1Q0QA 2QOEA 4G56A 3ICOA 3KPVA 4AN0A 5ALKA 4MPTA 1R1DA 3C3CA 1TB4A 1O58A 3L0OA 4TM8A 2NXJA 5LN1A 1NJSA 1MH1A 2IYNA 4MQLA 3ZCSA 4KYIB 1YE5A 4EYEA 3L05A 3Q9SA 2YN0A 3T34A 1OU0A 3K0KA 4HHEA 1Z0KA 1QHHA 4AZ3A 5LP6F 2O07A 2KJQA 3NV7A 1A88A 5DDIP 4EEXA 1Q20A 1S2DA 2ONJA 4F0JA 4CF7A 1C8LA 1WSAA 3WI7A 3UJPA 2OGSA 4LI0A 5CGQB 1YC5A 2YIVX 2H2GA 2D5BA 4W82A 1JMVA 1SBCA 4IJVA 4XYLA 4I1RA 4M9RA 4TS1A 3SXUB 4RVCA 4Q48A 4HP8A 5KINB 3IQXA 3I32A 2PUFA 2WABA 5FNZA 4D92A 4Z4CA 5A2QA 1U4NA 3BH7A 1QG4A 5EMMA 2AQKA 3KPYA 2IPMA 4IWYA 1YZ3A 1GQFA 3GNTA 4XDZA 1CUAA 3U7HB 3LMKA 3AF4A 4NZMA 2AE1A 4HATA 4YQYA 5JFGA 4C88A 5HK9A 1OI7A 1TQHA 1W96A 1FQWA 3G8YA 1HYEA 2V03A 1TEVA 2X6QA 4P4SA 2P79A 3KKMA 4KOEC 3HWSA 4WVLA 4HD8A 1V6SA 2PSJA 4PO3X 2J9GA 4J9UE 1B15A 3TZEA 2E5WA 2LDXA 4JL8A 1ZKDA 2BFMA 5DNEA 4X1IB 3VQTA 5JAHA 3GARA 2ZTSA 4EZIA 3EGXB 1DAMA 5GONB 4GOLD 4JCCA 4PRKA 2VHQA 1T24A 4BQIA 5AVYA 1SVUA 3CEAA 1LPPA 2NO7A 3DBLA 3PX3A 4ZU3A 3FOBA 3OCZA 1PVVA 4FIZA 1MJGM 2N0SA 5DASA 2PUVA 4CUKA 4DLVA 1MAAA 1FTGA 4OUDB 3RW9A 2CKMA 1Z7BA 2CW5A 3H2IA 1GU0A 3OY7A 1XZNA 4HUJA 4DAEA 2UUAB 1CF2O 4YWJA 1T6BY 2Y0CA 1NRJB 1QTNA 3BPSA 4RW0A 1N5JA 3ABSB 2Q5JA 4GGPA 2AXNA 3G0OA 1GZ6A 3KOUA 5C1OA 1Z6QA 2Y1KA 1D3AA 3VFDA 4UZFA 3KOYA 4Z99A 2FOLA 2D5CA 3RTAA 1Y3CE 2B5OA 3L18A 1LJLA 3C8MA 2C2XA 2O0KA 3OG9A 3QYFA 4FC6A 3NYQA 4KDEA 3AZQA 3F98A 1HYGA 4XYGA 4ASUA 4B7CA 2GN6A 2NTVA 4BXOA 3L06A 3EVBA 5DLPA 1OCEA 1KZHA 5I4IA 1NU8A 1CVRA 1SOMA 1KJ9A 4ETWA 1RJ9B 1KO4A 3DFMA 5EWLA 4FEGA 5ALDA 4B4KA 5AVZA 5JCPA 2DH6A 3PI7A 4LQCA 3GO4A 4TTIA 3BVPA 2IBTA 4IHAA 3DOUA 4CKCB 3QLUC 4DQXA 2H9AA 4HQKA 5LZ8A 2QTRA 4DPMA 3BMNA 3OJFA 4EF5A 1ZX1A 2VPXA 3L0YA 2DJ5A 2W2NA 3QMWA 1M5TA 2I87A 4IXDA 4KO2S 4RXMA 5KHAA 1YH3A 5TY0A 4ZEMA 1W9HA 2AJ8A 3I0MA 5CG2A 3NHKA 1E6MA 4I50F 3RKRA 2IYZA 4N41A 5TNXA 4M0UA 5AI5A 1O0CA 5ECYA 1NZDA 1IAVA 2B2CA 1Q2UA 1WDMA 1PU2A 4IEEA 2ETVA 3M4YA 3F73A 3CBQA 5KYGA 1S3FA 1DFIA 1MJ5A 4WK0B 1PZGA 3D7NA 2C4HA 3U3JA 2WG1A 4I4LA 4MRMB 2JJ8A 4N5HX 2JIZD 3MLBA 5DW0A 3VSDA 1YKFA 5JPDA 5LPNA 2AGVA 1GUAA 1RKQA 3EFOB 3FPCA 2YC4C 5F9MA 2IV3A 1VQ1A 1SPBS 2OLKA 3G2OA 4LDAA 3TLGA 1JDTA 1MAUA 1NX9A 2O3SA 3GZ4A 3QHQA 6Q21A 5FWYA 2ZITA 4KO3S 1J49A 4BLUA 2YDXA 3PQ6A 2OO5A 3P9YA 3LVRE 2FPGB 1R7RA 4XM2A 2DG2A 1HETA 1B73A 1C7RA 1ZYUA 2DFVA 4K8RB 1MV5A 4S2UA 3RLFA 1AQYA 3SQMA 3CF6R 4Y3UA 4UAUA 1PR6A 4MJ3A 5JDIC 4EOGA 2X2PA 5TIIA 2X23A 3DLCA 4PVDA 4UUQA 5L95A 3S8YA 2YFYA 3FNBA 1XLTC 4L50A 3SJUA 2ZIFA 3M6LA 5HRCA 1E3QA 5JECA 1I1OA 5TGDA 5JOQA 1H1TA 4QDJA 2ZQZA 3BGOS 4PC3A 2ZIUB 5KYYA 5KQLA 5LOVF 4PO9A 1WTAA 3PQ8A 1D04A 3D7RA 2DTEA 5EKXA 1OXUA 4QTZA 2WMNB 1NVMB 4TGLA 5AVKA 1CG6A 5BWBA 1XYGA 2C2GA 2XXAA 5TF4A 1NUHA 3KAJA 2AI3A 4IIXA 1VL6A 1X8JA 1YVUA 5H59A 5LJLA 2Z8XA 4E5UA 1JJ7A 1LNZA 2HRRA 3IUYA 4JJGA 4G2NA 3WQQA 4ARIA 1X1QA 1ZBDA 1ONNA 1VI6A 3ZE6A 3QEMB 3NOQA 4JB8A 3LGSA 4MSUA 4QJ4A 4AKEA 1C3OB 4UHEA 1AK2A 3U09A 4S05A 2WU4A 4YAFA 5D87A 3R9XA 5ALUA 3KV1A 1I51A 1W0JD 1SELA 2OZKA 3R3SA 4UDOA 4NMXB 1ZK2A 1EM8A 3DHWC 2FDCA 3E84A 1N0VC 3WIOA 2BFBB 2IHUA 3WMWA 1CWUA 2FSIA 5H4HA 3MIIA 5JQGF 2GK6A 1ZNQO 1T5HX 4EGFA 5J2TB 4QRIA 4WPGA 4M9SA 1YRYE 2J32A 2QPOA 1ZMBA 1CRLA 3FGPA 5COAA 4M1OA 3L0BA 1FIUA 4OX9Y 1E18A 1D2CA 5L3SB 3ZWWA 1C2TA 1BOOA 3CLUC 2BPOA 1QV6A 3F90A 5CVJA 5ERXA 1MPXA 1Z0FA 2HU8A 2VDLB 5C8DA 2YVQA 3ICCA 2XUPA 4IDHA 5I01A 2DBQA 5DTIA 4HLCA 2CFCA 1Q1BA 4UBMA 1X42A 2VSFA 4AUEA 1A5TA 3EZ9A 5AUPB 3LIIA 1XZKA 3JATA 4K1XA 4BQSA 2FPXA 2X5XA 4C6RA 5H5JA 3DS8A 5AJHA 3E7PA 1RE1A 2WJ6A 1Z0AA 3G7NA 3QG1A 3PT5A 4KN9S 3ZD6A 3OWOA 1QNFA 1E58A 1T43A 1P8JA 3W2HA 5G1NA 1OJLA 1YQ9A 5CH5A 3KETA 5ITZA 2AMFA 2P9TA 3RK1A 4DLXA 3R8FA 2WSBA 1K7FB 2HA5A 3HLYA 1KMCA 4I4IA 3EEIA 2M98A 2HPAA 1DX6A 3DJYA 3HUUA 1UXKA 1BHQ1 2Q9BA 3MJSA 4D1YA 4MQ4A 1M76A 4BKPA 4ES6A 3DFFA 3PX2A 1JHYA 3JQ9A 4N82A 4UHFA 5DNVA 5EFZA 1CUWA 1C9MA 1YS4A 1GVNB 3IEPA 3D2CA 1SUEA 1NVUQ 1NBIA 3K09C 1BMQA 2BBTA 3MWJA 1I0LA 1LTHR 2PH3A 3F4BA 4IG9A 5KKAA 5L7WA 3W1EA 3WTBA 2B25A 1KXJA 1M72A 2NXWA 5I7HA 4HAZA 4M1ZA 3DFKA 5BXQC 1ZZEA 2NP7A 3L7KA 2ZKIA 4IKPA 1SKMA 5IJ0B 1WBBA 5CEEA 1QB7A 2G17A 2BY4A 3RS0A 4DT1B 4FFLA 1T3SA 2W2OA 3C97A 2NG1A 2QDKA 3C3DA 2IXEA 4CR6A 1KBZA 1B6GA 3QX7A 1UMBB 3AHIA 3NV9A 3NNSA 5CIQA 3TSWA 4KW7A 4R2MA 3WMRA 4CQLA 3Q3CA 1CEQA 4G26A 4IDGA 1R0XA 1RXWA 2HREA 5TMBA 2OD7A 3LUKA 3QU5A 4RU1A 3RVKA 1PQWA 5ICCA 4HNSA 4PSKA 3IMKA 3OZDA 4OHKA 3ILYA 3I92A 3QMVA 1KP2A 3WSVA 5B3KA 2BR4A 2GK4A 4C4ZA 3MERA 2GXSA 5FFFA 2Z5LA 1G5QA 4DPKA 4EI2A 3THWB 3CWQA 3AB7A 4B80A 5JAIA 3NG1A 4J0HA 5A0TA 5CDFA 4EY3A 1Q0HA 2H31A 2VJLA 2AYZA 4ALLA 1WS6A 1QFJA 4NFYA 4CV2A 3GFTA 2GN9A 4KUEA 5CDUA 2OOKA 2YQ5A 2RHRA 3ZX4A 3B70A 4Q34A 1QHHB 1PZHA 3PDJA 1DC3A 2D62A 2V65A 3GGJA 1URPA 4BNFA 2PX8A 3QE4A 5DOVA 2ASVA 1W2WB 3M4ZA 4J0KA 1V4VA 2GCEA 3MT8A 3WDSA 1KQNA 4GYYA 4P33A 4LVCA 1GZDA 2NO5A 3AVOA 4XYEA 1WU7A 1IL0A 5T4FA 3BKWA 3S70A 1EXWA 3VR5D 4RACA 2W9XA 4CLDA 1WMEA 3D0KA 3IQGX 4OQLA 2DPHA 2Z95A 3DHNA 1E1LA 1TCBA 4QQFA 2CZGA 4Z4HA 3RO7A 3RVQA 4F3CA 2QM0A 2KPOA 2M6RA 2R85A 4Q05A 3OJXA 1QXSA 4TQAA 4N5MA 3MCTA 2A0UA 1E1KA 5JZMA 1XVLA 5BSFA 4NPCA 4WZ6A 4U7DA 3THSA 3FHOA 2X77A 1ZSVA 3C7DB 5L3QB 5D5QA 4B6OA 1F7VA 3MUOA 3OZEA 1O54A 3KZ1E 3PKIA 3Q85A 3CUUA 2J7PA 2O2HA 4UZSA 1G6HA 4KAJA 3EY4A 4BNHA 1JJBA 1X7ZB 1G8PA 3IA7A 3LBIA 2J46A 1FU8A 4H0CA 4P92A 1FQKA 5G2OA 5LUBA 1FUEA 2O6HA 4OM7A 5DGHA 4ZI7F 3RYFB 1P18A 3L0DA 4QVKA 1L7DA 4YCJA 3TMAA 3VX4A 1M2EA 1GLVA 1UZAA 3BRSA 5F77A 3OCWA 4B84A 2A92A 2WWFA 1R3UA 4GMHA 1PNTA 1XLTA 4G1CA 4N7JA 2OPBA 4WZBA 3EQZA 4RLQA 3FUUA 1IEWA 4FYVA 3ZBTA 1SXJC 4V0SA 5F3RA 4K03A 3BMQA 1RKVA 1M8GA 3OEED 4DOMA 1TF2A 1H93A 3CX6A 3Q7PA 2G0NA 4JITA 3SHTA 5DXAA 2HHAA 3KXLA 4C6TA 2AZDA 3QTLA 2QN2A 4ZPJA 3LVQE 3ONVA 2QTAA 1MRZA 2NPIA 3ET5A 4NBSA 3BN3A 3RAPR 5ICSA 3M6WA 4D3FA 3F96A 3GYBA 3O84A 4BNTA 4F1JA 1E59A 2QJOA 1XXLA 3CRNA 3QUTA 4FHDA 4HB2A 3NBXX 4KE8A 5DGDA 3WYEA 2FOXA 2VTKA 4P32A 4Y1FA 4W5NA 4Q4HB 4CEHA 2UV8A 3I3OA 3OY2A 1YR6A 1BA3A 4Y9UA 1HQKA 2WMYA 3D43A 1KGDA 1SCBA 1EFHA 5FUQA 3KZVA 3AR3A 4NE2A 4A23A 1W7AA 3TOZA 2I9PA 4YJKA 4OJKA 1KSJA 3GG2A 3JQPA 2OQRA 5FUXA 5DHFA 3BL8A 5BN5A 5EWJA 3R76A 1A0OA 2QRPA 4OL0A 4UDYX 2PH1A 5L8VA 1SRQA 3U4DA 1SULA 3C6ZA 4Q3NA 2WV7A 3WBKA 4AZ3B 2GZDA 4RPKA 1EIZA 2KI5A 2RHJA 4DW8A 3UK1A 2WZCA 5KPDA 3TZQA 5F73A 2MSDB 3EGVA 1FFEA 4M53A 1NULA 3L7LA 4V0NA 4ZRDA 3HI6A 3IESA 3KEFA 3H4VA 2WDZA 4KXQA 4LYFA 3X43A 1P8AA 1SCIA 2QMZA 9LDBA 1M6VA 1UQRA 2GF9A 1O77A 4Q1CA 3W9BA 2XE6A 4UD6A 1G19A 1X8XA 4YBZA 1JL3A 3N74A 4TXJA 2G9VA 4J7UA 3VPBA 1SOWA 3FPAA 2VP3A 3DBRB 3WGOA 4QNMA 1E1MA 4FCWA 2C99A 1NVKA 3LHKA 4EZEA 4IQ8A 4D8UA 5L3VA 3P2MA 4LW8A 5E1DA 3UJAA 2X7JA 2G5CA 3FZQA 1B3RA 3NGMA 1I4TD 3OT4A 1Q92A 4LFCB 2ZI4A 3LAWA 4OHXA 4TL7A 4WNCA 2BI7A 3EB9A 4QUDA 3RUCA 3CXUA 5KVVA 3UMGA 1UFKA 3RYCA 2NPOA 3N2IA 4NE7A 3UMBA 1NDUA 1P60A 2QYSA 4RKQA 3RBAA 3PFCA 5GMOA 1WWKA 4YRTA 3LQRA 3JQQA 2PNJA 1UWLA 1YZVA 2PZGA 4XSHA 3ITDA 3C7AA 5AK5A 4NENB 1C0PA 1GPAA 1MGOA 1W49A 3DKVA 1CS0A 3RF6A 3UXYA 3WGMA 1JG2A 2VCEA 2FMUA 4K6HA 3AQ4A 4CVNA 3E2PA 3PL5A 4WI1A 3QSYA 5J2UA 3A05A 3WLLA 1CDOA 1HLFA 1NC3A 3ONFA 2FWPA 2PS0A 4DG5A 1M2GA 1XTJA 1DG3A 2XLBA 4WL0A 2PMEA 3WB9A 3UY4A 4DZZA 2ZXUA 3T3MB 1UK7A 4RA6A 4X1OA 1P4AA 4REOA 1F2DA 3IUNA 1NVTA 3LUAA 1LSSA 1YDHA 2BGLA 3I6MA 4KGXA 5FH9A 4NP6A 3AUTA 3Q9UA 3UNXA 2MSLA 4BKRA 3SY8A 1PR4A 3QV2A 4LY6A 1ADBA 1JR3E 1IY8A 1E20A 3L82B 3QNWA 1Z0JA 4M9CA 5E95A 1CZHA 1ZAKA 1U0BB 3PHBE 4AKSA 2JFQA 3Q4GA 4P58A 3RG2A 4LDQA 4HJRA 2UXDB 1CZNA 2GD1O 2J9FB 3B9RA 5KNCH 3WWYA 5CT8A 3Q10A 5J58A 2E4ZA 2ZR7A 2WUGA 2X9VA 4QXRA 5CCEA 2A1TR 4TWIA 3ESXA 1K92A 4OYHA 2VJQA 3T9DA 3KAPA 3WNBA 5B2FA 4ARAA 1CJMA 4N8SA 5BPFA 5CA1F 2Y92A 4MHSA 1VBNA 3KYCB 1UJ5A 3PD0A 1FTYA 1Z0IA 3O38A 3R5XA 4M0KA 3RU3A 1IHDA 3SHQA 4FMCB 4R9VA 2Z57A 2JIDA 3S81A 5A4KA 4CV3A 2QVXX 3WMGA 3QLEA 2D1TA 1NVGA 3CX7A 3H17A 4ZAVA 4ZCLA 3IJRA 1UBEA 1VGQA 3TL2A 1IZ9A 2PA0A 1LKZA 2AVNA 2ZWVA 4HKTA 3AKZA 2P6NA 3QGMA 3R41A 3GJ5A 4M8IA 4F72A 5F9HA 2R96A 3FETA 2P2DA 3DDHA 4I3GA 4OK6A 4Q9JA 4I9GA 7AT1A 3H6KA 4YI3A 4HMQA 3I2YX 1U6IA 3GF4A 3IKVA 1K5HA 1GGEA 1QDLB 3A04A 1ACMA 4RYDA 3K6SA 4EQZA 1RMTA 5EEGA 1TJPB 4XUGB 2I65A 1IN8A 4UU7A 2I29A 2J3QA 1T2DA 5AP9A 3T61A 3QHAA 1HE4A 5BN3A 1E1CA 2IT1A 3CVOA 4HRVA 4GR5A 2C88A 3CUYA 4RAQA 2CNNA 2Z5VA 1P2VA 3U3XA 3ZGXA 1SA0B 3D2LA 3I6YA 3U6BA 4W63A 1FFCA 4RFVA 4A8JC 4CV1A 1IZ0A 2KQUA 4IRXA 5HA5A 1CJCA 1ZM7A 3GGDA 5JRJA 1NA5A 2OM6A 3OM1A 4B7XA 4DVJA 3IAUA 3TCKA 1K0FA 3C3BA 5A9TA 2WJ4A 4M6WA 4Y7DA 4CTKA 5CB8A 1FK8A 3EZ7A 4D6PA 1R00A 4MKRA 2NZ2A 3H97A 3QU4A 2O2GA 3R9IA 5PGMA 1JR3D 3T52A 4LNHA 5CK5A 2NM0A 1MABB 1ZXLA 3IRVA 5DI9A 2GM4A 1EBUA 1IUPA 3WBFA 5CDYA 5CXQA 1W36B 1E8DA 2BFCA 4L9SA 3UQYS 1QU2A 4CTNA 4JP5A 3P52A 3AIOA 5ALHA 1WP9A 3RIGA 3RSHA 1L7VC 2AB0A 1P44A 1K8ZB 4OHYA 3S99A 1AA6A 1P7YA 3EHDA 5EJ2A 4TRNA 3D4PA 1P6XA 1CIJA 4D9CA 1DZIA 2ATIA 1GPYA 4JLWA 1BDMA 4PC6A 3SN6A 3V42A 1YVPA 4K3VA 4KYVA 4NMLA 2F3TA 1DG1G 5EZQA 2ZIZA 4OXXA 1MVLA 2FW0A 4RPGA 2PUDA 1PZXA 2O50A 1Q3TA 2HLDD 1UINA 3C7CB 3EEYA 2QMUA 1NRXA 1XHFA 3M82A 1XP8A 2X4GA 3GPIA 4MWCA 4OQMA 1OAOA 4FFPA 4P35A 3WGVA 4XB6B 4TVBA 4LOLA 2OCAA 3B6KA 3D6JA 4ARZB 3QXCA 3JZMA 1B8NA 1BA2A 1JG3A 4TQUS 1E89A 2I62A 4C30A 1BC5A 1R6AA 4FMDB 4MUFA 5IAGA 1KJNA 3GLHE 1BVRA 1DT3A 3CO5A 3LBAA 2ILVA 5K4GA 1YRQA 3UC5A 1ADFA 2A4MA 3MJHA 4D4JA 3V1MA 2C2BA 1P7PA 3TTVA 4QPZA 3ZD9A 5IBRA 4OX9B 3A7DA 3UTDA 2C9CA 1ONBA 1W2GA 2QX9A 4PY2A 1RPJA 4YX9A 2O2JA 5ALXA 1WMBA 3MTBA 4NCIA 1GPH1 5L3RA 1KDZA 3VR4A 4TYWA 2F3PA 4K46A 3ES9A 1I3KA 1RHKA 3D6MA 3KE8A 3OECA 3HJBA 1AN9A 1KETA 5JI2E 1EBBA 1ZOSA 1R9NA 4UC0A 1N2CE 1RNLA 5EJIA 4QYWA 1P5ZB 2OUKA 4AURA 3BE4A 3PVSA 4TRJA 2EG9A 3LBNA 4WXRA 3PC2A 3ZI4A 2B5WA 3PPXA 3LT0A 2FWBA 1T1SA 3FD8A 4LXQA 4E3WA 4JGGA 3HHEA 1QANA 4G24A 4OKNA 3O93A 4MIKA 2A57A 3H0CA 2P5UA 3O90A 5E9AA 3RT7A 5FLKA 1G3IA 2ZJ8A 2I7VA 3N75A 3G0GA 4HEJA 1BJTA 1Y81A 1CUFA 3LP8A 4UOQA 2NADA 1P1BA 1GLGA 4UEOA 4ZKDA 4OXQA 3WNQA 3R7LA 4R2KA 1P4SA 4UUAA 1KJJA 1RP1A 3OM0A 4CYMA 2P91A 4MLDA 4EEKA 4DIBA 5AI0A 1RZUA 2BMAA 1NM5A 1ESDA 4EPVA 3DDZX 1CQJA 1E32A 1ZINA 3HU1A 3KQVA 4MKFA 5KYYB 1R0ZA 2PH5A 4JXKA 3L41A 5HF6A 2A0KA 3EXIA 5IT5A 3HR7A 3CH7A 3BK1A 4K3UA 4O29A 5C8ZA 2ODEA 2NW6A 3BH6A 3HDJA 4R7GA 1JLHA 1ZU5A 4QYIA 1A5SB 1DJQA 1GP2A 3KQOA 4YPVA 3NAMA 4IOJA 3EVCA 5JJ5A 4I1OA 2WTAA 1R37A 1P77A 3LF2A 4TQGA 1N75A 2ILTA 1IBSA 2GN4A 3FX2A 4QEDA 2X8JB 4N9WA 1CC1S 1NQOA 3DB1A 3STXA 3MQ2A 2GAJA 3UV3A 3GLFB 1EDBA 3EG9B 4YIHA 4HH4A 5K05A 1X7XB 3KEGA 2MINB 5CNKA 2Z9BA 2FZCA 3P4XA 4Y98A 5K2OA 4JASB 2A1TS 2QMYA 1O9BA 3ZDYB 1TO1E 1PK7A 4ADSG 3V4OA 5AHKA 1C9KA 2G5GX 3NXKA 3KWJA 2Z58A 1OFUX 1N9GA 4KXWA 4LRQA 4NFLA 4BVFA 1J21A 5LJIA 4V24A 2CDBA 4ML3A 3GPDG 1V11B 1XZJA 1EFRD 1SVWA 2E2WA 1G5IA 4BY9E 1ZCZA 2YJGA 2J3EA 1NF9A 1RW4A 2I6TA 4ZKEA 1V6CA 3BWBA 3VR6A 2CZCA 5FA6A 5K0EA 2AOTA 3C3JA 1KERA 3N7UA 3T9CA 4QPNA 4DJ5X 4JP2A 2Q28A 4Q1DA 3TX2A 3DW1X 2QLFA 3HU5A 3CVUA 4ZCTA 1L4EA 5F4ZA 2IBSA 3P5BA 3NB0A 4AJHA 1T5LA 5AJVB 2JHGA 4AKIA 4QXOA 2IZ1A 3F5FA 4GKAA 1N4DA 2I1WA 4J4HA 4TTJA 5F3DA 3VOAA 3OE4A 4KXVA 3DMPA 4WNAB 2UYYA 1ZOPA 1BKSB 1OR8A 3BCSA 2VLBA 1MHPA 2EJVA 2QZ4A 1F6BA 3L4KA 4DLNA 1DUIA 4FYWA 1CJSA 3D6HA 3TEMA 2V0NA 2DTXA 4UBOA 2IU4A 3GQBA 2ZRNA 3L4BA 1W0KA 1YJBA 1T35A 3M49A 3PGVA 5TMDA 4DMGA 4EJFA 2Y6VA 3WOVA 1M10A 4PHFA 4Q3CA 3F5SA 2PV7A 1UBUS 3K20A 4O5OA 2XODA 1ORWA 2JJMA 1P9RA 4R16A 4DZRA 4YUVA 4FINA 1QFMA 4N3BA 2FPWA 3MNFA 1UPCA 1G21B 4RPIA 2OHHA 5B4VA 4WW0A 1PG2A 1XD9A 3F7TA 4FBMA 3NIDB 4MTLA 4PLYA 2HV8A 1NYTA 3BSWA 1H2WA 1QTQA 3RRFA 5CVUA 1YTUA 1Q22A 1C0KA 1GGNA 1VCHA 1SKBA 4LY3A 3EIOA 4H7PA 4NESA 4R98A 3DW3X 5REQB 3G7UA 1J90A 1ZG3A 2H7CA 1W8DA 4IIJB 3C5EA 4ZVMA 2P62A 5JZ9A 1WR8A 4L5JA 1KYZA 2G1JA 1SMKA 5BQFA 3IT1A 3MT9A 4U5QA 1B8VA 2ES4A 1NRWA 2IC5A 1K2VN 2YNMD 2D2IA 3BJRA 1A76A 5LQUA 2JGAA 3R5JA 1O1YA 5KJ6A 4GUAA 2AZ4A 1Y7IA 5AFSA 4XIIA 4DWJA 1B6TA 4ZJYA 3FOEC 2E4VA 1DC6A 1KO7A 2XUJA 3I2GA 3WRYC 2V3VA 1D2GA 3IXMA 3AERB 4KN8A 1N7HA 1NQVA 2JL1A 1FSGA 2HFKA 3TTWA 3RVBA 4H7IA 5K8UA 3F9RA 4IGKA 3R74A 4UJ3A 2BDUA 4F9EA 1DV1A 3QE3A 3IAS6 4GRIA 5CFQA 2MSCB 3DKRA 2BJHA 4HCJA 4XWWA 3NBAA 1NJ1A 1H42A 3PC7A 5EL0A 2J6BA 2XMGA 1JHUA 4QPPA 4CMIB 1PDVA 3RT1A 1EK5A 2PYZA 3RYHA 4QSHA 4GZMA 4L4XA 3D4IA 4GE0A 3UMCA 3UAXA 4AJKA 5ABPA 1JB9A 3K2IA 5EIXA 3TEJA 1A8UA 1CY4A 4KV7A 1M8KA 1QJCA 1Y33E 1ZLYA 2W71A 2YMMA 4H7KA 4L1KA 5DLQC 1G8JA 2O3QA 2Q2OA 3QVLA 1Q1EA 5FTKA 3E2MA 3HCDA 3VZQA 4C0AC 1YQXA 5DIFA 2VKTA 3STYA 3UMVA 1G4UR 1A50B 4OB7A 4PZ9A 3VAAA 3QVJA 3GJ8A 3L8MA 3O91A 4CRWB 2Y4OA 3GU3A 2RKWA 2IYLD 1L7EA 3P27A 4YROA 2CSXA 1KR2A 2I80A 1C0IA 1FQJA 1I6MA 2QD2A 3NHRA 5KYXA 3T1HB 1SXJD 2PUTA 1H0KA 1L5OA 2NQ8A 2XB2A 4NICA 4LOKA 4MV1A 2QRJA 3QBEA 1O95A 1MBZA 3P2EA 4PQGA 4XWTA 1ZVJA 1MXFA 2X4LA 5KVCA 1BH6A 3UPTA 1HFWA 2BRUC 1VI2A 2GJKA 1EZ4A 1O0SA 4TVKA 3T0FA 3ZJ4A 3EIXA 4DREA 1Y1TA 3FUXA 4PINA 4FNOA 5IX8A 2IW3A 1YZKA 4XVQA 1C1XA 5CVVA 4EB6B 1U3FA 2PLNA 3CF0A 4W6ZA 5C2JB 4LYDA 3UXMA 3A6FA 4Q7LA 1NXSA 1OBHA 4GFDA 4J91A 5CLQA 1DMRA 2ZDHA 4DL9A 1XK7A 1TZKA 5DP2A 2AC2A 5ECWA 3PX7A 3N0VA 1L7AA 4IOLA 4B3GA 2IXAA 3IELA 3P9RA 3DXFA 1RWNA 3L6DA 4FFBA 4FT4A 4QBTA 4DV4B 3LQ1A 4BLQA 4BGIA 1YJXA 2ZUSA 4GWLA 5T6BA 3WC4A 5EE9A 4NBTA 4WLVA 4YCDA 4I1VA 2VSQA 1EUCB 3Q0TA 4MEBA 4X44A 4YHHB 3JVIA 4K5QA 1H65A 1WUKS 4X54A 3GLSA 5E2AA 5K3AA 5L45A 3ERCA 1Q3KA 4U3JA 2VK8A 2COEA 2KBEA 1GHTA 4YGYA 4J0FA 3U26A 2EGGA 4HDMB 3MCUA 4U7JA 4L2IB 4XWGA 3U81A 2ZP1A 4ROTA 4GU5A 1ZD9A 3MMNA 4IZ6A 5D6OA 5AUOB 4G0XA 1KAHA 1T2VA 3IP8A 5L4LA 4XWYA 5JU6A 2SNIE 2GZHA 2RGUA 2DQ4A 2XUKA 2DAPA 3QP9A 3S1LA 2J45A 3H5AA 2A5YB 3UMJA 2H07A 3USZA 1QONA 4OP2A 4ZCPA 1UQUA 1ZD8A 1QIJA 4HDRB 1R6DA 4PGHA 1EFVA 2BKVA 1OSNA 4NU5A 3ZWAA 3CLVA 3ZVLA 3QIAA 4J1TC 4UHDA 2EW8A 2Q1TA 1H23A 2CGEA 1I13A 3EA0A 1VHDA 3DF9A 3PNQA 5CVEA 4IFIA 3TZBA 2Y1XA 4BB6A 3H65A 2W93A 4ZJUA 4IDCA 3FVRA 4ROSA 4B2PA 1U8UA 4FHZA 1V16B 5IEJA 1Q1QA 2RGNC 4PPFA 3A1EA 4UEKA 2AKEA 1NUUA 4II7A 4V1CB 5AESA 2IDJA 1TCVA 3N6XA 1WY5A 5A5DA 1UBMS 2A9RA 1B3BA 3TJMA 4ZAWA 3LIPA 5D51S 4MGKR 4CNQA 4J3FA 1PJ2A 1W85A 2DP4E 4G67A 4XD2A 4MQ5A 3W5VA 1KRWA 4KP7A 4ASUD 3VMMA 4BGVA 4D7AA 2P5YA 4IIUA 4EHDA 4F56A 4XQCA 1YB2A 3F7MA 1KMMA 4IFBA 3T0GA 1IXSB 3A32A 4DWOA 1UC4B 4J75A 3SHOA 2VJOA 5BYAA 1W1WA 3WIDA 1Z39A 3ASVA 3GEHA 3GNQA 3H4TA 4P83A 1KZ6A 2ORIA 1AF7A 1SKYB 2BUCA 2I6SA 3I9V1 1AHNA 1WXHA 3FNHA 3LGXA 3LL4A 5TC4A 3OJWA 1S4MA 3KLNA 4DB2A 5FR2A 1NF8A 1NVBA 4IGAA 1T8SA 4JI2B 5DVZA 1JQBA 2FMIA 4Y6GB 2VZLA 3H87A 2ZFUA 3TUZC 3QI7A 3VNBA 1M2FA 5JAOA 3ADPA 3TLXA 4AQYB 2HJHA 4G0WA 3GJ6A 1JWBB 2MOKA 3N9IA 4IVQA 4KPEC 1JFRA 3V8PA 3NWJA 1FDWA 3WYNA 3BXGA 1TD9A 1WNTA 5DHSA 4UHCA 3T15A 3FKQA 3WL3A 4RK6A 4GE3A 5K0FA 3AEZA 3NHPA 2R7LA 2XOKA 3QPAA 2ZBVA 4EG6A 2ZCVA 3PNKA 3NORA 5KJEA 1YS2X 4RMNA 4MW9A 3QXSA 3DEKA 1SD2A 1QO0D 3EFOA 3V1KA 4RTQA 1Y7TA 2QGNA 1A1VA 3E9YA 3LKVA 1V8FA 3SEAA 1BVYF 1VBKA 4XFJA 4LFAB 3E3MA 3BWEA 1GTMA 1EP1B 2UUOA 3G8DA 4Y1RB 1ISFA 2XUDA 1DUVG 3NDIA 4Z9XA 1RS0A 2B78A 4BEJA 5LQJA 3NP9A 4DR2B 3A14A 2HKIA 1HLPA 2W2MA 2ZUWA 4HNTA 1NMSA 1P17A 1RBZA 3PYMA 3GD5A 3SYMA 1POWA 1JBKA 4RZHA 2Q5FA 4Q1AA 2CL5A