3FWYA

Crystal structure of the l protein of rhodobacter sphaeroides light-independent protochlorophyllide reductase (bchl) with mgadp bound: a homologue of the nitrogenase fe protein
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
268
structure length
268
Chain Sequence
b'GAKVFAVYGKGGIGKSTTSSNLSAAFSILGKRVLQIGCDPKHDSTFTLTGSLVPTVIDVLKDVDFHPEELRPEDFVFEGFNGVMCVEAGGPPAGTGCGGYVVGQTVKLLKQHHLLDDTDVVIFDVLGDVVCGGFAAPLQHADQAVVVTANDFDSIYAMNRIIAAVQAKSKNYKVRLAGCVANRSRATDEVDRFCKETNFRRLAHMPDLDAIRRSRLKKKTLFEMDEDQDVLAARAEYIRLAESLWRGLDPIDPHSLPDRDIFELLGFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light-independent protochlorophyllide reductase iron-sulfur
molecule tags Oxidoreductase
source organism Rhodobacter sphaeroides 2.4.1
publication title Crystal Structure of the L Protein of Rhodobacter sphaeroides Light-Independent Protochlorophyllide Reductase with MgADP Bound: A Homologue of the Nitrogenase Fe Protein.
pubmed doi rcsb
total genus 93
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 1.3.7.7: Ferredoxin:protochlorophyllide reductase (ATP-dependent).
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00142 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fwyA00
3B13B 2ZJ5A 4HLUA 2JLSA 3KUDA 1OYYA 2CLSA 2ZROA 2H1LA 3WNBA 4CEHA 2H5EA 1L4YA 3CIOA 4DLYA 4H1VA 3L82B 4PHHA 1CJUC 5B57C 3RVBA 2HF9A 3O8CA 3I3SR 2ODNA 3BJIC 3R9IA 3VU9A 3VNUA 1H65A 1E2KA 1L2TA 1NJGA 4MH0R 3K70D 1PVOA 4TYYA 3VHXA 1N25A 1QHSA 4LRWA 4AKEA 1NLZA 1YZKA 2CBZA 3QKTA 3ZDQA 2GBLC 1N5LA 4PSVA 4OYHA 3AF4A 4EPYA 1FUUA 1G18A 1HEIA 4M9ZA 3B78A 4Q7JB 2BV3A 1E2JA 5DISB 1IOZA 3P1JA 3R8CA 5J4HA 1OIXA 3NDPA 4MYHA 3MRSA 1YZUA 1XXHE 2CCKA 2NGRA 4PZLA 4TLEA 1H8EA 2C77A 4HDOB 4JLVA 3C5CA 5G41A 4XOIA 2JJ2A 2J87A 2W0MA 3TQFA 5DSZA 4PQFA 4ZI3A 2J1LA 2WWHA 4G5OA 2ERXA 1QG4A 2VHUA 3EZFA 3KX2A 3J81k 1FTNA 3LWNA 4ZV4A 2QUZA 4ZKDA 4C0JA 4BWYA 4ZCIA 3LY5A 5FOWA 5KSOA 4IW3B 1E3MA 2V6JA 3PITA 4WZBE 4CZ2A 1AA9A 4HB3A 1W46A 5C4GB 4D2IA 1IJFA 1NNEA 3B1XA 1KI7A 1BO6A 5CIQA 3EZ9A 4OK6A 4AYWA 1OXXK 3U2QA 3KB1A 1UKEA 4HDQB 3ASYA 4L4UA 5TVKA 1WBBA 3ONWA 3KFVA 3WHLA 2PEZA 5H68A 2NO1A 3KDSE 3W8NA 1TEXA 4TL8A 2PJRA 4U5XA 2EFDB 3TVTA 4A92A 3GLIE 4XVUA 2E9SA 1VTKA 1W0KA 2GK7A 3KB2A 3AF1A 1XXHA 4DB2A 5FI1B 4JSTA 2RGNC 2JLZA 5FUYA 5GJBA 1OFUX 4TQAA 1R7RA 3VR6A 2DFLA 2RGCA 2G83A 4ARZA 2VH5R 3IO3A 1Y3AA 2XTMA 1G3IA 3L0OA 4HAUA 1KK2A 4IEEA 1GM5A 3K0EA 2MMCA 4DSUA 1AK2A 5HZKA 2CE2X 1CF4A 1Q1BA 1DO0A 3AP3A 5EXPA 2ZUCA 3ZVNA 2GJSA 1SKYB 2IYYA 2QE7A 4DRZA 2V4ZA 4H1UA 1N0VC 5EE3A 2WHXA 3TSZA 1CTQA 1GILA 4HZUB 1CEEA 1MO6A 2X1VA 2GXAA 5KOYA 1QBKC 1FP7A 2O8CB 3K0FB 3KFXA 2ZYTX 5CK4A 1Z83A 3D8BA 3RAPR 2O52A 2VIIA 2JDID 3PEUA 4E03A 1E2HA 1G8FA 2OCBA 3O8BA 4L5BA 2ZRBA 3ZD6A 2YWFA 4A4DA 3K09A 2RKOA 3M0EA 3P20A 4W5WA 1JI0A 3AF3A 1I4LD 3EC1A 5L3QB 1JR6A 3OIVA 3QOFA 1IJEA 3QQ5A 2OBNA 1C4OA 2RGEA 2DFNA 4AURA 3QKUA 1T5IA 2BOVA 5IDVA 2GJ8A 2R2AA 1XX6A 3SS8A 3G82C 5ANRB 2G0TA 4LHZA 1U8ZA 1Z0JA 1CP2A 4LJ9A 5AR1A 2O8FA 3K0CA 2REBA 1SVOA 3NBFA 4KITB 2JJ8A 1OKKA 2PLRA 2CL7X 4HDCA 2FDCA 4TLAA 5FL7D 3VX4A 1DE0A 2FJUA 5A5GA 1G8HA 4DCUA 1JPJA 1DG1G 3PJRA 1AZSC 3OAAD 4BFXA 4MKIA 1UFQA 4MYUA 1P72A 3EA0A 4LYJA 3E2IA 2XITA 1G7TA 1T9HA 3MG9A 4QJ5A 4B3BA 4L8GA 3TBKA 4MGIR 1N0WA 3K70C 3AF0A 4V02A 3ADBA 1KKLA 3CX7A 3OE7A 3P4YA 1II9A 1I4TD 4I4LA 1TL7C 2REXB 5KDDA 3FKQA 4PC7A 3TSWA 1CR1A 5H70A 1Q57A 3AV0B 2J7PA 2BHRA 3E1SA 4D0LB 5EJEA 3SBDA 1I2MA 1NY6A 1ZM7A 2VHTA 4NBSA 1RYHA 1X8KA 1W2HA 1W0JD 4DLWA 3DM9B 1WBDA 4EPRA 4A0RA 1OF1A 1N5KA 3L0SA 4GP6A 4NDZA 4IHQA 2BVNA 3CRVA 3QXXA 1E2DA 3PVSA 2A30A 2D7CA 4NYJR 1AM4D 1E2PA 3RS5A 2UKDA 1RE0A 2CHGA 4XD7A 1VIYA 4KFSA 1XDBA 2J59A 4N0DA 1XTRA 5KNDA 1JQJC 3BFXA 1XZQA 3B9PA 1M7GA 3GJ6A 4KYUA 4V0NA 3TKLA 3B82A 3OEED 2Q3FA 3C15C 2HCJB 1ZCBA 2F3TA 3NBXX 5L3QA 1XD2A 2IXEA 3HR7A 4CEIA 3EIHA 4W5HA 1DAHA 1XEWY 2PZEA 2ZQ5A 3RSLA 2C9OA 1NN3A 3H1TA 2O8BB 1JJ7A 1XTKA 4HUQB 1UBFA 1SQ5A 2ZEJA 4QNRA 3DMDA 5JRJA 1G3UA 2WWGA 3A4LA 2A9KA 2X8AA 1NJFA 3L0IB 3SYKA 3EAQA 3CONA 3L43A 4TYPA 3PUYA 4PO8A 4ESHA 5B30A 2W6IA 4B6EA 4B32A 3QENA 5FR1A 1HT2E 3TUJC 1OT3A 2IS2A 2FGKA 2YWEA 1XP8A 4FXPA 2QSZA 3NG1A 3R20A 5EE1A 2QORA 3LW8A 1W0KD 4QGAA 1Z2CA 1T3SA 2NO9A 2EFEB 4AG6A 4LJ4A 4N1AA 5EZ5A 3GJ4A 1QHNA 4M8NE 1N5JA 1W47A 3K0AB 3MGCA 2AFHE 2FFAA 3TVDA 2WPDD 4NYMR 2ZRIA 5LBIA 3IPYA 4R2IA 3BGWA 2CVFA 2GEUA 3QPVA 4FCWA 2PT5A 4O2LA 5B2ZA 1IHUA 2BWJA 3PV0A 4XVQA 4DB4A 3CB4A 1NLYA 3IQWA 3W6NA 4F93B 1NLFA 4Z51A 3E5HA 1F2UA 3WMGA 3K0SA 4JVSB 4DIDA 3HPQA 5EP2A 2A3RA 2FA9A 1WP9A 1YR6A 2CHVA 3WNCA 2I1VB 5FBVB 1VCIA 2CCJA 2D74A 5JWHA 2QPTA 4WVFA 2CHQA 2JCSA 1Z3IX 2A5JA 4TMXA 4NU0A 2C95A 2AK3A 2P3SA 2RH5A 3CLVA 4OI4A 4EQ6B 2V3CC 1JAIA 5G40A 1KMHA 2YWGA 2QENA 2Q9CA 3QXHA 1YRAA 2PT7A 2ZU0C 3B2EA 4JL5A 5C1BA 1WRBA 3QKSA 4BEBA 1KMQA 4Q4HA 2AK2A 2ZSEA 1GNRA 1MABB 4JKYA 4G01B 3TAUA 3U5ZB 3BOSA 2H18A 2ZXUA 3S1AA 3NC1C 2I1QA 3U4QB 5DLQC 3FMPB 5JBQA 4GT1A 3I1FA 3WNDA 3LBHA 1XFAA 2VHQA 1H8HA 1CRPA 1NKSA 4BE7B 1II0A 2Z83A 4RZ2A 1GG2A 3SC3A 1MO5A 3EPKA 3AKDA 3QPUA 4X8LA 1OH7A 1N6NA 1D5CA 1N0UA 3F5FA 4NMMA 4U02A 5DO9A 2ZI9A 1M6NA 4WIAA 1FOEB 3RWOA 5JWRA 1OB2A 2G6BA 3SDZA 1Z2AA 4Q1BA 3FYHA 1M8PA 3U61B 1JJVA 4OKSA 4G5SA 2IYSA 1HH4A 4ABYA 5L3SA 4LHYA 2ORWA 4Z1MD 2HCBA 4WZ6A 1YQTA 3EPLA 1NKTA 4C2UA 1KK0A 1Z28A 2Y8EA 4OQMA 1YR8A 4JBWA 2OE2A 4PPFA 3TQCA 4QRHA 3VR5A 1NSFA 5KSZA 1F6BA 5EXTA 5FBWB 1OH6A 1W5SA 4EFNA 4B33A 1KNQA 5CDFA 2WV9A 4QG7A 5EZ6B 4W5JA 3LX5A 3WBJA 4TT3D 1U9IA 2QPOA 3NH9A 1O87A 1RIFA 5IK2A 4Q9KA 5EE5B 5EQTA 1XCPA 4D4JA 2JASA 4U7DA 2AX4A 2JLWA 3CO5A 4JYBA 2WIAA 1GKIA 2W2TA 4Q02A 3NXSA 4V0KA 3FPAA 3NTUA 5KSPA 1F2TB 3E70C 4WW0A 4BGDA 2C2HA 4K81B 4CEJB 4Q9LA 1SVSA 5J5CA 3ZZ0A 1ZNYA 1J8YF 2MSCB 1GITA 5JRZA 2FPLA 4GOKA 2NMVA 4BZQA 4IDHA 4PC1A 2OO7A 5HKKA 3UWOA 2YNMA 2QI9C 2FSGA 3KXLA 2H16A 4PANA 3LDAA 2RGDA 1PV4A 1CBUA 1Z6GA 2FOLA 4JLKA 4JLMA 4HAVA 2OCAA 3ADKA 1SGWA 4OQXA 3T5DA 1CJKC 4BECA 2IEYA 4C7OA 3NBZC 4URWR 3REGA 3SJAA 2R6GA 4DSTA 2IHYA 4Q5IA 3B7GA 3RRMA 3N70A 1E1RA 1KI9A 3MFYA 1W36B 1P3JA 1YU9A 3VKGA 4NYJQ 2WJGA 3K70B 4A9AA 3VR3A 1YJ5A 3NHAA 3GJXC 4QXAA 4ASUD 4FMBB 2CEAA 3THOA 1BIFA 5BYJA 1P2TA 1FX0A 2PH1A 4URUR 2O8DA 3EC2A 4NL4H 3RNLA 2AXPA 4MRRA 1Z29A 4G0NA 1FTSA 3THXA 3M6AA 2FNAA 4RD4A 2OFOA 2XNDA 1EFUA 2DFTA 2J0UA 3MLEA 3A1VA 5CYPA 4HZIA 2V7QA 4LJ8A 1GRQA 2QGNA 3SE0A 1G19A 4S35A 1OLOA 2Z5FA 1HY3A 4NYIQ 4AYTA 4Q9IA 5FTLA 2W2XA 2EU8A 2ZE6A 1RRCA 3QBTA 3SN6A 4C4PA 1OPXA 1UBCA 4DLZA 4E09A 2GZDA 3H84A 1A2KC 4DCVA 3PUXA 1OHHA 4TZ0A 4M1KA 5BW8A 4W7SA 5IT5A 2OLKA 4Z54A 4BFYA 4A0GA 4L9WA 4D4KA 2XX3A 3HJNA 3RANA 4LOAA 5HZHA 1NF3A 3FHTA 3AM1A 1N6PA 4JVNA 5M04A 2LCFA 4I1VA 2R6CA 1E2QA 1E9CA 1TUIA 4GNKA 4HB0A 3LNCA 4EUNA 4TQ9A 3LD9A 2WKQA 1I4DD 4BRUA 4M2LA 2ANBA 4PO1A 3U60B 1OSNA 2CL0X 3OESA 4PSAA 4Q48A 3WXMA 3I73A 2F3RA 3CKLA 1AGPA 1ZUNB 1N3BA 2GXSA 3OFNA 3X1WA 5K8IA 1G5TA 2PZFA 1U0LA 4PC6A 1HQCA 2HXSA 4DBLC 1SHZA 3BERA 2HLDD 4XIGS 5FBQB 4YMSA 3LVQE 4US2R 4ZCLA 2PLFA 2QTFA 2JLYA 5HR5A 1AGRA 2Q9BA 4UJ5A 4AI6A 4V0OA 2BMDA 4P4UA 3GLGA 2R6AA 1ZW6A 1A2BA 4GL2A 1MO4A 2XXAA 3BD9A 1MH1A 2Z43A 3PIRA 3VTKA 3PEYA 4DDVA 2HJGA 3CH4B 1TQDA 4OHWA 1S1MA 2ONJA 1BS1A 2ZREA 1ZAKA 4XWKA 3TAHA 1HE1C 2BBOA 2NOAA 4MRVA 3LQQA 3OIUA 1SVIA 4R9UC 1EFHA 1UM8A 2EYQA 2ZANA 1NBMA 1G7CA 1NP6A 3GEHA 4IFEA 2CNWD 4Y0AA 2CNWA 1FMJA 2GZHA 2QMEA 1FUKA 3HWSA 1P9WA 2DWPA 1XXHB 3UG7A 4HLDA 1KI3A 1RRPA 3KKOA 3GMTA 3AUXA 1VHTA 3FFAA 2F9LA 2Z6VA 3A37A 3GJ0A 3EPJA 4FMDF 5BN5A 2O8FB 4Q66C 2OBLA 4KJZA 5CIWA 3T61A 1KI8A 5HPYB 2HYIC 1FQJA 4Q7KA 3C7KA 3SZRA 2ZRGA 3O47A 1DAKA 1SXJA 4KO8A 3NEYA 1IONA 4OI1A 1KIMA 3T1TA 2IEZA 2GAOA 4DCTA 2JATA 2VF7A 4URVR 4CEHB 1Z0FA 1CR0A 4ZCMA 2F1HA 3ZZUA 1LS6A 2QMOA 2ZJ8A 1P62B 3HR8A 3K9LA 5K8TA 4NCIA 2FSIA 4C0KA 3BAFA 3GLGB 1G16A 3I61A 3QSYA 2DPXA 1G3RA 1FMLA 2V9PA 5LDDC 4M1OA 1OFTA 5DH9A 5HCNA 1FPMA 2FFBA 2PX0A 5GJWC 4KSCA 4AC9A 3GLHB 2FN4A 3OEHA 3WRXC 5DE3A 4BFVA 4PXAA 2GEDA 2KBFA 1PZNA 2VP0A 4B75A 3WRYC 3VQTA 3SU8A 2CJWB 1TU3A 2QAGC 3BB4A 4QJ4A 2QEQA 4LZZA 4B48A 2J9RA 4RY2A 3ZS8A 5KDOA 2YYZA 2VP6A 5EE0A 3V00A 1SXJB 2HF8A 4LHWA 4GRAA 5DI9A 1GNQA 2ZRMA 4UQOA 3I8SA 4EJSA 4Q4JA 1ZD8A 4C0BA 1WCV1 3ECCA 4PHFA 2ZRCA 4GSYA 2ZM5A 3C14C 4KV9A 1AQYA 1UBEA 2G1KA 2NO6A 4GI7A 3CX6A 2JJ1A 2QAJA 4MA4A 2J5XA 3GQBA 3P32A 3UG6A 1XRJA 2P5SA 1CIPA 2D7DA 5EUMA 4M53A 5C46F 4A2QA 1D2NA 4TLDA 4BLTA 1NIJA 1ZU4A 2V7QD 1ZD1A 4KHZA 3LLMA 2IS4A 5FPTA 4DWJA 1E0AA 2DWQA 5FPHA 2ORVA 1XWIA 5DYGA 5F2EA 4ILEA 3THYB 2AKAB 4JJKA 5IRCD 2XTZA 1QHIA 3IKJA 3KJEA 2YVUA 2GILA 2GXUA 2N1BA 3OF5A 3QXSA 4F4IA 3RRYA 1N2CE 2A5FA 2XAUA 3N2IA 4LPSA 2AFIE 3NHBA 5E4FA 1G21E 3HU2A 2YINC 1DAFA 3VX3A 4E07A 1G7RA 4MYCA 5BYKA 4CRWB 4LJ6A 5CK5A 2Q3MA 3BH0A 3ADCA 2ANCA 4KVGA 4IVPA 2QBYB 521PA 4WAUA 2NTYC 3WY9A 3HP1A 3F8TA 4OHVA 3WMEA 1SVLA 1UAAA 2HYDA 4NCNA 4MKFA 1G20E 3VHLB 3W3AA 2QAGB 3QF7A 4LI0A 3CWQA 2XGJA 1NG9A 4PAQA 1TF2A 1S0UA 4HAWA 4MQBA 3FGNA 1NSTA 3W90A 4DT1B 721PA 2VRWA 2WJYA 1KI6A 4Q4JB 2NIPA 2JLQA 4IVQA 3RS2A 4IFBA 3ASZA 3SR0A 5JCPA 1C9KA 4MKHA 1IY1A 3BH6A 1S2MA 4Q18A 2QE7D 3CPJB 3AUYA 3DKPA 1VDZA 2NPIA 4L9SA 4FN5A 1KO1A 5KU1A 5TMPA 1X3SA 5DN6D 2ZAMA 4Z8XA 3V9PA 1ZM9A 1E2LA 4HUQA 4CW7A 4Q4LA 2P5TB 3DPUA 4QKQA 5JMTA 1PLJA 4OHXA 2ZTSA 3GLHE 2ZETA 4DKXA 4EQ6A 4V03A 4CYMA 2QY9A 4HEJA 2IYUA 4LBVA 4P32A 4OBEA 1X1SA 4R7ZA 1EFCA 1HV8A 2QT0A 2PMKA 1Q3HA 1Z06A 1YZQA 1M74A 4IXNA 3GEEA 3UIEA 1LS1A 1MKYA 2ERYA 4LHXA 2ZI3A 1SVWA 1P2UA 4F7WA 3A58B 2G9NA 3GD7A 3PUZA 5BQ5A 1Q1QA 4YDSA 3HYRA 5HCIA 4RD3A 2BMJA 2ZVPX 1GDDA 4C7OB 3I5YA 1E32A 2RGBA 4DVGA 1R0WA 2K5UA 1O3YA 1BYIA 2ZJZA 4RJLA 4FIDA 2QM8A 1LF0A 1E79D 4ZDKA 2OT3B 4B2IA 1Z08A 3QUSA 2EWWA 2XOKA 3RHFA 2XOKD 1OFHA 4URZR 3TRFA 4LGMA 5TDHA 1YVDA 3FKSD 3K8YA 1XMVA 4UNRA 1XPRA 3OE7D 2LWIA 4GDFA 2PL3A 2V6IA 5F98A 1ZVQA 3QE0A 4FI3C 4YXWD 2WICA 3W34A 1A1VA 1NBME 5FUWA 3L2OB 3IHLA 5D3QA 2D62A 1XTIA 3FDIA 4UKDA 1KI1A 2IYRA 1G64A 5BN3A 1XPOA 3NWJA 4Q4AA 3TE6A 2P6UA 1P9RA 3N5CA 2GCNA 2FZLA 1NG1A 3H0KA 3TSOA 4D80A 3IBYA 4M4SA 1T91A 4IOKA 4D4MA 3CH5A 1E94E 4TT3A 3X2SA 1P4SA 4FWIB 4JVMA 4DCNA 1G5RA 4TSFD 4QBIA 2BCJQ 3BFVA 1UKYA 2JLRA 5GVSA 2ZPTX 2IHBA 3CRW1 2R6FA 1SKYE 5CM8B 4Q21A 2J7KA 1QZXA 4BRWA 5J4KA 4EDHA 4JL8A 1TEVA 4K8OA 3BXZA 4CEJA 4FCVA 3CRRA 1DAIA 5AK0A 1N6IA 4Q1AA 3PEVA 5JI3E 2AR7A 4PHTA 4BFTA 4PQRA 3PR1A 3PG5A 1RC8A 1N6LA 3DO6A 3THWB 3AGQA 1RRFA 3TH5A 1US8B 2WMNB 2O8BA 2QMHA 1IAQA 4LCBA 2P6NA 2W2VA 121PA 2Q21A 2IT1A 4GZLA 1AS2A 2O0JA 2VQSA 3EIQA 4JBYA 1EFRD 2XB4A 4KCGA 1WB9A 4TMTA 1DADA 4DIEA 1PJRA 1E0KA 2ODWA 3HPRA 3LV8A 4LWZA 4QHTA 2R6DA 4QM6A 2EFHB 1H8ED 4G1UC 5EP1A 4PQYA 1MRNA 2W58A 4RKFA 3CPEA 2WPDA 1EFTA 1T0JB 3QNUA 2WOJA 1HUQA 1P2VA 1ZD9A 1K5DA 4LYFA 3FMIA 3K0AA 4EPXA 3DZ8A 4HAXA 5TXGA 1E9EA 1MOZA 1NMXA 1NL3A 3Q72A 1Z0IA 1G9XA 2XJ4A 2ZYUX 4G5GA 4LJ5A 3H4MA 4BFZA 2AWNA 3RS0A 3QG5A 1NY5A 5C2JB 1UADA 5H1YA 4YQFA 3QIAA 2D3WA 1HYQA 4EPVA 3O8RA 1WDTA 3AKCA 3K9GA 2WTUA 4TN1A 3ZIAA 1E2IA 3T34A 3IEVA 1ZCAA 4P0TA 5FTMA 4XH9B 3MAAC 3WP1B 1Q1ZA 2ZSDA 4HLQB 1PLLA 4F38A 4UNSA 4F4JA 5A0FA 4GP7A 3UANA 4Q00A 2DHRA 4TTRA 4JLOA 2ZVQX 5FOTA 2GXQA 4AY2A 4V0MA 1E9BA 1XTJA 4IXMA 4JLBA 1R8SA 4U00A 2CLDX 1QVAA 4CEIB 3DHWC 1K8RA 1TF7A 5EUQB 3LXXA 1U0JA 3X1ZA 2D06A 5J4VA 1J2JA 1NVVQ 4JJZA 2G77B 2PCJA 5CYOA 2R9VA 1OIVA 4DLRA 4RD2A 4EPWA 3CRQA 1GZSA 1AZTA 2HDNB 1NBMD 2HLDA 4JLDA 5FBLB 1PUIA 4MGYR 5TB5A 2ORIA 3SYNA 2GVZC 2JLVA 2CL6X 3AVQA 4RCZA 3B1VA 1SKQA 4O2RA 5GJCA 2VHJA 3TJZA 1NMYA 1TQ6A 1IXRC 5EE9A 2ZRKA 1VYUA 2BMFA 5FUXA 2WBLC 3TR0A 2Z4SA 1E9FA 2YOFA 1J70A 1V5WA 4Q19A 221PA 2FF7A 3B1ZA 3PQCA 3IIKA 4BZXA 2P67A 5KO2A 2OESA 4O0MA 2FE4A 1F60A 2AXNA 2H92A 1YZGA 2QU8A 3LLUA 4A2PA 1UPTA 2RGAA 1U98A 4P33A 1TQ4A 1UDXA 2EWVA 5BN4A 4GFDA 1QF9A 1XTQA 1LF5A 4JT4A 2O8EA 1IXZA 5P21A 1KJZA 4PHGA 4BFSA 4DLUA 3SHFA 2O0HA 4PZYA 1LNZA 1S1CA 3RS3A 1AKEA 1HURA 1XB2A 1U8YA 3ND9A 4CDGA 4AIIA 1QHXA 3CWZA 1AS3A 1E2EA 4CVNA 3DOEA 3THWA 1GSIA 4TL6A 2QQ0A 3R7WA 3L8ZA 2AD5A 3UK6A 2ZRNA 2A78A 2C9CA 3FE2A 4PAMA 4KXFB 3QG1A 4PAOA 5JHHB 3LBIA 4O3MA 3B9QA 2ZUDA 3AP2A 4FWTA 1WXQA 2GCOA 2VF8A 4TYNA 2OZEA 1G5PA 3K53A 2IWRA 1SZPA 4TSFA 1T8UA 1D2MA 2IF2A 5CDFE 4JBXA 2F55A 1Q21A 1QHGA 1D6JA 5SZIA 3UATA 4ASUA 4EFMA 1JAHA 1TQ2A 5E95A 3SJCA 5DHAA 4AKHA 4JIMA 5CB8A 4PO9A 2LKDA 1Z5ZA 1N5IA 3DOFA 1FZQA 2F9MA 1OH8A 1KY2A 1U0HC 2J0VA 2JJ1D 2VSXA 1E0JA 1ZJ6A 2C99A 1OXSC 5KNBA 1NVWQ 2WWWA 1AN0A 1GFIA 5DNYB 1E9SA 1YZLA 3D7MA 2EQBA 3CRMA 4PSKA 4BPBA 1XTSA 1L7VC 1Z6AA 1YR9A 4PC2A 5FOUA 5FH9A 2RGXA 1UDWA 3M4YA 1NMZA 4HAYA 2LKCA 4MGZR 1G8GA 3Q8XB 4I1OA 4FINA 4B3GA 3T06B 4I99A 1ZIPA 1ZUIA 2WIBA 2HJVA 4Q01A 4R98A 5KPDA 1E2NA 4XSHA 2QNRA 2QTHA 3GJ8A 1NIPA 2GEVA 2IYZA 3MWKA 1VIAA 1YKSA 3NBYC 1OXTA 2JIZD 1Z6TA 4AD8A 2QL6A 2VYFA 2FV8A 2O8CA 2O8EB 1ONBA 5EXSA 4LPKA 1R2QA 1S96A 3VAAA 3W8RA 1K6MA 2Q3HA 3CUEF 3AGPA 1DPFA 4CT5A 4B3CA 5KTYA 3AVPA 2WWYA 1HA3A 1ESMA 3EW9A 2B7BA 3ZJYA 3QY0A 1Z47A 2UVQA 2WWXA 3CF2A 3V4FA 1X1RA 3NVAA 2JLXA 2VBCA 1U9IC 2WKRA 3AP1A 2ZJYA 4WA7A 2B8TA 2YV5A 3FVQA 4QHSA 5L8VA 2IW3A 2WWFA 1E2FA 3HDTA 3PFIA 3NC0C 3TGPA 1KO7A 2QRZA 1OHHD 2ZI4A 5HE8A 1KHTA 2GCOB 2ZJBA 4DLTA 4Q1CA 5UKDA 1WMSA 1VG8A 1KJWA 1A7JA 3ZQJA 3IILA 3U6BA 1JR3E 1RYFA 4AYXA 4JL6A 4I81A 5JZVA 3VKHA 2ECKA 2IXGA 2PEYA 1F48A 3KJGA 3TUZC 5DI3B 1M34E 1W5TA 3EWAA 4HYYA 5F9HA 2E87A 2QROA 3BC1A 2IS1A 1G8PA 1KAGA 4LC0A 4JLJA 1HT1E 2XB2A 2FFQA 4Q9HA 4B44A 4C9BA 1KJYA 2ODEA 1ZMXA 4RKEA 2ZUBA 2IXFA 4MRPA 1DOAA 2KBEA 3QXJA 3IDQA 4YDHB 2J41A 4A1FA 1ZINA 2H7VA 3G0HA 1ZNWA 1E6CA 2CLCX 4JS0A 2V1XA 2QP3A 2FX3A 3DEFA 4A8JA 2ZYWX 3SJBA 3A4MA 3FOZA 3MMPA 1BOFA 2AL7A 4X8HA 1DTSA 1G3MA 2NG1A 2XNSA 4JSYA 1KI6B 1SXJC 5KUTA 2ZSBA 4WXPA 3WYGA 3IPXA 4KAXA 2OEPA 1G6HA 4RSGA 4LC1A 5L3RA 1XCMA 4BLSA 4DSOA 4FD2A 1QDEA 3LW7A 4LDJA 1IN5A 3R7WB 1NVVR 1FFHA 4KI0A 2ZJAA 3X1DA 2X2FA 2Q0HA 3TW8B 3W5JA 3QXCA 4HLUC 3IBGA 5AUPB 1ZC3A 4TL9A 3I92A 2DCUA 4TMVA 1KSFX 2J0QA 5KDLA 3EG5A 4N3NA 4YC7A 4URYR 3HU1A 2YJTD 4C30A 4BLOA 2DYKA 1W4BA 5CJ2A 2ZS9A 1E9DA 1BH2A 4JZKA 2JLUA 1E2MA 2QN6A 4MITA 2ZJ2A 1LV7A 4TTQA 4YXWA 4AKGA 4LJ7A 4ZO4A 1MT0A 2OXRA 1YZNA 4TWZA 4Z1MA 3QKRB 2PBRA 3DM5A 3PEWA 4RCYA 3ZH9B 1T6NA 1SVKA 4ESVA 1DAMA 5JEDA 3TIFA 2FU5C 4B3DA 4BFWA 1LVGA 1D2EA 3CF0A 5K8UA 1G4AE 4XWAA 3QF4A 3R9WA 1R5BA 3SJZA 2NZJA 2DB3A 4XTCS 4D6PA 1U2RA 1JEEA 2B7CA 4WOPA 3B1WA 4L15A 4EJSB 5JS7A 1M1YE 2J0SA 1UKZA 2ZYVX 2P0EA 3KZ1E 5JJIA 1GUAA 1U8AA 2GBLA 3CF6R 3B60A 4PPNA 4XTRA 5TARA 2QTVB 1N6HA 5B58C 2BDTA 4JVLA 4EIWA 1F5NA 3C8UA 2P6RA 2ZS8A 1CXZA 3FB4A 3L8YA 4ZDWA 4DEYA 3GLFE 1XF9A 5CITA 2IUUA 3K9HA 4A82A 3EXAA 1DARA 4DDWA 2QM7A 1KMHB 3K1JA 1KO8A 4NHOA 3UMSA 4IOJA 4JKIA 2IF0A 3RRZA 4N0EA 4DC9A 4XD7D 1JXOA 5IHPA 3KTAA 5H8WA 2G88A 1EX6A 1FL9A 4QFMA 2QP9X 1E1RD 3GLIA 4CGZA 2A5YB 3WBKA 3C41J 3THXB 2VTKA 2PZGA 3RSOA 3GJ7A 4NTZA 4RFSA 1IN8A 4LJAA 4B71A 3OEEA 4TLCA 3SFVA 5C4MA 3ZLJA 2G3YA 2R44A 4KU4A 5FI0B 4CIDA 4LSGA 2FG5A 2F43B 3GLFA 2ZRLA 4MDFA 1KDRA 3EARA 4OK3A 1KYIA 2DY1A 1S9DA 3AEZA 1IN6A 1KK3A 2MSEB 3I62A 2BBWA 1P60A 3ETLA 1RKBA 1ZUHA 2ATVA 1HTWA 2RGGA 3AVWA 4NZYA 1VYVA 2FEMA 2QA5A 2ODBA 1G41A 1Z0KA 2OAP1 4C0AC 2F7SA 1KGDA 3SHWA 1KSJA 4PTLA 3GLGE 3U6KA 2BKUA 4LBYA 4JT2A 2JA1A 3RDPA 2KB0A 3MD0A 1MABA 1Z6XA 2BKEA 2W83A 4NH0A 1XCGB 2QMUA 5AUNB 2ZE7A 1KKMA 3ZS9A 1TUEA 2ZE8A 4TMWA 2MMGA 1XD2B 4LK2A 4UNNA 3SOPA 4YMVA 1TTTA 3AVVA 1GL6A 2C9YA 1II8A 1IY2A 1XPUA 2J3EA 2EYUA 2GZAA 3AF2A 5DI3A 4C0LA 4M0LA 3BS4A 1KO4A 1QRAA 2HUPA 2B92A 3QEJA 3F0TA 3OZXA 1AS0A 5J47A 2L0XA 2GVDC 5KPJA 4MYTA 2BIFA 2A2ZA 4BLRA 3EPHA 2IS6A 1OH5A 5FUVA 1E4YA 5L3SB 1TNDA 2WZQA 3TR5A 5JECA 1YHNA 1Z0DA 2RB4A 4D4LA 4BZPA 2OLJA 1KY3A 2BMEA 3LO5A 1W36D 2GF0A 2CCGA 2QGZA 3ZZTA 2QAGA 1Q20A 2Q9AA 4ZKEA 1S4QA 3AVXA 1ETUA 1JR3D 3SQWA 4CF7A 4K46A 5DIFA 2HV8A 1TX4B 1NRJB 4Q47A 3ZVLA 3KKQA 4C3ZA 2UZ3A 1EK0A 2WM9B 1R5NA 2XEXA 2IYXA 1JPNA 1ZYUA 2FGJA 3QF4B 3JZAA 4R2HA 3TK1A 4D0GA 3KQKA 3KQNA 4O25A 4US1R 3GLFB 1OW3B 4UNQA 2D2FA 4XSGA 1YRBA 421PA 1DS6A 3AB3A 2FPKA 4HAZA 3RWMB 2A5GA 2A7QA 1ODFA 3T35A 1CRQA 4MDEA 2GETA 2WAXA 1T3HA 1CR4A 5LPNA 2ZR9A 5G3YA 5CLLA 4HSEA 3FWYA 1US8A 2ONKA 2OV2A 5AJZA 4A0FA 2XZLA 4D25A 2XZPA 3OIYA 4Q7MB 1BYUA 2FSFA 1OKKD 1ELOA 2R8RA 4RD0A 3TMKA 2Z4RA 4URXR 2CVHA 4MRSA 1TAGA 4C2TA 2ATXA 3P4XA 1IN7A 4LY6A 2ZRJA 1R0YA 2P65A 4HLCA 1BMFA 1VG0B 1BMFD 2GA8A 4B76A 1JBKA 4JLPA 2Q6TA 1KAOA 2I3BA 1D9XA 4D81A 3A1WA 4LUCA 1WE2A 4JYCA 1Z07A 2VP4A 3KXKA 4E5UA 2YWHA 1VPLA 4NYMQ 4B3XA 5FOXA 1Q12A 1M2OB 1WA5A 2GF9A 5DGXA 1XMJA 5F3WB 2B21A 2IX3A 1MRSA 1Z6YA 4RZXA 5HKKD 5E7MA 3RYTC 1GTVA 3MWYW 3N2EA 3OEHD 4G3XA 3UWKA 2ZSAA 2YC2C 3R9XA 2PJZA 2GK6A 3T1QA 4DUGD 2CXXA 5J4YA 1VHLA 4P3YA 3PUWA 1G4UR 1Q44A 1G8YA 3SQXA 4P4SB 4AK9A 2BEKA 3NH6A 3TLXA 2F1IA 5JJLA 2J45A 4NKRA 4NPHA 2DFKB 5AWFC 4QBFA 2HT6A 3GJ3A 2W0SA 5FTNA 5LD2C 3KKMA 3PENA 4FW9A 4P4SA 4MRNA 4IEIA 4GZMA 1EGAA 1IXSB 1EFRA 3CPHA 2JIZA 2OG2A 1PUJA 2OXCA 3WHKA 5CM9C 4AG5A 4TMZA 3D3QA 2V54A 2CDNA 4J0QA 4BQSA 2XNDD 1FNNA 1NN0A 4ARZB 1Z63A 2IUTA 3CM0A 3IQXA 5CB6A 2G0NA 4M9XA 2F1RA 4ITRC 3JZMA 3QPWA 2V8OA 4B43A 4NYIR 2VP5A 3MJRA 2E1RA 1K5GA 2PCLA 4QBHA 4A6PA 3TUIC 3JVUA 1Q22A 2X77A 5D3MB 3DZDA 5FL3A 2W6ID 1YR7A 1AKYA 3BORA 2QBYA 4B2PA 2ZI7A 4TYWA 1GWNA 4LV6A 5FBRB 2OM2A 5JI2E 3EZ7A 1W2GA 4DDUA 3AVYA 2EFGA 3ADDA 4UNPA 1KDOA 4EAQA 3SFZA 1JALA 3Q85A 4KBFA 5EXXA 3IHWA 2HEIA 2IC5A 4LYAA 4OQLA 4LV8B 1F2TA 3GPLA 2JJ2D 5HTKA 2OBMA 4W9MC 4ZI2A 1KSHA 1ZNXA 4B2LA 1JB1A 4RFSB 4US0R 3A1UA 4MUBA 4E22A 2C96A 3EZ2A 4IRUB 1OV4A 4HATA 2AN9A 3NIBA 1T3LA 2VPPA 3IGFA 1XEWX 3UMFA 4HB2A 4A36A 4QNMA 1KI2A 3U7HB 2VEDA 3BH7A 2QPAA 5JS8A 4GBMA 1Z0AA 1N6RA 3GFPA 4OK5A 5KNCA 2H8KA 5AJVB 3ZVMA 1COWD 4OQFA 5C18A 2YZ2A 3FHCB 4I1UA 1E69A 5FFMA 4B6FA 1GKYA 1OYWA 2FWRA 4XJXA 4D0NA 3NDBB 3BB1A 3QVVA 3OIWA 4KFUA 1W4AA 1VCNA 3SI7A 2VHCA 4IVRA 4BFUA 4A8JB 2OSBA 1UBGA 2OAQ1 3ND8A 3LX8A 3DMNA 2BM1A 2FPMA 2ZE5A 1ZRHA 3PCRB 2REOA 4X8MA 2FZ4A 3FMOB 3T1VA 2QT1A 3S1AB 4UXJA 3ICQB 4XWOA 2BBTA 2XSZA 2ZIAA 3JVVA 4QOSA 3TW4A 1XNJA 1LFDB 1TF5A 3Q5DA 3WYAA 1E0SA 2RAPA 4DSNA 4GOJA 1W1WA 1SHKA 821PA 1TADA 2WOOA 2CK3D 2ZR0A 5LD2B 4IDNA 2CK3A 1DO2A 4NE2A 2HT1A 4YMWA 1XBTA 2RMKA 3QVUA 5FPYA 3U7GA 6Q21A 1DAEA 3WP0A 1CU1A 2GAAA 2MSDB 2V1UA 2EVWX 2ZI6A 2BJWA 3AH8A 4GMXA 1P9NA 2IBMA 5AJYA 2CE7A 5J4LA 3KQLA 4IKEA 4CT4B 1NVXQ 2QP4A 3QEOA 1QG2A 1XD9A 2GJAA 3AKYA 4LBWA 1XEFA 2GESA 5LB2A 8OHMA 2AKYA 2GNOA 3KXIA 1YZTA 3HU3A 5AJXA 1VG9B 1RRGA 4HI0E 1I2DA 1A82A 3EWSA 3QI2A 1EESA 2AHOA 3A8TA 3KL4A 1DEKA 3VKWA 1KOFA 1TU4A 1XMSA 2YHSA 5KHOC 1RZ3A 3RABA 1G17A 2X2EA 5JHGB 3IEUA 4RD1A 2WSSA 3I4LA 1E1QA 1AIPA 1EXMA 2WSSD 1G7SA 1U81A 3L0PA 5EP4A 4Q7LA 4C0SA 4M9SA 1P61B 2AWOA 3CR8A 3QKRA 2VP9A 1DVRA 1RW4A 4D26A 2XJ9A 5E7JA 5JSZB 2Z0MA 4GMDA 5K8LA 5BXQC 1Z22A 1GRNA 1S8FA 4B73A 3U3OA 4LX0A 3U3MA 2FH5B 1ESNA 3C4JA 1VECA 1RJ9A 2EW1A 3BRWD 3ZYCA 4RZUA 4DJTA 2DWOA 4P4TA 2J46A 4MKGA 1W44A 2VP2A 4BASA 1NI3A 2GRJA 1P5ZB 2BEJA 3H86A 4OJKA 2OFXA 1RJ9B 5FOSA 2AD1A 3K0FA 3QBVA 1D9ZA 4ERNA 4AKIA 5SZHB 2JAQA 1DAGA 3B1YA 4KSBA 3MJHA 2FMXA 3ZD7A 4Q1EA 1OXVA 3AVOA 4NCKA 3I8XA 3Q9LA 1E99A 1GRRA 3CNOA 4Y0VA 2QRNA 4DLXA 4DZZA 1X8JA 1GOTA 1LW7A 3BBPA 1MV5A 1OJLA 3GFTA 3GP8A 3U3JA 1FX0B 4ZPXA 2RHMA 1F3OA 3MSXA 5D3MA 2B6HA 4A2WA 2NPFA 1F2UB 1GAJA 1CKEA 3C5HA 2KI5A 2ASEA 2FEOA 1EWRA 4B34A 2QQEA 1VCMA 5FTKA 3BB3A 2F43A 1NN1A 4IDPA 1J8MF 3DL0A 4Q4AB 4ACAA 3FFBA 2YKGA 1OIWA 1W4CA 3U44A 3HYTA 5TY0A 1GKUB 5FPKA 1XJCA 3IIJA 5L3VA 1QVRA 3EASA 3QKSB 3A36A 1ZNZA 2ZS7A 2GKSA 4QGFA 3GLIB 1DG3A 1IBRA 4H9GA 1QHHA 4B35A 3T15A 3AKEA 2GCPA 1U94A 4KLNA 5JCZA 3SEAA 4B74A 3KKPA 3ZGXA 1S9HA 4TZ6A 2KSQA 4NP6A 3VR2A 1Z8FA 1KZ7B 2XZOA 2UZIR 2XTNA 2WVJA 2FSHA 3KUCA 3IUYA 2DR3A 2BC9A 3OFND 1W4RA 3KJHA 3UMRA 2F1JA 2D2EA 3EX7C 4DXAA 4Q03A 2QZ4A 4R71A 1VYTA 1BKDR 4FMCF 5AJWA 3PXGA 3U3KA 2WJJA 3RS7A 1W36C 1COWA 1GNPA 3W3ZB 5JLJA 3LA6A 1UEIA 2N46A 1XJ0A 5DN6A 3U3RA 2W6JD 5JSZA 2W6JA 1OFIA 2KWIA 4V0ME 1GIAA 3W6OA 2GHIA 5G3ZA 1CR2A 1PLKA 3AQ4A 4ACBA 3LFUA 3WYFA 3IIMA 4M1WA 621PA 1LY1A 3LXRA 4PR0A 1IQPA 1JEDA 2YOGA 1C1YA 3GJ5A 4KODA 2C5LA 2WMOB 4OQNA 1P75A 2RGNA 4LBZA 4A0HA 4KBGA 4OL0A 1SULA 1S3SA 2WKPA 2ZRHA 4Q1DA 5HE9A 1CJMA 1R6BX 1WF3A 3EIEA 4IOLA 4YMTA 4QM7A 4PPGA 3FMFA 2H17A 4I1SA 3SBEA 3U4QA 1CULC 2YC4C 1U90A 2I4IA 3I72A 4DEXA 2F6RA 3T1OA 3ICEA 3D6TB 5JEEA 5JJKA 2ZITA 4C0HA 3CX8A 1MR3F 4PFSA 4L16A 4M1SA 3DDCA 4QGHA 3WMFA 2JDIA 5B64A 1ZBDA 3THYA 3PUVA 1Q0UA 1SXJD 4WXRA 4QL3A 5BWMA 2B8WA 2C03A 1A5TA 2WJIA 4B47A 1YE8A 1ZC4A 1R10A 3K09C 3VFDA 4JMPA 3AVTA 2TMKA 3B6EA 4PX9A 1JXMA 4AWXA 3KQUA 5SZKB 1UJ2A 3P27A 3UKDA 5J40A 2A5DA 3GFOA 1KTVA 1XU4A 2C04A 3H2YA 2QG6A 4PC3A 1R0ZA 4KLZA 3REFA 4QJ3A 1D8TA 1X8LA 4LHVA 3I5XA 3UPUA 1ZM4A 4JLNA 4F4CA 2OUKA 1R4AA 1RFLA 2N42A 4QHYA 5KSYA 1KI4A 2YOHA 4A6XA 2NQ2C 4TL7A 4BEJA 4DCSA 4IJMA 2J7PD 1Q3TA 2KE5A 3CR7A 4FMCB 4IDOA 1ZM2A 4OI2A 3T5GA 3RC3A 2RHDA 4KFRA 1XJQA 4LJYA 1B0UA 4TQUS 3RS4A 1M7HA 1X86B 4QBGB 1LB1B 5FTJA 1W0JA 3ZQ6A 2NZ8A 1HQYE 4Q1FA 4A8JC 1J99A 1ZIOA 3OAAA 4NCHA 2NO7A 4KVAA 4DUGA 3TNFA 2V55B 3DVLA 3GCGA 2W00A 2GWHA 2OCYC 2OFWA 4ZIRA 4FCTA 4TMKA 2VLIA 3W9YA 4UJ3A 5FPSA 1W49A 1SVMA 4PZZA 1W48A 2BCGY 4RD6A 4DDTA 1OB5A 1J90A 4DLVA 4YMUA 4DHEA 1T4GA 5SZJA 2H57A 3BWDD 1T5LA 3AVUA 2ZRPA 1VMAA 5G53C 2X19A 4HZUA 4XVRA 1E9AA 3CW2A 4M1TA 1QHYA 5FR2A 1T0HB 2O0KA 2C98A 3EZ6A 4M22A 1JQLB 1NVUQ 1L8QA 4A15A 4V0LA 4Z8YA 5FOVA 1GL9B 4RZ3A 1FP6A 4QGGA 1OE0A 4LV5B 3MUFA 3BFKA 1KDPA 3B8HA 5F9FA 4DLSA 2CJWA 2FFHA 3MWLA 4DT1A 1IY0A 3R8FA 3O8DA 3CNLA 2IUSA 3P26A 1R0XA 5GJVC 2ZSFA 5DHFA 2O5VA 5E7IA 4II7A 1IN4A 2GJ9A 3GLHA 2RCNA 3LAWA 1G3QA 3X1XA 1E98A 2WSMA 4YLGA 1KO5A 4G5QA 2PMDA 2GJKA 2KJQA 3RLFA 4TYQA 4GOXA 1S3GA 1TPZA 4OHYA 1AJEA 2IK8A 1AQUA 1XD8A 1EX7A 1KK1A 1UF9A 4ZIRB 1NN5A 3RC8A 3Q5EA 2ZRDA 4QC2A 2PX3A 3U7FB 5KYKA 1UEJA 5ELXA 4S2EA 4OI0A 5JWOA 1CS4C 1FQKA 1GVNB 3BE4A 4TLBA 1XMIA 4D82A 3U7EB 4IOMA 1N6KA 1EWQA 2DBYA 4HB4A 4BLPA 4PPQA 1X6VA 5AUQA 3LH5A 2WJHA 3DKVA 2O8DB 2EFCB 2IYVA 3ZIAD 1ZP6A 3VR4A 2VO1A 3K9NA 3B5JA 3GEIA 3OHMA 4WZAE 3U44B 2BBSA 1WQ1R 2HXYA 4M1YA 2IWHA 5GADl 1R8QA 1B23P 1Q1EA 2BJVA 3M1IA 3QJYA 3KQHA 2ZR7A 5CJPA 1CJTC 1E2GA 2NO0A 3K0CC 2WJVA 2ZJOA 4HUTA 2BM0A 3LRPA 4C0QC 3EA5A 2JGNA 4UXIA 3SNHA 2P2LA 1TMKA 3CZQA 1XEXA 1M7BA 2ZAOA 5A4JA 1G1MA 1KSGA 1V43A 3V4RA 1EG7A 2D4HA 2G1JA 3VU9B 3RRNA 2IYTA 4NCJA 1RVDA 4MUAA 1R5OA 1T8TA 2IYWA 5DYIA 4LYHA 4RVCA 1GP2A 2IYQA 4EJSC 2IA5A 1VKJA 5IF9A 2R62A 2XXAB 2WAYA 1JR3A 3KTAB 2ZU6A 3VR1A 1N6OA 4BUJA 3G5UA 4Q4HB 1UKVY 3CBQA 3MWJA 4OJQA 3LBNA 4ZDIA 4NONA 1HE8B 2ZRAA 4ON9A 3KJIA 5AUOB 1DELA 2WWIA 3FHOA 4KYIB 4P31A 2IYLD 1Y63A 3A1TA 4B3FX 2J0UB 3CNNA 2VSOA 1E79A 3D31A 4GPTA 3IO5A 3NEJA 1E96A 5EP3A 3I32A 3W5IA 4ZDJA 4OHZA 2CMKA 1H8HD 5IK2D 2GTPA 3FTQA 1XEXB 4EFLA 3LQRA 4FMDB 3C16C 4EKDA 1FNMA 2GDJA 1MO3A 2XSZD 3BK7A 3FKSA 4IDQA 1L4UA 3VNVA 3Q3JB 4BLQA 1LTQA 4JLAA 4YONB 1W7AA 2IL1A 3W6PA 1JNYA 1P7CA 4UXHA 3MCAA 4F91B 3LVRE 3T12A 1JECA 1OXUA 2C78A 1RPZA 1ZM3A 2VA8A 1E1QD 1E4VA 1G6OA 2OCPA 3CZPA 4KFTA 4TTPA 3UXMA 4EPTA 2ZRFA 3X1YA 1ANKA 3SYLA 3NKVA 4POAA 5E3HA 1U99A 1P6XA 4M21A 5FL7A 4RFVA 1A4RA 5CLQA 2R65A 1VCOA 3VMFA 2QSYA 4WBSA 5GVRA 4MGKR 1SXJE 3ZVRA 4M1MA 1VG1A 1J7KA 1KNXA 1GL7A 2SHKA 3Q7PA 4X8OA 1FW6A 3BIFA 3B85A 1CJVC 4M9QA 3A6PC 2OHFA 1CLUA 1ZU5A 2VSFA 1IM2A 2C8VA 1KDTA 2OILA 1KZGB 3A1SA 1II8B 1E9RA 3Q7QA 5JFGA 5LB4A 2ZI5A 1DBSA 1P73A 4F92B 1G291 1QHHB 1XZPA 2VL7A 5TV2A 3A4NA 3KKNA 4G5RA 1P2SA 4Q9JA 2JEOA 3F3YA
chains in the Genus database with same CATH superfamily
1U0GA 2ZJ5A 1VB3A 3MMSA 4ML3A 3FNIA 4FW8A 3ZWQA 3KUDA 1H6CA 1NX9A 1OYYA 1UAYA 2CLSA 2NTEA 2VJMB 2H1LA 2ZDHA 3V8BA 3WLHA 5CIYA 3HL0A 2C29D 4NJOA 3IUQA 3OWXA 3VSDA 3NBUA 5I4CA 4BNYA 2XD4A 1GHTA 1T9GR 2HF9A 2OV1A 2YXNA 1U7WA 1U8XX 1RZRD 1U6IA 3FDJA 4FGJA 1QFMA 3H6HA 4QFDA 1XSEA 4TS4A 4QPDA 2H4YA 1XZAA 4P3XA 1C0IA 4MH0R 3K70D 1V6CA 5JCOC 1N25A 4Y6PA 1NLZA 1KE2A 3TPZA 2CBZA 2RKWA 3QKTA 4RF2A 3DEJA 1PEKE 1Q0QA 4MVJF 5GZ3A 4OQ4A 3AF4A 4YAJA 4CDNA 5C8VA 1G18A 3RVKA 4B8YA 1NG9A 4XGIA 1V5GA 1ODKA 2BV3A 3GNSA 3AEKA 3T0FA 1OIXA 2VHVA 4H6XA 2FR1A 1A95A 3HDGA 1XXHE 2HBRA 3LUFA 2TMYA 3N3BC 4TLEA 3OETA 4JLVA 5DTIA 5G41A 2O8EA 2BE7A 4XOIA 2HK6A 2W0MA 2EW8A 4HGNA 2EZ4A 4PNHA 1LVHA 1UODA 4XXHA 1NQAO 3EQ2A 2WWHA 3ZZMA 5E3IA 5E38A 3UJNA 3J81k 2BELA 3DD5A 4C2BA 1KQNA 5DNCA 4EUHA 2QUZA 3KALA 3GPIA 3FFTA 4LRYA 3M70A 3ZWDA 3ZW7A 4C0JA 3IQFA 2VSQA 4ZCIA 4GQAA 3W4IA 5BT8A 5ALOA 3HJUA 2V6JA 3PITA 3WLPA 4WZBE 4JIGA 5D7NA 4CZ2A 1W46A 8LDHA 4CLXA 4YWJA 5NLLA 1IJFA 2IIQA 5K8CA 4MWGA 3PBKA 3IPAA 3STWA 5CIQA 3EZ9A 3F5MA 3S0JA 1REQA 3JQ9A 2CWDA 1A4UA 1OXXK 1UKEA 1MTZA 1IG3A 2D5AA 4OJNA 2X41A 3U4DA 1BFKA 2EQAA 4C43A 3WHLA 2PEZA 5H68A 1H9CA 3W8NA 4X92A 3ZV5A 1NRIA 2B25A 2TYSB 2OHXA 3WKBA 4Y1RA 1WAMA 3PLRA 4U5XA 3TVTA 4B4VA 2YXEA 2G0AA 2E9SA 3AR6A 4MULA 1A5AB 1W0KA 2ZR8A 4MW9A 2E5WA 3KWFA 3KB2A 3AF1A 1XXHA 2R47A 4RH3A 4JBLA 1IJBA 4MV3A 2JLZA 5EJAA 5CCXA 3HJAA 4FGSA 4YRLA 2I4NA 5JNTA 2DFLA 4K87A 2RGCA 3ED1A 1UXJA 1ZVMA 2XI4A 3I3OA 4U6SA 1Y3AA 4AY6A 3ITDA 4J0GA 1QANA 3WKCA 4LTDA 4CU5A 1KK2A 1GM5A 2CV1A 2Z9CA 1NQWA 2ES4A 2MMCA 4CUJA 5HZKA 1IN1A 1R8JA 3GIWA 5JAZA 1CF4A 2FPIA 1ZHOA 4L74A 2IYNA 2OMKA 5AOVA 1GSOA 4BLWA 3BSYA 4P3PA 4U9UA 1W85B 5DLPA 1HXHA 2PUVA 2CLKB 4HZUB 4L76A 3TSZA 1J24A 1MO6A 3BF7A 5C8XA 4C5CA 1YT5A 2BFBB 2X1VA 4K28A 2PGAA 5B55A 3GB9A 4NMLA 1DTEA 4PLZA 1J9EA 2G7MC 4LEIA 5FKJA 2JZOA 2QVYX 1VLZA 2I33A 3FBTA 3KFXA 1Z83A 3OQPA 1QK3A 2JDID 4WX2B 1E2HA 1G8FA 3L0CA 3TD6A 4N40A 3ZD6A 2YWFA 4BMVA 3K09A 4LGCA 4N12A 4WCFA 3M0EA 1DEXA 3L7IA 1XO1A 3EC1A 3O95A 1KARA 4QLAA 1PDWA 1XC7A 1K4YA 1MRZA 4EM6A 3QOFA 5CEEA 1I1OA 3AW8A 3H42B 3QQ5A 1YDGA 4OHKA 4FBGA 1FVOA 5ERGB 1PV1A 3IJPA 1T5IA 5IDVA 1JIQA 2V03A 1YZFA 2JD0A 4GSKA 2ZBGA 4JYMA 1YRLA 4KLAA 4B6QA 5AKEA 2V8BA 2G0TA 1QB7A 1U8ZA 1KFJB 4B6OA 2JGFA 5K99A 1CP2A 2QJWA 2XQGA 2REBA 4H3VA 3N7TA 4YQYA 3M5WA 4KITB 2JJ8A 5BSUA 2CL7X 4HDCA 3UUFA 3GEMA 3DEAA 3AFGA 4GYJA 2PSFA 2XB6A 1JS1X 3Q88A 5E1OA 3V1MA 3FY4A 1ZG3A 1DE0A 5TQJA 2K6GA 2V3WA 2ZPUA 1C9YA 5ALIA 3VX4A 1JW9B 2WNHA 4D42A 4YT2A 4FZJA 1FFGA 2YY5A 5CA1F 1VXOA 1JPJA 3PJRA 1AZSC 3DVAB 3OAAD 1HORA 4KW7A 1F14A 4IDEA 2E4YA 3EA0A 4I1PA 1HT3A 1SFRA 1OBFO 1TO6A 2ZIEA 1RWMA 3E2IA 3M49A 5DVZA 4JXXA 2NXEA 1K7YA 2R4TA 2ALJA 4G1CA 1G7TA 3U37A 3WQHA 4BNWA 5AVUA 3EVDA 3H2KA 1WEHA 2CUKA 3MHTA 4I9HA 1TLFA 2VK8A 4JNKA 2NTJA 4QJ5A 4L8GA 2Q5OA 5ADVA 5ED4A 2FKAA 1CUZA 2C4HA 5BNZA 3OE7A 2QV7A 2Q3DA 5HQJA 1EE1A 1XZIA 3P2IA 4GM1A 1J07A 5IDXA 5ITWA 3G3EA 1OX5A 3FYUC 1Q57A 2J7PA 4FSDA 3O4RA 1I2MA 1WHSA 2P35A 1RZRA 1ZM7A 4NE9A 3LHFA 3WNZA 1Y8ZA 5AT1A 2ZZMA 1AUOA 4JEMA 2H6EA 1WBDA 3DM9B 1OF1A 1N5KA 2EBHX 3LWBA 3G49A 4FFRA 4Y2YA 3UBTA 2XYGA 4R31A 4MQ5A 3VR5H 3GAZA 1E2DA 3K3PA 2A30A 3OE1A 4UATA 1XAGA 4FILA 3F8SA 4NBRA 2GASA 4NARA 1HDYA 1RE0A 4YJ2B 3IUPA 1CJSA 4YJ3A 4M46A 1VIYA 1YCFA 5CT4A 4DE5A 1XDBA 2J59A 2VPXA 3OLWA 4FR2A 4N0DA 5IXYA 2VVTA 1T3TA 1D2HA 1Y7TA 4KYUA 3TKLA 1BXRA 5FIUA 3UUEA 1RRMA 3D0QA 3TLMA 2H2DA 5T7BA 3N2YA 1REQB 1D6MA 3EEBA 1UOQA 3NC4A 5JFTA 3NBXX 1X92A 4ALLA 2P69A 2ECFA 3SLGA 2IXEA 4LY0A 4ZZIA 1OI2A 3UJCA 2GFQA 3E4CA 1BGWA 1DHRA 1R4ZA 3A14A 1KBZA 1NUUA 1JJ7A 1XTKA 2G4VA 2O8BB 1TRHA 2OHHA 3EXEB 4QNRA 1JU3A 4WD3A 5FA8A 1E8NA 3VYRB 5K0SA 3ZHTA 1G3UA 2NQ8A 2I22A 3KQMA 1I1HA 2A9KA 1YL7A 3K6SA 1F8UA 2EX4A 1Z36A 2X8AA 3NYIA 2Q3BA 2JCVA 2UVPB 3B2NA 4GXTA 2H07A 2LXNA 2IY7A 3M6VA 4NESA 1R8XA 2Z6UA 2XE7A 5B30A 4TTTS 2J4DA 1F8FA 3A11A 3GFSA 1RZVA 4B6EA 4B32A 3QENA 1Z82A 3GLKA 1Z6ZA 2X6QA 3LYLA 3AONB 4HGZA 5AM0A 4FXPA 4UTPA 5F2OA 2OZLB 2PKYX 4L4XA 3RYCA 3AXSA 3WAKA 3ZI4A 1IY9A 4C08A 4OLJA 3L93A 1W0KD 1RWBA 2AG0A 1ZESA 3O3CA 1DKLA 4LJ4A 4RJTA 2X8JB 5C8ZA 1QHNA 1ST3A 3BX1A 3WE7A 3FYTA 4DS3A 2I55A 2AFHE 3OM8A 5GGXA 3TVDA 2WPDD 4NYMR 2ZRIA 4X1YB 5LBIA 2OXTA 3IPYA 3TZLA 5B7GA 2BGMA 2PD3A 3HKCB 4R2IA 5L7WA 3BIJA 3QPVA 1NVAA 4Q05A 2PT5A 3UHAA 4CFZA 3LQKA 1WKCA 1EMDA 4I55B 1TK9A 4O2LA 5IEBA 4C7MA 1VSTA 2HX1A 3RLIA 4L78A 2G71A 2PXXA 1I13A 1NLYA 2HBYA 4F93B 3RFVA 4RKQA 4RMJA 1NLFA 1JVSA 3GG9A 1F2UA 3K0SA 2FR0A 3H9JA 3H65A 3L7BA 4DIDA 4E3ZA 1WP9A 2CHVA 4IJWA 1FTQA 4ZT2A 3KM0A 4I7EA 4GMGA 1DHTA 1VCIA 2CCJA 2D74A 4MVJP 4QYSA 5JWHA 3EXG2 2FLWA 3RODA 3SYNA 2JCSA 3ILVA 3DDOA 4BX9A 4EKEA 4XVHA 4AZ3A 3EWNA 1SOMA 4KGVA 4QUAA 5CG2A 4FYXA 4NU0A 5KOHB 3TOVA 4F3KA 3I34X 5ILQA 4OI4A 4EG0A 1CQZA 4JI6B 4XI9A 1CVRA 3B2EA 2NO4A 3BWVA 4M6WA 4BNKA 3KHKA 3WFZA 5JV5A 3ZUGA 1U9ZA 2AK2A 1XRNA 3JRWA 4K3VA 2SBTA 3JRNA 3KQSA 1I0IA 3TB6A 3X44A 3QGMA 3U5ZB 5C1DA 1FF9A 2VT7A 1PFVA 1JTVA 3TSCA 3DUFB 1MOPA 2B8JA 3OZ7A 2HQ1A 3MCTA 2YIJA 3IAHA 2YQ4A 2GDZA 5EN4A 1NW7A 1ZN9A 4HBGA 2VHQA 1A69A 1NATA 4O8CA 4BE7B 1II0A 3SC3A 2A9OA 2BFCB 1TC2A 3DQPA 2QLNA 1NW3A 1N6NA 1OH7A 2HWXA 1N0UA 5EWMA 7GPBA 5DO9A 5EHIA 2ZRQA 1EXNA 1DXOA 1JVBA 2QRHA 3G1WA 3G5TA 1JSZA 4Q1BA 2O7VA 4ZMSA 1BVUA 2ZDGA 3U7QA 3ZHZA 5DGCA 3U61B 2ZTMA 4OKSA 3FCAA 4PNEA 3ZDXB 3NASA 2ORWA 1QIEA 4BTEA 1VE6A 2HMSA 1TM5E 2D1YA 2HCBA 4WZ6A 4PQGA 2F3PA 1HMPA 4S3MA 4C2UA 3SC6A 3HU5A 3TQCA 3PPWA 1GLVA 1YR8A 3T95A 4ARCA 2G5PA 3GY0A 3LBAA 5ALHA 5HS4A 5FBWB 4DV3B 2E4WA 4INAA 1W5SA 4GZ3A 3NDJA 4LZAA 4B33A 5I9IA 2WFAA 1ZOPA 4W5JA 3RS8A 3WBJA 1IMJA 2QPOA 1RIFA 2ZTLA 3PC6A 3HR4A 4F7DA 3TW0A 4M8IA 5EE5B 1GN9A 4MR8A 2RC5A 3MWFA 2FPOA 4Q02A 3ZU2A 2EW2A 3NXSA 4FYVA 2IEIA 3PFBA 4V0KA 3G2IA 5KSPA 2WW8A 3E9QA 1SVSA 4NFLA 3FPSA 1ZNYA 2WKSA 1IWOA 2C2KA 2IH2A 1ORVA 1QIJA 2X14A 4Z7QB 4L22A 4BZQA 1JMYA 4IDHA 2NMVA 5A3RA 3SOZA 2QI9C 2FSGA 2CB9A 2H16A 1DNPA 1D2CA 1QLWA 2R8BA 2VJQA 3IXQA 4F5ZA 5KYWB 4R8KA 3AFNA 3LY8A 1LSOA 1H2WA 2BKVA 1NI4A 1GXSB 2XVYA 4ZJZA 2R66A 2NUAA 3CUTA 3KCQA 1J8FA 4JLKA 1UMDA 4HAVA 3ADKA 1SGWA 2XTAA 4X97A 4C3OB 2IEYA 2AFIA 4DSTA 4D9MA 2HWKA 4UDNA 2DM6A 4Q5IA 1G8AA 4BKMA 5ENVA 3GWZA 5JAHA 5HOEA 2J5BA 1JTEA 1UMBA 1KI9A 3MFYA 1UJBA 1YU9A 2I4OA 4OBBA 3VKGA 3EVAA 2WJGA 3KR0A 2VZ8A 3K70B 1X1AA 3NHAA 1CY8A 2R1VB 3IAS1 1EVLA 2BE9A 3GMDA 1V16B 1IWBB 1PX2A 1MX1A 1QYCA 3F1KA 1H9AA 3LYAA 4RQAA 5BYJA 2B5WA 4PN3A 5I3CA 4XLLA 3S70A 5HJ7A 4MRRA 1PDVA 3P9KA 2XRZA 4Y9TA 1Z29A 3ECAA 4J3NA 1XDSA 5T6BA 2P4UA 2CFIA 3A6LA 2DFTA 2J0UA 2XGOA 4ESOA 3CVVA 4X20A 3JZFA 2V7QA 2JI4A 2QX6A 3ZU5A 4ZK6A 3B20A 1MDBA 1OLOA 1GAQA 5THKA 4AYTA 4Q9IA 3G8YA 5KX5A 2ETVA 1T9KA 5I7WA 3GYGA 3PDHA 2YFYA 3QBTA 4ZGBA 4X20B 2XLBA 3SN6A 4ZCRA 2B8NA 3KIPA 2J09A 1QM5A 1UBCA 2GLUA 4FYKA 1PBNA 1Y33E 2CSXA 2BFOA 2VUIB 2IY9A 3G1UA 1J0CA 3H84A 5BN4B 1S8NA 2XWPA 5HF9A 4TZ0A 4M1KA 1WXWA 4JEIA 3AXTA 4J3FA 3F9RA 4ANFA 4BMNA 1ZJJA 5BW8A 5JQGB 1FDSA 4Z54A 4QNNA 3JD4A 4X7PA 4B4WA 1XRSB 3ZEAA 4D4KA 5ER6A 3QTTA 3BQ9A 1QV9A 4LOAA 1NF3A 3VJKA 1QYIA 1P1JA 1QAMA 1YULA 4WK6A 1Z8NA 1YQXA 1EBBA 1VRWA 2WZBA 5FUMA 4GNKA 4K0KB 3PRHA 3WGOA 3CJQA 3ESQA 4M60A 1GRVA 1G5FA 1EM8B 3JQ9C 3WGJA 3EIUA 3WL5A 4YYEA 1WXXA 3AB7A 3MGKA 4FNAA 1ORIA 2AE2A 4K8RB 4BRUA 2ANBA 4PO1A 3LHSA 2FWAA 1FXWF 1FUYB 2VUTA 2YL2A 3H3JA 4JBHA 2PDAA 2XVAA 3I73A 4UVDA 2F3RA 5FJIA 3DJYA 1AGPA 3S2FA 1N3BA 3OFNA 4P5PA 2H59A 3X1WA 5K8IA 1RLUA 2P79A 1U0LA 1IUKA 2A5LA 4WESA 1RIIA 1T8PA 4MR9A 3WQRA 1HQCA 1PGNA 4PVDA 4AJNA 1W35A 4YH1A 2GHRA 5KWJA 4M37A 4J1SA 1C7QA 1NUHA 3HWWA 3R3YA 1IRIA 5KNCD 1X77A 1AGRA 3KD3A 3PXAA 4MUNA 4AF6A 3B1JA 4BQEA 5B36A 4GXNA 1B93A 3K72B 4DL9A 3OBIA 2BMDA 4V0OA 5EJIA 5F35A 1XRLA 4BE9A 5T64A 1TA4A 5KQGA 1U2GC 3X2FA 3GLGA 3DE6X 3BD9A 1EUCA 1Z4OA 2X86A 1DJNA 1RQRA 2Q5LA 3PIRA 5I9SA 1T6BY 3C3BA 3D6AA 5LZ5A 2YVLA 3VTKA 1Z17A 4XX0A 3UHOA 1RMYA 3WGZA 3C8DA 1DMRA 2OGWA 4FDLA 3WGHA 4BTLA 3PA8A 4YAKA 2ONJA 1S7GA 1YBMA 2PQ0A 2ZREA 3N7AA 4KB5A 5A02A 5JC1A 1H4QA 4G0XA 2UV8A 3DDWA 2NOAA 5K05A 1QPGA 3LKDA 4FVTA 4IZIA 5IULC 5BV7A 2R1VA 3DKKA 5ULLA 1EFHA 3GRZA 4HH4A 1UM8A 5G0WA 3SC2A 2ZANA 1N2EA 1G7CA 2X5XA 2AJTA 3DB1A 3GEHA 5D8DA 2OXIA 2GZHA 2O2IA 2OMEA 3EHDA 5CX1A 1FUKA 5KAMA 2PUJA 2ADOA 4XUDA 1JKFA 4W1RA 3VA7A 3KKOA 5HFAA 2D0OB 3FUWA 3GCDA 3NCTA 3HKCA 3VO2A 3ZUPA 3FFAA 4DLAA 1R4NB 2JIOA 3BK2A 1GQYA 1L7OA 1GGKA 1MQ9A 1RBQA 3WADA 1P19A 2PL1A 1WABA 1D2RA 3EXHB 5I8ZA 5ADHA 4NECA 4UUQA 3WGKA 1TA0A 2ZDQA 3EBPA 1KI8A 3N5KA 1QRDA 1FQJA 2HBZA 3EIWA 2ZGVA 3I04A 4FYHA 2XXJA 3SZRA 2ZRGA 5TE9A 3PIDA 3O47A 2HHJA 3GVCA 4BWFB 3NEYA 4OFWA 1BQ4A 4JI8B 1N8KA 5E6UA 2JATA 2VF7A 4URVR 1THTA 3VC3A 2QLFA 2F1HA 1RJDA 2PU7A 3WFIA 5C5IA 3X1MA 2R3SA 2ZK7A 1XKXA 2B82A 4NS1A 4QDUA 1MZPA 4HTFB 5K8TA 1L7PA 1I33A 2VDLB 2QQ5A 2NNWB 1DL5A 4GU5A 2DPXA 2FPPB 1QGZA 2XHEA 1ONNA 4JUFA 4P58A 3HM9A 4YDQA 1OFTA 4EHBA 2WA1A 5HCNA 4P0PB 4DW8A 1XHLA 2FFBA 2PX0A 3D6JA 2IPMA 3G6KA 1TPYA 3NX4A 3GLHB 3WMRA 5KNBD 1JMKC 1B73A 1YACA 3NAZA 3OEHA 3LKVA 5EKDA 5DE3A 3WDLA 4P7GA 3O73A 4IXTA 5FWAA 5ECDA 4ZU1X 5KI6A 2J4CA 5D87A 3HYLA 1FU7A 3DEYX 3HQ4O 4MCHA 3USCS 5AVXA 4OX9Y 4AS2A 1TU3A 2EJBA 4CQLB 1GPAA 3GA5A 4LZZA 2J9RA 4L6AA 2YYZA 1COZA 3HBLA 4A6DA 5EE0A 1VL8A 3UJHA 3VU8A 4Z4IA 1SEPA 4HX5A 3RKRA 5DI9A 5EHNA 1M2FA 4MUEA 4OOEA 2CMGA 4HXYA 4Q4JA 4RVFA 4BJ3A 2ZB4A 1ILWA 4GSYA 2OK7A 4PFKA 3P9SA 2G1KA 2HZBA 3LUKA 3U56A 4U7HA 3HP4A 2NQTA 3SGLA 4A16A 2C57A 4CKCA 5JD5A 1XRJA 3I83A 5JROA 4WLNA 4ZC1A 2P5UA 2GEBA 3PGKA 2M32A 4M53A 5CH5A 2PIDA 4EYOA 2VXCA 3RIEA 3LLMA 1K3TA 5MFPA 5F2EA 1XWIA 3OPYI 1J2EA 5IYZF 3HZZA 2PSEA 4UUNA 4LJKA 3EY4A 3TO5A 1QQBA 2HA4A 2A1UB 4C6SA 3LX6A 1BW9B 3OF5A 1P4HA 1TM3E 3RRYA 4HUJA 3HDVA 1ZGCA 3L8GA 1YA6A 1Y5IA 1NBHA 1G7RA 1DCTA 1JR2A 2DY0A 4CRWB 5JH7B 4NJEA 3IA7A 3M6FA 3QLJA 3EFEA 5C5DA 5IASA 4W6ZA 4E5KA 3BD8A 3WQSB 3TECE 3SSNA 2NAPA 4D9HA 4OQYA 3TW8A 4YR9A 3ADCA 2QNBA 4IVPA 4JUIA 1BE8A 1G98A 3OY2A 3S3TA 5I47A 2NTYC 4NU6A 1G8MA 2C7VA 3HP1A 3F8TA 3L77A 3KTDA 1ZJYA 3G7UA 4I6JA 4I4NA 5IM5A 3G9XA 4CTKA 4FN4A 3I2IA 3AHEA 3FZYA 4PZCA 3DP7A 3QF7A 4R41A 5DGIA 5KTRA 2XGJA 1S0UA 4LQLA 4J90A 2H85A 3VR2D 5AO9A 3VVLA 4P0QB 1N2SA 2VRWA 1Y98A 2A58A 1TIPA 4F11A 2H1SA 1NULA 3HB9A 1N5RA 5LP1A 3RS2A 4IFBA 5AOCA 2WIDA 3MBOA 1OLSB 5F9MA 1UQTA 4AROA 4BRZA 5LMCA 4X0EA 1S2MA 4O08A 2NT3A 2FPUA 3Q87B 1IQRA 5FQNA 3N0VA 4IUYA 4Q18A 3WZ2A 1NU8A 4FEAA 4S24A 1T2NA 4HAIA 1YQUA 1PJLA 4K9KA 5H59A 3ZWVA 4XFKA 1SCUB 4H18A 3ROZA 3H9CA 4KMSA 2ISCA 4EJ6A 1F6WA 3OZUA 3K8ZA 4CW7A 1E1YA 2JBAA 1RCUA 2WJ3A 5CNKA 1HZJA 1USWA 1I7SB 2Z6AA 2EDAA 3KAQA 4OHXA 1EBUA 3DL2A 4EL5A 1JA1A 3STHA 3R0ZA 2QVXX 3GXBA 5K20A 3OZTA 4V03A 4FX2A 2AEJA 4HEJA 1GQOA 1XPJA 4ZARA 3M8KA 3SR0A 2ZP1A 4DMKA 1WDMA 2NU9A 1O77A 3BXFA 5JCJD 1TKRA 2P41A 1QTRA 2E49A 2PMKA 4KDRA 1FCJA 3CR3C 3W1VA 1M74A 3UIEA 3GEEA 3QFCA 1E2BA 1MKYA 1RVV1 4FFBA 3VRHA 2W2KB 3T7RA 2ZI3A 4HFNA 4N6GA 1Y1QA 2P91A 1SVWA 1R74A 4BCBA 3PLAE 1WHTB 1H6BA 1ZQ1A 3ZGLA 3KELA 1T5DX 3PUZA 1MEJA 2DGDA 2H3EA 3C70A 3FVRA 2CGEA 2NYUA 3H9QA 4D4IA 1G1AA 4P36A 3F98A 1JDZA 2RHOA 2ZUSA 3F2VA 2Z5VA 4OREX 4HDRB 4RD3A 3VUFA 5LQNA 1U7OA 1M76A 2C3YA 1H5UA 3OQJA 3TI9A 1GFWA 5A0VA 1H2YA 5C80A 1XVIA 1CETA 1O3YA 2AI2A 4HPWA 5AK4A 1I3MA 4A5SA 3USES 1V7PC 4AQDA 2XBLA 1L5NA 3O4IA 2OT3B 2A0WA 2QG4A 4O3FA 3ACDA 3QUSA 2CLOB 2XOKA 1DI0A 2XOKD 3OUTA 1PSZA 4U4AA 3TRFA 3FSJX 1ZD5A 1TYDE 2VH2A 4QX6A 4ENRA 5A2QA 3MIZA 4O8ZA 2WD9A 2NU6A 5G1OA 3GROA 1U8CB 3LDFA 3ZY5A 1CUUA 5IN4A 1Q6ZA 5J2TB 3OQMA 5THQA 3OE7D 4D74A 1KZ6A 3OEYA 3GRRA 3V97A 4GDFA 1GQ2A 1PWZA 3DB2A 3T1NA 1N8SA 1KYWA 1WUIS 4KAAA 3CISA 5GQSA 1PNRA 1KZ9A 1Y7LA 5AI8A 3FWZA 2DSNA 3IHLA 3IKMB 3FOCA 4IEFB 2ZCVA 1T4BA 1SCKA 3NETA 3FCOA 4WFQA 3TE6A 1XTBA 1YZHA 5HS6A 1DQNA 2A9VA 4XGKA 1NG1A 1IBSA 1X8XA 2QZPA 4WOBA 2QBYB 5HHTA 1T91A 4H1WA 1DB3A 2VNIA 3R3WA 3CH5A 1QCCA 1EB9A 3DE1X 3GW8A 4JVMA 4AWAA 4DCNA 1G5RA 1E1NA 1PT9A 4L4ZA 4QBIA 2X7JA 1P1CA 2YY6A 2FTKE 1UKYA 4BGIA 2JLRA 2IOFA 1OZFA 1U3TA 2Q1XA 4ZAFA 4GICA 3ZJUA 3M5DA 1QC5B 3HFJA 2EF0A 2Q7XA 4Q21A 1QZXA 1Q7RA 3CW8X 3NWOA 4XIFA 2XEDA 4EDHA 1V4VA 1VLVA 4JI0B 5A5DA 4QWWA 1RC0A 2O6LA 1SQ6A 2BMAA 3VV3A 4KPYA 1ISIA 3B7WA 5GONB 4FCVA 3IXMA 4EDFA 5AK0A 1N6IA 3U7RA 1W5AA 1ZRSA 2AR7A 1X15A 4PHTA 4CR6A 4RELA 2PTGA 1ISRA 3SD7A 3AGQA 3UK2A 1VHQA 3R3JA 3TH5A 1SURA 2XCIA 3LHIA 3GRKA 4EENA 1RKVA 3EVZA 1GTJ1 4NEQA 3JU3A 1RPNA 1HPLA 1GGHA 3TLYA 2IXAA 3MINB 4S1NA 1PGPA 4B83A 2HMYB 1NQUA 4LOIA 2PH7A 4JBYA 1NNLA 4BNIA 4LDZA 1KKUA 1K7FB 4KCGA 1XLVA 1KDZA 3RCBA 4Q3NA 4Q9NA 2OAEA 4H1HA 4ND3A 4WKBA 3LV8A 3ZX5A 5IBCA 3E4DA 1H8ED 2J32A 4HQOA 3WFJA 2HHLA 3CPEA 2IDJA 3AY0A 3QNUA 3K6JA 4M55A 2V6MA 4EVRA 3T1YB 3C7AA 3DE7X 1ZD9A 3KHSA 2CXUA 5ICEA 3FMIA 2C1ZA 3OO0A 4G6ZA 1KU6A 3RT1A 5TEVA 2PFSA 1N2HA 1IIRA 1OXMA 2X42A 4LJ5A 2ZAIA 3T3MB 1PG5A 4AY5A 3STYA 3IAEA 3RS0A 1NY5A 3OUZA 4YQFA 4QG3A 1MUUA 2YJGA 3QIAA 2DLNA 2XE8A 1T29A 3NR2A 5TS2A 3NPAA 1F17A 4TKZA 3D0OA 3O8RA 3K9GA 2WNSA 3UPTA 1BS9A 2JGDB 5DNYB 1FDIA 1JWLA 5ADUS 3TQHA 2YYSA 5JYDA 4IWNA 1IK4A 3T3HA 1C0KA 3MAAC 2ORED 1A8QA 3CJTA 3NCHA 4HLQB 1PLLA 4WBNB 4K40A 4MR7A 1YOVA 3WIOA 2EZTA 4R2JA 2DPGA 3UANA 1Z6QA 4S1OA 5AVWA 4Q00A 3RU2A 4G89A 2ZVQX 5FOTA 2GXQA 1XAJA 5LMZA 2WQ7A 4AY2A 1CG6A 4JLBA 1WCWA 1R8SA 1VGQA 3HUDA 4NBLA 2CLDX 4RPCA 4TSKA 2FWMX 5MN4A 2QR3A 5F7XA 1E20A 3QNMA 1U0JA 2WR8A 3QVMA 1DCFA 1NVVQ 3RB8A 5JJBA 1K1EA 4RV5A 3T5TA 1OIVA 3AFOA 4HEA1 5A4MS 4CKCB 1GZ6A 1XNQB 1KC3A 1GPNA 1RU3A 4GE0A 4X1OA 1AZTA 2YXPX 4MMYB 1SOVA 3V42A 1P5HA 1PUIA 4XOUA 1J8VA 5EIAA 1F06A 5TB5A 1P2BA 5EJ7A 4BO1A 3RTDA 2X4IA 3PA6A 1Z4JA 5AH0A 5D86A 4FU0A 1TMGE 1SH7A 4G07A 4RCVA 3S27A 2ZRKA 1VYUA 3NUGA 3I2HA 4HNAA 3UV3A 3VPDA 2WBLC 2W6CX 2Q2QA 1E9FA 4AKHA 2I1LA 3S2YA 3I2JA 1SR8A 3H5LA 3B1ZA 1UR5A 2LDBA 4EA7A 5TQ0B 3TIVA 2QRQA 3FVVA 2AXNA 1PHRA 4BBPA 1YZGA 4A2PA 3ANSA 1PW7A 1C4XA 1UPTA 1VSVA 2BF4A 3HCAA 2F3QA 3U39A 4GWLA 1PBTA 2EWVA 2WSIA 4R1PA 2CVQA 5DZSA 1LF5A 2BFEB 1VJDA 1E3DA 2QRVB 3EVFA 4JT4A 2E82A 3Q7RA 5P21A 3ZWWA 1JAYA 4GRDA 2GN1A 4BNMA 1E5VA 4BFSA 2P3QA 2F1KA 3TG8A 1SU4A 5AJHA 1QIIA 2CUNA 3AJ9A 2Q5FA 3T9EA 3RS3A 1USVA 2P40A 1O54A 3RYHA 2WJ6A 3HP7A 4YMHA 3DAGA 7ABPA 3RPEA 2BTOA 4P7FA 2ZKLA 3CWZA 4JODA 3WRXA 4TV8F 1E2EA 5FO1A 4CVNA 1SQFA 3OQ1A 1LU9A 4O1HA 4TRNA 3R9KA 3WG9A 1U28A 4FUQA 1I0ZA 3C45A 4MYSA 1L4KA 1NZJA 4H16A 3H6KA 4IQ8A 1YRYE 4OFXA 3PU6A 4PAOA 4RH0A 1V96A 4C1NA 3H8SA 3B9QA 3AP2A 1WXQA 2GCOA 4TYNA 2JFPA 3S1LA 1NI5A 1C1DA 1G5PA 2OZEA 3K53A 4RM3A 1WQ3A 2IE8A 2DUWA 1IZ8A 2IF2A 4TV8A 1Q21A 1ZK1A 3I5AA 1QHGA 3FRJA 1IZ0A 2JEZA 4EFMA 1JAHA 1TQ2A 1S7CA 3SJCA 1RPAA 3O1LA 4LMBA 4EA9A 4G37A 4JIMA 2N1MA 2AMJA 4OGGA 5A3QA 1L5KA 4BCDA 1AHNA 4A10A 1KY2A 4O1IA 5CR9A 5HP4A 4PQEA 1E0JA 3WSWA 3ZY2A 5IC4A 3NM6B 1HLDA 2GZMA 3THRA 4L27A 2O57A 1NVWQ 2WWWA 4MB2A 1XLTA 4BP1A 1R9GA 1MDFA 2Y3IA 1OGJA 1P9LA 3HZOA 4PSKA 1XNHA 2B0CA 3I09A 4II3A 1YR9A 4Q3KA 1EUYA 1N2ZA 3CNQS 2HF7A 1JH8A 1UDWA 3TE7A 5A3JA 3MRVA 2OO5A 3M4YA 5K01A 4DA9A 2Y77A 4Q7QA 2VTBB 4HKTA 4MGZR 3Q8XB 5LBUA 4QUJA 4B3GA 1ZIPA 3A6EA 1LW6E 4IQ0A 4R1TA 5IUNC 4XSHA 4D45A 4PW0A 3DOOA 1F4LA 1QYRA 2QTHA 4RSRA 2ZIFA 2FZCA 2GEVA 4W99A 2B1IA 2E37A 1Z6TA 4JJFA 4AD8A 2O8CA 3QU5A 1XRQA 1R2QA 5DTEA 1MFZA 3PUIA 4QQ8A 3VAAA 3W8RA 3EYWA 3GI1A 3CUEF 3PT5A 1XCBA 1DPFA 1J9GA 1KOLA 4CE6A 4CT5A 4KX3A 5KTYA 3ELYA 3ETGA 4PFJA 1HDZA 5AQ1A 5KYYB 4UASA 1HA3A 2HLNA 1ESMA 4GBED 4C0XA 3LGSA 1ICIA 3ZJYA 2A9QA 3DMRA 1WLYA 2D2VA 3P2JA 3QPDA 2E85A 2BSAA 4Y7DA 4GVLA 4UZSA 1WMFA 4RLQA 4MV9A 1KMNA 3I1JA 1X1BA 2X7XA 4B80A 1LBTA 3AUTA 1QTNA 2IW3A 2WJPA 2WWFA 1QUEA 2YH2A 2G8LA 3V48A 1OHHD 2GCOB 1YUMA 2AFIB 1AK9A 4GVPA 1RFGE 5DM60 3OOEA 5UKDA 5I7VA 1WMSA 1LCIA 4PPYA 2YJZA 1PR0A 5GP1A 2A9FA 1NQVA 2PAFA 3NT5A 4PX3A 2C4TA 4RBNA 1FFEA 5KYWA 1V3UA 2GHTA 4I81A 1NW4A 2RJ3A 4QO8A 5DTJA 3M81A 2IXGA 2PEYA 3GH3A 1HNWB 4GX5A 3LI2A 1F48A 4J03A 1KMIY 1PD1A 3G2NA 3IP1A 4NDNE 4RE6A 3OCJA 5DI3B 3S2GA 3J7AC 4E2YA 4JQCA 4ZREA 5HKLA 5F9HA 3BC1A 2Q3LA 1RJGA 1N9ZA 4GQIA 2WHQA 3PWTA 5CB4A 2BZ0A 2EJWA 3TD2A 3A7EA 4G26A 5AW2A 3T4UA 4HQNA 2FW7A 1LQTA 1FRQA 1ZMXA 1U2QA 1O03A 2ODEA 1CUBA 3BL6A 3EPRA 5BSVA 2DR0A 2ZUBA 1WBJB 1C30B 1ULSA 4MQFB 2GCEA 4WQMA 1KF0A 2LE0A 3ELBA 4LRSB 1USIA 2H7VA 3KXPA 3G0HA 1DDGA 1E6CA 1IHPA 2CLCX 3L0BA 4Q9DA 3IAAA 4URFA 3FTCA 4XQGA 2V1XA 5LDHA 1ZW1A 3DEFA 2P6PA 5IC5A 4A8JA 2ZYWX 1XRPA 3D4PA 3MMPA 3BSFA 2AL7A 1QFZA 4RTPA 4CF3A 1G3MA 4EHKA 3N07A 4K2HA 3L7OA 4DAOA 1DV2A 2RH8A 4JSYA 1SXJC 3OPNA 5FAXA 3N8GA 2A9RA 4YS6A 4BO3A 1IFXA 3KPJA 3OLYA 4HWRA 4C14A 2F9FA 1FLDA 5JASA 2HU8A 4NOLA 1RWPA 3ED5A 5K4AA 5BR1A 3QELB 4UHCA 2W8ZA 4ZANA 4P80A 4BLSA 1Y3DE 4QU0A 2XMCA 1XZEA 4JSRA 2GBGA 4ROTA 1IN5A 1ZJ5A 4X1KB 1BHSA 1NFRA 2LDXA 1ZSVA 3A05A 3LT4A 1JT2A 1Z5NA 1DWPA 1RM0A 4CFSA 3NHKA 4M3NA 2V5UA 4QUGA 3H16A 2EEPA 2P9JA 2JGJA 2XADA 5JNSA 3QYAA 4HCJA 3V1NA 2BN4A 1I5OA 3IBGA 2DHDA 1VE1A 4FFVA 3HWRA 1Q7EA 1KSFX 1DOHA 1XE3A 1ZVJA 2XODA 1YV9A 1NDQA 3EG5A 2WJWA 2XMZA 3CH7A 4GZ5A 4N3NA 4C7BA 4HNTA 2YJTD 5JD3A 4C30A 3ZD8A 4BLOA 4OQPA 2DYKA 4A6EA 4F04A 3EZNA 3PYLA 2I2CA 4TUYA 1E9DA 1BH2A 2C7GA 1Y4AE 1RYYA 4JZKA 3SCZA 4AG3A 1XU9A 3X1KA 3VPCA 4TTQA 1IATA 3ABRB 5CXXA 3D4IA 3QTBA 3KKZA 1MT0A 5H9VA 4BNNA 2DQKA 2CSUA 5IH7A 2PBRA 2VCYA 3D7SA 1SVKA 1VKOA 2G1PA 2PZJA 5KVAA 2I3DA 4A5OA 1ABEA 2FU5C 1NBIA 3KBOA 2O5CA 2HADA 3UXYA 4BFWA 3VOBA 4TZKA 1E4EA 3H99A 4QUIA 3D4BA 3R7FA 5JD4A 1N9GA 1R5BA 2PH3A 3IX7A 2DB3A 4J94A 4GR5A 3G23A 3WIDA 4PYJA 4HDSB 3WL3A 1JLLA 4GX2A 3ZW9A 1BX0A 1KEPA 3RK4A 1VLLA 3GAAA 5YASA 1SVNA 3OFKA 5I9LA 2PR2A 2QTRA 3K6RA 4LF7B 1KVUA 1QVVA 1VKRA 1GUAA 1VP9A 3IMEA 1CNFA 1ST2A 3CF6R 4I50A 4PPNA 4XTRA 3ZDDA 2QTWB 2ACVA 2YBDA 1RYBA 1N6HA 3AUKA 2BDTA 5TARA