3FWPA

X-ray structure of uridine nucleoside phosphorylease from salmonella typhimurium complexed with phosphate and its inhibitor 2,2'-anhydrouridine at 1.86 a resolution
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
251
structure length
248
Chain Sequence
KSDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The X-ray structure of Salmonella typhimurium uridine nucleoside phosphorylase complexed with 2,2'-anhydrouridine, phosphate and potassium ions at 1.86 A resolution.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
molecule keywords Uridine phosphorylase
total genus 87
structure length 248
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fwpA00
3UAWA 4OGKA 2QPLA 1YR3A 4GMHA 2AC7A 1VHJA 3SCZA 4EB8A 1V48A 4RJ2A 5K1ZA 4H1TA 4NY1A 5IU6A 4OEHA 1YQUA 3DDOA 3LA8A 1JDUA 1RXUA 4BN0A 1CB0A 1TGVA 4MCIA 1V2HE 3PNSA 3UAVA 4F1WA 5F7ZA 1Z35A 3OOEA 4QAQA 4R31A 1ODKA 3P0FA 4L5CA 1RXYA 3UAXA 1Y1RA 5F7XA 4D8XA 2QTGA 1T8SA 3GB9A 4BMXA 4L6IA 1OVGA 3K8QA 3DJFA 1ECPA 3E9RA 1A9QA 1Z34A 4LNHA 2A0YA 1Z37A 4TS9A 1OU4A 3FAZA 4D98A 2H8GA 1RT9A 1Y1TA 1JE0A 4E1VA 4TYMA 4DA0A 1ODIA 3MB8A 4JWTA 5EUBA 1TGYA 3ENZA 3IEXA 1LV8A 2OC4A 4LZWA 2QDKA 3OCCA 1Y6QA 1U1FA 1JPVA 3DPSA 4D8YA 4DARA 1RSZA 3OZCA 2BSXA 1V4NA 4KN5A 1RXCA 1JDSA 4MCHA 5JPCA 1T0UA 5IFKA 1Z39A 4P54A 4TTJA 1B8OA 5B7QA 4WKBA 4M1EA 4WKCA 1SQ6A 4TS3A 1G2OA 4NSNA 4WKPA 4YMLA 1NC1A 2IQ5A 3F8WA 4ECEA 3EUEA 3O4VA 4GKAA 5EFOA 1JE1A 2QSUA 1PF7E 1Y1QA 1ZL2A 1PR6A 3BGSA 4F3CA 4DAEA 3KVYA 4TTAA 1NC3A 4GLFA 3NM6B 4FFSA 1Z5OA 3LGSA 1T8WA 5F7OA 1Z5PA 4QEZA 3GGSA 3BJEA 4G8JA 4TXNA 5B7GA 1N3IA 1PR1A 4U2KA 4OJTA 4JOSA 2ISCA 3PHCA 3UAZA 1V45E 4TXMA 4BMZA 4DA7A 5CYFA 1RCTE 4K6OA 3O6VA 1K27A 1PR4A 3KHSA 4MARA 4LNAA 5EPUA 4DAOA 2I4TA 3MMSA 1ZOSA 3BSFA 5F73A 1PR5A 2AI3A 4DABA 3NM4A 3U40A 4TTIA 4R2XA 5F76A 2QTTA 2HN9A 1A9PA 1U1CA 3OZBA 1LVUA 4M7WA 3QPBA 2GUWA 4LDNA 5CXQA 4TXJA 4F2PA 4DANA 2OXFA 1JDZA 1A69A 3FNQA 5C80A 4QASA 3KU4A 4TXLA 2P4SA 4QATA 3KVRA 2OECA 1SJ9A 4YNBA 4G41A 1JDVA 2XRFA 1PR0A 1I80A 4L5AA 5F77A 1T8YA 1SD1A 1TCVA 4PR3A 4DA8A 5B7NA 1OV6A 2ON6A 2HWUA 3INYA 4WKNA 3PHBE 1PW7A 1PR2A 1JP7A 4D8VA 3K8OE 4BMYA 1T8RA 2A0WA 4PNPA 1ODLA 1PK9A 1FXUA 1K9SA 3NBQA 2HSWA 3DP9A 3ODGA 2A8YA 1A9OA 1C3XA 1A9RA 1RXSA 4QARA 1VHWA 3DF9A 1Z38A 3C74A 4I2VA 4DA6A 3FB1A 5F78A 4LKRA 3EMVA 1Z5NA 1PKEA 3OOHA 1Y6RA 3UT6A 1XE3A 1PK7A 1M73E 3T94A 3OZDA 1ULAA 1TCUA 3E0QA 1RYZA 3E9ZA 5CYGA 1YRYE 2PGAA 1Z33A 1V3QE 5ETJA 3EUFA 3P0EA 1NW4A 3D1VA 1U1GA 2AI1A 4IP0A 3ONVA 1JYSA 5I3CA 1U1DA 3IOMA 4L0MA 4JP5A 3TL6A 3OZEA 1QE5A 1PBNA 1RR6A 4M3NA 1VFNA 3OF3A 5CXSA 1OUMA 1YBFA 3PNPA 4L5YA 1OTYA 2B94A 4GLJA 3KVVA 1PWYE 4YO8A 4WKOA 3KUKA 3FWPA 1YQQA 2OC9A 3FUCA 2RJ3A 3EEIA 2I8AA 5CCDA 1LX7A 5B7PA 4F2WA 4D9HA 1RFGE 4QFBA 4NS1A 2Q7OE 4YJKA 1ODJA 4F3KA 5CCEA 5F7JA 1SD2A 1OTXA 1A9SA 4R2WA 1Z36A 3UAYA 4OY3A 2HRDA 1V41E 1ULBA 4X24A 1VMKA 5DK6A 5FAKA 1Q1GA 4OF4A 4TXHA 1TD1A 4UC0A 1U1EA 5KB3A 2A0XA 1JDTA 3NM5A 1WTAA 3FOWA 1Y1SA 3LBAA 2AI2A 4EARA 1CG6A 4G89A 3BL6A 4OGLA 3OPVA 1A9TA 1B8NA 1K3FA
chains in the Genus database with same CATH superfamily
1WXHA 4J07A 4UEQA 1U7DA 4FOLA 5H16A 3VO1A 2FMTA 1UBNA 1WB6A 1H4TA 4L0CA 1T6BY 5REQB 3JCZA 3GRUA 4RVDA 1Y7HA 5TX7A 3MLAA 1V48A 3TSAA 3OZIA 2WYIA 2A78A 3WK8A 2NPOA 1WZNA 5FBWB 1PJLA 1EEXB 2ZR9A 3NI2A 4H1TA 5K1ZA 2Z1MA 3DC2A 3CNBA 4INOA 1T5TA 1EJ0A 2QTFA 3FFTA 3PFCA 1QRSA 4YDQA 4ARCA 2Y1FA 2PRYA 4ZN6A 5HIKA 4P1ZA 5JJBA 4PYMA 4TWBA 2C2GA 5BW5A 3RVPA 3ACDA 2QVLA 3K2BA 1Z35A 2AOVA 2R1VB 2OHOA 2CEKA 1PSZA 1Q12A 1QORA 4Q3OA 3UEOA 2RI6A 3D5EA 1KAHA 3L18A 4L5CA 1VYTA 2NT3A 3EVNA 2FDXA 4XWAA 2Y99A 3ESZA 4EUKA 4JBLA 4ZZ2A 1G7RA 3RKRA 4Y0AA 4CMEC 5CLQA 2VEOA 2GPAA 3QFRA 2PMWB 4IUBS 4KLNA 4X1YA 4A8TA 2BBOA 2IS4A 4CF7A 1JL3A 3DKKA 2BTQA 1R8QA 1Y33E 2E4YA 4I4CA 4P3XA 1EBFA 2HMVA 2IXAA 3L02A 4BMXA 3KL4A 1NM5C 1QJ4A 4DXAA 8GPBA 4KVGA 4P4NA 4YCAA 3SX0A 2X4GA 2A9RA 4L3VA 1IPHA 1CV2A 2ZYDA 2P6UA 2PYDA 1N2GA 4JAVC 4EHJA 1IC6A 1ZL0A 1FP4B 2EW1A 1SC3A 2J6HA 4KXWA 4O1IA 3UMGA 4CQMB 1EHYA 2FYTA 4RPKA 1D2EA 3OJ0A 1XJWA 3VRHA 3QX3A 3TOXA 4EPRA 1RC8A 2VXYA 4FGZA 5TVGA 4ENWA 2LCFA 5AOBA 4Y9RA 1NXWA 3CN7A 1A7JA 5JSFA 2AFHE 3VX4A 2CLOB 1YSCA 3C3EA 2INGX 3AETA 2UV8A 3MILA 4L6CA 2B4KA 1NU8A 3S2EA 3VZSA 1GTL1 2NO4A 3ZNPA 2EL7A 3IESA 3TBFA 2V0GA 4HDKA 3KOZA 1POWA 3BE6A 2WAYA 4IIYA 4PG7A 1KEPA 3K9NA 3MUNA 4LE2A 1QGUB 4F8EA 3R5SA 1F7VA 2JBWA 2YZMA 2ZRHA 3P9ZA 4LQLA 4QG7A 4YO7A 4D1YA 3RH0A 4AO6A 1JE0A 1XNHA 3DDSA 3K0KA 1YUNA 2ZB4A 1KZ4A 3JQCA 2NU7A 2QTRA 3GCWA 3IDQA 3R1IA 4LV5B 3RVSA 5FTLA 2CUKA 4R9SA 3KLMX 2B7CA 2WMYA 2DG2A 2G4VA 2QNBA 2Y0CA 1KAMA 2EFJA 3C16C 1LBQA 3DBLA 3EEYA 3L77A 2O19A 3BFJA 4OQDA 4Y67A 2ZIXB 1Q21A 4U9HS 4NE9A 3D4IA 5KNDH 1DHTA 1G1MA 1TTTA 4EVIA 4OHYA 2XLBA 4XR4A 3WA6A 4HV4A 2AD1A 3R3YA 1TRHA 5C4MA 2YHUA 1BDIA 4UCFA 1IJKA 4ZQGA 4OA8A 3ENWA 4QDTA 5EE1A 5F35A 5B1DA 2JJ2D 5F1KA 2E9SA 5AUOB 4FW8A 3Q0IA 3TZQA 1J21A 4PE5B 3GJYA 2QPTA 4MI9A 1Y98A 4WASA 4E5DA 3VR4D 3D6JA 4IWXA 2VQ3A 2R44A 4X41A 5FWXB 1JNYA 4TLCA 3PX7A 3KL2A 4KK4A 4MS4A 4MSUA 2WDZA 3L8CA 4ROSA 5J5VA 3WRYA 1JEQB 1L5MA 1QNLA 3DBOB 4N0EA 4QTUB 1QZ3A 4ZREA 1XZDA 3U9SA 5JNRA 3T3HA 1UMDB 2ERXA 3AXTA 2CNNA 5F4BA 3W6ZA 1Z22A 5KTTA 2F67A 2I4NA 3LBYA 3MMZA 4UE2A 1SK8A 4V3BA 5EHNA 4CM8A 2E4XA 1CVLA 4QRIA 4RUKA 5JAQA 5H9WA 5LFAA 1NXSA 1WKCA 4IXTA 1XP5A 4EPXA 5CA1F 3WICA 3CG0A 3JD3A 1XD8A 1JXOA 1UMBB 2KBFA 3R5JA 4FQ5A 5CHEA 5G0UA 4EGJA 1WEKA 3PF8A 4V1CA 2WTXA 4DBLC 2O8EB 4F84A 1C30B 4O4LA 2CBXA 1MQSA 4MQBA 1JWLA 1GTSA 3JWEA 4DF3A 4DQ0A 2IPXA 1C9NA 4YQFA 1E69A 3NM6B 3OZXA 3KU1A 1YQXA 2ZUEA 3VH3A 2B37A 2VF5X 1C8KA 1TUEA 3JATA 4H7PA 2RGRA 2J48A 1M2OB 2KX7A 3AFMA 2ILVA 2GD6A 3HLTA 3NJRA 2FN7A 2F2TA 4RDIA 1DPGA 1Y42X 4WA7A 2Q6VA 2VBCA 1QDLB 1YBMA 3BWDD 3H99A 4LRWA 3KXDA 1IJBA 2QQFA 2YV3A 4C4YA 1HE1C 2IU4A 4MI1A 3EQ9A 1RYYA 1Z0JA 2FSFA 5KPDA 4B80A 4H7KA 2JFXA 4XDGA 3I9OA 1BWQA 1SIUA 2X4IA 3AG5A 1UC9A 3PHCA 4JH0A 4QO7A 1STOA 3QXXA 1NF9A 1C1XA 3F47A 4PXAA 5GZ3A 1OLUB 4Q3LA 1S7CA 3OQIA 3QFFA 4DDVA 4NV0A 3M9WA 1Q3KA 5DXJA 5K20A 4KODA 1PEKE 4M46A 1OB2A 5HQJA 3MWGA 3ETDA 4JENA 2ECKA 3OPMA 2B4QA 4HLDA 4P31A 4ZKEA 1SUCA 2Z2JA 3CNQS 4ID3A 2AX4A 3ZLTA 1UWVA 4DYDA 5TMDA 2JGLA 3FSRA 3KLPX 2DWPA 3RU7A 2HYIC 4DJJA 4FGWA 4EHKA 3C3BA 4JLOA 1VLMA 3KTDA 1JLRA 4P82A 4W5WA 3MRVA 4N3NA 4BYGA 1QOZA 2A92A 3L9XA 1UBHS 4LRSB 4TRNA 5SV2A 4IIDA 5LOVB 4GRAA 1O97C 2VJAA 4TTIA 2QLJA 3VR6D 4UTZA 1QRDA 3CVUA 1JFSA 3A4IA 4ALIA 5DGCA 4OQLA 2MINB 2I3AA 4JQCA 4O4JF 4JOQA 4PO3X 5BXQC 2H18A 1CDOA 3UCEA 4CWAA 4F5WA 1NVMB 3FAKA 1QG4A 2G6TA 4TKLA 2XUFA 5IDWA 2W6ID 1XV5A 2QLNA 4MIYA 1XCOA 1NVWQ 3HB0A 1ZI8A 4BQSA 3UWMA 4M53A 4DANA 2XKBA 2VHZA 3DE7X 3RO7A 4BQQA 2XUIA 1XROA 2XR1A 2QTVA 3BG5A 1OI7A 1R6BX 2H2DA 2VTKA 1SVSA 2F1OA 3EXAA 3HKDA 1ONOA 3I3OA 3OVMA 3QVSA 4IDCA 5A0FA 4EW6A 3GFRA 3ZR4B 3ZH9B 1CYEA 4RCVA 1A8HA 3TSWA 4B3GA 4JT9A 1YJBA 3H11A 3JQDA 4N65A 5KWJA 5DM70 2QW8A 3SR4A 1YVEI 2JIRA 2VHTA 3CMCO 5CNJA 3TVTA 5EJ6A 2ZGVA 3Q7IA 1SEPA 5FNVA 3HUEA 1JDBC 1CUWA 2OG1A 3JSAA 2B25A 1KIFA 4HEA1 2PS1A 4I5FA 4AZWA 4Q3AA 3WGTA 3WL6A 3SSMA 3E5MA 4BNYA 1NIPA 1TCVA 2IP2A 4GEKA 3Q3VA 2IZ1A 4UBLA 4M6WA 5EJFA 1ZJ5A 4A1FA 4ZGWA 2AF4C 1RCUA 5KYKA 2IWHA 1OH7A 2AJTA 1CY1A 2HHJA 2CHGA 2EFCB 4QSHA 1M7HA 5JALA 2P65A 4UKDA 3NUZA 4RW0A 3NRCA 2P4HX 4G85A 4ZQCB 3SXUB 3SZGA 2WVHA 3Q10A 5HRCA 1RTTA 4RKWA 3GUUA 2PUBA 1NF8A 3MUOA 4QBIA 2IQIA 1CQPA 2WJ4A 3ZHXA 2C3OA 2QZ9A 2DUMA 2G40A 3PHJA 3PQ4A 4FLEA 4G5QA 3ZLJA 4NG4A 1UM9B 1MLDA 5IX8A 5FYQA 4CMJA 1WMDA 1S89A 1VJCA 5A7HA 3C43A 2AKAB 3TXAA 3B82A 4U0JA 3TW8B 2BBWA 4WZBB 4MUIA 1O58A 4X8OA 2XIQA 3SYLA 4FN4A 1A82A 3C48A 5CTJA 2R1TB 1DKUA 1Z8NA 4M22A 4E0BA 3V3KA 3KEQA 3MWLA 1T26A 3CX6A 3PYMA 3I58A 1WMAA 3HWRA 2FVYA 3S2FA 1USKA 1OJ7A 1T2AA 4NPAA 4DCOA 3ERCA 1FJHA 2VA9A 2JJ2A 4FK8A 4RVUA 3IKTA 5BUCA 4BBAA 1WTCA 4CTMA 2WT4A 3SWWA 2QZ4A 3NC1C 1RXSA 2EZ4A 5LBUA 2YWBA 3KKZA 1B3RA 3TTTA 1VMEA 3R3ZA 4R3NA 3QKRB 1H5NA 1JT9A 4YAEA 5LNK6 4QRDA 4G07A 1I6LA 4XQGA 4HWRA 3SQMA 4BFSA 4B3RB 2AF3C 1KAGA 1P45A 4LKRA 3E9YA 2IOYA 3UV3A 3RDPA 4GZLA 3MPUA 3Q72A 4MS3B 3RJMA 3ADBA 2G9NA 4RS4A 2YNMA 5MDHA 4PX5A 2TMDA 3EXIA 4GOJA 2PL3A 4ERXA 4YUWA 4IZOA 2FUCA 3FPFA 2LE0A 1COWA 2VNAA 4M8NE 1LV7A 1VRCA 3JQAB 2ACEA 2XUQA 1HR0B 2QUAA 4E32A 2XJ9A 3H6KA 3RU3A 3W5HA 1G8AA 2ZE5A 3G2MA 1L7NA 1OA1A 2RJNA 5T8KC 5IDYA 4WBNB 3GXBA 1PD0A 2XMDA 1YBHA 2C7PA 1KVTA 3EC7A 4IYRA 4BNIA 3L8YA 2GFQA 2CHEA 5TQ0B 2OGWA 3DBVO 4MR8A 1AMNA 2IS2A 5LYYA 1PEDA 5JMPA 3JAKB 4UBMA 4GBGA 3ZGOA 4AD8A 3U60B 4H0CA 3T06B 2BFFA 2OO5C 2AE2A 2V6MA 2IPAB 1XTJA 4QOIA 3R8XA 3TMYA 3QEAZ 2P1RA 5H83A 1LBTA 1CRWG 1PUXA 5CR9A 3AI2A 1AS3A 4IMRA 5CX4A 4G24A 2YRWA 3A9UA 1CY4A 3GEEA 4BXOB 3ZJVA 5AM2A 1TTQB 3RS0A 5ALKA 1XPRA 1QAOA 3GCDA 1X1BA 3DZDA 4OFBA 1TIKA 3KPYA 1QQAA 2GETA 4UVIA 1MEJA 5GJWC 4BJ3A 1QYIA 2HAEA 2Q4OA 2PX0A 5TQVA 1E2UA 2XSZA 4OFWA 5T5QA 5DISB 3KHTA 2FEOA 2X22A 5ANRB 2NACA 2XA2A 4J0HA 3H2ZA 4IUDS 3GLHE 4QUJA 4ICIA 1ZIPA 2Z30A 3FJYA 3NBZC 4D5EA 2OZLB 3UV7A 4B82A 1QK5A 1BWRA 2OBLA 1KIAA 2XRYA 1TVCA 4PIVA 4CT4B 4WBSA 2J5RA 2JJQA 3S2GA 1F6WA 2J31A 3NNSA 1DRKA 1UF9A 3JWHA 3PICA 3PNBA 4KI0A 1W35A 3D6UA 4Y6OA 3PDIA 4EO7A 3K0SA 3I0MA 3ZWXA 4GLJA 2B9EA 4FC7A 4C4OA 4YXFA 1ELOA 3PNLA 4ZOQI 3TRHA 5I5GA 4J4BA 3ROTA 1N5DA 5HFNA 4BKRA 4KXYA 4ONEA 4BO3A 3TMAA 1QANA 1SMKA 3LV8A 4ALNA 5DHRA 3H5IA 5EIEA 4KFUA 4OP3A 4ABYA 4TSFD 2I8AA 5JWOA 3E5RA 4IINA 2CMFA 2QX4A 2OMKA 5JCOA 3ZE9A 3CRVA 3RJ5A 1NVGA 5HHTA 1R10A 3IEIA 2GBLA 5CNKA 2D5LA 5BXYA 3AL0C 4RLFA 2PEYA 4WJKB 4D4JA 5K9ZA 4EMBA 4ZV4A 3ETHA 4HZUB 4C2UA 4X7BA 1ZA1A 2A9FA 3JZIA 4DDHA 4KQGA 1FYFA 2ODPA 3HP4A 1JLLA 3AHHA 4MB6A 5KVCA 5G3YA 5JSZA 3QPAA 5EGSA 1Q0QA 2A5YB 3L3BA 3AM4A 5JNVA 3AY0A 1A2QA 4IRUB 3WLLA 4BPRA 3VNAA 2XVMA 3EIOA 4JGIA 3VPHA 1JQJC 1Z5UA 3R9KA 1ZI9A 1GCIA 4CM4B 5LWQA 1CTQA 3C8ZA 5AKGA 1D9ZA 4JROA 4UNSA 2HRDA 2QRUA 3IQDB 4V0RA 1JVSA 2YXNA 4YECA 3UOGA 1U8YA 4DC9A 4X54A 1GILA 1I3NA 3BMNB 2WYOA 1MV8A 4HZIA 2Q3FA 5FEMA 2QM3A 1IN4A 2MHCA 3X2EA 4DDWA 3PUVA 4F8YA 1ZS9A 4Q9LA 4XYLA 3IAS6 2Q1SA 2FZWA 1LSUA 4JUFA 4PTZA 1G6KA 5AKZA 3WFIA 4QBGB 1KU0A 2XE4A 3GDFA 3EMKA 2GPYA 4MDYA 1JQ3A 2PQMA 1U9CA 2C9YA 4HAZA 2QG4A 3Q7SA 1PG2A 1RLOA 1E0JA 2A84A 4RTOA 2QNIA 2BGLA 4KO4S 4KPUB 1IB0A 3WP0A 1JXAA 1JGTA 1G41A 1VL8A 2C4WA 1ABFA 1L9XA 2OB2A 3AEUB 5E4YA 4YS6A 5FOUA 3SR3A 3ON5A 4GVXA 2AHRA 1EX9A 2QX8A 3HO8A 2GO7A 3RRMA 1ZSYA 3QHAA 3EXG1 3N8KA 3HY4A 1U0HC 5JQGA 4JJEA 2JLCA 3AEUA 4EGAA 2HV9A 3M4JA 5IAAA 4CR6A 3A10A 4DMLA 1J2RA 1Q19A 1TK2A 4TVKA 2IV7A 1Q7EA 1GFZA 1JI0A 1BGVA 2QPLA 4M98A 4PSUA 3BICA 3KDSE 1KVSA 1GNPA 1ZUHA 3V6LA 5KVAA 4NIMA 4BEVA 5AJVB 1T5LA 1RPAA 1V47A 4QWMA 2HPVA 4YIKA 2PGDA 2OAGA 3EZYA 1Z5VA 1DFHA 4ZOLA 2ERCA 3LL4A 5EEGA 2BELA 3VKGA 2ZRJA 3BMOB 4AO8A 3PLRA 2II6A 3LMKA 3VYSB 4Z54A 1KZ9A 2B1RA 3IYLW 5DE3A 1JNXX 1YRWA 3T4UA 4AXXA 1OKKD 3UKDA 3OIYA 4JFRA 5JCJA 3FOBA 3R09A 4F93B 5DI3B 5DM2A 1RHJA 1YI0A 3GL9A 3TE7A 1RYMA 1GV0A 4DSOA 4QAQA 2DPYA 1QXSA 1XZGA 5JCZA 4HNGA 2D5BA 3CPHA 2XDYA 3S5JA 3HXKA 1TM1E 2IZ7A 2QMHA 2GVDC 4CG1A 5EKSA 2RJOA 2R00A 3ZZTA 3ABZA 3FWHA 3SHOA 5F5LA 5HUJA 2C4KA 1GL7A 2Z1NA 5D8DA 1L3CA 4G1EB 4HS9A 5LDHA 1XRRA 1SN7A 4BUCA 4D8XA 2OFXA 2VN8A 2X0NA 1OI2A 3OBBA 3OLYA 4IAOA 3ZX4A 3KFLA 1YCDA 2KM1A 5KQPA 3KK0A 4FCWA 3FLMA 2ZRMA 5AI9A 3IT3A 3V9PA 3O4FA 1JYEA 3DLBA 1AHNA 3SFZA 4Z9FA 5ILQA 3F96A 1TB4A 1KEEA 2FE4A 3W3AH 3KZMA 1IWBB 1FX0A 1QQ6A 4OL9A 4JXKA 1FTNA 2QQGA 1EYZA 4FZ3A 4NFSA 4X6LA 3WE7A 1MJHA 2QQ0A 3T3GA 2EERA 1OU4A 2GT1A 3K09C 1U3FA 4OB8A 1SHJA 4QOFA 5TY0A 4KDFA 3SS7X 3TPCA 2VA8A 3MRXA 1US8B 3GPCA 4G5YA 5BNWA 2I5PO 3D0KA 4MTCA 4B2LA 13PKA 4OQZA 1J0XO 4K6FA 1JMVA 5I3ZA 3MG9A 1F3OA 1O57A 4EOGA 2I8CA 3M33A 2HUNA 4FOPA 3BCUA 3EBLA 2GD0A 2W2QA 1LDEA 3EGWA 3LUGA 4K9OA 3WISA 3ZJ5A 1ZKDA 2YX1A 4L7QA 4ODIA 5TRTA 3ROQA 3KELA 5KNCA 4KL8S 1S01A 3QPDA 4QYIA 1IN5A 1VZ3A 4QDZA 1Z17A 4CT0A 3IEXA 2Q4RA 1YUBA 4KOAA 3IERA 1XTRA 3RF6A 4N7MA 1U1FA 1JPVA 4Q7QA 2ROQA 1T2FA 4DKXA 4HLQB 5JAUA 1F7UA 3RSGA 1O9HA 2ZT5A 3ZHQA 4D3YA 3DMNA 3VO2A 1NW5A 4LC0A 3QKIA 1W48A 1DDIA 4MVJP 3RVMA 1WU8A 2BFFB 4I36A 4YP7A 4D0NA 2DWQA 3NW9A 1MVNA 4XIFA 3TB4A 2X8JB 3BWBA 1DC6A 5IFKA 1HFJA 3QJ5A 3TZEA 2HLDA 4YV0A 3IUEA 1DARA 4P54A 4PBSA 4AJPA 4DB2A 1YKGA 2GQ0A 2AYXA 5B7QA 3AJRA 1E3EA 1ESMA 4CL0A 5AI8A 4UUNA 3ZDCA 1M8JA 1O6BA 4EKYA 3OZFA 1AN9A 4A0FA 1SUSA 1UXGA 4PS0A 4JBHA 4WKPA 4MIEA 3EPKA 2FTKE 2AMYA 4INJA 1IOLA 4DV3B 2DERA 2IQ5A 3EODA 1F0KA 4O4HA 4DCSA 1RS0A 2FNAA 4TMVA 1GTJ1 5BWMA 1XN1A 1Y1QA 3IHLA 4F56A 1IG0A 1PKXA 5EWMB 5CLFA 4NJOA 4PFKA 1QK4A 1RQNA 4EW1A 5KEIA 1MAVA 2JAXA 3MA0A 5JXJA 3B6KA 3PEUA 4HWKA 5M5BA 4OYHA 2ZJ2A 4V24A 1ZNWA 4YCSA 4GLFA 1R9JA 4E12A 3W5AA 1RKBA 1X3LA 3L7CA 2VK1A 2OO5A 2BDEA 2X9NA 2YDYA 2BTOA 5JDCA 4M0KA 1KTVA 1W2WB 3BJEA 2MT9A 3F90A 4TXNA 1RAEA 4JUAA 5AOCA 3RHTA 2A1TR 1B76A 3R9WA 1LK0A 2AFHB 4JEIA 4YCBA 4F91B 4I50F 4N5HX 3EGEA 2PO5A 4JOSA 1V16B 2V3CC 4FMDB 1CIVA 1W88B 1TM5E 1RABA 2YVUA 2ISCA 3FNHA 4GIBA 1Q14A 2EKPA 2VP3A 3F8TA 4NP6A 1E1QA 2EKBA 4J29A 4BNDB 4C3ZA 4H0NA 1M2HA 1B00A 3E1KA 4WW0A 1LTKA 5E7QA 3UXHA 5A1TA 3K96A 3CS3A 3SYKA 3GRPA 1C14A 1Y0BA 2CVQA 1ZXLA 4KQCA 2YYAA 5G1OA 4DRYA 4BO1A 4MW9A 2JLSA 1N5MA 3V34A 2GBPA 3WO0A 1L6RA 4AB1A 4B6SA 1K7YA 4FFBA 2B1QA 1G5FA 1F12A 1W5EA 5I47A 1G8MA 3NB0A 3AP1A 3ILHA 1RP7A 3NOVA 3QE4A 1BNCA 4W1PA 3V1YA 4YMVA 5K5EA 3MOSA 4ND5A 2CK3A 1BDBA 4LQ4A 3VR5A 2PX2A 5KWVA 1QGDA 2Z2IA 2NNWB 1PV2A 3O83A 1IIBA 2PL5A 2PZLA 4UVDA 2P2SA 3WSVA 1ZRHA 4MPPA 5EN4A 3QLTA 1NQUA 4PZAA 4UBJA 3LC2O 1YZQA 2R85A 4I2NA 4OH1A 2V7XA 4J0JA 4WGGA 2OYRA 2VPQA 3VNSA 4EB6B 5FWDA 1CJMA 1A9ZA 5TLSA 1A9PA 4EJFA 1GXSB 1XHEA 3K6SB 4X61A 5FNVB 3PEFA 3PSAA 3GLIA 4RHUA 4XFJA 1PUJA 2AYZA 1J42A 1L5OA 1M1XB 4MKZA 4MQ5A 4QJIA 3K4QA 2C4TA 1U8TA 3AONB 5L45A 5JDIC 4CLEA 2RAPA 3ZYZA 2GZHA 4B7CA 1ZNYA 3DULA 2YN4A 2YJNA 3LBHA 4RETA 5I7HA 2GM4A 1G291 1ZEJA 5L3ZA 2C96A 3RQIA 4ZQIA 5AHWA 1A27A 4LF5B 3GMDA 3PZRA 4WCDA 3FWZA 2YV1A 1CR2A 5CJ2A 1I0ZA 1O0BA 2OGTA 3AUTA 4WCFA 3N2IA 3TNJA 2FPIA 2J07A 1SC9A 1CUIA 4J7AA 5LB2A 1E5LA 2PM8A 4CMHA 4E03A 2OORA 3LE8A 4UOQA 5T7BA 5AI0A 3PQ8A 4MWEA 1B6SA 5F1OA 1W9MA 3T7IA 2WI8A 3Q5EA 1XX6A 1GGNA 2AUNA 3P94A 4I4TF 2MR5A 2YWGA 1N2IA 3QFSA 3ABQB 3ZQUA 3AESB 3C7KA 3IJPA 5B64A 4GM4A 4YJFB 2BBSA 3LDGA 4C0HA 1UKBA 1YFZA 2BL4A 2ZB2A 3MQFA 4PZ9A 3SFTA 5IT5A 3H84A 1ULUA 3W5UA 4O08A 1TA0A 2IHUA 2WU8A 3ZDYB 4B4VA 2YOHA 1H3EA 1F17A 2WIAA 3DONA 4IJWA 1ZXXA 2P5UA 4BAZA 4F7DA 1PW7A 5BR8B 2OCAA 5KDOA 1KSHA 1Z68A 3LCRA 4IS2A 5DWVA 5DV9A 4F3NA 4TRMA 4YRZA 4FGLA 3BRCA 5ITWA 2EBFX 2ZAGA 3NUGA 2IF0A 4F92B 1V6CA 1RYBA 1IEQA 2PZKA 3I01M 4XCXA 4ZT3A 3VDMA 4F2GA 4JV5B 1QVWA 5DX0A 5GINE 3DF7A 4JZKA 4P3KA 2A9KA 5TT1A 1M6EX 1WVIA 1XRMA 1ZD4A 3B53X 2I1WA 2QRLA 4YRAA 1AMUA 4LV8B 4K40A 3JVVA 1X7WB 3PEYA 5C3UA 1RKQA 1V3UA 4QUAA 3SS9X 3WWZA 2WLSA 3SP1A 4AKGA 4C43A 4X1IA 1MIHA 1G59A 4QKQA 3EK2A 5ALUA 2CFOA 4CI9A 3RNOA 5IF3A 1AQYA 4C7OB 5BURA 1EBUA 1BMQA 1PT9A 4IFTA 4C1NA 4ZDJA 1OBFO 1E8NA 2O2IA 3CF4A 2AT1A 1RDFA 1WS6A 3E1GA 5FV4A 1MKYA 3RF7A 1WBBA 4ZQFA 1EVQA 1WXQA 2B4YA 1GRNA 3ZWQA 1SBQA 4JLPA 3U4AA 5K4HA 2PPLA 1LDBA 2AQHA 3GH3A 2DT5A 4CI0B 2JEZA 2HCTA 4LDPA 1JR3A 2GN2A 4DSAA 3TW6A 1MBZA 1FDIA 1EFCA 4A8PA 3L93A 2BF4A 4KPGA 4G25A 4JP3A 1WMFA 4GNKA 4K5QA 2Q2NA 3CN9A 3HL0A 3QHQA 2BR4A 4MHTA 1I3KA 4HL6A 5FLEX 3PUHA 1TTHA 3G02A 2FMXA 2XWBF 3WGKA 2IHNA 4FYXA 1ZBQA 2NZUG 4GG1A 3J80A 3DDZX 3CUWA 2Q2OA 2HIHA 3PC7A 3DCIA 3EB9A 3T3OA 5KNDA 3HQ4O 4RHXA 3H19A 1YRBA 4CM8B 1QVVA 3ETNA 4B3JA 2Y27A 1MIOA 5CNMA 3FBTA 2VTBB 3TLGB 1JSZA 1YGYA 3FUUA 3SX2A 4H3KB 1OLXA 4IICA 5FT9A 3NH9A 4F5ZA 3T5AA 1DLIA 1LJUA 2YW9A 2C4VA 1LPNA 1OLXB 4BE9A 4I5GA 4P34A 3GMSA 1E7WA 4KQWA 2JI8A 2MU1A 3EOAI 4LJAA 4Q4AA 4HAXA 3WK9A 4DLYA 1W2HA 4UUAA 1XJ5A 2JA1A 3ILXA 3P71T 3A6FA 3ZBUA 3BPSA 4ILEA 5CW2A 1C1DA 1U0FA 1EDZA 1O94C 2OQRA 1DP4A 2XQIA 4EELA 3Q40A 1QHHB 3HXPA 1KZ6A 2PT6A 4J0QA 5JI3E 2GB4A 3KP1A 2R6HA 2W2PA 2GLUA 2JAHA 2QW1A 1N6NA 2IU3A 3L4JA 3JX9A 1ZUNA 2A1UB 3KKLA 3GG2A 2NZVG 3A36A 4JELA 2EVWX 3R4CA 2BFMA 4C30A 1KVQA 3RVRA 3UUFA 3WO1A 1GEEA 2ZWPA 1Y3CE 2FKNA 2PMKA 3NHSA 2NU7B 1V5WA 4Y9DA 1PBNA 5GONF 3U1VA 4GMGA 3DOHA 3WLPA 4B84A 5CH5A 3JPYA 3LLUA 1W9HA 1EU1A 2AJLI 1OUMA 1D7OA 4HC4A 4RD6A 1E98A 2XUDA 1SO8A 3ASUA 3EVZA 4JI0B 2AEFA 2XNHA 4C7OA 4O29A 5FB3A 1QPZA 5BVGB 1G4AE 3QMWA 2LCQA 2I2WA 3SEQA 4D9GA 3WMXA 3H1BA 3SEAA 3D81A 4MH0R 3UT5A 3K35A 1G66A 2F64A 4M9RA 4ZO8A 1XKTA 5FAXA 2AXNA 2HIMA 2O2DA 1FP4A 2GN0A 3FUCA 1NJ2A 3RFVA 1DAPA 1GUZA 2WE8A 2C7VA 3JU3A 4Q93A 1U0RA 3MJTA 4OKNA 3RBZA 5EERA 4BX8A 3NRJA 3G1UA 4GKBA 1H5UA 3AR4A 3GJSA 4C3OB 3KBBA 3DFIA 1L7XA 1Y81A 3FSGA 1BEUB 1QG6A 4F2WA 5CX1B 5EJMA 3QEBZ 5AIBA 3O0TA 3DPIA 3JD0A 1FQWA 4CKXA 4MINA 1KJIA 4FDMA 2FMFA 1CZKA 2H16A 2NU6A 2F00A 3O8DA 1KZGB 3T3NA 4DV1B 1ZNQO 3VC7A 2C5BA 2O3JA 3AG6A 3E7WA 1IY8A 3FCSB 2XKJE 5DSZA 1L5GB 4GR4A 1SH7A 5D3KA 4MLPA 1OTXA 4ZO7A 1FUKA 2GVZC 2FEXA 2P4QA 2CMDA 3FPAA 2DAPA 3D6AA 1Q11A 4HH0A 4P7FA 2AWOA 4WDRA 4JD5A 3HP7A 2FK7A 4MHSA 4PONA 1EDOA 5I7SA 4X8LA 1PD1A 2EWVA 1J7JA 4HZGA 4AY5A 1DAIA 1X8KA 1FRZA 3C8UA 1ZFNA 1KFCB 2PK3A 1D07A 4O0MA 3AZQA 4G5SA 2PD4A 2QN2A 3KJEA 4MUNA 3C97A 4XYBA 3HHEA 2AE1A 3D8SA 3R7SA 3RABA 3VSDA 2GNPA 2BKVA 1Z4KA 2APJA 2DFLA 2G9QA 2AFIE 4MW0A 3V4FA 5DYGA 3P5SA 4EEZA 2B7BA 2FMIA 2Z9DA 2LDXA 3DVSX 1F9AA 3K5HA 3HFGA 3T9CA 1RQPA 4MVJH 2IPLA 2QMUA 2GFIA 4JR0A 5AJXA 1G5IA 1H9AA 4H7JA 4WV3A 1RWPA 2XCOA 1CY8A 4K8RB 1GCOA 3PA8A 4KDCA 5EPOA 2OCPA 5KNCD 4H6PA 3LK6A 3WNCA 2GO1A 1M54A 4BRSA 3FZQA 1TZKA 3M4ZA 4WLFA 1QMPA 2P8SA 4DLUA 1BG6A 4YALA 4Z2YA 4Q12A 3WLHA 4EB6A 1DSSG 5A6SA 1VPLA 3KSMA 1WXEA 4GBED 1FP1D 3RK1A 1E2PA 1TJNA 2CW5A 4PYNA 5J43A 2B8WA 3OG9A 4JLMA 2QVCA 5J2UA 2DR3A 2O0HA 2VHJA 4MGIR 3PQDA 3S40A 2CL5A 1ISMA 3FETA 3L7NA 1NFQA 4IQFA 1BW9B 4CDNA 4ZHQB 5AW0A 1NNSA 1G9XA 1GSHA 4LZOA 3ZXXA 1RRGA 2H63A 1DWOA 4HNVA 2JLWA 1G6OA 4TVOA 4RTNA 1W30A 1KJNA 3ZWAA 3DXXA 4FI3C 4RV9A 1WB9A 3ZUPA 5BN3B 4TUYB 1D4FA 1NKVA 2PX8A 3CE9A 1ECJA 3AM5A 3ED5A 1VHJA 2CDRA 3N8IA 3LWZA 4G56A 2UZ0A 2HU7A 1BTOA 2J3LA 1FK8A 2VJLA 2CNOA 1K97A 3BRQA 3W2FA 3DMPA 3DWGA 4BFWA 1QOPB 3PPIA 5C0OE 3X44A 2W4MA 5KWEA 2OD9A 4P4LA 4ZWNA 5C3MA 5FHRA 2CLFB 4TV8F 4OEHA 3TCXB 1AK1A 3COVA 2BKXA 1VPDA 4L8LA 1A50B 1TI7A 1CB0A 4BP1A 2YIMA 3F4BA 2GXUA 5E7JA 4C76A 4MCIA 4N9WA 4URXR 3BSWA 1XTKA 4GSYA 1KDTA 3UAVA 4N4AA 3H6GA 3T34A 4EPTA 2EAUA 1GDDA 1S5PA 3KEGA 3VVBA 4BL5A 3ZDQA 1JI3A 1YZHA 3R24A 1TIBA 5EP4A 2IHBA 3UQZA 3ZDBA 2WABA 1HG1A 4PF1A 3RS2A 1RACA 1MQAA 1IDOA 1EWYA 1EIZA 1JHMA 1D8TA 2PMDA 4G97A 5KNBA 4QU0A 1RI4A 1NTOA 3OKAA 3PEEA 4M7PA 1G4UR 1BE6A 1CS0B 2GAIA 2VK2A 3FWKA 1BA3A 1HOTA 2B78A 3CO0S 3CRQA 4Q9KA 1XZIA 3C3KA 3QELA 4RD1A 3WMFA 4IVPA 3I72A 4OI2A 1CJCA 1F6DA 3AU8A 4FOSA 2OPHA 3F3YA 3JTMA 4TTPA 3HU5A 3GZJA 2BFAA 3V6MA 4FE7A 4LYAA 3T7JA 3LT1A 3IAS1 3FMVA 3H8VA 5FFFA 5BNIA 4F0JA 1P2VA 5JS8A 4GOMD 4MUXA 5KX5F 1N9GB 3DCYA 5KWIA 2FQQA 1AKNA 3JD2A 4E51A 2FSUA 3F9IA 5AP9A 4N5DA 4TS9A 2QL5A 3R44A 1Y9ZA 3IVMA 4ZQHA 2NOAA 1PJTA 2OFOA 2YJ5A 4I50B 4FGKA 4BLQA 2Y68A 3FX2A 1MG5A 1JT2A 1E20A 2PFGA 2RHLA 3ZCUA 5FPYA 4M83A 2P9ZA 1RC0A 1AKYA 1OLOA 3RVKA 1M6HA 3IGFA 1NW7A 4C9BA 3B6IA 2X5OA 4ZEOA 3UPDA 1HKUA 4B35A 3BREA 4UDOA 1GQOA 1NMYA 3P1JA 1ZR4A 3OX4A 1UOOA 4PAMA 3MRSA 3D8NA 2O3SA 4DHEA 4UFPA 3IXLA 2CDNA 1W75A 2XDQB 1U0EA 3PI6A 3U4CA 1RLMA 5ABPA 1A8IA 1NVTA 3CJQA 3A6GA 2VAPA 2X1MA 2ZU6A 2OZEA 1THTA 5ED4A 4M8KA 1L7PA 3B1WA 5HIMA 1BVYF 3GZ4A 4F8JA 1UXOA 5HIIA 4DBLE 3AVXA 5KAPA 2GR9A 3DAGA 4BAUA 5LBTA 4QVIA 2AOXA 1Z75A 2I7VA 5JZBA 1E0KA 3OZCA 2NUAB 1NA5A 2SBTA 2W00A 1EP9A 3C1AA 4IOJA 2P0AA 4G5GA 2PSJA 1PQ4A 3O3OB 4WT7A 2J9FB 1UT8A 4UXHA 1G20E 5E9JA 4W99A 4A6XA 2BGKA 2WWRA 3TOCA 5CFLA 2H5LA 5DHPA 2XGGA 3U7IA 1BHSA 3HA5A 1G8HA 1SOWA 2HBZA 3NWPA 1RJEA 1IK4A 4RKRA 1ZK3A 1CJUC 4HXEB 2SKDA 3AP2A 2BFPA 3B5EA 2BT4A 4G0ZA 4OK3A 3UATA 4BTEA 1C4KA 4WEOA 5JISA 1HDRA 3Q11A 5EXXA 3RC3A 3AGPA 3C2QA 1AQLA 3RTAA 2C5FA 2G72A 3OLQA 4UHHA 5LC1A 3WRXC 2I66A 3IHKA 4F60A 3DAPA 2EQ5A 4YMLA 3AIKA 4POOA 1DLJA 4V38A 4E22A 4JBIA 1NC1A 4MGEA 4W5RA 4TTSA 4XQCA 1CUZA 1UM8A 2Q6TA 3EG9B 3IDAA 2N1BA 5C1IA 1H93A 1YR1A 1ZL2A 5AM4A 2V7EA 4OL0A 1ZUD1 4PU0A 4ZXFA 2G8LA 1J9ZA 3ZWCA 5FOQA 3AXSA 3F5MA 4I1VA 2HQSA 2GPJA 5A0VA 1C3EA 3D43A 1IONA 5K4AA 5JC1A 1AKVA 1X8JA 2DCUA 4JKIA 1N2CE 2D1QA 1KH1A 2LZ0A 3LKDA 3LVQE 3N1UA 4Q7EA 2J45A 5DZSA 2VHWA 1BFKA 3DVQX 2HMAA 3NEJA 4BIMA 3IE1A 3GQBA 4PAQA 5AHOA 3SI7A 3TNLA 4CTKA 6AT1A 1DMRA 1PV1A 1XXHA 2VYNA 5FADA 2DFPA 3B7PA 4NH0A 3R75A 3M6FA 2F3UA 4YUAA 3H3FA 4HWPA 4ZA2A 1KFKB 5AVUA 4MYSA 4G5RA 1T3SA 1XMVA 4LPSA 1DC5A 1T29A 3KOYA 3DGEC 4ZEWA 1DQRA 1U28C 4OHOA 5ELMA 3VR3A 4EA9A 5SZIA 4PXSA 5A3SA 3GJ3A 2NXWA 1ZIXA 4ARBA 1Q0ZA 1V45E 2FW1A 2XDQA 1KAQA 3WLSA 3EHDA 3L8DA 3R5HA 5EMJA 4DA7A 5HM8A 2JHGA 2JJMA 4MS1A 5CYFA 2I4IA 4OATA 3ZE8A 4KR6A 1OPXA 3H5VA 4MGHA 4GE0A 1K27A 2COUA 3SD7A 1N5RA 2PSFA 3K0HA 2CJWB 3LRTA 1TU0A 1KSGA 3DTVD 1PS0A 1ZK2A 2BFEB 3O31A 2UAGA 5FEUA 3RADC 4GRDA 4PG4A 3CBGA 4HEQA 3VQTA 4RPLA 4F3TA 3DEKA 7REQA 1XZPA 4CW7A 3PWKA 3NX4A 4OQQA 5KQMA 4B2PA 2LD4A 4YCMA 1SVLA 1MZVA 4M1TA 3WRVA 1UEIA 1ZNXA 3MC1A 5F73A 1CQZA 3QHPA 4XVUA 4ZQBA 4OBEA 2H29A 3UMVA 1G2PA 1JQLB 4IKPA 3FKQA 4G8DA 3S28A 4WNAA 1RI1A 1RQ2A 1N6PA 3QEOA 2X2PA 1GTMA 5IDXA 1ZH6A 2CGEA 1EHIA 2HRCA 3A70A 3QK7A 4HFMA 1O6GA 1HDZA 1Y3FE 4TWAA 5HSGA 1P2BA 3EZXA 4L9WA 1GRRA 4F71A 4JUIA 2BZ1A 2I2AA 2P1ZA 2VOJA 4OHUA 4P4UA 3GZTB 3LCCA 2Y4OA 4DLTA 4FJ2A 4R0MA 3RHZA 3U56A 1YQGA 3QWAA 1NL3A 4LVNA 3DEZA 1ADCA 5D85A 3CR3C 3W7VA 1DOHA 3O47A 3AL3A 2O59A 3ER6A 3VHRA 5KJ6A 4PCLA 1A69A 1CB7A 3OKPA 5SY6A 3PQ7A 5HQ3B 1JEJA 4NCIA 4DR6B 1DELA 3FPJA 3TW0A 5E8RA 4PLTA 3DBIA 4KE6A 3IEPA 3K31A 1XTVA 2E5LB 1U28A 1ESDA 1FMCA 2OECA 2IODA 3CPEA 1RJ9A 2W98A 5AW1A 1WSWA 4CM4A 5ILOA 1FFAA 3CLRC 1X80B 2XT0A 4RD3A 2EFYA 2FFQA 1H1LA 2H2FA 5T3YA 4MIKA 3T5MA 5K3FB 5M2QA 3OQNA 1AXEA 2ZG6A 1FYVA 5CFQA 1OZFA 4PZZA 5AKYA 2IH4A 3EDYA 4UDYX 4B6RA 1IRIA 3UGQA 4ITVA 1IQRA 2EJBA 2OHXA 1QCDA 2OT3B 4PC3A 1YDHA 5IVDA 4AW9A 2WAOA 1YS6A 3Q3IA 5DXFA 3D59A 3WNVA 1ZH2A 4BNMA 2PBLA 2CC2A 3IOEA 4TYQA 2YJGA 3S68A 3O8OA 4DIBA 1NQXA 1DIHA 2NNLD 4MZXA 3UN1A 1RWOA 1H2AS 2IW1A 2FU5C 3K1JA 5E1BA 2VWPA 4CIVA 3V4RA 1R5BA 3O8QB 3LD9A 1HG0A 2YV5A 3GZNA 2ZBUA 3N58A 4Q9DA 5IC6A 1H2EA 1BW9A 1OOEA 4Q1AA 1LH0A 4HWTA 1R2QA 1XMOB 2EWMA 1UBRS 2RGAA 5B58T 4ZMRA 3AVUA 4WRRA 1Y89A 2G88A 2GAOA 2J3DA 1V1RA 3WLKX 4GPZA 4LRTB 1XT6A 2A0WA 5AUNB 3TUJC 3GEPA 5CB4B 2BRUA 3ZHYA 2VUHB 2WHYA 1K3TA 1QU3A 1FXUA 1A2BA 1EI9A 3DOOA 5E3IA 5A04A 4WZAB 3E05A 3VHLB 4ZIRA 1WD5A 2ID8A 1K89A 3ANYB 1XMSA 4HJXA 3W5JA 4D6YA 2X76A 4UCWA 1E3IA 1P1JA 2EHJA 2I9KA 1KRHA 2XZOA 3HPRA 3QLJA 4DE5A 1R12A 5A6VA 2A58A 1W5AA 4D3SA 4MUYA 2Q4TA 4N0MA 4I9GA 4OBBA 2K6GA 1YHZA 3LA6A 4M36A 4O2AA 4DN6A 5IJ0A 2VZ0A 3C6ZA 1GAXA 3MJDA 3N8NA 5ECDA 2MYPA 4D4IA 4DDMA 4X60A 4FWBA 1HKHA 2J5BA 3C74A 3GRCA 4WXYB 3BH7A 3EVGA 1JEYB 4MQ6A 5T4BA 2F1IA 4XPZA 4TZKA 3AVOA 1EDDA 2BP7A 3TVDA 2W6ZA 3QVGA 1KETA 4P53A 2ZFUA 3KV1A 4YV2A 1GARA 4ZU3A 1PKEA 1UQRA 2QBYA 1EESA 1X9GA 2DWCA 2QEQA 5LA6A 5BYKA 4M7RA 4TKUB 3UT6A 1IK6A 1K4YA 1P9OA 3DHEA 4BXOA 1N5JA 3IA7A 4OV6B 3NCHA 1CUJA 1C4XA 1Z45A 5DXAA 3S2UA 3T52A 5KJ1A 5LQUA 1RW4A 1S8FA 2YHIA 3DV0B 4RPHA 1OBVA 1SXQA 4FUTA 3QF4A 2AJ8A 3BIJA 3MJFA 1XDDA 2XCQA 2G5CA 1NXPA 3L1IA 4ZO6A 3V7FA 3OA2A 1M67A 3AWDA 3DDNA 3BSSA 1WVGA 2WTBA 4MR8B 3VSCA 4BPBA 4C4PA 3L0IB 2WZDA 4DJDC 1VCIA 1NIJA 2PUGA 3HLYA 4ER3A 2DECA 5REQA 5FA5A 1XNJA 1WXWA 1IFXA 2UUCB 1KS2A 1W96A 2ZW9A 3ECCA 3GA7A 2QRHA 1NW6A 2OHJA 3LPDA 1W1UA 1FOEB 5FULA 4NXMB 2JA2A 3ILVA 4BEJA 3H2YA 2H2HA 2REQA 2PH3A 1KOLA 2M98A 3C6QA 3G9QA 4LSMA 3LUBA 3EGIA 1ZSVA 4I0WB 1ACMA 3WYGA 4EI7A 4V03A 1OZ0A 1PE0A 1U1DA 4LCJA 4YJHB 2PZBA 5BVGA 3JD4A 1GG5A 4UJ3A 2X0RA 1H6BA 2F3PA 5AK0A 3O93A 5ALHA 3P96A 3HM9A 4FHCA 3I0ZA 3OD5A 4Z8XA 5DVZA 5HBRA 2ASVA 2DUNA 4R40A 3Q12A 2QF7A 3IDFA 5BV0A 1E5XA 3ZCPA 2J59A 1H4QA 1WZIA 1NP3A 2C03A 5JAZA 5PGMA 2W8BA 1QX4A 1N2XA 1T9GS 2A9OA 3IS3A 2YZKA 4ZT6A 4BVLA 4DXHA 1NYQA 2E18A 2X3FA 4L4YA 4XUCA 4S2UA 3NDRA 1CRLA 4QQ8A 5E6SB 1FFXA 2JK1A 4EG0A 3QNMA 2WQ6A 1E4EB 1W4LA 2HJSA 3PNPA 4IDQA 4EITA 2JGFA 5GIOE 4JI4B 4Y98A 3K8ZA 3ZDAA 2GRAA 4HO1X 1ZICA 3EQ2A 3HNRA 1F8XA 4B0OA 2VJYA 2ZJ1A 3VNVA 3LT0A 3WBKA 5AVYA 4FFVA 4WXMA 5D86A 3EXEA 1FS5A 3EIEA 4EA7A 2I6TA 1XVTA 2Z2YA 2CL7X 3DFFA 2AOWA 4D43A 3HDHA 2YUTA 3KQMA 4U8HA 5L3RA 4BZPA 1XHLA 4OGGA 2MSEB 3NJ4A 1BO6A 1EE2A 2F9MA 3LXUX 2AW3A 2UYQA 2WU1A 2D4AA 1W2GA 3P9CA 3SICE 3BJZA 3KZXA 1FP2A 3QVMA 4P83A 4EKIA 4NBWA 1T5OA 1PV4A 4ZTBA 3BK2A 2Q6IA 1Q0HA 2NWQA 5EIHA 3MNFA 2CLSA 2HSDA 5AI4A 5KNLA 3DE0X 1M2KA 2C78A 4JXZA 1MC5A 3VV3A 1F9EA 4U6QA 5SYMA 2I62A 1KYTA 2Q5FA 3DTVA 4A0SA 3KSAC 1DCTA 3DOFA 3DKIA 4YCNA 2QORA 3H4VA 1KGSA 2QZZA 3WC4A 2XNSA 2IL1A 2ZIUB 4QL3A 1ATZA 4LKOA 5I9TA 2W8ZA 4CV3A 3DLTA 2XQKA 1Z2CA 4I55F 2C8JA 2X19A 3GYBA 5TGDA 1WQ3A 3G9XA 4QPCA 4ZXPA 4DDKA 1VMKA 1F2DA 3O03A 1E9BA 4BMPB 4B3TB 4HTFA 2YCLA 1XZHA 1IBMB 2HYDA 1AG9A 1BXGA 1TECE 5FAKA 1L4KA 2DT8A 1XEWY 1OT3A 2F43A 1GZ3A 4JLAA 1JHPA 1XB2A 2G9UA 4LI0A 3MLEA 5J4VA 5LJIA 4S35A 2AZXA 3WLFA 1UT6A 4US1R 4DMCA 3FMPB 5A9TA 1JA1A 4S04A 9LDBA 4L57A 5DWDA 4LHZA 3TQOA 1NLZA 4Y9SA 2HHHB 1LDNA 2Y9PB 2EWWA 1FMFA 1LTHR 1K88A 2HQRA 1GUAA 2W2KB 2WIBA 3LI2A 3SDZA 3RC2A 3SGLA 3S1SA 2ZBDA 1YE3A 3WWCA 4OTZA 3CTMA 5E9WA 5J58A 2UXDB 3FOZA 4QNRA 3W2TA 4UTRA 3MBOA 5K03A 1HETA 3KKPA 1WCXA 4Q1VA 3GJTA 1NWCA 1RYNA 4WVFA 1AUOA 3BMXA 4ZVLA 1NG9A 1ZOLA 2J3MA 4RS3A 2KI5A 4RXTA 3KR2A 3OZVA 5ES3A 3P2YA 1PI3A 5IKXA 1B6TA 1W36D 1SKYB 3R5FA 3OPVA 4J7CA 4C4XA 3A0RB 2O48X 2C9MA 4FZJA 5ALQA 2F3QA 2IP4A 3DMRA 3B6JA 3QV1A 2JI6A 1ZD9A 3QTLA 2CJXA 5FKJA 5CH8A 5SY4A 4UNNA 1U0TA 1P8JA 4UVEA 3SLGA 4X00A 4FBMA 1ZH4A 10MHA 1FQJA 4K26A 5GPBA 5IN5A 1P72A 2D5AA 2ZTMA 4NMHA 3ZHZA 4HWSA 1OH6A 1IAQA 4L5BA 3U0BA 4OGWA 1HYHA 2HV8A 4RXUA 1I33A 1EGHA 2RGCA 4GQAA 3LA8A 1LI7A 4GT1A 4Q9JA 4P92A 1TGVA 1V37A 5LA6B 2YN0A 1V2HE 3O26A 4DZRA 2WAXA 3PNSA 4U7HA 2P9QA 4Z0NA 5LSAA 1DIOB 1GPH1 2WZBA 3EIWA 3MJRA 5IHXA 1J0EA 2GN8A 2NQ2C 2I03A 4DLLA 5ALWA 2PT7A 3EFEA 1JEYA 1H5QA 3RYTC 4RQUA 2ZYRA 4BFXA 1L4GA 1VG8A 1R6VA 2IIVA 1I5OA 2NYUA 2XEDA 1GNSA 3CZPA 4FSHA 2ETVA 1DKOA 4LOJA 4O2AB 5EYPB 3WLOA 2XDWA 3H1FA 4FJ1A 3HBLA 4JXJA 3TD2A 5EZYF 4B81A 2A9JA 3HP1A 3RE1A 4UNQA 3NWBA 5FBLB 4GWLA 1PZEA 3F0TA 2QTLA 1I7NA 4P5DA 4DRXA 4OGFA 3UAOA 1EFDN 1SG0A 4PQRA 3C4JA 3GFSA 1MFPA 2QVXX 5JYEA 1OWNA 3CUUA 1LPMA 2Q1XA 5K09A 3A9SA 3VPSA 3SE0A 1JPNA 1RI2A 4Q7LA 2ATEA 1K5HA 2IDMA 4D9BA 1NUHA 4ZANA 2CV2A 1Y34E 2CXHA 4K6KA 1A9QA 2P6OA 3HFRA 2EFEB 4I19A 4NAHA 2FSHA 5CTAA 3WQRA 3AVYA 4UATA 1ZONA 4AG6A 1T3HA 2DBYA 1EVYA 3A4YA 5ERXA 1OFTA 4V0SA 1GKLA 3CEAA 4AJKA 5CFZA 3ZDDA 2O4UX 3O8QA 1RT9A 3U3OA 3UGJA 5ES4B 2I1VB 5K01A 2R9VA 3TZKA 2EKQA 2EFDB 4DJ5X 4KWIA 1KJJA 2ZBQA 1GCUA 4MDFA 5TQ2A 4NS4A 3EC1A 2IYXA 5AW5A 2VDPB 4J1TA 4K86A 2X1VA 1CR1A 2HSGA 2P8JA 1DG9A 4ND8B 3SS8A 3VR0A 2B6NA 3I2IA 1TGYA 3O7WA 3LYLA 3ENZA 1TVEA 1QE0A 4JQSA 2IS6A 3GFPA 2CMHA 4DWOA 1NQAO 4REQA 1FFSA 4K9KA 2A4MA 2WUGA 3FYUA 4ZOBA 4JL5A 1NMQA 1LBIA 3FNFA 1TT5B 1NBIA 1DEHA 2PYZA 5D87A 5KHOC 4DUPA 3JV7A 3VJMA 1KAEA 3LG2A 1I0LA 3OCWA 4KN5A 3LHSA 4RCZA 3AI1A 1QGUA 2ARKA 1G7CA 1ODFA 2H51A 3DDHA 2Y67A 2CVPA 3KYCA 3GRAA 3PRHA 3BMCB 4GKJB 5JYCA 2HPAA 4OD0A 2VKTA 2BEWB 4GH5A 2O20A 2FV8A 4GM1A 5DBGA 4D2IA 2H9YA 1NHWA 1GNVA 2HLPA 2VJMA 2Z8YA 3AY7A 4IIVA 4Q4JB 5IJAA 2CSXA 3OAAD 4FHFA 5BQ3A 2JH8A 2O2GA 5ESXA 3V7YA 4BWVA 1E5DA 3IDOA 1Q3HA 3G5UA 1EX6A 2PYIA 5L7TA 3ROXA 1ARZA 2PQ6A 3KDAA 4O4HB 4R4JA 4UZFA 4KRFA 4C03A 4QOHA 3ABIA 3C3WA 2DY1A 4GZ5A 1OXMA 3I9V6 4P7JA 5ALEA 5HG0A 4BNNA 5L3VA 2OBNA 4RSRA 1XIVA 2GK7A 2C54A 1XWWA 3DUWA 1X1AA 4E7PA 4HYYA 4Y7CA 3AOGA 3LY8A 4EPWA 4Y1RA 3AW9A 4IQ4A 1R5JA 2XQFA 4BJ1A 2I0FA 1Z88A 4Z0TA 2B9VA 1R27A 3MN1A 3PUWA 2V7UA 3AFNA 4JL8A 2X8JA 4NFYA 4RELA 5K51A 5NLLA 3W6NA 2XXJA 1SQ5A 4YUXA 1BIFA 1H9BA 2VHYA 4GM0A 5EINA 4RULA 4X1YB 4FDVA 2Q8NA 3IMKA 3IX7A 3OTWA 1JHQA 3ZLUA 4AG5A 1U4OA 2RK3A 4E08A 1BJKA 3SVTA 1N1DA 1OASA 1U7OA 1WD7A 1JIQA 2YY6A 2C9DA 1PR1A 5C8YF 2XB9A 1KTIA 4CODB 2VHVA 4M99A 4UZEA 3H18A 2XB4A 2IYSA 3LP5A 2UZ1A 1V71A 3RC9A 3S2YA 2FUG6 4S24A 4BKMA 4AL4A 3TX6A 2BUAA 3Q7TA 4UHFA 5E6RB 1YWGO 3HWWA 3IH5A 4BV8A 5ALJA 3SQLA 4ALKA 2OAQ1 5JSKA 4C4AA 5EJEA 4I1OA 1GQ2A 4QYIB 3QGMA 5FWYB 5KYVA 1VPWA 1QIKA 4E6PA 1KPHA 4RZHA 1CULC 5G4LA 3V00A 1QTNA 1MB9A 4FILA 1DBRA 4QOGA 5ALIA 2W6MA 1K68A 2PN1A 4UOZA 2JLZA 2F9LA 4DZTA 2PUCA 1SXJC 1NUQA 5C52B 3ZI4A 2B2XA 2HB6A 1WDKA 4MKGA 3NGXA 4AZSA 4R2IA 3NNNA 4B3MB 1EZ4A 2ZYSA 1IE3A 1NVBA 2I4TA 4XGNA 3T5TA 1ZN8A 1T10A 2SCUB 3GFOA 1AXGA 3C3PA 1OAOA 4LXTA 3KXPA 2HO5A 4IIJB 1CQJB 4N5LA 1SQGA 2DTDA 2ILTA 3FDFA 5CHYA 3I2HA 4DABA 4EYGA 4TMZA 1MO3A 1E79D 1SA0B 1VCNA 2W2VA 1IY9A 3CISA 2MMCA 3DNFA 3R6LA 4QC2A 3MK31 4AX8A 1MCZA 2R6GA 3KQNA 1AJEA 3BXGA 1EXWA 1SQSA 3ZXSA 1PZXA 1II8A 5DBHX 4HAUA 5DBIA 4DNPA 2O7VA 2WWTA 2QSJA 3G5MA 4ITUA 2FFHA 5LP6B 4EB0A 1CPYA 4KREA 4LFBB 2HK6A 2FZKA 1KBOA 3LQ1A 4YBZA 3L8ZA 1F06A 3WKCA 3H2IA 4Q9IA 2C8LA 1XRNA 1U9YA 3A1FA 4QNNA 3PITA 4MP3A 1SCIA 1QHYA 4AJIA 4E7OA 2FDRA 3BQ9A 1HTTA 4DUZB 3FKSD 2VLBA 3M2PA 1V5FA 4OPMA 1FZQA 2AQKA 1FDWA 2GKSA 3GPDG 4DEYA 5C80A 3NVAA 1ENYA 5TS2A 4K6GA 1AMOA 2Y8EA 1U2RA 3T5PA 2GPSA 3NQ41 6CHYA 4BZXA 2DH5A 2IDJA 1MO4A 2ZT7A 4ENUA 1Z06A 2FR0A 1LRKA 3GNTA 3IKJA 2IWRA 2ZI9A 2AEMA 3VTKA 4FC6A 2GAJA 2ZJOA 3OT5A 4LEIA 1HDIA 4COOA 1JDVA 2HW8A 2BW0A 2P3QA 2GPTA 3OAAA 4LZZA 1U63A 4BMSA 1IPEA 3ELDA 1ZU4A 2XODA 4BFCA 5CIYA 2VQ6A 2UZ1B 4RK4A 5IT4A 4XVQA 3M6VA 3VC1A 4E11A 2OESA 5HKLA 1MPTA 1ZLXA 1YDWA 3KKMA 4RE6A 3LZ6A 4KYIB 3F1KA 4BNGA 4RTLA 5CAEB 4G23A 1MQ9A 2J67A 3CR7A 2FUEA 1ZJJA 2VP5A 2Z6VA 3EA5A 4WKNA 2C0CA 3L8HA 4AJ4A 5CDSA 2C4HA 1WXIA 1GYQA 3PHBE 1S3SA 5J47A 1MC4A 4YWJA 1LF0A 2P0YA 4BB9A 4GOLD 2V3VA 5EGNA 3TSYA 1XSEA 3DD5A 4NYJQ 4TKVA 2IELA 2PJUA 2YC2C 3MGBA 1QC5B 3PNVA 2AZ4A 2YC4C 3B3GA 1ML3A 2OMEA 2NG1A 3HO6A 3ICWA 3P2JA 3SYTA 4DC0A 4EJ0A 4C89A 4YRRA 3RUDA 5C18A 2J41A 1AURA 1Z6QA 3VZPA 2WKWA 3IT2A 2I3DA 1JKXA 3A1UA 2ZDGA 3NANA 4MP6A 3STHA 1USGA 1EFTA 2HSWA 5FOVA 5T6MA 3IIEA 4U1RA 1Q91A 3DHVA 4I6JA 1IXYA 2QTZA 1NZJA 1L8AA 1JJFA 2IK8A 2C07A 3KB2A 3N53A 1E89A 1BCSA 3ICOA 1XL1A 1HZJA 4MEAA 3HR4A 4IKOA 4BB5A 3CZ4A 3OY2A 1CS4C 3BMCA 3PS9A 4FEGA 1P7YA 2BLNA 1C3XA 1QIFA 2FPOA 5CDHA 2RGYA 1WZ2A 3MWDA 1DV2A 4KXQA 5LKRA 5AXCA 3PUZA 3PUKA 3T3IA 3OUUA 8MHTA 4CLXA 4H18A 3C1TA 5B5SA 1A2KC 2D5IA 4DNQA 3K1TA 1XOIA 2OOSA 3UXEA 1XQXA 3VH4A 4M9XA 2H17A 4RGBA 5DCLA 1RZUA 1GITA 3D7RA 3M1AA 4KITB 3T99A 2GMWA 1UMCA 4MV0A 2P5SA 4RK7A 4FDUA 1MG0A 4MW6A 1N8TA 4I9UA 1Q3TA 5JS2A 1JLLB 4D9JA 2XCTB 4ZYZA 3H8JA 4YX9A 5BW6B 3VKHA 2Z4RA 2G5GX 3U3JA 5CG1A 1OTHA 4HVAA 5EE0A 1V1MA 2AFRA 3RRNA 3GGCA 1DUVG 2DHRA 3ET4A 4NYIQ 3ICEA 1U6IA 4HLUC 1B26A 1WMSA 1PVVA 2QVZX 3EEBA 1M0WA 2MSKA 1GZDA 2QP3A 3LUKA 2W4QA 2WPNA 3P0EA 1W5TA 3SYNA 3T12A 4WLEA 4E07A 2CWWA 5AJUA 4S1WA 3PQ3A 3ZXUB 2WZQA 4MEJA 1U8FO 1BGWA 1JHYA 2ZRBA 2FG6C 3IUYA 4J76A 4IDHA 4JKOA 4O2BF 4R69A 3TGWA 2AQIA 5ICMA 3AEYA 3B48A 5HTOA 1OWLA 4DT1B 4BN0A 5K0JA 3W1VA 1E94E 4J9VA 1XEFA 3K15A 3PUIA 4QBFA 5DNAA 2AUTA 1IHDA 2Q1YA 4R0NA 4Q48A 1WPGA 4UAJA 3AW8A 1SHUX 3D2LA 4FLFA 4MO2A 3W3ZB 1WPQA 4IIEA 2GK6A 1W85B 2F59A 4GYKA 4CGZA 1KQ3A 5GVRA 3WNQA 1NYRA 1SCAA 2VHQA 4RD4A 5EC8A 1QU2A 5GP1A 2F8LA 3FTQA 2AOUA 2P9FA 4GEGA 4XAQA 4Y2JA 5CP8A 4U7DA 3LQRA 5CLIA 2JZNA 4FKZA 3PU6A 2IYWA 1Z5GA 3KKEA 3SC2B 4AYXA 3P0JA 4MVYA 5FO1A 4Z4EA 3ANMA 1W49A 2FPRA 2VTDA 1QHXA 2VPYA 2YV2A 4M4SA 4MUEA 4WD3A 1COZA 1OILA 3IBSA 4UD6A 5DBOA 1P2DA 3OF3A 2O8CB 1ADYA 2ZIAA 2MSNA 4X44A 2IXDA 1OTYA 4KFTA 2IHTA 2QGZA 5EL0A 5G53C 4OJNA 3KB6A 3AJAA 3HWSA 4KGVA 3TX2A 3FLAA 4HBZA 3ZU6A 4B5KA 3LP8A 5KI6A 3ICVA 5ELXA 4YRFA 4ERNA 3IMGA 4PS1A 1KKLA 1R50A 1AF7A 3ZBPA 1LZLA 3O8CA 3FM9A 1HDGO 3LJKA 1EGVB 4LCEA 4R1SA 4G3XA 1BDMA 2ABWA 4RL4A 1EX7A 3QOYA 1WUIS 2VOEA 2G71A 3AJ9A 3G13A 3GEGA 2YICA 3JARA 1BXZA 3UW1A 3IHWA 4X64B 1Z0ZA 1JQDA 1GU1A 5KCZA 5C31A 3BT7A 4NOMA 3NYRA 3H4TA 3KQVA 5H70A 5SYAA 5GJCA 1FFEA 5GAJA 3W05A 4GNRA 3OFKA 4LWZA 3OIFA 3W2HA 1DAHA 1HYQA 1R4NA 3L6BA 4PLPA 2NMVA 4LJ8A 4MJXA 1THGA 1BH6A 4R5HA 2W70A 3V8NA 5T4HA 1XDUA 4MQEA 3ST7A 1BX1A 4W6ZA 1XCMA 4UEOA 1YQ9A 3WQSB 1PJ8A 3Q41A 4C0KA 3QU2A 4ESHA 5KOIA 3GBVA 3OOYA 4YRNA 2GZ2A 3F1LA 4FB5A 1SVNA 3G82C 2TYSB 2BGUA 1DZ3A 3KXKA 3MXOA 3UT5B 5DLYA 2O52A 4EVSA 1EFKA 4NFLA 1E2GA 5UKDA 5KINB 1XZJA 2UYGA 4WZAA 4OLAA 4RK1A 4R2WA 2I99A 2REOA 4YXWA 5DT9A 4AWAA 4NESA 1NR1A 4AI6A 4KIGA 2PXHA 5F2KA 3KEMA 2COEA 2QP4A 2ZSUA 3B3QA 1E3LA 4GR5A 1QYVA 1TUGA 4E2YA 3R23A 5IEJA 2DETA 4MXDA 3GFFA 4F04A 2X4LA 3BGOS 3C1OA 2PFSA 4M9ZA 4KUHA 1EVZA 1UAAA 4Z4GA 4HDAA 1NJ8A 3NHBA 4FQ7A 4LJ9A 3S2SA 3TM5A 4IEEA 4EX7A 4WI1A 4PLGA 4XQ9A 5H0IA 3B38A 3KR1A 2QMYA 4E14A 3L7JA 3FVQA 1LEHA 3PWSA 4B79A 5FPPA 3LLVA 4PYRA 1PQPA 4ZP1A 3RVDA 4ME6A 1DPFA 4K88A 4MVJA 3GELA 3PFHA 5D5HA 4P81A 2DBVO 2ZYGA 3A6PC 3FR7A 1ZRSA 3PSHA 3KE8A 3TEMA 2AJDA 4AMBA 1Q1BA 3AQIA 3CE6A 1WPRA 2PS9A 3TW8A 4ISBA 5IYZA 4Y8VA 2X58A 1BCRA 4G89A 5GY7A 4B45A 2K2WA 4HFJA 5IG2A 1YACA 3M6AA 1W4CA 2WLTA 5GM2A 1UM9A 2CDBA 4LYDA 1X80A 2H48A 2XTJA 4Q02A 2R4TA 3LDUA 1KZHA 1FCJA 1A9TA 1PTKA 5CVUA 5JBNA 1X39A 2C31A 2GCOB 6ABPA 4M7OA 2Z5GA 7YASA 1WCIB 5K0GA 4XJTA 4JC5A 3TO5A 4C6SA 4F6CA 1BH2A 3GPBA 3UHFA 1NKSA 1ORDA 4PWZA 3JD1A 2NSLA 4JLSA 5AICA 4Y0NA 3WFJA 5AW7A 4JYZA 3MERA 4JI8B 2VRBA 4U7TB 4M6WB 4BECA 4CG3A 5DRYA 3ZNQA 3OJOA 4GWKA 1SC1A 4JEMA 1BCSB 3CY6A 4C7XA 2BKLA 3AKZA 5D7NA 3Q5GA 3NR2A 4YMGA 2ZU0C 5BT9A 1JDUA 2HA5A 1R4MB 1RPNA 4P08A 1DV1A 2P9HA 3M5CA 3OHPA 1GPKA 1D1PA 3K0CA 1KO8A 2DPHA 3THYB 4YCJA 4IY1A 1BD4A 2ZE6A 4D3DA 1GQFA 3H87A 3DJYA 1BMTA 1N8NA 5J40A 3H11B 2ZUCA 4L9AA 3PA6A 3FVTA 3K7EA 3E3AA 3HVHA 4UTOA 4NU6A 3SDBA 1TO6A 3CVJA 1XLVA 2V8BA 3TOSA 2ZCVA 4QO8A 1RZRA 2W6NA 4QOEA 3MTBA 4O4LF 3VHXA 4FKBA 3JQPA 4MW2A 3B9RA 1BE0A 2BY4A 3LOQA 2CHQA 1JVNA 2WVJA 3HDVA 3RBAA 4RIEA 1SEVA 2DVMA 2AMJA 4L85A 1LNQA 2WG2A 4EYOA 4TTQA 4X94A 5KTMA 3LSTA 3ZE6A 3K30A 4ENSA 1T5BA 2J0SA 2WF8A 2WOJA 1P81A 2OEPA 1QPBA 1XK6A 1E60A 2FFRA 1NQVA 1R3UA 3C8DA 3GLHB 4PSCA 3UJ3X 4CM5A 3HVIA 3M1IA 3MMNA 3JQ8A 4R6WA 1P2GA 2HR1A 1UOPA 1Z28A 2Q5HA 3LFUA 4I1IA 4QHTA 1JEOA 2GBIA 3UOAB 1OFHA 3AIMA 5HKAA 4MWDA 1S8OA 2ZQ5A 4QXQA 1UDWA 1MAUA 4WZZA 1QH1A 1T15A 4ZAWA 2JLAA 3QUSA 5JZSA 4F11A 5LQCA 2AN5A 4BGDA 4ADSG 3OT4A 3R41A 4ZT7A 1EZ1A 3MYRA 2OCGA 1IG3A 2XBUA 4H17A 3H97A 2QYTA 3WHKA 1S2DA 4UAGA 4I5IA 2X4DA 1RWMA 3EC2A 4A03A 1BXRB 2ADOA 3NGMA 3DC7A 4A9AA 2OLJA 1MB3A 4ZAZA 3AESA 5DGXA 3R7AA 5BSGA 1SKYE 4DA0A 1XNQB 1IN8A 3U09A 1JIVA 5D3ZA 2ZKLA 3DV0A 3UJ6A 4GR9A 1H3NA 2JIDA 2OP0A 4O6VA 4DWWA 4YASA 2XBMA 3K0CC 4LJSA 3RVOA 2C82A 5LP6A 2HKIA 1AH2A 4US0R 3PQFA 3FDZB 2FHSA 4ZMBA 2CE7A 1FSPA 5BN4B 1JV2B 4TTVA 3TZHA 3QSGA 3VR2D 3W34A 2V1UA 2HHAA 4XRRA 2BP7B 4D25A 4IXWA 5HKOA 4TLDA 4OBXA 1W93A 1C29B 3JQ9C 1XYGA 3SYMA 1ZM3A 1JR4A 1JDSA 4JSTA 5KQGA 1IHPA 1R16A 1W8DA 4Y6GB 3EN0A 3N75A 4NV1A 5F5NA 3VZRA 4IIJA 4K9LA 1OAAA 2PVCA 1KI9A 4OI4A 2PEZA 1WBJB 3T0IA 5JPDA 3WS7A 2IOFK 4CMEA 3C45A 3ULKA 1CE8A 3GLIB 3L6OO 2H4HA 3N74A 3RK4A 4HNUA 2J08A 3PGXA 5B6JA 5L4LA 3LT4A 4W9NC 3CLSC 4H3SA 1XLWA 4BMVA 1JKJA 3DGFC 1UH5A 2JBAB 3A0UA 5HUQA 3L0SA 2WSBA 3JQGA 2AS0A 5CU7A 1NRIA 1FJXA 2O1WA 1N9ZA 3OQMA 2I8LA 5K3OA 1PF7E 3VH2A 3PR1A 1IRXA 1WY5A 1L1FA 2GDJA 3BGSA 2FEMA 2ZUDA 2C3PA 4O8CA 3OZ7A 1IDN1 2EQAA 1JEQA 5MN6A 1KF0A 2X0DA 3ZS8A 5EXSA 1TF5A 3ZGXA 4YV7A 3LXRA 4NYIR 2WSSA 2OFFA 3U4QB 1J2JA 5A1JA 4B48A 1SKUA 1ULHA 1NVEA 1M1YA 3O8OB 5DM1A 5A3JA 4UE6A 4FFWA 3RWBA 4PFSA 4Z7JA 1G1AA 1N0UA 1ZM2A 3UG7A 3GV0A 4X5OA 3GGSA 4PICA 3QMPA 2Q5LA 3HH8A 4L6AA 1B3BA 4W5HA 4E5KA 2O8DA 1IN1A 1QGED 2HF8A 1WUJS 5GOZA 3IVRA 2J33A 3NONA 3GLQA 4AQYB 4BX0A 4Y30A 1QFMA 3IP7A 5LCXA 4JQZA 3DWIA 3UBMA 4HFRA 4NDZA 3SLKA 1V6SA 1T9KA 3T4EA 1SXIA 4OQXA 5EKDA 4DIEA 4DY6A 1HTBA 4OXRA 1JJIA 2B20A 1ECFA 5TS3A 3U62A 4DBZA 1ONBA 1LTQA 2BFDA 4G84A 4BVFA 4JXXA 2G7ZA 4J7UA 4X84A 2AG1A 3G0GA 3ZJ4A 3A6ZA 4KBYA 3O6VA 4EDHA 2QZJA 2AC4A 1Y9JA 5A4AA 3DSRA 4GP9A 1YQEA 1QAQA 4DGQA 1KDPA 1LPAB 1MGPA 1MU0A 3CH4B 2NZ8A 3MJVA 3CG4A 1LGYA 2V9CA 3SHWA 2D8AA 4QJBA 4MJ7A 5FFMA 5JZMA 4XWGA 1LDYA 3IIKA 2P3SA 4KC0A 2G1PA 16PKA 2D13A 3TAXA 2V7TA 3O84A 4G5FA 1K0FA 2YHSA 2YVQA 2J1LA 4RANA 4C87A 2WB2A 3BHMA 1JN0A 3JR3A 3QSYA 2FSPA 5BQXA 3UMRA 1Y8ZA 3QEJA 3AFHA 1TA4A 3GGPA 1DXYA 3RV3A 4CR7A 1JQBA 4OHWA 5MF6A 1CUFA 1VA5A 4R5MA 4G4JA 4A2WA 4CTNA 3OQVA 1GPYA 2BRUC 1GFWA 4FFLA 1BA2A 1JZSA 5TEVA 4HUQA 1R0BA 2BHSA 3GA5A 4MITA 1E7SA 2VCHA 3A2MA 4J4TA 4ML3A 2YVLA 1VJRA 3ZY5A 3LZDA 3QVUA 2VDNB 4OUDA 3OWXA 3GJ0A 3KSZO 4DLBA 2Q9BA 4P5PA 1ZJYA 2XWPA 4N0QA 1JXMA 3SOZA 2O9JA 2Z08A 4RH0A 3VH1A 1LJLA 1FY2A 2HMTA 4WKGA 3R3WA 2WVAA 1XEWX 3LGXA 3F6EX 4MK4A 3V7UA 4JS0A 1Z3IX 3GUVA 5DTRA 2F1HA 2CL6X 3T7DA 4HVCA 1N57A 1CW2B 3F7TA 4P98A 4TUYF 2XYHA 4Z9AA 3RNLA 4PNEA 5J2TA 4HF7A 5IBQA 1QB8A 2NSHA 2OYCA 4L15A 3VV2A 4ENRA 5BT8A 1XZLA 2AFVA 3RUAA 3DAHA 3FWYA 1XZCA 3S7TA 4TQ9A 4BTVA 2I6XA 1XC7A 4C1BA 5C37A 5IZCA 5JRDS 2UU9B 3R9XA 4H3VA 1RBZA 3CVVA 3Q8LA 3DTYA 3MMXA 1KZYC 2OVFA 3ETGA 4V0LA 1R0YA 3HM2A 5ALOA 6LDHA 1MA3A 1CU1A 1O6ZA 2KLBA 2Q7DA 5I51A 3BXPA 3P9XA 3ZC3A 1T5HX 1HE8B 3EBPA 2WSIA 3OOJA 4NU0A 4Q03A 3T9BA 4G63A 5BSKA 4Z4QA 4DNOA 1W47A 2HWUA 5F23A 5FR1A 4PBRA 2I2BA 1E1DA 1Z0SA 4UM8B 2XUOA 1NUTA 1PJSA 3OPYB 4UQOA 2D2XA 3A7DA 3N3BC 1ZJWA 2ZZMA 3ORHA 1IOZA 3EQ7A 4UAUA 1X94A 1TKCA 2PKQO 1R00A 1TW2A 4NQZA 3IO5A 3E1SA 4IDDA 2N42A 3PFKA 3K9LA 2C5HA 4IHJA 1JBKA 3TIFA 4PG6A 3GT4A 4DILA 3UJ8A 3B78A 4BMYA 3TN7A 1J5EB 1ZVKA 1APBA 1NFFA 2C9OA 1Z8HA 1N4DA 1SPXA 3OC0A 2GUGA 4W7HA 4WE3A 3NHWA 1K5GA 1C9EA 1ZN7A 2J9ZB 4C3VA 3NDBB 3ANNA 3JYLA 1I2AA 1TT7A 3PEVA 1TCCA 4J0EA 4WY5A 2BFBB 5DGTA 1SUIA 3L49A 1B2RA 1NSYA 3W9SA 4ROTA 4HQNA 4J91A 4LTNA 3ZGNA 2BM9A 5BN4A 3FCYA 3LRXA 2OG2A 3RFFA 3CFYA 1A4IA 4IW3B 2XGMA 3AZPA 4R7ZA 3EAGA 3EWAA 4FNAA 5L9AA 4X66B 3TNFA 2A94A 3B1XA 3AR2A 1H6CA 3TBKA 2ZSAA 3WLTA 5LZ9A 1XMQB 1DQYA 5JTTA 3DZFA 5FDFA 2O5RA 2GCIA 4J2OA 4W4TA 2B0JA 2H4YA 2A5LA 3VNBA 3NFRA 4QJ5A 4TRJA 1MX9A 1WB5A 4YT2A 2QWXA 1GPLA 4HAVA 4R9VA 3RSFA 2PUAA 3I64A 1P60A 4V0OA 5ITZB 3B7WA 1TU3A 2ZWAA 2ZJ4A 3FDJA 3QG1A 5IULC 4B73A 1VP9A 1EVIA 4DA6A 1D6MA 4DXDA 4ZT4A 2VT7A 3FGPA 4KVAA 5CVCA 1BOOA 1H6AA 2P3OA 1NT4A 3CZ5A 3OEED 3RPEA 3CF4G 2Q29A 1RU3A 1NTRA 5B4UA 5ICGA 2AN3A 4KACA 3D8UA 1DT3A 1WLSA 1EA7A 2C3UA 1D9XA 2ORVA 2OTCA 1EB9A 2GH1A 3I04M 2RG7A 3MTQA 1JVBA 1Q0UA 4ZK2A 2HPZA 3ORQA 2PLFA 1K75A 2YUIA 1X9IA 3MWJA 4G5XA 3KJNA 4Q16A 3AF5A 1KI6A 3FYTA 3Q15C 5CYGA 2QLTA 1FLVA 2I2CA 3E0XA 2G28A 1KZ7B 1XVUA 1K7FB 2GTIA 2HA0A 2EIXA 2P9YA 2I22A 5C8XA 4GHWA 4PXYA 3ZYCA 1F8GA 1HE2A 1C9JA 3HNPA 4ZGBA 3HKCB 3J7TA 1JECA 5D01A 3WJ7A 1X2EA 1HDEA 3R0XA 4OIFA 3WGOA 3H5RA 4Y1GA 4N5NA 3MGAA 4PC2A 1T5IA 3PGLA 3QLVA 1NW4A 2X41A 5CFMA 1DJQA 4LY6A 4L72A 3WGLA 4PN7A 4IP0A 3U49A 2L17A 4MUJA 2X23A 3DCJA 3HJTA 5EZQA 1KH3A 1ZH0A 4X93A 2WTNA 1AF4A 2HPHA 3AHDA 4HTFB 4IHKA 1YTLA 1E3WA 2JGRA 2CUZA 4KHZA 5DBFA 5CBPA 1M1NB 3GLKA 3IODA 2CYCA 1N8KA 4NOKA 3IKVA 2PGXA 5AVWA 1LWOA 4QHYA 1SHTX 3GRRA 3G8AA 4YRDA 5D7BA 5HDBB 3RU9A 1RQ7A 5JG7A 2H1VA 4MRPA 1H2RS 3GLGB 4YHBA 3CPSA 2GCEA 5HE8A 5BMOA 2XUJA 2FZCA 3EUWA 1Y5MA 1MX5A 3D3WA 3II6X 5AM3A 2PTHA 1ETUA 3WDMA 2HQ1A 2V7VA 1IAVA 1PYGA 3SQXA 2V6BA 1JU4A 1JR6A 1K7XB 2FWJA 4OK6A 4Q1BA 3W4IA 3X2SA 4R1OA 3OQOA 5DN9A 1CS0A 2X2EA 2HDOA 1QYWA 2WAMA 4J0KA 1WSBA 1KI7A 4ZJPA 1ABBA 3V7NA 4RYDA 1VFNA 2GYYA 4TROA 4BOYA 2R11A 1I1NA 2CMKA 1P6QA 2A9QA 4MV4A 5A62A 4I81A 1ORVA 4PSKA 3ZLVA 5B3AA 5H4GA 3ABSB 3G1TA 4H6WA 4YLEA 5E6UA 4F6RB 4MKXA 3E3MA 1C1HA 3U3MA 4BLUA 1JLKA 3W5IA 3A31A 3VOAA 1OFUA 1RVV1 3P45A 1DDGA 2HNBA 4FSXA 4P58A 1KQPA 1IJFA 2PT9A 1R4ZA 3KUKA 1C3LA 3FWPA 1SFRA 3O1JC 4MV9A 5JR3A 4KV7A 1LRLA 1N5KA 5IYZB 4EG4A 3AVTA 1ESZA 5FBKA 1BJRE 5L51A 5SICE 5LJLA 1VIAA 3G88A 1HNZB 2NIPA 1YC5A 3O0DA 2QJFA 4I9NA 4A1OA 4GGOA 1LX7A 2YRXA 2DZDA 1RFGE 4MWZA 3SIXA 3CV3A 4BVGA 1T1RA 3H8WA 4FZVA 4BVAA 2G3YA 1BKSB 1O9GA 1UXKA 3H9CA 2RIRA 2JGAA 2JPDA 4DEVA 5FXMA 4F3KA 4DLWA 2W2XA 3D7LA 1TF2A 3WIVA 5JHGB 2HA7A 2W8BB 3B6ZA 4HDOB 1GP2A 4KCGA 3M70A 4EDFA 2ZATA 2Y1XA 4KJXA 4U6SA 3OTIA 5DGDA 5I9MA 1G6Q1 1ENZA 4A6DA 1KQOA 5FOTA 5KJEA 2GKOA 3HJFA 4F06A 4CF4A 4X1IB 2FA9A 1XLUA 1X7ZB 4ED9A 5KNDD 3BD6A 3PDIB 1JEAA 1A8QA 2XLCA 2UZAA 1EJ2A 3RTCA 2G17A 3NLLA 4JJKA 3FZNA 1WQ4A 4XPIA 1EFLA 2ZSFA 3HVJA 4OOFA 3AM1A 3ZVLA 3TWOA 2C3YA 2VNIA 3N2KB 4EJ6A 2EL9A 1Q0PA 2X6QA 4L4ZA 2WIGA 2ZK7A 4RXMA 4OF4A 2PNJA 3U7GA 2BH2A 4CUZA 1FLDA 1KQGA 3OEWA 4IF6A 3HA7A 1ORTA 4ZICA 4B8ZA 3OE5A 1P77A 2WKRA 1BQ4A 3D9QX 3E9CA 5CEJA 1JDTA 4G36A 1PL6A 1KXJA 4B6OA 1PZGA 2X0EA 1KH2A 4NHEA 1TQ8A 1EDBA 4ZV9A 5CB8A 5DHQA 1GFSA 1NX9A 3I4FA 4I5DA 5CA1B 3S1AB 1Y4ZA 4DLSA 5HVNA 4EI2A 5I7FA 4QFMA 4TMFA 4R7GA 4I99A 4F3YA 4DQKA