3FWYA

Crystal structure of the l protein of rhodobacter sphaeroides light-independent protochlorophyllide reductase (bchl) with mgadp bound: a homologue of the nitrogenase fe protein
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
268
structure length
268
Chain Sequence
GAKVFAVYGKGGIGKSTTSSNLSAAFSILGKRVLQIGCDPKHDSTFTLTGSLVPTVIDVLKDVDFHPEELRPEDFVFEGFNGVMCVEAGGPPAGTGCGGYVVGQTVKLLKQHHLLDDTDVVIFDVLGDVVCGGFAAPLQHADQAVVVTANDFDSIYAMNRIIAAVQAKSKNYKVRLAGCVANRSRATDEVDRFCKETNFRRLAHMPDLDAIRRSRLKKKTLFEMDEDQDVLAARAEYIRLAESLWRGLDPIDPHSLPDRDIFELLGFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the L Protein of Rhodobacter sphaeroides Light-Independent Protochlorophyllide Reductase with MgADP Bound: A Homologue of the Nitrogenase Fe Protein.
pubmed doi rcsb
source organism Rhodobacter sphaeroides 2.4.1
molecule tags Oxidoreductase
molecule keywords Light-independent protochlorophyllide reductase iron-sulfur
total genus 93
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 1.3.7.7: Ferredoxin:protochlorophyllide reductase (ATP-dependent).
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00142 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fwyA00
4B75A 3KKPA 3D31A 4AKIA 1P4SA 3AP3A 1KI7A 1VG0B 2H5EA 4C0SA 4KO8A 4LJ6A 2J0UB 2KJQA 1A2KC 1U94A 3OEHD 2O52A 4DEYA 1SZPA 2F9MA 3ZS8A 3C8UA 4M1TA 2QSYA 1SXJB 1N6OA 5J4LA 4B3GA 2OT3B 2EFCB 1GL7A 5DE3A 1OXSC 1X1SA 2QUZA 2GAOA 1TU3A 3C41J 2BWJA 1SHKA 1G291 3ZD7A 1XPOA 1ZNYA 2ECKA 5HE9A 4P4SB 4IDOA 1TF2A 3O47A 3KQHA 1W7AA 2YHSA 1F6BA 3G0HA 2J46A 4HLUA 5HR5A 4W9MC 1F48A 4B74A 3FE2A 5LB2A 2D7CA 2ODEA 3TUIC 1AZSC 3P1JA 4Q21A 4KLNA 4Q03A 2ZUCA 4JT2A 2IHBA 2VP9A 1FQJA 2CE2X 3HWSA 3K70C 2GESA 1RPZA 3MG9A 4V0LA 4L15A 3EPKA 3CBQA 5AJWA 1G8YA 3FOZA 4EPXA 4MKGA 2F3TA 2NPIA 1KHTA 2D3WA 4Q66C 1HH4A 1XMJA 2QAGA 2VF7A 3KXKA 4JBWA 5EXXA 1K8RA 1ZU5A 2HCBA 4FCVA 2IXEA 2JJ2A 4LHVA 4KXFB 3SHWA 3T06B 1UPTA 2XTZA 1JQLB 3RSLA 2F1IA 5HPYB 2BKEA 5EUMA 2JLZA 2WHXA 3HR7A 2VYFA 3QPUA 2R2AA 1QHYA 4DC9A 2CBZA 2LKDA 1N5JA 3CNOA 1XWIA 4PANA 3EW9A 4G5GA 2ZITA 1KOFA 2YWEA 3QG1A 4XH9B 1E9AA 2JGNA 3L8ZA 2BC9A 2CHGA 3UMSA 4K8OA 1YZNA 2OAP1 4GOXA 1BS1A 1KDTA 2IK8A 4B35A 1G7TA 4A2QA 1MKYA 1W36C 3QVVA 2DFNA 2BCGY 4DIEA 3X1YA 2REXB 4Z8XA 4YMTA 1XB2A 3EA0A 3EZ7A 5CLLA 4PC1A 2W6JD 2FPLA 2OESA 1Q44A 3U44A 1TNDA 5CITA 1QVAA 1VIAA 4DZZA 2V8OA 1SXJA 2OCPA 3ZIAD 2HT1A 1R6BX 2ZETA 1Z2AA 1Q1EA 3W6PA 5GVRA 2QA5A 3HPRA 3CLVA 721PA 2X2FA 3PEYA 3OF5A 3MMPA 4ASUD 1YZLA 221PA 4KU4A 4TTRA 2FSGA 1Z29A 4EPWA 3RAPR 2XEXA 4D0GA 4DVGA 2C8VA 3ZS9A 4C9BA 4M4SA 2GBLA 1ZJ6A 1II0A 2OLJA 3WYFA 1FZQA 1B0UA 2I4IA 3GLHB 2UZIR 1G16A 1NKTA 1PUJA 2IYVA 4FCTA 4ESVA 2RH5A 4MGIR 2WKPA 1DG3A 3I1FA 1XTQA 2IYXA 1Y63A 3EPHA 4BPBA 1TUIA 1P60A 2X77A 4E22A 3RS5A 5KOYA 2JATA 1YHNA 1HE8B 1WBDA 3I8SA 3QY0A 4IW3B 5H1YA 1D9ZA 2EFEB 4PPGA 1VCNA 4D0LB 4JLPA 4A8JC 3LH5A 3VTKA 4A2WA 1PLLA 1Z28A 5JSZA 1IONA 4EQ6B 2IYUA 4Q7MB 2A9KA 3KUDA 4ZDKA 2EQBA 3K0EA 2ZR9A 4LBYA 2GJKA 3RWMB 1OYWA 3WRYC 1XEXB 4IDNA 4HUQB 3GP8A 3K0AA 4B76A 4I99A 3ZH9B 3GLIB 4ZDWA 4PC2A 2C2HA 1GG2A 4C0LA 3EXAA 1FL9A 2FNAA 4IDHA 3SJCA 1DAKA 1DOAA 3WBJA 2FFQA 1R2QA 4A0HA 3F8TA 4X8HA 2WBLC 4PSAA 3UG6A 2VF8A 3BGWA 4CVNA 4ZKDA 1DELA 2Q9AA 2AK2A 2FU5C 1FX0B 2WJYA 4Q4LA 2ZROA 4TZ6A 2ODNA 2HV8A 2W6JA 1VYVA 5JBQA 5KU1A 1OH7A 1XXHA 5C18A 3QOFA 4XTRA 1ZNWA 1BO6A 1FTSA 3Q7PA 4XOIA 2CHQA 2GK6A 1U2RA 3K09A 1R0WA 1KY3A 4JKIA 4ARZB 3ZQ6A 3HU2A 1KYIA 2Q3FA 5C2JB 2HJVA 1XZQA 2AN9A 1W2GA 4QNMA 1NVVQ 4MKIA 3ZJYA 3VR5A 4DDVA 2FSHA 3E2IA 2JLYA 4P33A 3P4YA 5FFMA 4Q4HB 4AKGA 4L9WA 4RD6A 4M9SA 2WAXA 2CK3D 3NHAA 2FV8A 4DCUA 3KFVA 5EE3A 4QGAA 3IEVA 3VQTA 4GDFA 2WICA 4W5JA 4C0JA 2VPPA 1HQCA 4F91B 4GSYA 1VECA 1G21E 3BORA 1KSGA 4YXWD 2ZE5A 3M6AA 1A4RA 2WWFA 2QE7A 4D4MA 4C4PA 4V02A 3OZXA 2F1RA 1YZKA 2W2XA 2ZJBA 4LBZA 2LKCA 1E2EA 2F3RA 1IY2A 1LF5A 1I4LD 3FMOB 1QHIA 1XTSA 2ZS7A 4QJ3A 1KTVA 1KNQA 3EPLA 5FBLB 5SZKB 4HSEA 4LI0A 3I3SR 4AC9A 3AKDA 2JLUA 2YJTD 4ZIRA 2FPKA 4JKYA 3KUCA 1XTIA 3CR7A 1NLYA 3LO5A 2V55B 2QQ0A 2L0XA 3K9LA 3U5ZB 2J0SA 3AUYA 1OE0A 5CJ2A 2GBLC 2I1VB 1Q1BA 2ONJA 3SBEA 3QEOA 3E70C 4PAMA 2ZRDA 5HCNA 1ZVQA 1YE8A 2R62A 2HLDA 4FD2A 4DEXA 1XJCA 1N6NA 3GLHA 4N1AA 3TLXA 3GJXC 2BJVA 2ZJ8A 3T35A 2ODBA 3U7HB 4H9GA 5DLQC 4JBYA 1YU9A 1T3HA 1KO7A 5L8VA 3SFVA 4Z54A 4M8NE 3ECCA 5FBRB 4TQAA 2NQ2C 3TQFA 1AKYA 2ATVA 5EQTA 3V00A 1EK0A 1JNYA 2ZYWX 2HUPA 2NO6A 3D6TB 1FUKA 4FXPA 4QBGB 4O25A 5C46F 4MH0R 4LV5B 2O8DA 2J45A 3U3MA 5AUNB 1Z0JA 1Q21A 2QTHA 2NO9A 5FR2A 1T8TA 4GI7A 3ZDQA 4OYHA 1Q0UA 1D2NA 4Q4AA 5E7IA 3QBTA 4NYMQ 4S35A 3EARA 2B92A 3FKSA 2GTPA 1RVDA 4Q19A 4C30A 2XXAA 1T0HB 3BB1A 1NN3A 1SKQA 5H8WA 2ZPTX 1UKVY 3NBYC 1JB1A 3AVVA 1FQKA 2GNOA 1JEEA 1TUEA 3ZVNA 2R6AA 2JLVA 1IN4A 4QM6A 4A6PA 4UNNA 2RGNA 3A1SA 2IW3A 3RHFA 2ZJOA 1GRRA 1ZM9A 5EP4A 2QAJA 1F2TA 1HA3A 3KFXA 5JEDA 3L0SA 3D7MA 4Q9LA 4Q9HA 3TVTA 2WKQA 2IYSA 2KBEA 3X1WA 3FFAA 4E03A 3PV0A 1ZC4A 1W36D 3LD9A 2YKGA 4YMSA 3QQ5A 1CKEA 2J3EA 4BUJA 1ZD8A 4YONB 1Q57A 3PFIA 4URVR 3TMKA 4C0BA 2CL6X 2W2TA 5JZVA 2ZU6A 1S3GA 2GEDA 1AA9A 4I1VA 5EE9A 2CHVA 3THYA 4U00A 1E0KA 3VHLB 2QI9C 4QG7A 1Y3AA 2NMVA 1AKEA 2IYZA 2ZRPA 3A37A 1RFLA 2CNWA 4MUBA 3PUWA 1UKYA 2V7QA 3AP1A 4PPNA 1UBEA 4TYYA 1G6HA 4TLEA 3IKJA 4V0OA 4IVQA 3OE7D 2CJWA 4URUR 2OO7A 3EC1A 5CIQA 2FH5B 2OG2A 2HT6A 1JQJC 2I1QA 4M2LA 1ZCAA 4FMCF 1X86B 5G40A 1TF7A 4OHZA 4QM7A 3UG7A 3LFUA 4DSUA 4EKDA 1US8A 3IDQA 3QF4B 3B5JA 3K9GA 4BLSA 1G5PA 1O87A 1P9NA 1ZM7A 1DG1G 4MKHA 4TL8A 4TZ0A 4WVFA 1EX7A 2WTUA 4V0MA 4QL3A 2O0HA 1Z22A 1E0SA 1N0WA 4TN1A 1ZRHA 4Q02A 2VIIA 2H92A 1C4OA 2ZE8A 3U3JA 4A2PA 1XX6A 2RGEA 1G64A 4PC7A 2EYUA 3FGNA 2JDIA 4RD1A 3Q8XB 3CZPA 1OFHA 5DYGA 3T1QA 1XF9A 4UNSA 3VR1A 4BFXA 1U9IA 2HCJB 3NBXX 2IS4A 4B43A 4W7SA 3ZVRA 3OHMA 4LV8B 2GJAA 2F7SA 4GL2A 4C0KA 1TF5A 5CB8A 2AX4A 3AV0B 2OE2A 5FUYA 1NSFA 3K0SA 5HKKA 2A5JA 1NP6A 2FE4A 3N5CA 3BFXA 2EU8A 2CCJA 2QNRA 2ZAOA 4G5QA 4PO9A 1IAQA 4LC1A 3QF7A 5DISB 5CK5A 5KUTA 4DCNA 2FSIA 2YZ2A 2CJWB 1BMFA 5CIWA 3T1OA 3B2EA 4MITA 2W58A 2GXSA 2C99A 1M1YE 2PCLA 3B78A 1N5KA 4Z51A 1US8B 1G20E 2AL7A 5AUQA 1J99A 2WWIA 3QIAA 1M7HA 3RYTC 1E1RD 5KNCA 2WZQA 4M0LA 1KGDA 4RCYA 3U60B 1H8HA 4AKHA 2DFKB 2YOHA 3CRMA 3EZ2A 1CRPA 1SVLA 2OCBA 2D4HA 5CLQA 1X3SA 3MGCA 5IT5A 1U0JA 5AR1A 3B7GA 4TT3D 4NCKA 5B64A 4P0TA 4PHGA 2NIPA 1KO1A 1Z6GA 1KNXA 2W6IA 3KKQA 4DLRA 5IRCD 3CPJB 2JLSA 2VHQA 2XB4A 2E87A 3O8DA 1XDBA 1Z47A 2EWVA 1E99A 1KDOA 4HDOB 4LZZA 4MYCA 4BFTA 1P2VA 2XAUA 2PZEA 4BE7B 1UJ2A 1P9WA 1E9FA 2ZRMA 1JAIA 5DYIA 2DWPA 1ZNXA 4HLDA 4PHTA 3ZLJA 2V7QD 4HAUA 3QJYA 2PJRA 2DB3A 4M9XA 5FTKA 2J0QA 5FUVA 2WKRA 3AEZA 2ZM5A 1CS4C 1W46A 5FBQB 1SQ5A 1VG8A 2F43B 3TAUA 3B6EA 1SKYB 2BM0A 2BOVA 4XSGA 3GLGE 2GCOA 4DT1B 1JR3D 3OEED 3S1AA 1XP8A 3A4NA 3UMFA 3GFTA 1GNRA 3DMDA 2Z5FA 2FZLA 4FIDA 2ASEA 1XJ0A 4OQXA 1N0VC 3CRQA 2BMEA 3LXXA 3ICEA 2WMNB 2NOAA 4LJAA 3CWQA 4O0MA 4IOLA 3GLFA 3KL4A 3KKMA 4NCIA 4QGGA 2AWOA 2BIFA 1KKLA 1UBGA 3X1DA 1X8JA 4JLMA 2R6DA 2CXXA 1Z0IA 5H68A 2CVFA 2P5TB 2OCAA 2RB4A 4TMXA 3BB3A 3RS2A 2A7QA 1G3QA 2JEOA 1KK2A 3IILA 4AG6A 3CUEF 2PT5A 2MMGA 2QRNA 2YOFA 1G41A 3T15A 1Z63A 1TQDA 2A5DA 1T6NA 2G1KA 3KX2A 3RWOA 4JLAA 1S9DA 4Z1MA 1V5WA 2ZTSA 4KODA 3SU8A 5FI0B 4YDSA 3PUZA 3WMEA 2ZXUA 2OHFA 1W47A 3PG5A 5E4FA 4PO1A 3PITA 2Z4RA 1Z0AA 4D0NA 2OCYC 2BJWA 3GLGB 4B48A 3BRWD 5FOVA 4O2RA 2Z6VA 4R7ZA 2V54A 2ZRCA 1S1CA 3NWJA 4PQFA 3RS0A 2ORVA 1F60A 3GLIE 2P5SA 3IQXA 1FP7A 2GA8A 3LBIA 4L4UA 4PC3A 4RSGA 5BYJA 3KJGA 3TR5A 3VFDA 4A82A 1Z3IX 1BMFD 1NSTA 2GZDA 4QBIA 2XZOA 1YZQA 2J59A 1OPXA 4AYTA 5FPYA 4DSTA 3F0TA 4A15A 4D2IA 4LDJA 4QHTA 3ADCA 3C5HA 5FL7D 3FHTA 1WA5A 2O0JA 5AUPB 3WXMA 4EQ6A 1N6RA 4MRRA 4GMXA 4OQNA 3NDPA 2I3BA 1AN0A 5L3QA 1GL9B 1TEXA 1E2DA 2GCOB 1FOEB 4DT1A 2GRJA 1E9CA 3L0OA 1WE2A 4KV9A 4KAXA 2OUKA 2B7BA 1QF9A 1VG1A 5JRZA 1F2UA 2NO0A 5G3ZA 2PZGA 3GFPA 4RCZA 4EJSB 1PZNA 3ZVLA 2W6ID 3CNNA 3QBVA 4CEIB 2PMDA 4TYWA 1CR2A 1UDXA 4LX0A 2ZE7A 3IO5A 1GIAA 4JVSB 4Q7LA 4G5RA 3THWB 2GEUA 4CZ2A 2B21A 1YRBA 3BBPA 4B2PA 2ZRKA 3PUYA 2IYTA 1RRGA 2IUUA 5JJLA 3DOFA 2GEVA 1NN1A 4ZO4A 4YMVA 2WOOA 3W8RA 3RRNA 3RSOA 5FTMA 4AI6A 2IEZA 4KSBA 4QC2A 4XWKA 4R2IA 1OT3A 4PSVA 2KBFA 4MDFA 4C7OB 1OFIA 3A4MA 3IUYA 1ZAKA 2J7PA 4HB3A 2EFGA 5FUXA 1HT2E 4OHWA 2ONKA 1NN0A 3HU1A 1ZD1A 1E2IA 1S0UA 1RC8A 1IHUA 3CX7A 3VHXA 4N0EA 1P72A 2F43A 4WZAE 1FUUA 3TKLA 2FJUA 1KSHA 1R0ZA 2ZRGA 2QMOA 3FMPB 2FGJA 4BRUA 1ZNZA 3DL0A 1NBMA 4ZKEA 2HDNB 2ZVQX 1KAOA 2FA9A 1NG9A 3KXLA 1MRSA 1WQ1R 4A92A 4LRWA 1CULC 4F4JA 4CEHB 3VNVA 1N5IA 4RVCA 3GEHA 4J0QA 2ZSBA 1CJTC 4MA4A 5JS7A 4Q47A 4I1SA 4RZ2A 1EFRA 1VG9B 1X1RA 3NG1A 4BFYA 3ZGXA 4OKSA 1PJRA 1E79A 1Q12A 2ZRBA 4U7DA 1RYHA 3DHWC 3ND8A 5FPHA 3Q9LA 2A5FA 5G3YA 5B58C 2IS1A 3QE0A 3AF3A 1OHHA 1NBME 4R2HA 2BMJA 2GCPA 3R9WA 3IPXA 1L4YA 3LW7A 3WP0A 1GL6A 1W49A 4WAUA 3QSYA 2BBOA 2EWWA 4NH0A 2WPDD 3EA5A 2GAAA 3CM0A 2BBTA 4O2LA 1S96A 4IFBA 4MKFA 1KK1A 4M21A 4C0AC 5FL3A 4CEHA 4QNRA 2OAQ1 4US0R 3EZ9A 4UKDA 1QZXA 4BEJA 4NYMR 3BWDD 1R5NA 5FBWB 4BFSA 1MO5A 3K0CA 2IL1A 121PA 1KI6B 1HY3A 1IN7A 4PQRA 2J9RA 3H84A 5DGXA 4US2R 1IXRC 1CJMA 2ZU0C 2N42A 4CEJA 4BRWA 3IHLA 3L0IB 4NE2A 2BM1A 1XPUA 1OB5A 4A6XA 2H1LA 3Q7QA 1JR6A 4Y0VA 3DEFA 3W3AA 5B2ZA 2F6RA 2ZSFA 2ZYVX 1KMHA 3B1VA 1GM5A 2G3YA 4CT4B 5TXGA 3N2EA 4KLZA 1LV7A 5FOTA 1ZBDA 2MSEB 2AR7A 1O3YA 4ZCMA 3KQNA 1NNEA 2IYQA 2IS2A 1P6XA 2AXNA 1GKIA 1T0JB 2ZI9A 2REBA 4F38A 1GITA 1SVKA 2BKUA 2WWXA 5A0FA 3REFA 4C2TA 1NI3A 5AJVB 4LJ8A 1F2UB 1T9HA 4X8MA 2KE5A 2E9SA 5F2EA 4FMDF 3R8FA 1TQ6A 3TVDA 1KZ7B 1OKKA 4YMWA 5AJXA 3O8RA 3A6PC 2GXAA 1KI2A 2PMKA 3IIMA 4LPSA 3HJNA 1G4UR 4FW9A 4IFEA 1Z83A 4DB4A 2DYKA 2QTFA 1AIPA 4NMMA 4XIGS 2Q6TA 4LHXA 1RRCA 1R0XA 4LHZA 4EUNA 3U7FB 2B7CA 4B6FA 3FMIA 4TYPA 3BXZA 2R6GA 2FFBA 2Z0MA 3R9XA 3N2IA 4Q4HA 4B3DA 1W2HA 2OV2A 3CPHA 3ETLA 4WW0A 1F5NA 5CYPA 3OIUA 2HF9A 5JJIA 4NHOA 5DI9A 2F1JA 1OH5A 2KSQA 1JJVA 3R9IA 2JAQA 4GBMA 3SYKA 1IM2A 4K46A 4WBSA 4JVMA 3DZDA 3F5FA 3I72A 1WMSA 4S2EA 1HURA 4ZIRB 5K8TA 3WNCA 1YR7A 3T12A 4CIDA 3PUXA 1KO5A 2IEYA 3EASA 3UWKA 3L43A 4KJZA 4DHEA 2VO1A 4N3NA 1JR3A 4RFSA 4DBLC 1BYUA 4LJ4A 1GRNA 2SHKA 1KDRA 1E2MA 1IJEA 2BMDA 4KVAA 4A36A 4PC6A 1Z6XA 1TU4A 2OFOA 2R6FA 2G0TA 1QG2A 2NZ8A 4PTLA 4R71A 4FINA 2HXSA 1T5LA 1XCGB 3TSZA 4HAWA 1ESNA 1OXUA 3HU3A 2XB2A 1PUIA 4HAYA 3LAWA 1Z6TA 3TQCA 1E9EA 2PEZA 3B1ZA 3W6OA 2FFAA 4KFTA 5IHPA 4Z8YA 3ADDA 2UVQA 4XTCS 4UNQA 3B1XA 1S8FA 2RKOA 5JWRA 3LVQE 5L3RA 3PEVA 5AJZA 5FPSA 3U6KA 4MGKR 4M1WA 4I1UA 1RJ9B 521PA 5BWMA 1E69A 4B32A 3RRMA 4OQMA 2Q9BA 2GDJA 2H8KA 1P73A 2WJHA 4PHHA 1YRAA 2IT1A 1NIPA 2Q3HA 4DSNA 3U4QA 5FBVB 2XJ4A 1ZCBA 3T1TA 1ZUHA 3BH6A 4IXMA 1G5RA 1EFCA 4MRPA 2GZHA 5JHHB 1L4UA 5DI3A 5L3SB 2E1RA 5FPKA 5LB4A 1LTQA 3AGPA 3CPEA 3Q72A 4UXIA 1IN6A 2TMKA 1XTKA 4GOKA 2QG6A 4FN5A 1P61B 3LA6A 3U3RA 4DLTA 3FTQA 1OXTA 2J41A 3SQXA 1LY1A 4ZI3A 1KI1A 4Q9KA 3CR8A 4B34A 3NDBB 3U3OA 2CLCX 2NG1A 3A8TA 3MUFA 2FWRA 2CEAA 1KO4A 1RIFA 2H16A 2VLIA 5FR1A 2XSZA 2QROA 3TW8B 3Q85A 3I32A 1XMIA 4QJ5A 1CXZA 2D06A 1EESA 2RGAA 4AK9A 3CWZA 2ZR0A 2VEDA 4OL0A 4LWZA 4C0QC 3C14C 2X8AA 4IOMA 3D3QA 2WIAA 2ANCA 2FEOA 2PCJA 1N6IA 3THYB 2VP6A 1KI9A 1JR3E 2QQEA 5DSZA 3CF6R 1FP6A 3K0FB 1M7GA 2EFHB 2D2FA 3WY9A 5A4JA 2ZSDA 3A1TA 2WJIA 3F3YA 2FEMA 2VRWA 2GK7A 2CL0X 2A2ZA 4IVPA 4BGDA 1AZTA 1VPLA 3IBYA 1DS6A 4OQLA 2JJ2D 2OFXA 4B3CA 3THWA 2DWQA 4LGMA 1Z5ZA 2JLRA 2JDID 3O8BA 3OIVA 4X8LA 4JLNA 1S3SA 1TADA 5H70A 1E96A 5HTKA 5GJCA 3VU9A 1JPNA 1U99A 3JVVA 3R8CA 4FWTA 4P31A 1J2JA 2IBMA 3H1TA 2J7PD 3K53A 1CP2A 421PA 1LS6A 1Z0FA 4RZ3A 1MO6A 3CW2A 2CCGA 4HUQA 4B6EA 5HKKD 4NYIR 3B13B 1G3RA 4K81B 3BFKA 3IQWA 1EWQA 1FMLA 3AGQA 5TDHA 1E2JA 4KFUA 2NO7A 4URWR 2XNSA 3W6NA 2JLQA 4GRAA 3THXA 5KNBA 5SZHB 3MWLA 3EPJA 1CJUC 2QPOA 1Z8FA 3ASZA 3THOA 2DFLA 2YWGA 4W5WA 3IIKA 821PA 4C3ZA 4BEBA 4PPQA 4EJSC 3C4JA 2XZPA 2R44A 1AS2A 1DBSA 1J8MF 4AKEA 3C15C 1IBRA 2P2LA 5DI3B 3TGPA 3RNLA 1JALA 2A30A 5EUQB 3AVUA 5CB6A 2XSZD 1ZUIA 2ZVPX 3AF4A 4HZUB 4MYHA 5EXSA 3X1ZA 3NH6A 4NCJA 3I5XA 3GLIA 2PH1A 5G53C 2WWGA 5KHOC 1M6NA 1Z2CA 5K8LA 2GCNA 3WP1B 2C96A 1E0AA 1AS3A 2FN4A 1IY1A 4BFWA 1P9RA 5HCIA 3ZD6A 1D2MA 2EFDB 5F98A 4KBFA 4BFUA 2G88A 3U3KA 4IOJA 4HDCA 3DMNA 1XEWX 2H17A 1R5BA 2AFHE 2QGNA 2YYZA 4PAOA 1MRNA 2WSSA 4JJKA 3DZ8A 5F9FA 4HUTA 1KAGA 1R10A 2ORWA 4M22A 1FPMA 2YWFA 4TQUS 5FOSA 1P62B 3JZMA 4FCWA 2VHUA 3BK7A 1DO2A 4Q9IA 1S9HA 2IA5A 3QXHA 5L3QB 2ZRAA 1YJ5A 1E98A 4B73A 4ZI2A 4URYR 1Q3TA 1RJ9A 1XEWY 3I5YA 2QBYA 1DADA 4B33A 1WRBA 1DARA 1DAEA 5UKDA 1NJFA 1N0UA 4BLRA 1K5GA 1WP9A 2X1VA 1VKJA 1OIWA 2GJ9A 1Q22A 2J5XA 4KFRA 4P32A 4L8GA 1D9XA 1E6CA 4LHWA 3OAAD 3QF4A 3GPLA 1BKDR 1SGWA 2EYQA 2R6CA 1X8LA 4M9ZA 4UJ5A 1GKUB 4QBFA 2Q3MA 3LX5A 2C95A 1OXXK 1UEIA 2ZSAA 3VR6A 5AUOB 1WB9A 3B60A 3IGFA 4DLWA 2ZSEA 5G41A 2C78A 2KB0A 3THXB 5SZJA 3CF0A 1QHXA 1G18A 4JYCA 3VX3A 2QPAA 3WBKA 3TNFA 4JT4A 1ONBA 4TMKA 1AM4D 2P67A 2REOA 2VSOA 3BAFA 3W3ZB 1W5TA 3LBHA 4WXPA 5BQ5A 4EFLA 1G3IA 2GZAA 1OFUX 3H86A 2EW1A 1D2EA 2QENA 2Y8EA 4M9QA 2QMEA 4TTQA 1RE0A 4ZCLA 2QAGC 1U8ZA 2P6RA 4DWJA 3L2OB 4F7WA 2ZQ5A 2O8FB 1GAJA 3TSOA 5IK2D 1OB2A 2P0EA 1KMHB 5CJPA 2ZUBA 2J1LA 1G6OA 2IXGA 4L9SA 4QJ4A 3U7GA 1VHTA 2JLXA 1G17A 5CK4A 3DKVA 5SZIA 3UWOA 3BS4A 2ZRJA 1GOTA 3QI2A 1XD8A 2QZ4A 2G0NA 4XD7A 3P20A 3UPUA 4CEJB 1G4AE 3W90A 2IWHA 5JWOA 4Q1BA 4WIAA 5IDVA 4JVLA 2WWHA 3AM1A 5JEEA 2OBNA 1F3OA 2C03A 4HLUC 4KCGA 1T5IA 3AKYA 3SN6A 3K0AB 4OK3A 3CNLA 2WWYA 2XZLA 1ZM2A 2V6IA 4XSHA 2J0UA 4OHVA 2ZIAA 5EZ5A 4BLPA 4JJZA 4II7A 4WOPA 2B8TA 2BCJQ 2W2VA 1YVDA 1OIXA 2RGNC 3FDIA 4DRZA 3X1XA 1OLOA 2A5GA 3BD9A 4Q1AA 4L5BA 1X8KA 5D3MB 1KJWA 2VL7A 2IWRA 1UFQA 3OFNA 2QTVB 2IXFA 4TLDA 4CF7A 2MSCB 4Y0AA 2WJVA 4EPTA 1E2NA 1CBUA 1E9BA 4LPKA 3QXXA 3RRZA 2IS6A 2O8CA 1DTSA 1C9KA 1FNMA 1ODFA 4F4IA 2WSSD 1G9XA 3MD0A 3GJ3A 1EGAA 4D26A 4GMDA 1C1YA 1N6LA 1KK3A 3MCAA 2F9LA 2DPXA 1CJKC 1XZPA 1XEXA 3JZAA 3LV8A 4HB0A 5FUWA 3RDPA 4ARZA 1JI0A 4JBXA 1G5TA 4AIIA 2G6BA 1OJLA 3M4YA 1KJZA 2C9YA 3T5DA 1XPRA 2H57A 1Z0KA 2FG5A 2R9VA 4XVQA 3GLHE 1CEEA 2ZAMA 3QXJA 1E2QA 2PJZA 3RRYA 3SHFA 4A0GA 4US1R 3QUSA 4RD2A 1OIVA 2YV5A 1VIYA 2WJJA 1QRAA 4PXAA 4DJTA 5B57C 6Q21A 1SVIA 4ZDJA 3HYTA 1AQUA 3BFVA 4OK6A 4YQFA 2O8BB 1NVVR 1E1QA 5J4YA 1NVWQ 3H0KA 3PQCA 4B2LA 1H8HD 2ZI4A 1E79D 2IUTA 3BB4A 3HYRA 3K70B 1RRPA 2FMXA 3A4LA 3MLEA 4HB2A 1WXQA 4MYUA 1UBFA 4BASA 4LCBA 3VR2A 4P3YA 4GNKA 5DN6D 2MMCA 1XTRA 4RKEA 5GJVC 1XXHE 5KDOA 1ZP6A 3LQRA 1TQ4A 4FMBB 1W44A 3K8YA 3H2YA 4XD7D 2Q21A 1U81A 2FX3A 1HE1C 1NN5A 2DCUA 4H1UA 1II8B 2QU8A 2V6JA 2VA8A 2WPDA 5EP2A 1DAMA 4LY6A 3I61A 3KJHA 3KZ1E 1NLFA 3GLGA 1IJFA 3CH4B 5EE5B 4BLQA 2KWIA 4OI1A 3UANA 3KTAA 1E4YA 1IXSB 3T5GA 1HQYE 3CB4A 4Q5IA 3AF1A 1YR6A 2WVJA 5KDLA 3LBNA 3GQBA 2H7VA 1J70A 1RYFA 2ZYTX 2AKYA 3CIOA 3CO5A 1NMZA 3GLFE 2HYIC 2AXPA 1L7VC 4CYMA 4Q1CA 3E5HA 1SVMA 3KJEA 4LUCA 1ZYUA 1W4RA 4NPHA 1II8A 2Z43A 2FDCA 1JXMA 2QM7A 3GEIA 1N6KA 1IXZA 3ZIAA 5CM8B 1D8TA 1W0KA 3B8HA 2GHIA 2CNWD 4D4LA 4TL6A 3TRFA 2LWIA 4URXR 1A7JA 2GF0A 3K09C 4QRHA 2P6UA 3DM9B 5FPTA 4DDTA 3VKGA 2IUSA 3KDSE 5BXQC 4OHYA 4PSKA 2WMOB 3B9QA 1SVOA 1XTJA 2QT0A 4WZ6A 2B6HA 5DO9A 4HAVA 5J40A 2VSFA 3VX4A 5JSZB 4DB2A 4BFZA 1FNNA 2A5YB 5ELXA 3TH5A 2ZJZA 3P32A 4WXRA 1CR1A 5LDDC 1XBTA 4DLUA 4BWYA 4E09A 2GVZC 3EG5A 4TWZA 3GJ6A 2IYYA 2W0MA 1KMQA 4HAZA 3AUXA 4LC0A 1PVOA 1ZD9A 2OEPA 3REGA 1GDDA 1MABA 3IPYA 4DCSA 3LVRE 4V0ME 5C4MA 4Q01A 4P4UA 3AVWA 1G8PA 3QKSB 3U2QA 3R20A 4WA7A 1PLJA 5L3VA 2ZI6A 4AY2A 5JI3E 2ZI7A 4KSCA 3Q3JB 1QBKC 2ZI5A 3L82B 1IOZA 3NXSA 1CR0A 1H8EA 3CZQA 4LBVA 1S2MA 2XNDA 4QXAA 2W00A 1JJ7A 2ATXA 2VHCA 4CT5A 1XCPA 2PLRA 4GPTA 3I62A 4V0NA 2GETA 4Q4AB 4A8JA 3NVAA 4LK2A 3QENA 4P4SA 4PZLA 4LJ5A 1UKZA 2ZJAA 2V9PA 2XJ9A 4E07A 3U44B 2VTKA 4JLDA 1JEDA 4IXNA 3ZZTA 4D25A 3B1WA 1LS1A 1GNQA 3KQKA 3AB3A 3O8CA 4LBWA 5KSZA 4TL7A 1GZSA 1TL7C 2YINC 5FI1B 4JMPA 5KPJA 1II9A 1XD9A 4GP7A 3SS8A 3T1VA 2VHTA 5EXPA 1W1WA 4PR0A 1ZINA 5EJEA 2D7DA 4OI0A 2CLDX 3ZZUA 1LVGA 1M8PA 5JCZA 1UBCA 2HF8A 4DIDA 3WNDA 4ZV4A 1YZGA 3K9NA 2O8EA 3GJ8A 4PZYA 1XMVA 5JRJA 3GJ4A 4TMVA 4NYJQ 4YC7A 2HXYA 1QHHB 2OFWA 5TY0A 1N2CE 3KKNA 3P26A 4LOAA 3MJRA 4HI0E 3PJRA 1M34E 1NVUQ 3LLMA 3M0EA 4U02A 1J8YF 2FF7A 1XNJA 1NG1A 3U61B 2C04A 1KIMA 4OI2A 3SNHA 1T4GA 5JECA 4B3XA 1R5OA 1ZUNB 3L0PA 2CK3A 5CDFA 3BE4A 4NBSA 2O8BA 4FI3C 1ZIOA 3LXRA 5JJKA 3TK1A 1D6JA 2J87A 4GFDA 1YR8A 4V0KA 3GFOA 3E1SA 3MWJA 2BMFA 1X6VA 2QRZA 4ZCIA 4DLVA 1Z07A 1TPZA 1P3JA 3LWNA 4HZIA 4R98A 5TMPA 1HTWA 1E9DA 1T3SA 4LV6A 3OESA 2RHDA 2ZUDA 1WDTA 3IEUA 2D74A 5IK2A 3TJZA 3LRPA 2P65A 1GNPA 5DIFA 1CIPA 3ADBA 2WSMA 1YQTA 2O8DB 2O0KA 3EWAA 3NIBA 4EPVA 1Z6YA 4HLQB 5GJBA 2KI5A 5F3WB 2PLFA 1NY5A 1OYYA 2IC5A 4ACAA 2N1BA 4B44A 1V43A 4BZPA 3PEUA 1DAFA 1A2BA 1YZUA 2J0VA 4HLCA 1Z08A 1ESMA 1E2HA 3MFYA 2OM2A 4BECA 2G77B 1XXHB 2VP5A 2H18A 4KBGA 3VKHA 1G19A 1Z6AA 3ZQJA 4JLKA 3QKRB 2OLKA 1PV4A 2IYWA 2VHJA 3RS3A 2EVWX 1QHGA 1DPFA 4XWOA 4JSYA 3B82A 5K8IA 3NH9A 3EX7C 3V4RA 2FZ4A 4FWIB 2NZJA 3GD7A 1HT1E 1VCOA 4AD8A 3RVBA 5BN3A 4LJ7A 1ETUA 1JAHA 2ZJ5A 3AQ4A 3KKOA 4ZPXA 1W0JD 1B23P 3H4MA 2BBWA 4AWXA 3AVYA 4D80A 1E4VA 2MSDB 3DM5A 4QGHA 1COWD 2BBSA 3CKLA 4Q00A 1IY0A 2ZJYA 3SC3A 1GRQA 1J7KA 1FMJA 2IYRA 3KB2A 5HZKA 1DO0A 1U8AA 1MT0A 2D62A 3QXSA 5E7JA 2JIZA 1FFHA 1NF3A 4H1VA 3HP1A 4N0DA 1VTKA 1VYTA 2JJ8A 4M1MA 5DHAA 3A36A 2GILA 1XU4A 4HDQB 2A78A 4MDEA 2QP3A 3FHCB 4DCTA 1ZW6A 3KB1A 5D3MA 1R7RA 4NYIQ 1CJVC 1OFTA 2PT7A 3RANA 3VNUA 4ESHA 4JS0A 4TTPA 4QBHA 3VU9B 3JVUA 5KNDA 1CTQA 4KYUA 3KXIA 1KSJA 2AD5A 5E95A 4NONA 3T34A 2P6NA 2R8RA 2UZ3A 4DSOA 1R0YA 4C7OA 3IIJA 1KY2A 1Z0DA 3QNUA 5JS8A 4XJXA 3PEWA 3GMTA 4A0FA 2QMUA 1L8QA 2CE7A 3NBFA 3W8NA 2GF9A 1KZGB 1BIFA 2JCSA 1QHSA 2CDNA 2QM8A 1I4TD 3EIQA 2JJ1D 4D81A 2ERYA 2VP2A 4V03A 621PA 3K0FA 1NY6A 3SFZA 1CRQA 1NIJA 2G1JA 4OQFA 4ERNA 4M1KA 3HR8A 1E32A 2ORIA 4D6PA 2QT1A 5EXTA 4R9UC 3QKRA 2QP4A 4IHQA 1JBKA 1KI4A 3EZ6A 3TAHA 1G8FA 3QXCA 1GFIA 5BN4A 4DKXA 3LY5A 4DUGD 3AF0A 8OHMA 4F93B 2YOGA 3L8YA 1DE0A 5C1BA 3FHOA 4UXJA 3WYAA 3SZRA 5KPDA 1QHHA 4O3MA 3GJ0A 1F2TB 2PX0A 3EZFA 3FMFA 5EZ6B 1Q20A 2QN6A 2W83A 5KO2A 2XXAB 1AQYA 3OIWA 4QHYA 3UKDA 4HEJA 2AKAB 1W0JA 1TTTA 4KI0A 5BW8A 2WV9A 1E2GA 3MWYW 3W9YA 3D8BA 2PEYA 1E9RA 4UNRA 2IF2A 4Q48A 1E3MA 4GT1A 4QOSA 4RY2A 4L16A 1IQPA 4HATA 1OH8A 1LNZA 2OBMA 4RJLA 4TQ9A 3UMRA 4XVRA 4B3BA 4A9AA 4B3FX 3UXMA 1SKYE 1T3LA 4Q1DA 4EFNA 1W4CA 4URZR 3AKCA 3I8XA 2ZS9A 5CM9C 3GEEA 2GKSA 2B8WA 2YC4C 4Q7KA 3NEYA 3DOEA 3J81k 2IF0A 2LCFA 4LHYA 5KSPA 3OAAA 4JLBA 3AKEA 2NTYC 1E1RA 4CEIA 1ZMXA 4JYBA 3IO3A 1MH1A 4IDQA 4LSGA 4MGYR 3FFBA 4TYQA 2XOKA 4DLSA 1EFHA 3AVOA 1COWA 3CONA 2GJ8A 2CMKA 3FVQA 4FMCB 4JZKA 4EPYA 4OI4A 5A5GA 4G1UC 1M2OB 5CDFE 2HEIA 5TV2A 1NL3A 2O8FA 4IRUB 2NGRA 3MSXA 5KTYA 2JIZD 2JJ1A 3ADKA 2PBRA 1DEKA 2ZREA 3HPQA 1EXMA 4TMTA 2Z83A 5LD2B 1G8HA 2OXCA 2C9CA 2Z4SA 2ZI3A 3BOSA 3UATA 3VAAA 1ELOA 4DLXA 5FOWA 3RS4A 1DVRA 2OXRA 1U0LA 4GZLA 3TE6A 4POAA 5E3HA 2YWHA 3ICQB 2AD1A 3DO6A 5KSYA 2V1UA 2DBYA 4JLOA 1I2DA 1WF3A 2F1HA 1GUAA 2RMKA 4PAQA 4Q7JB 4TMZA 2FSFA 2RGGA 5EP3A 5KSOA 3FKSD 3AVXA 2NO1A 1G3UA 1MO3A 2WJGA 3S1AB 4JL6A 2JASA 4LJ9A 4MYTA 1SXJE 2RAPA 5D3QA 3WYGA 3VKWA 4MRVA 3W5JA 4PQYA 2R65A 1LW7A 2V3CC 2YNMA 4IKEA 2DR3A 4PZZA 3BERA 2UKDA 1KSFX 1N6PA 3ASYA 1JECA 1LB1B 2C9OA 2JA1A 3GLFB 2O8CB 1E94E 4G01B 1SXJD 2IHYA 2P3SA 3C5CA 1VDZA 3PENA 4RD4A 3SR0A 3NHBA 1MR3F 3PVSA 4CDGA 1E2PA 3QVUA 3RC3A 3GCGA 1N5LA 2VH5R 4DUGA 4IDPA 3HDTA 5JMTA 4RFVA 3LX8A 3OFND 4F92B 1ANKA 3EC2A 1H65A 5JHGB 5TVKA 1SVWA 1KKMA 3I73A 2K5UA 1S1MA 1EFTA 1FTNA 1DAGA 1DAIA 1KJYA 1E2FA 1P5ZB 4M1YA 4B2IA 1K6MA 5JLJA 4M1SA 4Z1MD 2V1XA 5DH9A 4DDUA 1T91A 1W4AA 4AYWA 3AF2A 2ODWA 1UAAA 1E1QD 5L3SA 1TX4B 3BJIC 4I4LA 1FX0A 2WWWA 2XOKD 4JSTA 3K0CC 2DHRA 3DKPA 1UEJA 2RGCA 1QG4A 4M53A 4ILEA 1G3MA 3UK6A 2BDTA 5JWHA 5J4VA 2ERXA 5BYKA 5DN6A 3QPVA 3PUVA 1Q3HA 2PZFA 4PPFA 4TLAA 3R7WB 2GJSA 4RD3A 4TLBA 3LDAA 2DFTA 1HUQA 4DXAA 1EWRA 3AP2A 1UDWA 4MUAA 4LYJA 1G7SA 5K8UA 2XGJA 2XTMA 4OBEA 1N6HA 5EE1A 4NP6A 4NL4H 1N3BA 1Z06A 4XWAA 4TMWA 3WHLA 1Q1ZA 2Q0HA 3ZZ0A 1NVXQ 4OK5A 1UF9A 4U5XA 4ITRC 4IEEA 4CRWB 3NEJA 4Q4JB 5AJYA 1QHNA 3VMFA 1OW3B 3DPUA 4TL9A 2O5VA 3RC8A 1XD2A 5GADl 5CYOA 4JVNA 1JXOA 4Q1FA 3KTAB 5J4HA 1KO8A 1VHLA 3FPAA 3P4XA 1CF4A 3IBGA 3MRSA 3G5UA 1CU1A 2QORA 5GJWC 3R7WA 1U0HC 3BIFA 2QY9A 2FOLA 1HYQA 2WM9B 3RABA 2RCNA 1M7BA 3ONWA 4G3XA 3K70D 4A1FA 4BLTA 2XTNA 1NRJB 1XEFA 3SDZA 1NJGA 1PLKA 3CH5A 4LJYA 1BYIA 2BVNA 1ZU4A 2BHRA 2GXUA 3FKQA 3QG5A 2FFHA 4YXWA 1E0JA 1MOZA 3TW4A 4EJSA 5KYKA 2G83A 5LD2C 2QE7D 4IOKA 3Q5DA 3KQUA 3CX6A 1W0KD 3U6BA 3CRRA 5FTJA 1LFDB 1AGPA 1XMSA 3PCRB 1D5CA 3X2SA 3SYLA 4F4CA 4EIWA 4EPRA 4BZXA 1AGRA 5J47A 3ZVMA 2NPFA 3EIEA 4LYAA 1MABB 1W5SA 2RGXA 4JL5A 4UXHA 1E2KA 4BLOA 3KQLA 1Q1QA 4NCHA 4BFVA 1W4BA 3TR0A 1OXVA 3QKUA 1E2LA 2F55A 1KI3A 3BH0A 2CCKA 3C7KA 3FB4A 4D4KA 3SQWA 1WBBA 2GWHA 2A3RA 4HB4A 5JI2E 4TSFA 3AVTA 5DHFA 1UADA 3TIFA 1XJQA 5AK0A 1KDPA 4X8OA 2C5LA 1NMXA 3FWYA 3G82C 2ZYUX 1ZM4A 4DDWA 2C77A 3ZYCA 1IN5A 3MJHA 4DLYA 1GWNA 1I4DD 1ZM3A 1NBMD 4M1OA 3WHKA 1RRFA 1R4AA 2XNDD 3A1UA 1E9SA 2J7KA 1AS0A 1TAGA 1VCIA 1YZTA 2XITA 2PX3A 2WAYA 3I4LA 1OH6A 3TSWA 4OJQA 2QBYB 2VQSA 3GJ5A 4JLVA 4EAQA 4XVUA 3SEAA 2X2EA 4NTZA 3SE0A 1GP2A 4A8JB 5IF9A 1R8SA 1NLZA 1S4QA 3EAQA 1VMAA 4RFSB 3MAAC 2BV3A 5TB5A 1G7CA 4A4DA 1A1VA 4B71A 4QKQA 4TLCA 1KK0A 5E7MA 2QPTA 5C4GB 3SBDA 4UQOA 1IN8A 2XX3A 4Q9JA 3DDCA 5B30A 3TUZC 4NDZA 1GVNB 1T8UA 2ZE6A 3FYHA 4KYIB 2AHOA 2FGKA 3I92A 3WNBA 4IVRA 3QPWA 4OJKA 2CLSA 1G8GA 1RKBA 5J5CA 1UKEA 3T61A 1OF1A 2IX3A 4C0HA 4TYNA 1WCV1 3NC1C 2V4ZA 2IYLD 1ZC3A 3VR4A 1GTVA 1GILA 4PO8A 1A5TA 2ZRHA 5TARA 3NKVA 4MQBA 4IEIA 2PL3A 4LYFA 1P7CA 4EDHA 5LPNA 4IJMA 2ZS8A 1KI6A 3VR3A 1ZIPA 2CL7X 3EWSA 1TQ2A 1BH2A 4WZBE 4G5SA 4E5UA 4G5OA 3ND9A 2C98A 4JL8A 4Q4JA 4A0RA 3N70A 3RS7A 4ON9A 3CRVA 2ZRLA 4CW7A 2GVDC 1MO4A 2JLWA 4P4TA 1L2TA 3QKSA 1EX6A 4I1OA 1G7RA 3V4FA 4YMUA 3WMFA 4ZDIA 4ACBA 2YC2C 1XCMA 1FW6A 2OILA 1JPJA 3B1YA 1M74A 2QEQA 3SJZA 2ZR7A 3LLUA 4PX9A 4AG5A 3OE7A 1OKKD 1YKSA 2AK3A 3AVQA 5FH9A 4RZUA 4OHXA 5ANRB 4UNPA 1U9IC 1U90A 1UM8A 3P27A 2W0SA 4KFSA 4C2UA 4EFMA 4Q1EA 3AVPA 3LQQA 3CRW1 3OIYA 2QSZA 2ZANA 2ZJ2A 1SHZA 4I81A 3A1VA 1SXJC 3PXGA 1P2SA 1TMKA 3K1JA 5J4KA 1AK2A 4DCVA 4HAXA 2N46A 4HZUA 5FL7A 4TSFD 5BN5A 3A1WA 4Q18A 1OV4A 3CF2A 1SVSA 1XD2B 1NKSA 5HE8A 4PFSA 3SI7A 4B47A 2AWNA 5FTLA 1GKYA 1J90A 3Q5EA 3NTUA 4PHFA 3WMGA 1XRJA 2VP0A 3CX8A 1XFAA 4G0NA 4MGZR 1K5DA 3PR1A 5LBIA 4GP6A 2WIBA 1MV5A 5F9HA 5P21A 3B85A 4ABYA 3K9HA 2Q9CA 1SULA 2D2EA 2G9NA 5JCPA 2RGDA 3TBKA 5EE0A 4KITB 5FOUA 2ZRIA 3OEHA 3U4QB 5DNYB 3M1IA 5FOXA 4HYYA 4NKRA 4UJ3A 4YDHB 4LYHA 3C16C 4MRNA 3GJ7A 5M04A 2FPMA 2ANBA 3PIRA 4RD0A 3A58B 1HEIA 1QVRA 1CR4A 3LW8A 2ZRNA 4QFMA 3TUJC 2CVHA 2BEKA 2OSBA 1YR9A 3LNCA 5AWFC 2ZRFA 5HZHA 4YLGA 2GXQA 2HJGA 1P75A 3NBZC 1EFUA 1A82A 3U7EB 1NMYA 2DWOA 5GVSA 2QAGB 1P2UA 1GSIA 1U98A 1RW4A 4MRSA 1I2MA 3B9PA 3UIEA 4DLZA 1TEVA 5FTNA 4QGFA 2RGBA 1W36B 2WOJA 3AH8A 3KJIA 4BZQA 2QL6A 4D4JA 1LF0A 4QHSA 4GZMA 4JIMA 2HYDA 4RKFA 2QGZA 4NZYA 4AYXA 3MWKA 5KDDA 4KVGA 1BOFA 1DAHA 4NYJR 1W48A 4AURA 2OZEA 2RHMA 4GOJA 1RZ3A 1KI8A 4FMDB 3SYNA 3RLFA 4CGZA 2AFIE 3BH7A 3SOPA 3DVLA 5EP1A 2VBCA 1R8QA 1AJEA 3EIHA 1U8YA 1VCMA 1HV8A 2O8EB 4W5HA 3W5IA 1VYUA 2DY1A 3IHWA 4NCNA 3WRXC 4ASUA 1EFRD 2HLDD 2VSXA 2QP9X 3BC1A 3NC0C 4RZXA 3SJAA 1OSNA 5JFGA 2X19A 2VP4A 1G1MA 1EG7A 2ZEJA 2OBLA 4D82A 2YVUA 2QMHA 4BQSA 4JLJA 4NU0A 1CLUA 3QEJA 1H8ED 1N25A 4TT3A 3SJBA 3V9PA 1OHHD 3W34A 1P2TA 1QDEA 3OEEA 4KHZA 3QKTA 2BEJA
chains in the Genus database with same CATH superfamily
3PDIB 2CFOA 3KKPA 4RL6A 2VSYA 3QVTA 2H5EA 4MI9A 3UC9A 3L06A 2VBGA 3Q3VA 2ADOA 2R8EA 3R09A 4GX0A 4IQ0A 2GM9A 4KO8A 4L85A 1NU6A 5CH5A 3R3SA 1ZQ9A 4R0NA 2HMWA 1WG8A 2G06A 4RF3A 3TRHA 3BTSA 3ZWPA 2OBBA 5J4LA 4ZYTA 4X84A 4FSXA 3EXFA 4QG3A 4B6JA 2JBAA 3ORHA 4CIBA 5KTNA 1FFXB 1DHRA 2JBHA 3L4BC 3QYAA 2BMAA 4JU9A 1WNTA 2QV0A 4N54A 2BWJA 3EIFA 1HC7A 1G291 3FRHA 3GHYA 1KVUA 4QGSA 1N77A 2G1UA 1M73E 4WASA 3I05A 2ECKA 2VYVA 5HE9A 1XQXA 3I4CA 3FSRA 3VDRA 3KQHA 4LQLA 4YP6A 3NM6B 1JHMA 4B74A 2Q1XA 5HR5A 3FE2A 2D7CA 3PT5A 4IH1A 5HGJA 2Z8ZA 3O84A 3OZWA 2O3UA 1AZSC 4P93A 1UKCA 4QFDA 3K9WA 3FBTA 4CI0B 5HIIA 3ZHVA 4D9KA 2VP9A 3ZHQA 1FQJA 3S68A 1Z4KA 3HWSA 3O7WA 4FMPA 1H2EA 2CGEA 1L3IA 4JFAA 4UBLA 4AP6A 3K2QA 3FOZA 2JAOA 1V1RA 3R3XA 4MKGA 3DMYA 1IATA 1EUYA 3E3OA 5EFZA 2F8TA 2NPIA 4FYPA 1ORWA 2Y4NA 3PYMA 4L5CA 4D42A 4OYRA 4TX1A 2ADMA 5JALA 4MWBA 2E4VA 3SY8A 3QE2A 1K8RA 3SHWA 1EE9A 4KXFB 3T06B 3GLRA 1UPTA 2CYAA 8LDHA 2PM8A 3RSLA 3MK31 5BNZA 3B6JA 4QYMA 1YQXA 2R2AA 4QDUA 4BNJA 2CBZA 2LKDA 3G5LA 2ZBRA 4PANA 2ZIGA 1HYGA 1Z45A 3HUUA 5AHXA 1FJ2A 2Z2IA 3M6UA 4LZJA 3SM3A 1XTBA 1U8EA 1E9AA 2XB8A 3L8ZA 4M0EA 1R6UA 5DM2A 3UM9A 3O4IA 1YZNA 1UEXC 4NV0A 1A8PA 1UBHS 2IK8A 2HOQA 4FGLA 5K7SA 4WJLA 1ZUD1 5FP0A 4A2QA 1ES9A 4FQ7A 4DR1B 3QVVA 3UK0A 3SMVA 1UL1X 5KJ1A 4ZEOA 3U4AA 3K8QA 3W77A 5K2OA 3K6RA 1LBHA 4EH1A 1JYFA 1PJ3A 1XLTA 3R3UA 4JFRA 4UTRA 3UHAA 2WF6A 4RULA 4IMJB 3U44A 2O1SA 4LHSA 5M5BA 1VIAA 4JDUA 3T54A 2AOUA 3LMKA 3MJEA 3ZTYA 5LVAA 1R6BX 4AY6A 1UOQA 2ZETA 1Z2AA 3Q40A 1SNYA 3IDZA 2J30A 4CMIA 1WUHS 1BHQ1 1CETA 1Q1EA 3NT2A 5GVRA 3JASA 3HPRA 2C82A 1GZ7A 3N8HA 2X2FA 4I50A 4YGYA 3RH0A 4LAFA 2DPMA 4ASUD 3OX2A 2CXOA 2XRMA 4KAFA 4LKRA 1Y7PA 4GPZA 2EJTA 4P58A 4J1TA 3ZS9A 1HQKA 4CTOA 4M4SA 3LYUA 3GRUA 4OHCA 1YB2A 1RABA 4J75A 1II0A 3C4QA 3HDYA 3O9MA 1FZQA 3UW3A 1WB4A 1YOVB 3OZUA 1G16A 1NKTA 1PUJA 3FLEA 3HXPA 3N87A 4WDRA 1LQ2A 3GUZA 4ZV9A 5KC9A 5ICCA 5KYNA 1C4KA 1SIOA 1YB6A 3NQ41 4AM8A 1F1JA 1X8XA 3G13A 2W90A 4EO9A 4HT3B 2OYCA 1O9HA 3T8YA 5KOYA 2JATA 4C89A 1HE8B 1WBDA 3ANMA 2DAPA 5B4VA 1BZYA 2I22A 1QE3A 3CU5A 2VDVE 3DEZA 1JU4A 3COZA 2XGMA 3T1NA 3LT1A 5LZ8A 3LH5A 4A8JC 3ZJVA 2ONYA 1PLLA 4S0XA 3IIIA 3QZUA 3C3MA 1UC5B 1GR1A 1IONA 2CNKA 1EA7A 2Q29A 5KQPA 3PQ4A 1VHDA 4ZDKA 4GC5A 2EQBA 4A0SA 3OPXA 4EF5A 5L51A 3L04A 3KTDA 3PRYA 2ZR9A 4HUJA 1XNRB 3PKJA 3Q11A 4TWJA 3KPJA 3N7TA 5BRNA 1EHYA 1MZVA 2QYTA 4WZAA 3TZHA 1ZOOA 5C8VA 3ER8A 3GOHA 4HYTA 2GZ3A 4DMLA 4ZEWA 3BE8A 5BQFA 4BMNA 4J16C 3EXAA 4IDHA 1M8KA 1BCRA 3A2NA 3ZDXB 2FFQA 3F8TA 4X8HA 2WBLC 1OASA 4WCFC 4HFRA 4HQLA 2D1SA 3UG6A 3X1JA 3R2JA 2YYSA 3RADC 1P18A 3DF9A 1ODLA 3WB9A 4ZKDA 2QMQA 4NBVA 1JFVA 4U9IS 5E1OA 4YY3B 1WXEA 4CFSA 4EL0A 2CV2A 4OHRA 1KQPA 4TZ6A 4C6RA 5AKHA 5I8WA 4RGVA 4W1SA 1GU0A 1EXDA 1VYVA 1Z12A 1G5HA 2RDMA 4IL5A 1XXHA 3LLVA 5C18A 3QOFA 1WUYA 4OUDB 3W7VA 1ZNWA 3E61A 4R4JA 3T7SA 5IF3A 3R0QA 3JD4A 2WQ6A 2IHNA 2I4OA 4HX2A 4J1SA 1TU0A 3AOEA 4AZ0B 4JKIA 2ZIFA 4X1KB 4C5CA 4CNQA 2F8MA 1O5IA 3ABOB 2JZOA 1WVGA 5B7NA 2GPJA 4XIFA 1XP5A 3KOMA 2BGWA 1NVVQ 3L8HA 3WSTA 1KH1A 3VR5A 4C6TB 2I71A 2C2WA 2FSHA 2PUAA 5E2BA 1AGNA 4P33A 4HX9A 3P4YA 2TMGA 2EP7A 3D4BA 5J2TF 2HIHA 4RD6A 4QU9A 1KWKA 3N2KA 4BU1A 3KFVA 4Q16A 3S70A 2KQUA 4GMGA 3VQTA 2JD0A 1I1HA 3F9RA 1LTHR 2I4RA 3QPDA 1NUUA 2PPLA 2VH1A 4ZZ2A 1JR4A 4MQMA 3DAYA 1FYVA 1V4BA 3RC2A 1ISIA 1CUFA 1PK9A 2R00C 1XPJA 3BORA 3KD3A 4N9WA 4LGYA 3CISA 3HCOA 3THSA 4PS0A 3RR2A 3UMBA 4D3SA 5E1MA 3S0JA 1W30A 4C2AA 4V02A 4BRZA 1WUKS 1XMOB 1V11A 1YZKA 2W2XA 3NP7A 5KX5A 4LBZA 4HDNA 1VL5A 4YUVA 1OZ0A 1XZFA 1LNSA 1IY2A 3I9LA 1I4LD 1I3NA 1T10A 1TO2E 2YW9A 5FO0A 5DTEA 1TKAA 1KNQA 3FPSA 1CW2B 4OQDA 3EPLA 4R51A 4E4RA 5FBLB 1A04A 1WSBA 5FKJA 3V1MA 1B2RA 4LI0A 2C97A 3DBLA 4J0KA 5EWMA 2ZCJA 3IC5A 4OLHA 3CR7A 2NSJA 4JGGA 3H2GA 2QU7A 4QO7A 1C29B 2V55B 4DANA 3U5ZB 1V48A 2XQIA 5CJ2A 1R8XA 5DLYA 3O1LA 3ISVA 1Q1BA 2FSPA 3R3HA 4F5EA 5LLDA 2DUNA 3OJCA 3E22A 4AROA 5AW2A 3EJ6A 5C5CA 4YVFA 5CXUA 4OF4A 3U7RA 3P9PA 1IZZA 1WV1A 5BV2P 3TRIA 3GLHA 5HCNA 3U48A 2O7SA 4KRGA 3DEJA 2ZSHA 3T35A 3N7AA 4AUMA 3U7HB 1M6WA 4FD3A 5DLQC 3GRAA 1YU9A 4JBYA 4R8VA 1G0NA 5TVGA 1PBTA 2AC7A 3C7DB 3EMKA 3V7WA 4A5SA 4TQAA 1YRQA 2IY8A 3ZE0B 1LPBB 1E6WA 4JK3A 2I78A 5CVVA 2C0CA 4U6SA 1KFKB 1L4EA 1JNYA 4QBGB 5TE9A 2NO6A 3OWXA 4OB8A 2D0DA 4CG2A 2BH9A 2J45A 5AUNB 4OBXA 2FQXA 3WKEA 3KM0A 2W48A 1Q21A 2AG8A 2NO9A 3EVAA 3MW8A 2V65A 4GI7A 4H4EA 4K28A 4ZXFA 4E33A 1UBKS 1UFKA 4NYMQ 2R7MA 4PYIA 5FEUA 4WK0B 4WJKB 1JIIA 2GAJA 2ISCA 4CWAA 1P7ZA 3IQHX 3EARA 3FKSA 2GTPA 2XXBA 4IDFA 3DMPA 3R5KA 4Q19A 5AM1A 4C30A 5A2QA 3PYXA 3UH1A 2XXAA 4A03A 3W6UA 1NN3A 3KEQA 3I01M 5H8WA 1QX4A 3T7TA 4LI3X 1IPFA 2ZPTX 3DEIA 5KI6A 2Y1FA 1UKVY 1L7PA 1IZ8A 1D7OA 5J1SB 4W8HA 1MD9A 1RHUA 3ZVNA 1BE0A 1J97A 1BA3A 1OA1A 2CJYA 4TT8A 4XFKA 3MWEA 3IV9A 4PGFA 4UNNA 5ALUA 1SXIA 4A6PA 4PRLA 3UOGA 4Q37A 2Q6LA 4KNWA 2WYIA 1ZM9A 5ULLA 5JS2A 3QA3E 3AI3A 1C9MA 1HA3A 5JEDA 2AFHB 3EXG1 3D7MA 4UAUA 5D1HA 1GPYA 4HRAA 2BGMA 4YUYA 4F2GA 2VAVA 2KBEA 5CB4A 2VBFA 1LWNA 3L4EA 4XCXA 1PX0A 1TJ4A 1ZC4A 1XQ9A 4DNXA 2NU8A 4QOEA 2QG9A 5HX7A 1N2BA 1RYEA 5DT2A 4CCWA 3KQWA 2Q3CA 4UUBA 5KYUA 1B1AA 2J3IA 2PWZA 2L69A 4CM8B 1CKEA 2J3EA 4CIXA 1L9XA 2XUZA 4YREA 3PFIA 3G85A 4DYDA 5C4IA 3EVFA 3KPYA 4M6WA 2G63A 3VYSB 3RPEA 3GI1A 3IAXA 2W2TA 3ZHRA 4XLLA 3JQ6A 3SXUA 1LV8A 2GEDA 1X7YB 1AA9A 1WQ3A 4RMHA 4B46A 3W5CA 2CMDA 1XIVA 3AHEA 3ZCUA 1LDMA 3TB6A 3AZPA 4QUBA 2EJBA 3THYA 1RXVA 1E0KA 3VHLB 2QI9C 3NEAA 4QG7A 6CHYA 3HWWA 1AKEA 1XTPA 3HY6A 3GRZA 2GK4A 2H1RA 3PUWA 1I7PA 3Q4GA 3BD7A 1YQUA 1UBEA 1VJTA 2G5TA 2MOKA 2JAHA 4YP1A 4TLEA 4S1VA 4IVQA 3M6MD 2CJWA 4OGFA 3SSMA 2OL4A 4URUR 4RTNA 5CIQA 1Y1TA 2H9YA 3PPIA 1PG2A 2OG2A 3L0ZA 2C00A 2BFCB 3RVJA 2HADA 5KNBH 3FJYA 4FDTA 3K0KA 4GNRA 4OHPA 4JHLA 4GICA 2QWXA 2OTCA 1G5PA 2H3EA 1O87A 3NX4A 1VPWA 1P9NA 1ZM7A 2HWKA 5DHTA 4J3JA 1YRHA 1JEAA 1Y4UA 1V8BA 4BIMA 4J4HA 2WTUA 2YN0A 1ISFA 3LHFA 1PP4A 4KR9A 1Z22A 1O5OA 4EVQA 2J3KA 5HG0A 3PNKA 4NK4A 2DWUA 2XQJA 4MZXA 4TN1A 5HJEA 2AN1A 3VSDA 2VIIA 1C4OA 2G04A 4Y2UA 4ETNA 4ZZ0A 2VXOA 5FAXA 3GA7A 1YQWA 4RD1A 5KJ6A 4TXMA 2M1XA 1A98A 4DQDA 5DNWA 2GPWA 2PZKA 3P0HA 3T1QA 3TNJA 3VR1A 4JT8A 5JBNA 2V5UA 1NKVA 1RE1A 2R47A 3BAZA 5DHRA 3WE7A 4BFXA 3FNQA 1YC2A 5K3FA 4O2AF 2OUIA 4ND5A 4QBTA 5EY5B 1UODA 4B43A 4L76A 1YKGA 2LDXA 3R1IA 2PDAA 5K3OA 5KYWB 2I2FA 2GJAA 4KTVE 4GL2A 3KFLA 1RWPA 1IOLA 3LY9A 4C0KA 1TF5A 1P0MA 2NZUG 2D7JA 3RFUA 3PX7A 1TJ3A 4ZXPA 2HSJA 4N0PA 4DHWA 5I4IA 3GN2A 2A5JA 2B82A 3NWBA 1IIRA 1I24A 1IUOA 1RQNA 2RI1A 2VPYA 4HQKA 2LV8A 3ABIA 3WBBA 1ZJWA 4E5MA 2BT4A 4YMIA 2NUTB 3SLRA 2IHJA 2AKEA 2EARA 1P31A 4MIEA 4LC1A 3W7AA 2IZ0A 1ZOPA 4EECA 1Z4MA 4AU1A 4DCNA 1N33B 3IQGX 5AKJA 1XZLA 5CIWA 5L4NA 1HETA 4B83A 1BRTA 2W58A 3KAJA 1JSCA 2C99A 1M1YE 1PL7A 5AI6A 2PD6A 4BCCA 4PYJA 5B2EA 1MG0A 1N5KA 1WTCA 2H4ZA 3I45A 2Y1KA 1L1RA 4RIFA 4MVYA 1G20E 2AL7A 2HU7A 2I2DA 2WWIA 1Y1LA 1M7HA 1N2GA 3DKRA 4MVCA 3SJUA 1KAMA 3H8JA 2WA1A 4ZJUA 9LDTA 2C4TA 3SZGA 3D7KA 2X8JA 4HGPA 1C1DB 3U60B 2QVGA 2JFOA 3CLSC 4UUOA 1H8HA 2VRCA 3K5HA 2DFKB 2YOHA 1CRPA 5ALMA 3WQRA 1CYEA 3BDAA 1HMPA 1X3SA 4EZBA 3L05A 5FUBA 5CBKA 1U0JA 3WDLA 4N76A 3B7GA 1QRTA 3BX1A 3JRWA 1RP1A 1N5DA 2QLMA 5B64A 5TT0A 4K9RA 2E89A 2W6IA 1BW9A 4LVUA 2QG4A 1JAXA 3KEGA 4XJSA 1PIWA 2JLSA 1BVHA 2C1EA 2XB4A 3O8DA 4HD8A 1XDBA 3E9MA 2Z8XA 2AF3C 1DUSA 3H65A 4AZWA 4HDOB 3NGXA 4MYCA 1ZAYA 2XAAA 1P2VA 1A71A 1Y4AE 2Q4OA 1V4NA 2E7ZA 3ANNA 3KEMA 3EK2A 4PRZA 4QPJC 2PZEA 4WRRA 3G2PA 1GZ4A 1UJ2A 4Z9XA 1JAIA 3SKYA 1U5AA 3H7AA 4WZBB 2AOTB 1ZNXA 1U28A 5DCLA 5CP8A 4FDLA 2B83A 2C8JA 2HXGA 4HAUA 2PJRA 4MVJH 3I9NA 2FZCA 1HZJA 3BFJA 1JW9B 3D4OA 5FUVA 4ZOCA 1IUNA 2Z3ZA 4W1RA 1W46A 3SOZA 1SQ5A 2F43B 4CMHA 3PXBA 4JI3B 2ZM5A 3GGSA 1VJGA 1SKYB 3ROXA 2V3WA 1RJGA 3P2JA 3VPXA 1S2IA 3E05A 2QX8A 1ISJA 1AXRA 2CXQA 3A4NA 4FKZA 2XVYA 4BHTA 1NUQA 3GXOA 1AHNA 2XHZA 1PR5A 5EJ2A 1J9EA 4X7MA 4EJ6A 1BWQA 4OQXA 3TDMA 2FP4A 4F46A 1N0VC 3TLMA 4GX2A 3TE7A 1KZHA 3KKEA 5A1TA 4XX0B 3WLNA 3ICEA 1NJSA 4KVFA 4RVUA 3COJA 3IKMB 4O0MA 3R0ZA 1ID1A 1NR7A 3KJZA 4QLAA 2R97A 4Q3KA 4QGGA 4YAWA 2AC2A 5IDYA 1UBGA 1X8JA 5FA8A 4W5NA 2NZVG 3KE8A 4JLMA 3Q8WA 3ZU6A 2CXXA 4M8LA 4N5HX 1ULHA 4C7XA 1PSZA 3KPWA 4ENSA 1GUBA 3FZGA 1L5GB 3L77A 4LRSB 1AMUA 1NNUA 3QUAA 2OC9A 4M1ZA 1K5HA 5HXAA 3BIXA 1WMEA 3CSUA 1EEHA 3I53A 1HM5A 2C3MA 2MMGA 2W6ZA 1N7HA 4ZYZA 3T15A 3DP7A 5JYEA 1Z63A 3RWOA 3VHRA 1EA5A 1FS5A 3FN4A 3ZWCA 1V5WA 4X65B 5LM3A 3OD1A 2P8SA 3SU8A 2GPSA 5C81A 3BEOA 5JYDA 1S8OA 1QJ4A 2GEKA 1X9GA 2JIPA 1U65A 2OHFA 4KQMA 4X20A 5BNIA 4HQNA 3I5MA 1ZXBA 3WMWA 1XALA 4Q93A 1MAVA 3VSAA 1WUIS 4D45A 3WWOA 3F78A 5GM1A 3G88A 2AEFA 2YJ5A 4PQFA 4Z6KA 3T7DA 3MM4A 3BKXA 1YBFA 3CA8A 1D2AA 1YDGA 3GRFA 5SY6A 3IQXA 4L4UA 3VPAA 5HRCA 1SC1A 1JHQA 5JZMA 2RE8A 3TR5A 3VFDA 2O19A 4JP8A 2PJUA 4FW8A 5AW3A 2XZOA 2H2IA 3UJBA 4PFKA 1FP4B 3DW3X 4G97A 5FPYA 1WEKA 3F0TA 3LXMA 4CIWA 4A15A 1IHOA 2QNIA 3ADCA 1FNCA 2CXSA 4YASA 2C83A 5EPUA 5IW8A 2WTXA 1XDDA 4UNIA 1IE3A 5HMMA 1S2DA 2IU4A 1N6RA 1YRYE 3WXMA 2XODA 4NU5A 1WCXA 2GEJA 1JFFA 3TZCA 1HQDA 4O4HB 5L3QA 2H2FA 4P7FA 2X0EA 2AG0A 2GRJA 1SXHA 3GUVA 5E0KB 1NVDA 1I3LA 4YJFB 4BN0A 3OTHA 3M4XA 1QF9A 1YQEA 4Y6LA 1R0BA 1QE0A 1TGVA 1T4CA 2FPIA 2P68A 3FPHA 2ZB7A 3OJXA 2PZGA 2TSYB 4ZAWA 5G3ZA 4X62B 1YJXA 1VB5A 2E1PA 2W6ID 3ZVLA 4MCHA 3M7IA 1RXUA 4CEIB 1ODIA 4HOYA 4OMDA 2O3TA 5LKRA 5IP5A 4F5WA 2YVQA 1M6VB 2ZE7A 1H2RS 1VGQA 4ID3A 1GIAA 5EZYB 1DWOA 3P94A 4Q7LA 4PGHA 1TTQB 2X5OA 4E3ZA 3THWB 1Y9JA 2Y0PA 4DBVO 3UC5A 5TJHA 3TS1A 2VJMA 2YMQA 1YV9A 2B21A 3I34X 3PF8A 5H3HA 3CYFA 3QWIA 1LJLA 2X4DA 2JFNA 3HVJA 2DM6A 4AMYA 2CJXA 1RRGA 5JJLA 3QX3A 3GK3A 5JO0A 5AQEA 2GT1A 4YMVA 5FWYB 5FTMA 4CL0A 4AI6A 4KSBA 2E4YA 1AE1A 4MS4B 2V6BA 1DNPA 4R2IA 1OT3A 1NRXA 3VYVA 4RPCA 5FWXA 1T9AA 4J3NA 4ITVA 5DWDA 4OX9B 1O95D 1OFIA 3ECAA 1ZAKA 2WHPB 4HH0A 2J7PA 5H9VA 4D9GA 2YHUA 3EJWA 4RX1A 3Q9SA 1HT2E 1KMCA 3FZQA 2P3QA 3QVSA 2EWMA 1Z2EA 2HCFA 2ONKA 3ADOA 1E3SA 2J6HA 3PPWA 3V1KA 3HU1A 3HNPA 5FT9A 2RHOA 4WXHA 4U7JA 1KP2A 1T36B 1XELA 5BUQA 1VIVA 5A5EA 1C8VB 1IQ0A 4WZAE 3TKLA 2IRWA 4YQEA 4MRMB 1KSHA 2E3JA 1IMJA 3WO0A 5DGDA 1WTAA 3ON5A 2QMOA 4WV3A 5CLGA 3H9JA 4IIJB 3A6ZA 4G84A 1L3BA 1R9NA 3DL0A 3MRTA 1MDFA 3PNMA 4NG5A 3T7KA 5EJ7A 2HHAA 3KG2A 1K7XB 1VHJA 2QR5A 3H0EA 1DUIA 2ZVQX 5T4HA 5K0NA 4ENQA 5BP7A 3V8NA 3KXLA 1LA2A 2HK7A 4MUXA 4UTNA 4AN4A 5B1YA 1CULC 3VZBA 1JFSA 5HM8A 5LQCA 1N5IA 3GEHA 5F2KA 3E18A 3WNVA 5CNMA 1ACJA 4I1SA 1EFRA 1VG9B 1XZKA 3AL2A 3FDFA 4KDCA 2JIRA 4GRIA 3AYXB 3H5AA 4ND4A 5KHAA 1QS0B 3Q87B 4FR5A 2OHHA 1P4HA 3N76A 2Z2JA 3EDCA 3OCWA 4U7DA 3K15A 1Y3BE 1BVUA 2Z2KA 3INYA 4JJEA 1FU7A 3GGGA 2GKGA 3AF3A 1OHHA 1PF7E 2ZIEA 3P9SA 4ITUA 5SYNA 5FOQA 3IPXA 3QFSA 4XI9A 2M9MA 1J0EA 3GJSA 3PDCA 4E32A 3OKFA 1E20A 1I1QB 1W49A 4LXTA 4NE9A 2BBOA 4NH0A 3QSYA 3N5KA 1MFPA 5F3DA 2I2WA 4O2LA 4EB6A 3EH1A 4MKFA 1LH0A 2H2GA 4QNRA 2VDJA 2JGEA 3A9SA 4K6HA 3EZ9A 4YAFA 1QZXA 1Q0RA 2C8LA 4FYXA 3KV3O 4KWTA 4E0BA 2IZ5A 4ARVA 4BMZA 3RYHA 2GCEA 121PA 3U13A 1IN7A 1HY3A 1ULZA 5IJAA 5DGXA 4US2R 3C6MA 1E6EA 2AYXA 1PDVA 1IXRC 3FX2A 4QOJA 1GTMA 4BRWA 3IHLA 1DQRA 2VYVD 5ALJA 3I9JA 1H4VB 3CUVA 6REQB 1ZGJA 2H1LA 2X8BA 5LA6F 5HIAA 3FMVA 4Y0VA 5KWVA 1UBSB 4XIIA 2XADA 3WGNA 4IJQA 3W3AA 4PYKA 2F17A 2VZ0A 2PSHA 1V3VA 2F6RA 1TD1A 2A0KA 1KMHA 1J49A 1QV7A 1XKXA 2V03A 2WKWA 3B1VA 3HM2A 3NTLA 2QX9A 1ULSA 2GN4A 1KXJA 3M6LA 1MEJA 2YYYA 2MSEB 2CBGA 2O6LA 5COQA 3TSAA 2AZXA 1NNEA 1PYDA 2ZT5A 4YMGA 2AXNA 2ZI9A 2REBA 4F38A 4HS4A 4NZPA 1J8DA 5IEBA 1L4MA 4RMIA 3DWFA 3REFA 2FEXA 1NI3A 4HGNA 1D2CA 4P2GA 5AJVB 1QYCA 1WHSB 3DTVA 3ROKA 4EA9A 3LKZA 3AQIA 4DE5A 2HDHA 2VAMA 1BE6A 1JLLA 2VHYA 3OMWA 4D9MA 5I7RA 1C0EA 1E7YA 3DZGA 3O5AA 5AJXA 2QX6A 1PNQA 1WMBA 2NAPA 3WKDA 1KI2A 1RWQA 5JU6A 2PMKA 2GXAA 4LPSA 5I4CA 4OO3A 1ZSYA 2GN8A 2DYKA 4B3MB 3S4YA 1G38A 2QD4A 4LYYA 1ODCA 4NU6A 4DV1B 4LHXA 2WG0A 3RYCA 3U7FB 1JG7A 1BE1A 2ZBGA 3Q3IA 4Y2XA 3AJAA 4TUYB 3ODGA 4B6FA 1M34B 2VAXA 3GGPA 3JD2A 3KUKA 1A9YA 3N2IA 4WW0A 5FFNA 5GONF 3O31A 1ACLA 2Y77A 3GT4A 2HF9A 3IUJA 2F1JA 3WDMA 2I4MA 4BJ6A 2B98A 1BGWA 5LZ5A 3I72A 2QRJA 7MHTA 1O96A 4IY1A 5ADHA 5DPMA 1QC5B 4WUTA 4DRXA 1OZGA 2TRSB 3EASA 1Q0PA 4O2BF 3TMAA 3UWKA 4G1MB 1JMKC 3WTCA 1Y98A 2R11A 2VO1A 1JR3A 1ZHHA 2TECE 1RWBA 2J5BA 4RFSA 1GRNA 1KDRA 1E2MA 2JBWA 2XUOA 1MEEA 4PSUA 1ODTC 2R6FA 5IBCA 3EAGA 2ISQA 2G0TA 3X1KA 1JH9A 1AXGA 3NM5A 4QUKA 1WJGA 5EJ9A 3PBKA 3ZW8A 4FINA 1IHXA 3PDHA 1F6DA 3V6MA 4CF4A 5KYYB 1XCGB 2PGLA 3HCWA 3CE6A 2XB2A 1BSVA 4GR9A 5K3BA 3UENA 3FKJA 1FXWF 2WDPA 2C58A 1ACMA 3IVAA 4WQMA 3B1ZA 2FFAA 4ECEA 4KV7A 5IHPA 2XD9A 3MC1A 4IQGA 3B1XA 1GPH1 1EFDN 2RKOA 3ZG6A 1P4AA 4D57A 3VNAA 5L3RA 5SY9A 4YB8A 5CXQA 3MT9A 1DKPA 1TVKB 1O8CA 1J2YA 1V11B 2AUTA 4RPKA 5E8JA 3V1LA 5FPSA 5JMWA 4BVGA 2HDOA 2QTAA 5DMXA 3EEFA 1E69A 5BUZA 3MWDB 3P45A 2HGSA 4ODIA 3OX3A 3L49A 2QTTA 2Q9BA 5EKDA 3VYUB 3O21A 2NSLA 3E4CA 1J2RA 2GDJA 3S55A 3P2IA 3ITKA 2PZ8A 3ZHYA 2QD2A 3E6AA 4WK2B 1KH2A 1OVGA 5T41A 1YRAA 1DEHA 1KYXA 2P2ZA 2Q3HA 4RGQA 3VU0A 2XJ4A 5EHQA 4ENUA 5JJCA 1YA4A 3PK0A 1RDFA 3BH6A 2OD9A 5CPBA 3T1TA 4C04A 1G21A 1D6SA 5BN5B 3CB2A 4B7AA 1YT5A 4IWYA 3VNBA 4R1NA 3KQTA 2E1RA 4D5EA 5CA1F 1XK7A 3K71B 1LTQA 1H42A 1NBAA 3C97A 3MOSA 4UXIA 2GLTA 4LGVA 1KIFA 3ML1A 4MQ4A 4DLTA 5JTTA 1Y33E 3FW1A 1NBEA 3SQXA 3GVIA 1SG0A 3ODPA 4LY9A 3KK0A 4YXFA 2XRFA 4UHJA 1HDYA 4Q9KA 1G42A 1X1CA 4B34A 5I3CA 1RFGE 3LKBA 3U3OA 3MUFA 3KTOA 4C2BA 3U16A 3OFVA 5JZOA 1OLXB 4MUKA 5FXMA 5KNCH 1GY8A 2VLIA 5FR1A 4YV0A 3K2IA 2IHUA 3KYIB 1QOPB 5ALIA 3DOCA 1EFVA 1LKZA 3LS2A 4QJ5A 4XX0A 1FYXA 1B73A 1CXZA 4RJKA 1N9ZA 1EESA 3RIXA 1UUFA 4TXNA 1JKMA 4MVJE 1MX5A 3KO8A 3BA1A 4C08A 3C14C 5LWQA 2ZUVA 4ZAGA 2WIAA 2PCJA 5E1DA 3WGHA 5BT9A 5EHIA 4DA0A 4DMKA 3EDRA 1D09A 1Y4ZA 1NNLA 4LVCA 3RU7A 2FKAA 1KEVA 5DSZA 3IMGA 4NFLA 1FP6A 4GW3A 3WR5A 1IBLB 5EYPA 1DKNA 1GUDA 4ZO8A 1T29A 4V38A 2P1RA 1RSZA 2A9RA 3A1TA 3F3YA 2J09A 3C98A 3QWHA 1XCBA 2VRWA 2XBMA 2A2ZA 1U11A 3BHJA 1LLQA 3RJ5A 5J59A 3DFUA 2XUAA 1QG6A 4ZN6A 3VGJA 1ZN2A 2WYUA 4UQLA 3GY0A 1E5TA 3L5OA 4OQLA 5HS6A 2RH8A 2V4MA 4R1TA 2G9VA 3THWA 1DLIA 1E3WB 2JVIA 3R3WA 2MR5A 3T3IA 2IYOA 4S12A 1EX9A 1TADA 3OZFA 4UMEA 4YP5A 5HTKA 2HLHA 3VU9A 1JPNA 4R8KA 4Z4QA 4LF9B 2C9ZA 2P9GA 3F5DA 3KHTA 1X14A 2SICE 1PG5A 2IBMA 3FTCA 3DE1X 1C3EA 1UAGA 2EV9A 3K53A 4DMGA 5BORA 3FNIA 3WL7A 1QX3A 4GPAA 5DF1A 4PZ0A 4KO1S 3MPOA 1Z16A 2GTIA 2I8AA 3EXHA 4OGLA 1PZHA 2CCGA 3WYCA 2BGUA 3M3DA 1JQ3A 3ROFA 3L7CA 4QQKA 4KI7A 4DC1A 5LU9A 3WGIA 3PQ3A 4GBGA 4YA6A 2J5QA 2WK1A 1XQVA 2GN2A 1FLAA 4V0RA 3OI7A 3QKIA 1EWQA 5LQNA 3AGQA 3FPEA 5CLHA 1E2JA 3ITDA 4KFUA 2NO7A 4URWR 3P0JA 1T0UA 5ALZA 1RRKA 3MWLA 3ADPA 1B15A 2P77A 1XZAA 3DF7A 1Z8FA 4KJXA 1OFVA 4XW2A 2ASVA 4F3KA 4YN3A 4LFAB 1Z5UA 3NWOA 4OU5A 1V7QA 4GLOA 5ERGB 4EJSC 1J8MF 4IKPA 4ZGBA 1YVPA 3C15C 1J0CA 2P2LA 4Q15A 4CM8A 1P1CA 4LQCA 1JALA 5ICMA 1V41E 2A30A 1GNVA 3QITA 1DJOA 4Z49A 3IT1A 4HR7A 4PY2A 2VS1A 3AF4A 1ZUIA 1MJHA 3IUPA 2JFZA 1GPAA 3KS9A 3MCWA 1YCGA 2CNNA 3MJSA 3NH6A 4HZUB 4NCJA 4RHEA 3IERA 4OA8A 2VH2A 5KHOC 2GCNA 3WP1B 2C96A 1T1IA 4MWTA 1IY1A 2FZ5A 2PUHA 2XWJI 4MUNA 5IU6A 3ZD6A 1DBQA 3T9AA 1CZLA 1I3MA 3M5WA 4IMPA 4KBFA 1GZHB 1R66A 2G88A 4UBJA 3U7JA 4BAGA 4BFUA 2V96A 4IOJA 3DMNA 4ZCPA 3WGYA 1R5BA 4PAOA 2YYZA 3ZXUB 3FGZA 1YDWA 5IWAB 4F8YA 4DR3B 3OD5A 4BMDA 9LDBA 1RPAA 2QZZA 5TMDA 4QOIA 3L41A 2HHCA 2OR3A 1JKIA 3U49A 3JZMA 1KHHA 2XMRA 4KKVA 5KQLA 4RHFA 3JZFA 4Q24A 1I94B 3WSVA 3ORFA 2ZTHA 1M2WA 4RVFA 4B73A 1NT2A 2IW1A 3I76A 4URYR 1RJ9A 3G0OA 3WDSA 3I5YA 1H2BA 4C0WA 1FFBA 4WD3A 4LC9A 3OLWA 1K8XB 2B8NA 1NJ5A 2DBRA 1IZ0A 3D6HA 1K5GA 1WP9A 4WK6A 5EKSA 3VOSA 1VKJA 2GJ9A 2I4LA 4CLOB 4KFRA 3B8EA 4L8GA 1D9XA 2WUFA 4FGKA 4D3ZA 1SGWA 3F6RA 2R6CA 5A03A 1XFDA 4M9ZA 2DG2A 2V4UA 2XDQB 4KPUB 4BNNA 1U7UA 4ARIA 1RM4A 4TZKA 4BAZA 3EQZA 1UEIA 4I1IA 4BJ3A 3NDRA 5K6RA 2ZBVA 5G41A 3P2KA 2VATA 2KB0A 4X1YB 3THXB 1KRXA 2NACA 4MXDA 4K5QA 2N47A 2QPAA 3WBKA 1XCOA 2JH8A 2JK1A 3T5BA 3TNFA 1EUQA 3KBBA 3PFGA 3UK2A 1XT6A 3H6HA 2BHNA 4J91A 1ONBA 4IGFA 1AM4D 4E30A 1AV6A 4RK7A 1W76A 2VSOA 4QTXA 3INTA 2Z5VA 3UB3A 3UN1A 3CW8X 2GZAA 1IPEA 2DHDA 4QGBA 2EW1A 3ZDZB 1GCIA 4MLPA 1RMQA 4XARA 5F9MA 2XECA 3RVDA 5GP1A 4ZQFA 5AKKA 3OQOA 1SURA 1RU3A 2PD4A 2OMEA 2NN3C 5EIEA 3O6VA 5IS2A 3L2OB 2ZQ5A 2O8FB 4G4IA 2IYEA 4BNMA 1KMHB 4JYMA 1AGYA 1OILA 2J1LA 4GQBA 3HB5X 3U7GA 5A04A 4ADSG 2O4UX 4K9KA 3P5BA 5CK4A 2ZWAA 4R1LA 3CX4A 2X22A 2POQX 3RIGA 3FROA 4L8LA 1J9ZA 1WZCA 4B8ZA 4AUNA 3QX9A 5DBHX 4KAJA 3W90A 4JX8A 3MIZA 4Q1BA 4WIAA 1KA9H 2GEBA 3JQ8A 5JWOA 2B2NA 3JVIA 2HN9A 2EX1A 4OU4A 1RYZA 4WOKA 4O33A 1T5IA 4PIVA 4R3NA 3G9XA 1DQSA 5H80A 1LBIA 1CQXA 3K0AB 3TXYA 2WWYA 1N36B 4GGOA 1YBAA 2XZLA 1ZM2A 3TFQA 3COSA 3FUXA 2MINA 3TCNA 4BLPA 2X2OA 1U3TA 4NDNE 1RI1A 4EELA 4WOPA 1W9MA 4J1TC 2Y0CA 3FOWA 4BVEA 1OIXA 1BX0A 2BGTA 5FAKA 3W1WA 3X1XA 1XNQB 3NHMA 1NRIA 4Q1AA 4L5BA 5HF8A 5D3MB 2VL7A 1T34A 1TKBA 1FC0A 3BWXA 4HQOA 4CLRB 4CF7A 5LZ4A 2MSCB 2WJVA 2ZT7A 1GGMA 1E2NA 3HKEA 5KAPA 3QUBA 5AO9A 3RRZA 4E5VA 3QK7A 1JF8A 3IE2A 3O95A 3P9XA 4QDKA 1I0ZA 1X38A 1DTSA 3GYGA 4S3MA 2IV3A 2FPOA 2ODQA 1FZTA 3CINA 2C29D 1Y5NA 4YRLA 1UKAA 2PMCA 4OB6A 3EMBA 3D6MA 3CXRA 3QHPA 4TYMA 1C1YA 1N6LA 2YXLA 1KK3A 4ARSA 2C7QA 1CJKC 1KJJA 2C2OA 3JZAA 3V4PB 5FUWA 5JJBA 4LHEA 4DV5B 3C3CA 4JBXA 3LP6A 2G6BA 4PYOA 2HA2A 4X64B 4BMSA 2B5OA 1THZA 2R9VA 2OCGA 4KK3A 4YAJA 3JQGB 3D7RA 4NZOA 3AXSA 5K3SA 3JALB 3RRYA 2CJFA 3C70A 3SHFA 3T7IA 4US1R 3WOVA 1VZ2A 1O08A 4ZTBA 2HA3A 3ENVA 2Q8NA 2RKWA 2YYAA 1OBOA 1T5HX 2P2YA 2YV5A 3BTOA 1VIYA 5KKNB 1QRAA 4JUAA 1MC1A 4PXAA 5E9AA 5TNXA 5F2NA 3NTVA 1MAWA 1SN7A 4EM6A 4HWKA 2FVXA 5E6RA 3D6AA 5DIFA 2V7PA 2R87A 3R0VA 4QYWA 5DWQA 2O8BB 2I29A 3AOGA 1DJQA 2G08A 2AMFA 1SCAA 1H8HD 4NV3A 4BU0A 2ZI4A 3AILA 4QXPA 4BC0A 3TTTA 3ZBTA 4BVKA 5CA1B