3FWPA

X-ray structure of uridine nucleoside phosphorylease from salmonella typhimurium complexed with phosphate and its inhibitor 2,2'-anhydrouridine at 1.86 a resolution
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
251
structure length
248
Chain Sequence
KSDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The X-ray structure of Salmonella typhimurium uridine nucleoside phosphorylase complexed with 2,2'-anhydrouridine, phosphate and potassium ions at 1.86 A resolution.
pubmed doi rcsb
molecule keywords Uridine phosphorylase
source organism Salmonella typhimurium
molecule tags Transferase
total genus 87
structure length 248
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fwpA00
3UAWA 1Z5NA 4PR3A 5CYFA 4DANA 2OC9A 1ULBA 4DAOA 1PBNA 4TYMA 4GMHA 1SD2A 4GLJA 1NC3A 4NS1A 4TXMA 1ODIA 1K3FA 5B7QA 1T8WA 3SCZA 4G89A 5IU6A 1NC1A 1WTAA 3KUKA 3KVYA 3OOEA 4TTJA 1ZL2A 4LKRA 1RXCA 3EEIA 4WKPA 1Y1SA 4F2WA 1JDZA 3FUCA 1Z5PA 1A9OA 4F3KA 3DDOA 5C80A 3NM4A 3OZBA 1A69A 1U1FA 1RSZA 3OZCA 4D9HA 1A9PA 1YQUA 3BL6A 3GB9A 4IP0A 3ONVA 5DK6A 3K8OE 3MMSA 1Z39A 3T94A 1K27A 3P0FA 5CCDA 4DA7A 1V41E 4OGLA 2IQ5A 1ODLA 4L5YA 1T8YA 3IEXA 4G8JA 2HSWA 4M7WA 1A9SA 2OC4A 1K9SA 4MCHA 3ODGA 4U2KA 3UAVA 1SD1A 4TTIA 2A0YA 3E0QA 1ODJA 4K6OA 4JOSA 2B94A 1LV8A 1C3XA 1YBFA 1Z5OA 1Y6QA 5B7NA 1NW4A 3OZDA 5KB3A 5JPCA 1RR6A 5CYGA 1Z33A 4TTAA 4D8VA 1Z34A 1Z36A 1A9QA 1Y1RA 1YQQA 4EB8A 5K1ZA 2I4TA 1JP7A 3UAZA 2QPLA 5F7ZA 5F73A 1Y1QA 1OUMA 3IOMA 1TD1A 1PKEA 3DJFA 4TS9A 4TXLA 1JDTA 3KVRA 4DARA 3PNPA 4F2PA 4D8XA 3PNSA 1Y1TA 1V3QE 3NM6B 3F8WA 1RXUA 5EPUA 1T8RA 3MB8A 3LGSA 3FWPA 4YNBA 4OJTA 1TGYA 5IFKA 5F7OA 1OV6A 5CXQA 4TXJA 1PR5A 4YJKA 1VHJA 3DF9A 2HWUA 3NM5A 4M1EA 4WKNA 1PK7A 3PHCA 2HRDA 3DP9A 4RJ2A 1CB0A 1TGVA 4WKBA 4L0MA 3D1VA 1OU4A 4DA6A 4PNPA 1JPVA 4R2XA 3KVVA 4LNHA 3OF3A 1SQ6A 2QSUA 2A0WA 3PHBE 4R2WA 4G41A 1PR1A 2AI3A 4KN5A 1YRYE 2ISCA 4LNAA 2A8YA 2AI1A 1ECPA 4LZWA 4FFSA 4P54A 3OPVA 3BSFA 1U1DA 3UT6A 1JE0A 1B8NA 3TL6A 1JDUA 4L5AA 1V4NA 4LDNA 3NBQA 3LA8A 4TXNA 1PK9A 2AC7A 4ECEA 5CCEA 4WKCA 3UAXA 1JE1A 4QAQA 1T8SA 2OXFA 2OECA 5F7JA 3OOHA 1CG6A 4BMXA 1I80A 4D8YA 4JP5A 4DA8A 3KHSA 4BN0A 2ON6A 1B8OA 1RT9A 3GGSA 3QPBA 5EUBA 1RXSA 3E9ZA 1PR6A 1ODKA 4YMLA 1V2HE 3E9RA 5F78A 3UAYA 3DPSA 4QARA 4BMZA 3OCCA 4H1TA 3EMVA 1M73E 3K8QA 1T0UA 4E1VA 4UC0A 4TS3A 5B7GA 1Z37A 1ULAA 1FXUA 3P0EA 3ENZA 4F3CA 4F1WA 2P4SA 1JDVA 5B7PA 3EUFA 3FOWA 4OEHA 4WKOA 2HN9A 3FAZA 5F7XA 4NSNA 2I8AA 1N3IA 2Q7OE 2RJ3A 1TCUA 4QASA 1A9RA 3U40A 4EARA 4X24A 3OZEA 3INYA 3FB1A 1Z35A 3KU4A 4I2VA 3C74A 1PR0A 1ZOSA 1Y6RA 1TCVA 1OVGA 4JWTA 4R31A 4DA0A 1PWYE 3EUEA 3FNQA 1RCTE 4OF4A 1PW7A 1PR2A 4MARA 1JYSA 5CXSA 5ETJA 1G2OA 1Q1GA 4NY1A 4OY3A 2XRFA 4L6IA 4GKAA 4DAEA 5F77A 5I3CA 1U1CA 5EFOA 1U1GA 1PF7E 4OGKA 5F76A 1OTYA 3O4VA 1SJ9A 1XE3A 2AI2A 4MCIA 4TXHA 1LX7A 4DABA 4L5CA 1LVUA 2BSXA 3BJEA 5FAKA 1VFNA 2PGAA 3O6VA 3BGSA 2GUWA 1YR3A 4QEZA 2QTGA 2QTTA 1Z38A 1RYZA 2H8GA 4M3NA 1QE5A 4QATA 1JDSA 1PR4A 4YO8A 4D98A 4QFBA 1V45E 4GLFA 1RFGE 1V48A 1A9TA 1VHWA 1U1EA 1VMKA 4BMYA 1RXYA 3LBAA 1OTXA 2A0XA 2QDKA
chains in the Genus database with same CATH superfamily
4J0GA 1BEEA 2JJMA 3KKLA 4Z9AA 4UVIA 2DUJA 1QUFA 2WTNA 1A2OA 1FW8A 4R1PA 1KRWA 2N3ZA 1T3LA 3HABA 4FR5A 4EGSA 2OAP1 1MFPA 5FTKA 1E7QA 2GEUA 4OI0A 3R0XA 4PYIA 4DLXA 4DMKA 4TKVA 1IPFA 4B47A 2CUNA 1RXEA 2KE5A 4DHWA 4O1MA 3QKRB 2Q8PA 3CLTC 5TNXA 5IW8A 3TRFA 2AFIA 4KVZA 4JKIA 3W77A 4HP8A 5DV9A 3ZHCA 5LKAA 5KNBD 2FMUA 3HCPA 4GMHA 3NIBA 1BGWA 2YZKA 5ITZB 1G3UA 2FW1A 4MJ3A 2VP0A 3Q7EA 2VAPA 2CDAA 3RYIB 1I0ZA 2FP4A 1Z88A 2YRWA 2I1LA 2Z9BA 4AW9A 2O5CA 3U56A 2J3MA 1O96B 2B6HA 2ASVA 1I1OA 1U3WA 4FU0A 3ZNQA 4C0JA 1PVVA 3FTFA 1DAGA 4WLNA 5JANA 4FCWA 2PRJA 3D7MA 3PKIA 1KDZA 4ZYVA 1ENOA 1I01A 4LKRA 1BDMA 4I19A 1XMXA 2W6CX 1YC5A 3N87A 5L3VA 3NC1C 3RYFB 2R5WA 4ECAA 2EFDB 3RF7A 2IYEA 3AEKA 1KDTA 1NHWA 2ORVA 4TL6A 1SQ0A 3JY6A 3FM9A 2EYUA 3T34A 3TDMA 4JKOA 3AI1A 1H2BA 1RHQA 4MUBA 1KDVA 1I10A 2OYCA 4UXHA 4DPKA 1EWTA 3L0ZA 1CR0A 5KJCA 3ZDBA 1FUYB 1Z5GA 1KYQA 1NM5A 3FJYA 1V8PA 4JT8A 4U5XA 4EFLA 5JARA 4IVPA 1ESMA 1JWBB 2GTPA 2HIAA 4OH1A 4QTUB 4BP9A 2GCOA 3GMSA 3V2UA 2R7NA 3BMCA 3DFZA 3DW3X 3IQXA 4JJKA 1YBAA 4KXFB 2IH5A 2VSOA 5ALUA 2DSTA 5GZ1A 2ZKLA 4IVQA 1CJCA 2EBHX 2RONA 4ZVQA 1BTOA 2ZJFA 2WWRA 1XCLA 3RANA 2C97A 3MTGA 2O7NA 3OLQA 3OOJA 4PZUA 3N7TA 1K2VN 1NP3A 2ZJZA 4M55A 3PTAA 1G6KA 2O2JA 2C9ZA 1W76A 3G8BA 4O3MA 4R81A 3D02A 4P32A 3HY6A 1Q1EA 4TKZA 1LDBA 1NYTA 1R8SA 3M49A 3ZN2A 5I51A 3I0MA 3STYA 2VNKA 4KIUA 3SSMA 2VRCD 3C16C 3OFKA 2HBZA 3B5JA 5BSHA 5B2EA 5JWOA 3GFPA 2CE7A 4RZXA 1JJFA 4U2BA 3PXAA 4GNKA 4CIWA 2AV6A 4NEGA 2DRIA 3ZBUA 5EVJA 3AVWA 2DBZA 4L08A 1VDMA 4GPBA 2IU4A 4MPTA 3WK7A 2VUUA 2JIZA 4B6JA 5DRTA 2X6RA 3E9YA 3DZHA 3V7YA 1GPAA 3I5AA 3WFJA 2FLWA 1XA0A 4Q1FA 4GKVA 4WFIA 4MVWA 3VTKA 3WKAA 5H3LA 1B00A 5CB4F 4B79A 1TMYA 2XPCA 3P94A 1DWOA 3C5EA 4D81A 1EUDA 1KIAA 1Z8DA 4TMKA 4BLRA 4WCFC 1CX9B 3E4CA 5KOYA 2G17A 4LGMA 2Q3JA 5I9SA 4R7ZA 2LDXA 2WG0A 4LA4A 5HJ2A 5AVWA 1D5CA 3BJIC 2GPYA 2BR3A 4IQ8A 2HRQA 3Q85A 4HV4A 3SHWA 1X8XA 3CRW1 3N6XA 2BIFA 5CFLA 2GYUA 2ZJ4A 1NW4A 2Q5LA 2YOHA 3OZDA 4J94A 4Y30A 4YV7A 5FBLB 4TSKA 2J31A 2O2IA 5JPCA 1R9MA 4RQBA 3MGAA 4BU1A 1U5CA 2GS9A 2AQ8A 4EY6A 1CR6A 3PQ8A 4MGKR 3HXKA 4B6GA 1WD7A 4RDCA 4W1QA 2Q8QA 1AE1A 3D31A 4KE8A 2G1UA 3EZ6A 1UIRA 5BN5A 5JS7A 4PZEA 4O4HF 2IYVA 5FUXA 3GEGA 2C9OA 3HZOA 2OA0A 3W5JA 4Q37A 4B33A 4EGAA 3BIOA 4E0BA 5BNTA 4XX0A 4CV0A 2NUAB 1JLLA 3TNYA 1BOFA 5FTWA 3E5MA 1TQDA 3PC8C 4P7GA 5B12A 2PS9A 5BQOA 1UXHA 2ETVA 4LZAA 3EAGA 2XF8A 1TLLA 3BTSA 2V97A 1R5NA 1JBEA 1V25A 1NP7A 1XZ8A 2A5YB 2CGEA 2B36A 2ZQYA 4JZKA 4WESA 4AK9A 2IU6A 4R0MA 3PNPA 1M2NA 1U6JA 3ZCTA 1E7MA 2R5NA 2WB4A 1N75A 1N2SA 2ZS8A 2OG1A 3IHWA 2KMLA 1SUBA 3BDIA 3G2IA 3N6VA 3Q4GA 4I1OA 4J9VA 1JMYA 5CPFA 3RSOA 4YRZA 4P4NA 2V9PA 2ZE7A 3DDHA 3EQ6A 1YVEI 2GH1A 3BA1A 2VT7A 2NUTA 3VSBA 4GS5A 4N6NA 4U4AA 4CIVA 5IFKA 3GLHA 1TLFA 1ADYA 3T7KA 1DCMA 1UFQA 2GETA 3V32A 4E6PA 3H9JA 3PP8A 2EZUA 5IPFA 1SULA 1SUFA 3DBLB 2PWBA 4Q05A 2MOKA 1TX4B 4B3SB 1RBYA 1Z63A 4EG3A 1DFIA 1HRKA 4U02A 5ISMA 2QL9A 1WDMA 2WKQA 2WZQA 4PYQA 4QODA 1WLSA 2FSHA 5REQB 3S2GA 1B0UA 1BGVA 2EGUA 2FLVA 3DMTC 3NHZA 4YRFA 1W6UA 4BNLA 1FYFA 4KFRA 1H69A 1JSLA 3KZXA 1UBRS 2ZR9A 5DLPA 5DTIA 5IARA 2X4DA 3WQSB 1W36B 2CLCX 3BTOA 3C7CB 1JGTA 2D2IA 1MQAA 3AEXA 4EHNA 4BLPA 2JEZA 4DSNA 4B73A 1WCWA 2OXEA 4II3A 1COWD 4KHZA 4LWZA 5HS6A 1OB5A 4C14A 1CUFA 1USIA 3AKEA 4JLKA 4JSRA 4ZOLF 4AL4A 3RHZA 1EG7A 1U98A 2CNWD 4K26A 3SIPA 2DBYA 1OXVA 2OGSA 3AFIA 3R7WA 1U4NA 3S2IA 1NX9A 1O7JA 4RHCA 4JXXA 3PPIA 2P9CA 4BB0A 2EHDA 1LF0A 2O14A 4A73A 3UC5A 3TLEA 3JQAB 5KYYB 1CUSA 4MS1A 2QMEA 8OHMA 1H66A 1KDPA 2TECE 2NTVA 1WUKS 5FUYA 4D82A 4M46A 4J8PA 4Z4FA 4KXWA 1ST3A 5T8KC 3T7EA 4CGZA 1Y1KE 4XGRA 1OLOA 3T54A 4YRNA 3PC2A 1CUZA 3EVFA 1FC0A 4Q39A 2VNAA 2C7QA 4U8HA 1T91A 3RGGA 3A2KA 3K9BA 1I9GA 4QRHA 4RMNA 2QE7D 3LHDA 2XQGA 3PE6A 2BTEA 1FFAA 1XI2A 3HL4A 1YJCA 2G40A 3PR3A 4XGKA 1MB4A 4JELA 2IYLD 3WKBA 1NN1A 3GC6A 3JAKA 3V6MA 1QMPA 3V8BA 2HU5A 3H18A 3ZPXA 3D2LA 1JLSA 3HEAA 1N0VC 3W2TA 1IY1A 4RJKA 2E3JA 1E4EA 4TLMB 1CNMA 3AU8A 1TMOA 2CVOA 2FCAA 2Q3MA 2IXEA 2V6BA 3DXZA 4HQ0A 4RGQA 4TT3A 3OIYA 3HWSA 3WRYA 3ILVA 4UATA 4HGYA 4JH0A 5ALRA 1IZZA 3T3HA 1RPZA 1ECGA 4LX8A 1BS1A 4R05A 1KJNA 1QCYA 4V1CB 4PPQA 3ZWOA 4BO0A 1A7AA 4C7JA 3H9GA 3DH0A 2D5AA 3GDGA 4HBZA 6REQB 5HZGA 2Q3CA 5P8WA 3OLCX 3OZIA 4OGGA 2OECA 5IM4A 3AJDA 2XZLA 3AVTA 2BJWA 4KB5A 3R5JA 2FDCA 1QDLB 5GAJA 1WDWB 3MMPA 1EEHA 1P29A 3FWNA 1HE5A 3KBOA 4OBXA 1NASA 4BXOA 1ARZA 3LH5A 4V0ME 3ROQA 2J4DA 4LV8B 2EAUA 1US8A 6LDHA 2BKLA 4MJXA 4UKDA 5E9JA 1G17A 1Q84A 1A88A 2HO4A 2XGMA 4CMIB 2SCUB 5G4KB 4NATA 1WNFA 3HKBA 1NBWB 4JJ4A 5TQ2A 1MO3A 4YI5A 2WJPA 1RM0A 3RABA 4KKVA 3AUYA 4C6TB 1I6WA 2FRVA 1AQIA 2JJ1D 2BE7A 3QLJA 1E1NA 1XOIA 2BM9A 1ZH2A 2XNDD 1D4FA 1SQ5A 2FNAA 2A7XA 4MJLA 4H7IA 1EFPA 2CVFA 2WP0A 2WPNA 2C2KA 4JODA 1PR6A 4J29A 3DBRB 2RMKA 3SSOA 1MT0A 2ZRPA 4QVIA 1PZMA 1FRQA 1UXGA 2VEOA 1UBOS 2A3NA 3DYIA 3UAYA 4FB5A 4CLHA 1FBNA 4QU5A 3K73O 3PDJA 2BC9A 3HYNA 3TZLA 4BMZA 3G82C 3MWDB 3AUFA 2SICE 2BKXA 1UJ6A 2VPPA 2QHXA 3PX2A 1G291 4G5HA 4TYNA 4OXNA 1YWGO 4A82A 4E1VA 5D3MA 4ITVA 2X6TA 2P9HA 1QO0D 4RH3A 3UB4A 3DXXA 3DL0A 4D9JA 1A4IA 1E96A 4V1CI 2QU8A 2IA5A 1OXSC 2MSCB 2V4ZA 2H5EA 3MF4A 3W8DA 1ULAA 3TBKA 1Z0ZA 3I9JA 1Z0AA 2FMTA 3NHSA 5K3FB 1Z7GA 4TKLA 4NQZA 4UM7A 4Q01A 1X7GA 4NICA 5JFOA 4XPIB 1ENYA 3HH8A 1FS4A 4KL8S 4E70A 1KQGA 4D4JA 3DZ8A 5JS2A 1YL7A 5HKKD 1P0IA 2QN8A 4DUGD 4TUYB 4FFPA 4C20A 1YHNA 3NW9A 4M1WA 3V2HA 1ECFA 1AT1A 3CUEF 3KL2A 4HYEA 4ZQGA 1RZUA 2B4TO 2PDAA 2QTLA 1XEAA 4A5OA 2YN2A 2IK8A 3CCFA 3CF6R 3F5SA 3FI0A 3GLKA 1U1IA 3ZCRA 4OYHA 4NECA 3LY8A 2VH1A 4D0NA 2CLOB 5FWAA 1XC7A 2VDUE 3AF1A 1PTKA 3D81A 2BZ0A 3BGVA 4F6LA 1T9GR 4LXUA 2NGRA 3GLIB 2EJWA 4CEJA 2C2GA 3WB2A 3IXQA 4N0MA 2WWFA 2A5GA 3G9TA 1Q0TA 1Z6YA 1S3SA 1L5VA 3F7OA 3PL1A 2VFAA 1UC8A 3GH3A 4CIXA 4JSYA 4QUKA 3A36A 1YB7A 1KQ3A 1C1XB 1G5FA 2D1TA 2PYZA 3C6BA 1O9BA 3DOEA 4JI6B 5HQ3A 3I04M 3HVUA 3OP1A 3TLAA 2ODPA 3OQOA 3D3WB 1OX4B 3GDFA 5TXGA 3RH0A 5CM8B 7REQB 4KREA 2BAGA 4L0QA 4O2AB 2H4FA 4YFYA 1ONPA 5F2OA 4AD8A 1YOBA 2YMQA 3IBCA 1VCOA 1E7RA 2XMZA 4UTPA 4E1AA 9GPBA 5I7FA 3A6GA 3KD3A 1Y6GA 5L3SA 3C39A 2Q4EA 3PJEA 5C4GB 2CBXA 3PFFA 1JG1A 1J21A 3GEBA 1BVRA 3RTEA 2I76A 3WNDA 5AESA 3OKFA 3DM9B 4DV1B 2Q1YA 2ZYUX 5I9MA 2IL1A 6CHYA 1AKWA 1XMPA 2DT8A 3KOXA 4BO2A 5FYQA 2D06A 2EWWA 1CUWA 2X8BA 1TEXA 4FWBA 1MRSA 2VHUA 3AJRA 1JG2A 1J2YA 2VWGA 5ARBA 2QW0X 3VV3A 4HLCA 1M9NA 1OLUA 2QRZA 3CIFA 4OHFA 5B55A 4DEYA 2X1MA 4U9IS 4DR6B 1DHTA 4RIFA 5F3RA 4YV1A 5FAKA 3GCXA 5JVDF 5I9LA 4ARIA 1JSRA 1UFVA 4AQDA 5EKDA 1GADO 4ITRC 4PIMA 2VHTA 1A76A 3T1OA 4GP9A 4MO9A 4JI2B 3Q2KA 1O6BA 4ZVKA 4ZVPA 3MRXA 1Y3DE 3PQ3A 3HSYA 3KTOA 5ECYA 4MLZA 1IEWA 1FJ2A 1AF4A 2H92A 2QW1A 2VPXA 2FWJA 1BDJA 3AK4A 3KWLA 5EHGA 4A0RA 5DTMA 3DBVO 5JRDS 3BXOA 3FCOA 5LQSA 3WLLA 2Q6OA 4EHDA 2JAPA 3KKEA 1SG6A 5SYAA 1LPMA 4CT0A 4ENQA 1QE5A 1EX9A 2R4QA 4B0PA 4OUDB 4F2DA 3K6SB 3PBKA 1PR4A 2YHIB 4EY8A 3OWHA 4E6EA 3TSAA 2R8YA 2R1TA 3JALA 4JC4A 4PFSA 5E7JA 4CKBA 3TJZA 3WRWA 2DBVO 1YDHA 1GY8A 4ZEVA 4UEQA 4R8KA 1PV4A 3EW7A 2VSQA 2A86A 3EVEA 4BCBA 4JC0A 2RAPA 4FGJA 3IEUA 4AYWA 2C5SA 4UE3S 1RWPA 2D00A 3CLHA 4MB6A 3IOEA 1LDNA 1P7VA 1QE0A 3MPUA 4HTFB 4Q3BA 4RANA 1HNXB 2OCXA 3SLKA 3NU1A 4QYTA 1JWAB 3KXKA 4DG5A 3L8HA 3PQ2A 2GEJA 3UAOA 5C8YF 5TGZA 4FSDA 3QE3A 1QG4A 4DBLC 1AGYA 3UAWA 2MIIA 4TKUB 3ZXSA 3K2BA 1IHYA 2HCFA 1SG9A 1VBFA 1N2ZA 4XE5A 3WLNA 2VA8A 2DG2A 4CMHA 1YAJA 1YZYA 1NRWA 2WD7A 4U6QA 5FV7A 1J09A 4QPNA 3U4CA 5A4AA 4LRSB 1DWPA 5DF1A 3QV2A 5AW1A 4MGHA 2V74B 4TYMA 1UZLA 1ZM9A 3CX3A 2AL7A 5EQFA 4FEEA 5FBVB 1GN9A 2QG6A 4BPRA 1NULA 4C3VA 4S05A 1B4DA 4EKEA 5FJJA 4RVSA 4NJEA 1W7AA 3CV3A 1NC3A 4RC9A 3EBLA 2FR1A 1VYVA 4EJ6A 3ZNNA 3HJBA 4AJHA 4FGSA 4XSGA 4AS1A 2AHOA 2GVNA 3PDCA 821PA 1KTIA 3KQNA 2HF9A 1GG2A 4RD1A 1LDEA 3P2OA 5EIAA 4MP3A 1XN1A 2GYVA 4O29A 5KAPA 2YHAA 5JISA 1TIPA 4KQ9A 2W22A 1V35A 2JVJA 3EXAA 1VZ2A 3E03A 3PE3A 5C7YA 5BPHA 4CIDA 3O4RA 2JARA 4MWBA 2WFZA 4HVCA 4IGEA 1W6RA 4ZDJA 2WRZA 3NIFB 3EA4A 1IG0A 1NXWA 1JDZA 2XDQB 5IAJA 2WPDD 1UBHS 3WNVA 4IDEA 2ZWAA 4DVJA 3AVXA 2GSWA 4PG6A 3GN1A 4KYTA 5IUJC 2ZUBA 4LHXA 4KIGA 4UW9A 4R1TA 2NU6A 1H22A 2GXAA 2I62A 1G0OA 4LJ5A 2GSDA 4ZVNA 3NM4A 3SY8A 1N92A 4UCFA 2E2WA 1WSWA 1XNHA 4KXQA 1YO6A 4UQLA 3OCVA 4NMMA 5BOVA 2P5SA 3QX3A 2CDCA 4S04A 4KDFA 4WNCA 3CRRA 2F1IA 4I1IA 2BMDA 4NAVA 2C0QA 3GROA 3NBYC 2UUCB 3BRCA 2G72A 3ZWYA 1ULUA 4MB0A 3IB3A 2AKEA 2ARKA 1HBJA 3QG1A 1YKSA 1LS1A 3S27A 3IE1A 2RK3A 4KQWA 1X2EA 2BEUB 4IP0A 1N5IA 4V0OA 2UZ4A 4WZAA 2IE0A 3MGKA 1ZQ9A 3H5OA 5LZ5A 3VC7A 2D8AA 3COPA 4W82A 1P4HA 4IG9A 2F9LA 3ZIAD 3ELUA 1TT7A 5HUQA 2IYPA 4A0QA 4JLBA 5H3CA 5AD1A 1RPAA 3QPAA 4B40A 4D43A 4F4DA 4L27A 3OJEA 4C89A 4DDMA 3MWFA 5BNWA 1DIBA 1M6VB 2BSAA 4G65A 3R09A 2OO5C 1Q91A 3ET5A 1RAGA 2QMOA 2P6PA 2A3RA 2B0JA 2EJUA 3GLTA 1SXHA 1RRCA 4ISCA 2C07A 3C3YA 3NORA 3ADCA 2XGJA 3CH5A 1OHHA 3I58A 3ONEA 2DFKB 1UPCA 1DAOA 1FFXA 2YMLA 3HVIA 4N4AA 4QOFA 1IBMB 1KZ1A 1G20E 4ENWA 3H99A 4TV9B 1FW6A 1WKBA 4LSGA 1E3EA 3I5YA 3U3KA 1PSWA 1VSVA 1NNLA 1YS1X 1GA6A 2QUAA 1XRSB 3O4IA 4UHJA 4Y1RB 4B6FA 4ZI3A 2ZVQX 4HEHA 2VG8A 5IJ9B 3UUFA 3ZYZA 2LVBA 2AUTA 3R5TA 4WZBA 1BXRA 3COVA 4MVJE 4OXQA 3GOHA 2IOYA 4NJOA 1GDTA 4ODIA 1EINA 3Q8LA 1V1JA 4DQLA 2WBLC 4I6JA 2J0EA 1SHJA 2NO9A 1USGA 1TA4A 1C0LA 2ZB8A 2DLDA 3GMDA 2CF6A 3CLKA 4YV0A 1T34A 1XZJA 3ONWA 3KC2A 4QYIB 1CZHA 2IZ0A 3T52A 4B71A 1XBTA 3PXUA 3SX4A 1ZZGA 3U7IA 1I5OA 4MR7A 3LHIA 4YWHA 1IY2A 1L3CA 2AKAB 1VLZA 3JQDA 1G7TA 3LZCA 4RZIA 5AXCA 3V7NA 1QVAA 4D3XA 4ZHQB 1ZRNA 3CMCO 3LL7A 4XKJA 4FMPA 5HF5A 2PLWA 4EJMA 1K6EA 3VH1A 5C7OO 3BE4A 4PX9A 1ZD8A 5HX7A 4DXHA 2CL0X 2B5VA 2O19A 4B17A 4IFIA 5L8VA 3O0DA 2DVMA 4DMUB 1N6KA 3DZJA 3H5IA 3HDJA 3IAM1 4J7AA 1FFEA 2HWWA 4AO7A 2DHQA 2J46A 4DDVA 5G40A 1FSGA 3B7WA 3NLLA 3O4JA 2A14A 5DE3A 3DJFA 2NV0A 4J16C 1KJZA 1S3FA 5CU7A 3LW8A 4G09A 4Q7EA 2FCRA 2XOKD 3QX9A 3CW2A 2QVXX 3D6VA 3G85A 4F2PA 2ZCJA 4FJ0A 2CHFA 4LTDA 5IJ0B 2B8JA 2BFBA 3NWOA 5HOQA 3NEJA 1ZI9A 1DV1A 1RXUA 3DEZA 3R4CA 3MJTA 4MUAA 2I87A 4Q7JB 4L72A 1O6FA 3PNLA 3AR6A 1S1CA 1T4BA 3WL7A 4C2AA 1TGYA 3ENWA 3L41A 4Y6RA 3SLRA 2BTOA 5CIQA 4WSOA 1F20A 1QIGA 3QVLA 4R1QA 1WSDA 4YRBA 3B1YA 1X7ZB 4TXJA 4GR9A 3EBOA 5MFZA 1BQEA 3GQVA 3QK7A 4Z4QA 2HWUA 4I2NA 5HIJA 4BDTA 3BH0A 1C9DB 3GY0A 4ZCRA 3WKEA 4NE7A 3FNHA 1OGYA 2AGVA 2E4XA 3GK3A 1T0PA 1NJ1A 1QAOA 2H4YA 2V7WA 1CB0A 3BJRA 4M2LA 4PXYA 1E0KA 3O21A 2AE1A 1GA1A 4B46A 3DR5A 4NV0A 2FEKA 2BEVB 3DAPA 4M53A 5EIXA 2X42A 4O4LF 1DEAA 4P7FA 4YALA 2Q7DA 3SFZA 2CV1A 1UK7A 2FW7A 5K8TA 2V4MA 3LXRA 4IFEA 1BROA 2BWJA 1EGVB 1OU4A 3FPAA 4QFMA 3LDAA 1Y48E 1OI3A 1Q1ZA 3LSTA 2C82A 3BD6A 2I4OA 2DZDA 3MRVA 1PGNA 4YJGB 4H6XA 1I2ZA 5ERGB 3DT9A 3G5UA 3OPMA 3U7JA 2WKSA 5LMCA 3IILA 2AZTA 4B09A 1QH0A 2A9KA 4K81B 3THWB 3U4QA 1VJDA 4H1HA 3Q8MA 3FHTA 1W4RA 4RF4A 4G41A 2FTKE 2DGDA 4DBLE 4U0KA 1JFRA 1XQ1A 4EHLA 5HXAA 5JXGA 1TQ4A 4RJLA 1QZZA 3K0CC 5EZYB 4ZVTA 1XMVA 1VCHA 3REQA 4DYDA 1ECPA 5I6DA 3AJ9A 4G0QA 1Z13A 2BH9A 1TB4A 2GNOA 3M34A 3Q3CA 2A0UA 3O2QB 2QTCA 4JBGA 1GQFA 4YP0A 4A8PA 4RVHA 3WSVA 1KO7A 2JGJA 3UT6A 3OEYA 2OAGA 1JE0A 1H93A 3MTDA 1T2VA 1YD7A 3AEQB 3FCCA 3MFQA 3N2KB 4UUBA 4NCKA 3V1MA 2ODNA 3PNOA 2HM7A 3FSEA 4IFBA 3NC4A 1Q0PA 3M5DA 1DFGA 3FPEA 4LDNA 1HTBA 1KO1A 5CB8A 2VA9A 1ORRA 2EQ5A 3DZDA 5H1YA 5JYCA 1OYOA 3HB7A 1UMCB 4V3BA 1JH9A 2FRXA 3EIWA 2R6ZA 1N0WA 3O93A 3VV2A 1UBUS 2JZOA 2GTIA 4KE7A 4L7QA 1J0EA 3S8YA 1JMVA 3H04A 3PQ6A 3T99A 3NHYA 3R0QA 2QJWA 3RYHB 5KTMA 2HBQA 2J1LA 4IQ4A 4MQEA 4RK4A 4BV3A 5I9NA 1MVLA 2WWTA 3JZAA 2ZSAA 5G1PA 3LXUX 4OLFA 1Q7EA 1R6TA 2YS7A 2G9NA 3FNGA 3KAKA 1ORVA 3NHMA 5HZKA 1CUXA 4HGPA 4M83A 1QYWA 3AM5A 3AHHA 1T5IA 2C3PA 2WIKA 5BN3A 4RD0A 1OTHA 1P7PA 3ZLJA 2ZREA 3JSXA 1E2IA 1YFZA 3PCTA 3FMGA 2Q5JA 2ZYTX 3GJ4A 4FC6A 2QRPA 4FX5A 2XXJA 3D8RA 1K5GA 4KO8A 3RSLA 1MX5A 1FDTA 2HPAA 1U11A 1YS4A 2GEKA 4CTKA 3UXYA 1DRVA 4OUDA 5JJKA 1QPGA 3K6SA 2A4MA 1B8OA 2YHIA 3HR4A 3JARB 5DASA 1GJRA 4DLTA 4EYGA 2C4NA 5J9FA 4QNMA 3F9RA 4DS3A 4PHHA 1UP7A 5EJFA 5FOXA 4R69A 5LMUB 3QVWA 3GA0A 1Z12A 2PCLA 4TLCA 5DEOA 1AHPA 1FTGA 2XHZA 1KBOA 2YXPX 4HTFA 4LUCA 4EMTA 3E48A 4JQCA 1NDUA 1GPH1 3CO5A 4GGOA 5LQRA 1WX1A 1XEWY 3F67A 3JATA 3QH4A 4CKYA 2VCEA 2CZCA 4EKIA 4P82A 1Z2CA 4QJ4A 2C03A 3GAZA 3HVKA 3ICCA 3IXMA 1D2GA 1M6NA 3MCZA 1NW3A 3DAYA 5HFJA 4WK2B 2R7KA 5CFRA 2Q5HA 2IH4A 1VL0A 2EZ8A 2GHQA 3F2VA 5I01A 3L46A 3K1ZA 4J2TA 4OK5A 1K7SN 4OVKA 1M5TA 4AZWA 2IHNA 2WLSA 4ZU6X 1H23A 1PYDA 1W94A 1WW3A 4FBLA 1UKBA 4KFCA 4JEUA 5B7PA 3EK2A 5EPOA 2X5OA 2XWSA 3FOWA 3HDGA 2K4MA 3LBFA 4Y6LA 4WKOA 1RQRA 4MQFA 4AJJA 1QU2A 4QAJA 2QX4A 2J5QA 2FKNA 2QDXA 1W34A 1EVKA 1QK4A 2N1MA 2Z04A 3A6JA 3DUFB 7ADHA 5JEEA 5JZSA 1Y8AA 3NTVA 3HBNA 5CHYA 4F4UA 5F52A 4EMSA 5JJBA 2F8SA 2HHJA 4UCQA 5KOIA 3GZTB 2NPOA 1V8ZA 4BKUA 4EZEA 3PR1A 4JL5A 1GUFA 1MHPA 3DTVB 3UK1A 4FDUA 5CT9A 1VIAA 3UJ9A 2HEIA 3GHYA 2GJAA 2XEXA 2SBTA 3S40A 3IULA 4PWYA 2RSLA 3VPHA 5DKFA 4CI0B 2ZRJA 4R54A 3EC2A 3OQIB 4A91A 3QE9Y 4DLSA 2WG1A 4HJRA 4N12A 5IWCA 4G8BA 3HFJA 5LLDA 3UEOA 4JITA 4OCZA 2B8TA 5FNVA 3ZJYA 5KDDA 4U0JA 3SYNA 1Q7BA 2DFNA 3EDRA 1IRXA 5J2UF 4QUDA 3OX3A 2JK1A 1T3ZA 1GKKA 2XUHA 5CEJA 3OTGA 4X8HA 2WW8A 4OHMA 4G36A 4TV8A 3U0BA 4DRXA 2M32A 1K8RA 2OFXA 2PANA 3O82A 3KHUA 2E7ZA 3G2LA 1A9YA 4KU4A 3KB2A 4J91A 4M1OA 1JLRA 3QU5A 2VTKA 4LEIA 4Q6BA 4OU5A 4R1SA 3SYKA 4BJHB 1TM7E 3GLUA 5LL6P 3WLAA 3OQMA 4G8DA 3RC8A 2OAEA 4WFQA 1CUCA 4IKEA 2NO4A 4U9HS 3PEFA 4LMPA 2RGCA 2KWIA 4CFSA 2P6OA 3D9QX 4QG3A 5ITWA 1BU5A 2OHHA 4GKAA 1SCUA 5JNLA 2IDMA 5F77A 1X94A 1BEZA 1RI3A 2HCTA 3CUWA 3K0EA 3ZHYA 2Z4RA 3MBOA 2QRQA 2FEOA 5KNBA 2JLYA 3K4PA 1GP2A 2KQUA 3JVIA 3RUEA 3I4LA 1AN0A 2OHJA 5F76A 2H18A 3UWPA 2V7VA 4DM4A 2NQTA 5HJ7A 1RJ9A 3O8OB 2HIHA 3ZI4A 2B4AA 3ND6A 2XNCA 2ZRIA 4F5YA 1ABEA 3PZRA 1UBLS 2D1QA 2UUOA 3NCHA 4RKRA 4L5CA 5INTA 4RSMA 4KDCA 1H94A 4YASA 3S8MA 1L4GA 4U7JA 1BDHA 1OI2A 1SXJC 4N7BA 4M9RA 4EB6A 4Q9LA 1C8LA 3M6MD 2FQXA 2O7RA 2MSKA 3HCFA 4K86A 1M2OA 1DJLA 5B6IA 3UG6A 6GPBA 2OCDA 2Z2ZA 4P8RA 2WZDA 3VZCA 5GM1A 2FZVA 3IESA 4Z7JA 2J3HA 1PV2A 2VZ9A 1FLVA 3DULA 5ICFA 1PG0A 3TTYA 2O4UX 1N2OA 4HNTA 4K2AA 2VZEA 3WLMA 4EY7A 4JXZA 4CNQA 1FU7A 1V7QA 1ZM4A 2PQMA 3JQEA 2HLHA 4XFKA 2OFFA 3K0FB 4H4EA 3WP1B 4MWGA 1FFWA 3ICWA 4QGHA 2OV2A 2MYTA 1ESNA 2C31A 3OQNA 3B8HA 5FAXA 2Y67A 3A37A 2AF4C 4DY6A 4KLAA 2D5LA 1NNI1 1KE2A 4BBPA 2VWQA 4ZT3A 2ZI7A 1GOTA 2JI8A 3SJ7A 3CG4A 2YDXA 4RIGA 4E2YA 4TZ6A 4KYVA 2EVWX 2WUVA 3G5TA 3DGEC 2PXHA 2B2NA 2EXXA 2P4QA 2R47A 1RJGA 2DT5A 1PT6A 2R6JA 1LZKA 4EGFA 4AMBA 1SBZA 3K4QA 2VDJA 2Z2XA 1HYHA 1L7MA 4M1MA 1TPZA 1YZUA 4LJ9A 3O3OB 5JCJD 2Z3WA 3GAAA 3JWIA 3WGOA 2ACKA 1AS0A 1W73A 2FOLA 1UBEA 4LQ4A 2HNBA 1XHFA 4HRAA 4AIIA 1L9KA 2BM0A 4Y9SA 2WFMA 2ATCA 1CZRA 1N78A 4NV1A 4KBFA 5F9FA 4ZV9A 2A0XA 3EF1A 3GJRA 1XCGB 4L3VA 4XEUA 4M7OA 5D1NA 4YAKA 2D13A 2C3OA 4FBMA 4CMBA 2VRCA 2WTAA 1OLSA 3BC1A 3CX7A 3L92A 4RLQA 5FJIA 4ERXA 5IAOA 5K6TA 2NQ8A 2PBRA 2UZAA 2CLDX 3HJGA 3L6RA 1CTQA 2YVQA 1EG2A 1R74A 5LBIA 1FMTA 2Z5GA 3D7RA 2O8EA 3ORFA 3P9RA 3CNHA 3K1TA 3MVEA 2Y77A 1FU8A 1E7WA 3AEUB 1F14A 1IFXA 1DINA 3NT4A 5I8ZA 2NXNA 1Q19A 4ZI7B 4HGQA 1EFLA 1EVEA 4Y2SA 2O2GA 1D0SA 4TL8A 4HDKB 4NP6A 4M87A 4M76B 5K6AA 4HQ6A 3IAEA 3ZZUA 4F4FA 2JFNA 3A27A 4E14A 3SZRA 4GLJA 4LAFA 4P2BA 1IY8A 1SRQA 5KSYA 2C5BA 1GYQA 4S35A 5AW3A 1KEVA 3A7DA 4D0GA 3C87A 3SCZA 4EB0A 3B1JA 2PLFA 5IU6A 4I3FA 2P4EA 1EZ4A 4N9WA 2ZYDA 5TRTA 3D6FA 1JWLA 4DC1A 1ISHA 3ZGOA 3CZCA 3BQ9A 3IPCA 3HPRA 3KAJA 1AKNA 1YBHA 1WXQA 3NRCA 4INPA 4P2GA 4C03A 2CKMA 5JV5A 4EGJA 1JAXA 3QE2A 4MZXA 1HDEA 1BW9B 4TM7A 3OZWA 3BIXA 3PHLA 2PSFA 2W00A 3SR0A 3PRJA 5FWNA 2GN8A 3LWBA 2HU8A 1PFQA 3ZWWA 3ENQA 4M36A 2NLOA 2A6PA 5J4YA 2OOSA 2HIGA 3NTRA 3DZFA 4XWWA 4IFTA 1XZHA 1QF9A 1SKBA 1J07A 5K0BA 5KVAA 3NTOA 5J5CA 2FZLA 4AUEA 4PYRA 2Y1WA 1JHDA 4CEHB 4L50A 1CT9A 1KJWA 1TTHA 4I4TB 2R6DA 1TF7A 4A6EA 1QHXA 2C58A 4EHAA 2BELA 3K05A 2AMYA 4TYQA 3JWHA 1GZDA 4BNDB 1NJ8A 4ZVSA 4URWR 3RRYA 2FWRA 5GZ6A 1YRWA 2OHXA 1EFCA 3F7MA 1SUDA 1GQOA 3B9QA 2H4HA 2Y66A 1MXFA 4MV5A 1S2MA 5FPSA 3G1UA 2A4KA 1F9AA 4WY8A 2FSVA 4EVRA 2RGUA 4KR3A 1NUPA 2WAAA 3B6KA 4MS4A 3ZU2A 5E7IA 1E9AA 1YJ8A 1X1AA 3DZGA 1LJ8A 3WQBA 2GLUA 3IAM6 1KIMA 1OPXA 4M0CA 5K8CA 4V02A 2W5UA 2R6HA 2GPJA 2X58A 4HL6A 4BVAA 3NKLA 2Q5CA 1M34E 1BRTA 1ZK0A 5J4LA 2J9RA 1DKMA 3CEPB 4J0KA 4L22A 4G0NA 3FSRA 4FEGA 3O1JC 1DUVG 2O5EA 1YQGA 3BH6A 3FPJA 3PGJA 3OOWA 2FPLA 4MA0A 2O1XA 5KTRA 1N2CA 3UAVA 4BC0A 1SD1A 3O2NA 2NSLA 4RD6A 3RC1A 2BCGY 4ACBA 3WWDA 3GWGA 2AXEA 2HMYB 3E0QA 5IVKA 1QVVA 2IOFA 4IEFB 1JB9A 1UMCA 3KPUA 4K6OA 4ROSA 1ZM7A 3MT9A 1TQ6A 1ZJ6A 2FHSA 2IF0A 4ZT6A 4ZVOA 5CT8A 2G1AA 1C0PA 2YHSA 1WDTA 4C07A 1N6PA 1J2RA 1V9LA 4RM2A 2GCNA 2CCGA 1RRKA 2GBGA 4YACA 3RTDA 4BHTA 4NXMB 2YIJA 5HE9A 1U80A 1Z56C 3D6UA 1CIVA 1Z4QA 1WB5A 2OESA 4M8IA 3FETA 1TJ4A 1NDQA 3G9ZA 4OIFA 4PGMA 5E2AA 2PL3A 2EERA 1C7JA 5BSWA 1EP9A 2AIRA 2HMSA 1QQBA 2XTZA 3SQMA 3KEMA 4MR8B 1EXVA 1R5JA 3ASYA 3THOA 1WUHS 5E38A 4GOJA 5LDGA 3SC6A 5CLJA 3KX2A 4NBRA 5LYJF 4BO4A 3M5WA 4M6WB 1H3FA 1VXOA 3OTQA 2VNIA 1JQEA 1OREA 4FGKA 4IR7A 4XWGA 5TR9A 3ESRA 3KIPA 1T4CB 3DMPA 3EFBA 4JU9A 4ARAA 4IXNA 3SHOA 3CRNA 1T6ZA 5LC1A 4NESA 3RYTC 5CTAA 3VYTB 3KZ1E 4GPIB 1AMNA 3KJNA 1DKUA 2O5RA 2QE7A 1HTTA 3A1FA 4TTRA 4UTVA 3WGIA 5F1YA 3CKKA 4X1YB 5TV2A 2P35A 3TZKA 2F1JA 2ILVA 1UK8A 2VCYA 4B44A 4UM9B 1NMQA 3ZVLA 4CG3A 3TBHA 1KP3A 2AN1A 4BASA 3K0BA 4NXNB 1KC3A 4PCUA 2OKGA 1KK0A 4M1KA 4R83A 3D4IA 4YCNA 2Y0BA 3C3DA 2QU7A 1SU8A 2PG3A 3DEYX 5JJCA 1RZRD 4DLPA 2KX7A 2YNMD 3GQBB 1VXRA 3RVBA 1I4TD 2OK7A 3DV2A 3V4LA 3GUHA 3WADA 5DNCA 2JLXA 4PC6A 1HNZB 5L51A 2D2FA 3WL6A 3LKDA 2V03A 1SXJE 3SIRA 1MV5A 1EXWA 1NN3A 4ITUA 4F6RA 3A4MA 3ILXA 5DX8A 4BVLA 4CI9A 1RC8A 3H1PA 2F3TA 2EATA 3KSAC 2W2KB 1N5LA 4QUJA 3WHPA 3EEYA 3RSZA 1G5QA 1Z4MA 2EJTA 2ZAYA 4NC9A 1ZA1A 1M2HA 3BFKA 4ISBA 1LTKA 1S8NA 4FHGA 3OKAA 5CXQA 1K6JA 4GMKA 2HDNB 2HY7A 4NZYA 5BWNA 4OJKA 4DIBA 3VTAA 3HI4A 3L8EA 3QG5A 4CV3A 4QTTB 3HDTA 3GT7A 5CAEB 5JCZA 3B48A 5K99A 1N2BA 1LSJA 2KYRA 1PT7A 2NG1A 1GTVA 1Z2AA 3E5NA 1TGVA 1E8NA 1PL8A 2GN1A 3IB6A 1GAQA 2B7BA 4GOND 4QECA 3TE6A 3FB4A 4CYMA 4DCOA 5M34A 1ZGZA 4YCDA 2UZ0A 1LJUA 1DB3A 2E85A 3TAHA 4CR7A 2Z2KA 2R7AA 1QONA 4M86A 5U9CA 3BWBA 1IUNA 5MHTA 3WL5A 3QWBA 4R8SA 4KWIA 5FTJA 4MZDA 5CXUA 1U5AA 1ITZA 2G9ZA 3BJMA 4LYEA 3FUTA 1GGKA 4Y2TA 1KQFA 2HMWA 4L73A 4M38A 4L2IA 3ASUA 3HNPA 1KAEA 3R3SA 4MGEA 2GJKA 4DIKA 3LQ4A 2V98A 1PYOA 2CK3D 4R2WA 3S99A 1LA2A 1O0BA 3ZZTA 1JZQA 4R1NA 3FI9A 3W6UA 1KP9A 1QO0A 1JKFA 4N5DA 4GO1A 1IEQA 2MSLA 4OD0A 5FBKA 5IEBA 4ENVA 4P7KA 3PJDA 4BNHA 1J8FA 3PD7A 4L0CA 5FBZA 3ON5A 4FFDA 3S1AB 3U3JA 2PQ6A 1ZCJA 3EDYA 1BMQA 4B4DA 1CEXA 2PSSA 1KVTA 2OQ2A 3L84A 2AFVA 3LHFA 2JGAA 1BA2A 3B38A 3KZOA 3LDHA 3R0JA 4MWTA 4D6PA 2AJDA 3P0IA 5G02A 4FR2A 2ZIWB 3K1AB 3HJCA 4WK0B 4EB3A 2HWKA 2F9MA 3LQQA 2WHYA 4F5ZA 2C5HA 1MFZA 2X0IA 5I7SA 2HHCA 1TUEA 2ZE8A 4MKZA 4DMMA 1ODTC 6NULA 1AV7A 1SH7A 5HKLA 3TL6A 4MCJA 5IAAA 2DPHA 1L1QA 1D8TA 1V8FA 4RHYA 5AJWA 5T7BA 1EDDA 1ZU5A 2AG5A 2GJ8A 3TG2A 3GMIA 2NZYA 2ZJ7A 5CHEA 2D2XA 1XAHA 2YXLA 2PLAA 1J0CA 1BN6A 1O5OA 3KPYA 1U2GA 2DPLA 4Y2PA 5DBHX 3WSTA 3CIOA 1WZCA 2RGXA 3P27A 4FVTA 5KPDA 2GPAA 3LGAA 2I7CA 5BN4A 4B3TB 3UAXA 1W25A 4LHWA 3CLTD 4INAA 1U0TA 3UGJA 3HDHA 1JG6A 2A92A 3SMQA 1KA9H 1LK7A 3U7GA 1SVKA 1RM3A 4JVOA 5FI5A 2IWHA 6ADHA 5A5DA 4JWKA 2A58A 3EZYA 5TVGA 4NVRA 4I55F 4MB2A 1I80A 2K5UA 4MV8A 4CL2A 3U6KA 1PQPA 1NKSA 1T8PA 4LG1A 1HT3A 2XCIA 4DA8A 3Q0TA 1LWNA 2FMHA 1JHPA 4G0PA 5CVDA 4KQHA 1IVSA 1Z6XA 4N54A 1YR7A 5GPBA 1BYUA 5DBGA 3UJBA 1U7DA 3GOQA 1JT9A 3O8LA 1INLA 4Q4LA 1PG2A 1XTTA 2BLLA 1EAMA 3IH5A 3QXXA 4L57A 4LJ4A 5DCLA 4EHFA 1E2PA 3P2YA 3AJAA 4G23A 4E03A 5K2OA 1B6GA 1A5BB 1O5IA 4RY2A 4F85A 4YJHA 4AAYA 4R40A 3OJFA 1E64A 2AD5A 3K53A 4YMLA 3A31A 1FP4A 3DFMA 3HP7A 1X3SA 4C06A 5JHGB 1EHCA 3TMKA 2Q3BA 3A6HA 4UNPA 2HT6A 4ETIA 3FF4A 2Y8EA 4P7BA 3E4DA 4CUJA 3ICEA 2BMEA 3G13A 3CNEA 4NTZA 3SM3A 1GNRA 4L28A 4CNBA 3J81A 1JBQA 1X3LA 4AF8A 1A82A 4FD2A 4L5BA 2OBNA 5HW0A 5EJ6A 3ZE0B 4ZQEA 3IR5A 3KO8A 4LJRA 4CTNA 2JFBA 4YCJA 1HFWA 3L0CA 3MGCA 3NTXA 2PFGA 1GPKA 4KXXA 3ULKA 3W04A 5CLFA 3REFA 3IS3A 4LOAA 3ENZA 4MKXA 3E9EA 3L0IB 1AH2A 5EMNA 3EYWA 2WMDA 3B6ZA 3NHBA 1JDPA 3H19A 3TLGB 2BGGA 5C51B 1MABB 2Q1TA 1Y7PA 2ZIAA 3H65A 4HDRA 5E0OA 5ES3A 4I1PA 1RIIA 5ARCA 2PD4A 4LYHA 4UFNA 2WU0A 4F11A 4O2LA 3ESCA 3DW1X 3GG9A 5JW6A 4JJGA 4C2BA 1D7AA 1L5LA 2Z57A 1WDKA 2BGMA 1N3IA 3K96A 2YWRA 1NAIA 2A9FA 5JFTA 3AHCA 4XQ9A 1DX4A 1E5QA 4HB0A 3GJ0A 2FPGB 2KBFA 2VZ0A 4MR9A 4EARA 1B0ZA 1T6YA 3BULA 3THYB 1NQUA 1AXRA 1EE2A 5LJIA 2CFTA 5G53C 1MIOA 2Q6KA 4NJMB 1YACA 3K20A 5IT5A 2MINA 5TMEA 1ZSNA 1AA6A 4L16A 1OVGA 1JIKA 1DJOA 5ADUS 3IMGA 3TWOA 4RTMA 3FNQA 1R15A 4HGRA 3AP1A 1PQYA 1VRVA 2GZAA 1EVZA 2HMUA 3NHUA 3PDIB 1JQKA 4FZVA 4P4UA 3SC2B 4QBGB 3EXHA 3LTEA 2JFUA 1PW7A 4YRTA 8GPBA 1PR2A 3TVYA 4IRXA 3KOMA 1UPAA 1Q0ZA 3OSUA 5FOTA 4WNIA 1R0KA 2EHJA 4MARA 2UYGA 3K0AB 3VNAA 1ORIA 1VE5A 2RGEA 3AQIA 3RBAA 3A1EA 2DWOA 2HF2A 1M7HA 2XD4A 4GXNA 3K9QO 4Z4HA 5IFLA 1VMEA 2P3OA 1Z6TA 4R8LA 2DFTA 2JZCA 5FXMA 3UXHA 1G59A 4CEHA 1QDEA 2I1VB 1KFCB 4QUEA 2VUSA 4YHBA 1YE3A 5AXDA 3CNQS 3GRAA 5ERXA 4DLYA 1Z4IA 2D74A 3GJ7A 4EL5A 4TQAA 2CV2A 1DRUA 5K7SA 2Z2IA 5M3BA 4UEJA 4G4GA 1VE1A 2CHVA 3QUBA 4YRDA 2OXTA 3T9AA 3L77A 4OGKA 1P1IA 1YH3A 2AFIE 3INTA 1N4DA 1Z28A 2C1ZA 3QJGA 4Z8XA 4E5DA 1HURA 4RADA 3TDNA 3PQEA 4HNVA 5B36A 5I8PA 3R1IA 3ZDXB 1H4QA 5K4HA 2FPWA 4F0JA 2TYSB 1SNYA 4XQ0A 4CKWA 1RHMA 2JCGA 3IYLW 1CV2A 1OF1A 1WG8A 4H0FA 3SOPA 1U5BB 5BPFA 3DZKA 3GJSA 5AOBA 2HJRA 2JJYA 3V8RA 2WYOA 4JN6B 2QQFA 3ETCA 4NARA 2BSXA 3BWYA 4RY9A 3W8FA 3WRYC 4Q1BA 3NONA 3I2GA 1GUZA 4MGIR 5JE8A 1HG1A 1PWEA 2MYNA 2NU7B 1LSOA 4L4YA 1Z7BA 4UBLA 4UOQA 4WW0A 5BNFA 3WNCA 4H9GA 4GW3A 2ECKA 2F3PA 1LSSA 1MJHA 2XKAA 2W2MA 2WPDA 4Q4AA 2OR3A 2OBLA 1N8TA 4L07A 1E3IA 1DO8A 1DPGA 1JXOA 2H16A 3TTVA 2Z56A 5I48A 4L8VA 3OFSA 2ZYVX 1X1DA 4X1IA 1QCCA 1U2ZA 4PIVA 4R9SA 2PAFA 2NU9A 3JAWB 2O3UA 4QGBA 2IXFA 5AKEA 3ZCQA 2HCRA 5K5EA 2CVHA 2PZJA 4R9VA 3W1VA 2ZJ3A 3QKSA 3VHQA 3IRUA 2QSYA 1T5DX 4QYXA 2E4ZA 1Y5IA 3NYWA 1KGDA 4UZEA 4C0QC 1Y37A 1FFYA 3C41J 3HHEA 4HWOA 1TE2A 3WK6A 2IPXA 2JFGA 3LOPA 3LX6A 1NKVA 1T25A 1HPLA 3WLJA 1IN7A 5BUCA 3RS5A 1T2UA 5I7EA 3GJ5A 2VWPA 1YGPA 2ZYIA 3OQ6A 1HV8A 1R4AA 1VQ1A 4JLOA 3GIWA 1VJTA 3CVOA 1K0FA 3ESYA 3N0VA 4X00A 5G0VA 2YN4A 5G41A 4B85A 1NI4B 2QMZA 3ADOA 3G2NA 1HL7A 4KQGA 2O8DA 3AESA 2VPQA 3FRIA 4B6SA 4KR9A 3E27A 5JLJA 4HT3B 1B2RA 3OT1B 4WKGA 3ZIAA 1IM2A 2EC5A 3WZ2A 1V4VA 3HR8A 3SYLA 3WBJA 3C6QA 1N6LA 2ZRMA 1KKMA 1L7AA 3M4NA 1D2RA 2WOOA 3LQ2A 4K3VA 3GJTA 4NCHA 2HC9A 4AP9A 3Q7RA 1GTSA 4LZLA 5CDUA 2G6TA 2ZRNA 1FP7A 1EJ2A 3IUBA 1ZGHA 1I5RA 2DCMA 4QBIA 5ESRA 3ZD9A 4XD7D 2LE0A 4NULA 4P53A 3VMMA 1X87A 3ZIDA 5LFAA 3AVUA 1R0XA 3KQOA 4QRIA 2G8NA 4EG6A 4J7XA 4GPAA 2RHHA 1G55A 3F6YA 5CG1A 2ZRLA 2PA3A 4R68A 3AXTA 3ZNPA 4AULA 2H7VA 4BLQA 4E21A 1UOEA 2X6QA 5GOTA 5EMKA 3GRFA 4BNWA 1FYEA 2UUPA 4RPLA 1G60A 1K86A 2PXCA 2QWXA 2ID4A 4O02B 3ZD8A 4UNRA 5YASA 2AHRA 3ZKWB 3WGTA 1JR4A 3M4JA 1T5SA 4I99A 4BFVA 1Q3TA 1NRIA 3M6LA 3C48A 3RI3A 5FOQA 4C0KA 1N6IA 4A0GA 3WRVA 1LTHR 4L8YA 3VH4A 3OD5A 3OBIA 1Y8RB 2EL7A 3W79A 3R0ZA 1NBHA 3OCZA 1ZOLA 3K9CA 3LS2A 4GC5A 1LF5A 4BNXA 5KQMA 2CXNA 4PNEA 4REQA 2YFYA 4HY3A 4JROA 1M8JA 2W2KA 2LWIA 4KZKA 3TQTA 5TMBA 5A4KA 3LUPA 4AUNA 2WJZB 3L02A 5DMXA 2QZ9A 1DL5A 2Q0QA 4L1KA 4FHCA 4FTWA 2YVUA 3Q8WA 1NDHA 4GOXA 3I9V1 2WWHA 2OM2A 4BUZA 4AM8A 3TIXB 3F6CA 2JLCA 2PZMA 5J4HA 2H1IA 3AGQA 4MTCA 2Q1XA 3BERA 2VK1A 4O63O 3OLXA 3TSCA 3ZXUB 1II8A 3U1VA 4U7GA 3VZSA 4FXPA 1NMZA 1MJFA 2W7TA 5J63A 4NE2A 1E6CA 4KPGA 5ESWA 5T4EA 5KYKA 4AWAA 1Q21A 1DJNA 2WIAA 4G84A 1OH7A 3SMVA 4K05A 1NW5A 4PU0A 3TSOA 1MJ5A 1BKSB 2GZHA 3ZV6A 3I64A 3I6BA 3CSDA 5JC1A 3DD5A 5EZ5A 4BTEA 3DPIA 3LO8A 4AZ0A 4B76A 2R6GA 3KVNA 3O4HA 4IJ6A 4L4RA 3GFOA 3GRUA 2CNDA 5DSXA 3RS7A 4KXMA 2ZR0A 4YRMA 4YQFA 1XCPA 1OBHA 1XZDA 2XOKA 2JI9A 3K8OE 1Z06A 1KY5A 3JU3A 4BATA 2J0VA 1BKYA 2IZ7A 3IUYA 1YK0A 4KI7A 1SUSA 4JP2A 4N3BA 4R2IA 4Q7QA 5KOJA 2COUA 1FE8A 1F5NA 1S8OA 3PFWO 4J0HA 3X1DA 1Q74A 3GI1A 1Y9AA 4XARA 1BHSA 4TTPA 3RC7A 1M1YA 3P2MA 1ZK3A 4L5YA 2ES4A 5IJAA 2GRAA 3JQ9A 2HYIC 4QLOA 5FLEX 2UYYA 1RPNA 2YH2A 1ABBA 1KFEB 1PNQA 5JUWA 1RAFA 2CXUA 3PUXA 3GDHA 4UAJA 5AOVA 3PFNA 3TLXA 4TL7A 3GLHE 4KWEA 2Q21A 1CUAA 3RRXA 3AF5A 2ZAIA 5LD2C 1AO0A 4ED9A 2OILA 1ZD1A 3JQQA 1ODJA 3PGKA 2SKCA 1LK5A 1UFKA 1VCMA 4U2DA 4CKEA 4ZOQI 3FRJA 2NO1A 4ZZ0A 1S2OA 4C76A 4OJQA 4X7BA 2ZSJA 4WBNA 2BGUA 3QRWA 1A8UA 5K9ZA 1GZ4A 1PQUA 1WVIA 3HVHA 4BIMA 3E61A 4UXIA 4EO9A 2ZIXA 1Z0KA 1TO2E 4M49A 3H17A 1QC5B 1MQ9A 1TCAA 3FZNA 4W5JA 1UT8A 4PR0A 5CIWA 1NJSA 1DC5A 4E5VA 2Y68A 1RYNA 2DPYA 5JAUA 2XYQA 4G24A 5A5EA 1DHRA 2FXIA 3CGWA 4OFXA 3Q7IA 5IAKA 4E51A 1VSTA 1XTKA 2VHWA 4B3XA 1VJRA 1XKLA 3LUJA 4E3WA 5AUOB 3WX0A 2OCGA 1YF3A 1XMIA 3FWYA 3N2YA 2FN9A 2I29A 4TQ9A 4LWPA 1M6EX 3K2QA 2L17A 2QZZA 2IDJA 1L4HA 2SNIE 4RPJA 1FDVA 4AC9A 2YL2A 3GRKA 1T4MA 1Z25A 4I4CA 1GPYA 2CXPA 4L4UA 5CB6A 2V3WA 2C88A 2XB4A 1PZNA 1D09A 1TJ5A 3LQFA 3R7SA 1PSDA 3T0GA 4BLOA 3BHIA 5D3QA 3LBIA 4RWZA 3TEJA 1G63A 1IHOA 1E3MA 3ZJ5A 2O8CB 3KEQA 1MBZA 2Y0CA 1P2BA 2BR4A 2LTAA 2P2LA 3ZY2A 1ZMBA 3NNSA 3IELA 4ER7A 4FZ5A 2C4MA 4INJA 1YMVA 1VPTA 5FB3A 3TFQA 1PJ3A 2QLJA 3ZE9A 4DWOA 4CM9D 1TW3A 2C0PA 3A6EA 3F1KA 2XYVA 4DLUA 3RVJA 3WDMA 5DEIA 5F4BA 3RSCA 2IU3A 4KNWA 3K9GA 5B2ZA 1UPFA 2OORA 1UDXA 1JDTA 3QPUA 5LMZA 2P0YA 5F4ZA 4TUYF 2HEGA 1M54A 2F8LA 4R3WA 1Y4ZA 2FZWA 4EEXA 1Z4JA 2G7MC 3T7AA 1Y1TA 3T8YA 2J59A 3S5UA 3SE0A 2FJUA 4D25A 1QO7A 2YX1A 2RHDA 1DTWB 2JIMA 2WC1A 3DLCA 5C37A 1FA9A 3KOUA 4JA0A 4YXFA 2CT8A 4UEWA 3EJ6A 2NUBA 3SHVA 1TQHA 3FLAA 3GT3A 4HZGA 5EJ9A 2R48A 3WICA 4OX9Y 5KQSA 4ZA2A 5CP8A 5KMGB 3NAQA 3TEFA 4EYEA 3FNEA 1DXHA 3HRKA 3W6ZA 2J3LA 2WLTA 4IJKA 5DO9A 4KK4A 2B82A 2QI9C 2CN1A 2G36A 3Q7QA 4GT1A 4Q02A 4ZT7A 2XWBF 5CT6A 2R1VB 2HPHA 4IEEA 3HR7A 4LDQA 4N3NA 4RGVA 5KYXA 1DRKA 5A9TA 5IVPA 2F43A 1IJFA 5ALEA 1NVXQ 5K45A 2P9YA 3T35A 2ZJ2A 2FPPB 5G0SA 4V2IA 1FZQA 3G6KA 3PF9A 4FE4A 4MW1A 4Z4EA 4JLPA 5A3JA 1FNCA 1HQDA 4DA6A 1W36C 4PM4A 3C8DA 1JPVA 2WNSA 4X93A 4JNKA 4EKYA 1UKEA 2FPIB 2WYWA 1PJZA 2W98A 3JQPA 3K09A 1IIRA 1A5ZA 3LE8A 3R3UA 1Y82A 4M8LA 4O2AF 4RPCA 5E7QA 2DWUA 4RTRA 1NQTA 5G4LA 1U8ZA 3FHCB 5ULLA 1SUEA 1KPGA 3ZVKA 5FNZA 1E89A 4IQGA 2XT6A 3IUSA 5LOVA 3CN9A 3KPVA 3H2YA 5TE9A 1QOPB 2WSMA 2UVQA 2OP0A 3GCGA 3D0KA 4HB2A 1BX1A 4YRSA 5I7AA 1O8BA 4OQ4A 1IEVA 1GARA 4W9MC 4ZAZA 1IRIA 3WJ1A 5KWEA 5KYWB 1NVWQ 3URMA 3VTFA 4F4HA 4ZYLA 5FP0A 4AI6A 2BFCA 3H0KA 3WISA 2M6KA 4DCNA 3GP8A 3PUZA 2E4AA 2PUBA 2ZQ5A 5F51A 1T5BA 3PPYA 4CLOB 2IPOA 2QJTA 1FXSA 1BFDA 1T9DA 4ZDWA 3ZS9A 4DL9A 2DWPA 3IT1A 1EPUA 2CCJA 2PRIA 1QGYA 1E69A 1P18A 1J6UA 2IVZA 2WHPA 5DM70 2Z98A 1TO6A 1N0HA 3UPUA 2JAQA 1YULA 2D4AA 2N42A 3HEMA 1FNMA 1ZH4A 2QQ5A 3PTZA 4YJ3A 3SZ3A 1MW8X 3LG2A 3TOSA 3ETNA 3MINB 2ZUFA 1XRPA 4Q6WA 3EWIA 4DZRA 3SEQA 3SOZA 4WJLA 4TOIA 3KQVA 5LIRA 1A72A 1AA9A 1RBMA 4YMSA 5A9RA 1SUCA 2YYYA 1E6UA 4UMFA 2H1VA 4Q9DA 4COKA 4JI3B 4P3OA 2Q2NA 4EJSA 4YUVA 2ATXA 1UEIA 1WPRA 5F1PA 1S2IA 3U31A 3TJMA 4MSUA 1EA7A 1T43A 3BXPA 4FX2A 3ECCA 1OX6A 3H1TA 1CYDA 3CX4A 4HGNA 4S3MA 3BX1A 3S6JA 3TNDA 5GZ3A 1QHIA 3KHSA 4J3JA 2PUGA 1N0UA 3UCFA 1QDUA 2BMAA 1P0MA 2ON6A 4EUFA 4Z3KA 2QXYA 3CCBA 3IOBA 1WB9A 3B1XA 1JEAA 3KKZA 4MUHA 4A10A 1RT9A 5KWVA 3PSAA 1M3SA 1JJAA 2RGNC 2QZJA 4K9KA 4LX0A 1TQ8A 3OPYA 4R5HA 2W6MA 3PNYA 4URFA 2FR8A 4DDUA 5JNVA 1CUVA 3LKZA 2X3UA 3WMXA 1IY0A 1CC1S 3KVOA 1NGSA 4E5KA 4C05A 3JYNA 1YJ5A 3GFSA 2WF6A 3SXJA 3T4XA 3FTCA 1CDZA 3ZDAA 1R00A 1XL1A 1H2EA 5KTTA 2YTZA 3ZDZB 3BL5A 4FGZA 4HLDA 1SVOA 2VJMB 3JTMA 2JHFA 5IDWA 5KDLA 2XKKA 1AGRA 3ZG6A 3BN3A 3T4PA 4R4JA 3PUWA 1LPBB 1WO8A 3AETA 4D3FA 2I6TA 2IELA 4PLGA 4RL6A 3C3AA 1P4JA 5SYMA 4UOEA 1TFRA 1UOQA 3IX7A 1X7XB 2XUIA 1JXMA 3OIUA 4WJZA 5JAQA 3WV4A 4KPFC 1UMBA 3P9CA 3SZOA 3U2QA 4F3CA 4PG8A 1DMSA 2OD7A 1P1CA 2VDVE 1H6CA 4INZA 4IDQA 4UUQA 2W6ID 3PNMA 2CBGA 5U4QA 1WV1A 3RIXA 1ZCZA 1YIAA 2HN9A 3R6LA 4AY6A 1IY9A 2WJIA 3C6XA 4YT4A 2HHAA 1NY6A 2C7VA 1REQA 3OJWA 5L7YA 1GGHA 4PNHA 1JAHA 3RSSA 5CEEA 3TECE 1OCEA 4CIBA 3QF4B 2Y1GA 3A25A 4U39A 1FTNA 4UUMA 5F9MA 4RTKA 3AIOA 1L8QA 4B9AA 3FX2A 2H52A 3MTAA 4DB4A 1RZVA 1RJFA 4X8MA 1IZ9A 5CIYA 2RFLA 2RHLA 4NYJR 2Z08A 3SHQA 1NMYA 2CXHA 1V9CA 2JIDA 5CK5A 2BF4A 2I7TA 5JCJA 4JI7B 4ZXPA 5THXA 1LV7A 2AEEA 1MC4A 3B6EA 4ZKDA 1PQWA 2IX3A 1PR0A 3TVTA 5CFNA 4DOMA 4P9NA 2VUTA 4MWCA 3CRQA 4CPDA 3JRXA 4GKBA 5TS2A 1XXLA 2J9XB 3EUEA 4UPDA 4CCYB 3BAFA 1T5TA 3UGQA 1H8ED 3E3MA 3M89A 3ZE8A 4MDEA 1KBZA 3L6UA 1ISGA 1JS1X 1N1MA 1U0RA 1ZGAA 3IAUA 3UOAB 4IY1A 1F4PA 4LQLA 1JYSA 1POWA 4XTCS 2PH5A 5L6MB 1QZUA 2H5JA 3PICA 4IIGA 3ZU4A 2OAQ1 3HJHA 3IERA 1UXIA 2DKFA 3LBNA 1UZMA 2VP5A 1EDOA 4CIAA 4ZJUA 1APBA 2AE2A 1R16A 5LBUA 3KT0A 3BGOS 4DSZA 1U7UA 3RADC 4DFDA 3RS3A 4BGVA 4JGGA 4CM8B 4DDTA 2E5LB 3THRA 3NBUA 4FHDA 1DZ3A 3EY9A 4KN6A 1X1EA 1C8KA 2XUZA 4MA4A 4HRXA 1G21A 3I2YX 2CFOA 2OFWA 3K1JA 1DAKA 3EGCA 3FBTA 4WXYB 1LX7A 1P5ZB 4J0QA 2WJVA 4JGBA 3VPDA 1R9JA 2Y4NA 3VU9A 5E6UB 2VBGA 3WO1A 5LU8A 2MWMA 2VZ8A 4CDGA 3MJ4A 1YNOA 1TVMA 1E2UA 4QOEA 4TV9F 3MWKA 4C3OB 4P86A 2Y05A 2WG2A 1S2GA 1SWVA 2H1RA 1JXQA 4P84A 3PXBA 1V16B 5C5DA 4Y2GA 3AFOA 2ZI5A 4HG2A 1TA0A 3BGSA 2IS6A 4M0PA 2GUWA 4EEZA 1QZ3A 3FAKA 2EX0A 3GYBA 4L8FA 3UT5B 1LPNA 1Y34E 3E2IA 4L5JA 1E99A 2I4RA 5FPQA 3II6X 4AKEA 1HDCA 3LOUA 4PINA 1HZJA 2QNIA 1CBUA 4IEIA 1J9ZA 2B1QA 3K31A 4HN4B 3FPCA 1L7RA 2JVIA 2RJOA 3IKLA 3EGXB 3MXTA 2P6MA 3R3XA 1KO8A 2G5CA 4Y2RA 3O0TA 1ZNQO 3D8TA 3VI4B 2XZOA 4ALIA 5HUJA 2A1UA 3VVCA 3DLIA 3Q5DA 4Q48A 1UUFA 4QOGA 1N2EA 1T8TA 1H8HA 4RA6B 4F71A 1KI3A 3ME5A 5DHFA 1JDSA 3MIIA 1Y7IA 4P38A 4C4YA 5CDHA 3AILA 1E2MA 2VYCA 3I9V6 3PEEA 4FSXA 4ZHQF 4HUQB 4JEHA 6Q21A 1E1RA 4KIJA 4WE3A 4PGGA 3S28A 1Q7TA 3DZBA 4OQDA 2QBYB 3BH7A 5K0ZA 1ZUNB 3B1VA 5COBA 3MOGA 1B2LA 3W9BA 2F62A 4ZQIA 5L3QA 4HSGA 1WE2A 3I05A 4G67A 3SU8A 1DQSA 4K0KB 2Y6UA 1AHNA 3B2QA 2OUIA 5DHRA 2JAUA 4Z0HO 1Y6FA 1QH1A 3C24A 4N40A 5LVAA 2Q8NA 4P6VF 1ZJJA 3EH2A 5KQGA 3P32A 4IHAA 4YUXA 4S24A 4BLWA 3KKPA 4WVFA 5BWCA 2I1WA 1GKIA 3FGOA 4L95C 4EELA 5B6JA 4DUZB 1H2XA 4WZAE 3K2EA 4F04A 1YB2A 1QF7A 1RCFA 2OL4A 1XLUA 4WNYA 5H4HA 5HOEA 3I61A 1OLXA 2Z2YA 4CVNA 5JZMA 4E7PA 3ROMA 3RSHA 4CQLB 4IWNA 1HORA 3ELWA 1C2TA 3A3PA 3PGLA 4B82A 4FPXA 3JS5A 1XMJA 2Y9MB 1J20A 3LF1A 3U0VA 1I4LD 4G9EA 221PA 2B0CA 2JVKA 1VG0B 3ABZA 3CH6A 2PUJA 3DFKA 1H6AA 1XZPA 2V65A 1OT3A 2Z2JA 3HFRA 5BYJA 1GSOA 2FPRA 2ZSEA 2ZT6A 4NBVA 4CQMA 1VSBA 3V3KA 1IOLA 1PVOA 1JJIA 2JKYA 3WHIA 1PWZA 2FW0A 5FLXA 2PAAA 4LJSA 5TEVA 1JFTA 3L6EA 3H11A 3LCJA 1KH2A 3P26A 4LQDA 1MO4A 4NYJQ 2GD0A 1I1NA 2WHRA 4V39A 1MH1A 3WLFA 4DKXA 4DMFA 2MJLA 3T7CA 2Z6AA 2D3TA 1JAZA 1QKIA 3DV0B 4TQGA 1FXWF 3VO8A 1ZAKA 3FZEA 3ZWAA 3T3DA 1DTWA 5CVEA 3NWPA 3OOEA 3CF0A 1P1JA 2B37A 1ZL2A 2RGBA 3FVTA 3ORHA 4TTJA 4WZBE 1P0QA 2CFIA 2CNBA 1RKXA 4CKCB 1P81A 2J48A 1LNSA 2PSHA 3EEIA 4OM7A 1M8FA 3PVZA 2ENUA 2JANA 1X9IA 3WGJA 2ZTSA 3IMKA 4O6VA 1DADA 3B82A 3RUCA 3P2KA 3E53A 3Q7TA 4QPZA 3RYCA 3QBDA 3AG6A 3NP7A 3OX2A 4MVJP 4Q9NA 721PA 1Y5RA 4CL0A 3HA7A 1SIUA 2NXJA 2ACWA 2Q07A 5IN5A 5C80A 1Z9BA 5AVXA 1XTBA 3VR3D 5B58C 1YQTA 3VOAA 5I7UA 2MR5A 1B8UA 5DVZA 3G89A 2WFAA 1NG9A 3TQCA 5G1NA 5EZYF 5LIPA 2PKYX 3OZCA 4MW9A 4ZVLA 4WH0A 4FJ1A 4ZT4A 3E7XA 2QMHA 4YQYA 5B3KA 3GRVA 4LSWA 4BV9A 5ALKA 1P45A 4I3GA 1WZ2A 2FPIA 2NZWA 3R3HA 2QV7A 1RZRA 1N0IA 3PDHA 3IJRA 3DMDA 3FUWA 5AW0A 2PT6A 2YNMA 3UFXA 1J8MF 3L4BA 3AWDA 4HUJA 4Q03A 4O1IA 3VYUB 2XB2A 1CEQA 1SK8A 4RXTA 4GL2A 1BD3A 1G19A 2OLEA 4FHEA 3MJCA 1YBVA 3QLVA 4IHJA 1RM4A 4H3KB 5KNLA 1TUBA 4NAHA 1N2HA 3VYWA 2K7FA 1MIHA 2PL1A 4KQ1A 1JQDA 3CXRA 4LYJA 4MS3A 4PZ9A 4H6VA 2E4YA 2BFEA 4CUKA 4YMWA 1J4AA 1TM4E 2H31A 4GZ3A 1NNEA 4GFDA 1OH5A 1HZZA 3GA5A 5LP6B 1XTZA 4E5SA 3INGA 2A9VA 3GEIA 1ZM3A 2W6NA 3ESQA 4DLZA 4TMXA 2VTBB 5FPKA 3ZTTA 3H42B 3G2QA 3GZNB 4RUKA 5JDCA 1EJ6A 2N75A 1P1FA 4NYMQ 1S6YA 2CXXA 2JBAB 4M89A 1G6Q1 4DLAA 1EFVA 1EXDA 3UUWA 2OSBA 5BXQC 1ZMOA 3WYFA 5EXPA 2HK6A 1T5LA 2V1XA 3MUFA 2X8JA 1WEHA 3TLCA 4GBJA 3WIEA 2X13A 1QP4A 1YJQA 5JPDA 3HWWA 2VO1A 2XCTB 4AKSA 3E7WA 3HU1A 2GRUA 1J39A 1P44A 2NQ2C 3HB4X 1XK6A 3MINA 1ZS9A 3PG5A 2PKEA 3CX8A 3L6CA 2QUHA 3MRSA 1CE8A 1IWPB 1AGPA 1V0JA 2NYAA 3OUUA 1YBMA 2IC5A 2DEUA 2WM3A 1H0HA 3BK1A 4JENA 1GEGA 3TRDA 5T67A 4E22A 3BKXA 2AQKA 2CK3A 1D8AA 1CQJB 1IB0A 2NV6A 2DFDA 1J5XA 4RJJA 4E94A 2Y6VA 1RQLA 3QNWA 3TH5A 5L4SA 1SPBS 1RR6A 3S2SA 2VCHA 2WVHA 3EEOA 1SXPA 2RAFA 1N25A 4N8DA 1XVTA 3FVRA 4GBMA 4WOKA 5HE8A 1SU7A 4I1UA 1WY5A 2VS1A 3KEGA 1KY3A 2B92A 3JQFA 4L8LA 4ZVMA 4CDMA 1JDNA 1TD9A 2BGLA 3ZX4A 4GG1A 1FF9A 4MLCA 1JW9B 1YUMA 3O8QA 1H2YA 2A1IA 4WASA 3QEAZ 1YTUA 1E5DA 2VAWA 2VXYA 1I3MA 2CL6X 2PRYA 4PGAA 3UATA 2IYAA 2PUTA 1YV9A 4KAAA 3GVXA 4F3TA 3OHMA 1G18A 2EKQA 2G83A 4W1SA 5HJEA 2ZI3A 1X0XA 1IM5A 3PVSA 5GWXA 4HAXA 1VPWA 1GG8A 1TF2A 4NDZA 1X38A 1I1QB 2V3CC 1P19A 1K3UB 2AA3A 1SOAA 3E23A 4ARZB 2OZLA 1GV1A 3EXEB 5K3CA 5K6AC 4E5PA 3RUAA 4Q9HA 5HS4A 2IHKA 3R6DA 2PEZA 2QMUA 3TMAA 4D8XA 1BQ4A 1QFXA 1SN7A 3GRZA 1EUYA 3E35A 2ZBUA 5DP1A 2H4XA 3GVCA 2OTCA 1WMDA 2GK6A 2QMYA 3EARA 3R5HA 4MQBA 1OWMA 4MRNA 4DV6B 4Y0VA 1EK1A 1QBKC 1PFYA 1UADA 2O8VA 4OXYA 3WS7A 1ISSA 3IJ5A 5IT9A 1B8VA 3N5KA 1OFTA 1RLUA 3AHFA 2AOVA 4NE9A 3ID6C 2QP3A 2ZVJA 4XDHA 3E7DA 1MORA 4XTRA 4FXOA 3VHXB 1U04A 4DCPA 4Q9IA 2XUGA 3STUA 2ZB4A 5CEFA 1RC0A 5HIMA 5IK2D 2C92A 1QQAA 4I50B 5FOWA 5JXJA 5FFFA 3VPBA 1EDBA 4CLDA 3HCNA 1TF5A 1CY6A 1XU7A 3UYLA 4QM7A 2ZDHA 2F8MA 2QRLA 3WBFA 4ZVVA 2I67A 4RJ2A 3OJCA 5IBCA 4XUCA 1SXJD 3U4MA 1A5AB 3CZMA 1NW6A 1RVV1 3EMBA 1YIDA 2QY6A 3EAQA 2FZ4A 2X5NA 1X42A 1JSXA 3DE4X 5TSDA 3SPXA 3B60A 4A2PA 4D4MA 4RTQA 5I4BA 1HMPA 5EN4A 1GKLA 4PNPA 3HYRA 4WPGA 3ELDA 3LT5A 1QGAA 2PX0A 3H2GA 4QQNA 5JG7A 5AK0A 5LNK1 2XQVA 1SQ6A 5FWYA 2YV3A 3I6QA 1PJQA 3AF4A 1OZAA 3ZGVA 4RHUA 4PRYA 1JU4A 3OCJA 2QLMA 4FYHA 4R51A 2IWRA 5JALA 3HLKA 2PUAA 4LDJA 3L3BA 3PFBA 3D8NA 3CR8A 5HBRA 4C3ZA 5EZSA 2FSVC 2ZCVA 2OZEA 4OKNA 3FJ1A 4LRTB 3TSWA 4A6DA 4B3FX 1NVDA 2PSEA 4MHOA 3VNUA 5FL7D 1UBSB 4MWSA 1YRYE 4BNYA 2X9LA 3DDNA 3IKMB 4FKBA 1QRTA 2REQB 2YQ4A 4JYAB 3I5UA 4JEIA 4ZOBA 2Q4RA 4BKPA 2N9UA 3ZBTA 2YZNA 4IOJA 4XVCA 3BT7A 1IMJA 2Y3IA 4ID3A 1HMYA 2XTJA 1Y8CA 2BEWA 2E5FA 3EPLA 1SC6A 2ZR7A 3AF2A 4LJ7A 2F1HA 3L0SA 5G0TA 4QUAA 5TQ0A 1UFOA 1CUHA 3FUVA 3MCUA 2CNOA 1FVHA 1VIYA 4I6EA 4YCBA 5EWLA 4C4XA 1A98A 2Y1LA 5C8ZA 3TNJA 1P2SA 3ZX5A 3AUKA 1ZJWA 4EW1A 3B1ZA 3W8RA 1T1GA 1JHRA 2XMDA 4KR0A 4C04A 2ZAGA 4C0HA 3HKCB 2WVAA 4K87A 1CRZA 1JTVA 4A2CA 3O75A 3T6KA 3SVZA 5J2TB 4BKRA 3KE8A 1FFDA 1NWHA 1PK9A 4LXXA 3TZHA 5TIIA 4P08A 1NL3A 3DBHB 4QIHA 2HADA 1CJTC 1QAQA 2MMGA 2DQZA 2OXIA 1VGRA 1NBMD 3A9CA 2AOWA 3AW8A 3DV9A 3MWEB 5ELXA 3T7JA 3JWPA 3OM1A 3OICA 3LO5A 5JQGB 2X22A 1MOPA 1WPQA 2B1IA 1GHTA 4PFKA 3LF2A 3NMUF 5L95A 2Z9CA 1B6RA 1NLZA 1CG6A 3EZ2A 4ZYWA 2X41A 7MDHA 1OY1A 4JYBA 4TROA 4EY4A 1T1SA 4JP5A 4R2HA 1A7KA 2O57A 3EQ9A 3EMDA 4TRRA 3F90A 5MN4A 3GGJA 3K8ZA 4RA6A 3S7ZA 3NT5A 1GN8A 2QV0A 1W85A 1RQXA 3KFVA 1TYAE 2QN9A 1G1AA 3BRWD 3QPBA 3U4IA 4IXMA 4WD3A 2O50A 1OW3B 3HDQA 3RAGA 1DEOA 4BKMA 1ACLA 1E32A 5SZHB 2FRDC 3ZKAA 4BFCA 1I2AA 2KPOA 4K7JA 2WIBA 1VYHA 1DAIA 1MG0A 2O8FA 2RBGA 3PGA1 5HSGA 5DP2A 5EINA 1IZYA 2GERA 1Z2PX 1J70A 2YFKA 3DPSA 1YZVA 3FXAA 1S8AA 3A32A 3QKWA 4FFMA 3GYGA 3HMQA 4PSDA 3EVCA 3OURA 3SEFA 5FX2A 5CBPA 4PS1A 5KZMB 1RAEA 1ORTA 3I2JA 4C6SA 1M73E 2JASA 2WJ3A 2X5KO 2ZATA 1A3CA 4UHHA 4UZFA 2BGIA 4OSEA 1A9ZA 3AY0A 3GELA 1J23A 3HUDA 4RF3A 4Y9DA 4URZR 3M4YA 2ODEA 2I4MA 3C1TA 2X3FA 3IUNA 4CM4B 2YC4C 4PZAA 5EIOA 3WGLA 4RJTA 3P0EA 4HQNA 4AJOA 3AKYA 1VKJA 4CN8A 2JLAA 1VLHA 2I7VA 4MW6A 4UMEA 1H4SA 5IJZA 5M2QA 1SCIA 2C2ZA 4DCVA 1TOAA 4RHEA 2QY9A 1OX5A 2XQIA 4FSHA 1BU8A 2OK8A 4LVUA 5FUMA 3H5WA 4EFKA 4IJMA 1KKLA 1T8UA 2GI4A 3DEKA 3C98A 3IOCA 4NBNA 4P33A 2RBEA 1BOOA 4ZAFA 1G66A 5DBEX 1NUTA 3GZJA 5C4IA 5JAZA 1PTJC 1CNFA 2A9RA 3PNBA 2R96A 1HDZA 5DJ5A 2OG2A 5GMOA 2WJGA 1NVUQ 1PJSA 4QASA 1AKMA 5DNUA 4JP8A 3UBTA 4ZP1A 1GFWA 1V47A 1VHTA 2YYZA 4W7HA 4KQFA 3KXDA 2IYNA 4IXDA 1YU6A 3MTEA 4X54A 1KK1A 4M1TA 1RKUA 4F1JA 3JWJA 1EE9A 5AJZA 2QM8A 4M0KA 4F96A 3MOIA 1ADJA 2POCA 4PQRA 3RUFA 4EUEA 3OZFA 3FCYA 1GGFA 2YIDA 4I4TF 1JKJB 4HNAA 1TCVA 2I03A 2VQDA 3KZCA 1PWYE 2QRNA 2DR0A 4PSAA 4D80A 5C8VA 3DMTA 4OF4A 4EGCB 4FEAA 4OH7A 4HBGA 3USCS 4FYXA 4V03A 2H11A 2BFAA 3Q1LA 5GOZA 3T3NA 2HT1A 3PC6A 2RHMA 5E0KB 3PWKA 2IYZA 1E1KA 2YIVX 4GPZA 1O89A 4X20A 2IIVA 1C7FA 3VKUA 1ZNWA 1NFRA 4A0SA 1K8ZB 3ZW9A 5AM0A 4MKRA 4A6XA 3SBXA 4KN8A 4LKOA 3FYCA 4RZ3A 4XD7A 5HK8A 1LFAA 3QY0A 1ZXBA 1NYQA 4B3MB 4D9BA 1NXQA 4WERA 1VKNA 1USUA 3IMEA 1T9HA 2AFHB 4OI2A 4WOJA 1I2BA 1KAMA 1CS0A 4R2KA 1NVGA 1WSAA 2WIJA 2X1VA 3QXSA 1ZUD1 3P0RA 5DTQA 2QM3A 4EMBA 3G68A 3RU3A 1H4VB 2PZLA 1GTRA 3GXOA 4KH0A 1K7CA 3P9YA 2W83A 4JFRA 3EZ9A 3C4QA 4MVJH 1KJ9A 1Z18A 3V4VB 2D0OB 4N0EA 2AG6A 2C1EA 1J90A 1FNBA 2HA6A 1RW4A 1WCIA 2O2YA 2WSYB 3BXHA 3NETA 4L3WA 4XEHA 3IE2A 5HDBB 4X9XA 4BFWA 3H0CA 5K0EA 1TM5E 3HBJA 4KC0A 2AX4A 5AJUA 1SXQA 2HH9A 1V3UA 2GTHA 4GXTA 4LI0A 1C3EA 2NYVA 3QM1A 2LXNA 2R6FA 1U2GC 4MTLA 2E6KA 5BSUA 1GCIA 1K8QA 1UMDB 4L4XA 3ZWXA 2EG9A 1DDGA 4FFBA 1HFKA 3OSZA 3P9XA 4UUAA 2QRVB 4FMBB 4MGYR 2VT6A 3WNZA 5CJJA 4WL0A 2AOUA 4BO1A 5IH7A 3GRRA 3AR8A 4GVLA 3Q15C 1YQDA 5JO0A 1X8LA 1A5TA 3PXDA 4CM7A 3MTBA 3WNQA 4YJFA 1QU3A 1E8DA 2OV8A 2OZVA 4DA9A 2HWXA 3NVAA 5HFAA 3KELA 4P5EA 4C0SA 3JZMA 5JC8A 3LC0A 4FN4A 4NEQA 4DPLA 3U4GA 2PJZA 3B1WA 5AR1A 3GJXC 3C8UA 4CMEA 3LK6A 2A84A 5IASA 4WOCA 4Z49A 4CR6A 2VP9A 5E7MA 2JCXA 1E1LA 3U81A 1J22A 2G82A 4MPRA 4IDCA 4WNAB 5D86A 2Q1UA 1LXCA 3OOYA 1F0NA 2C42A 2R7LA 2LCFA 2ZAOA 9MHTA 2DULA 2PS0A 1Y4AE 3LNCA 1RP7A 4QO7A 5E1DA 5JSYA 4B87A 1E58A 4R1UA 1G98A 5HCNA 3T15A 5JXIA 1XPUA 4EI7A 4ZEXA 3VJLA 3HTXA 4DMGA 1V2GA 3JD3A 3N8HA 3ZWCA 1Q57A 3A05A <