3FWYA

Crystal structure of the l protein of rhodobacter sphaeroides light-independent protochlorophyllide reductase (bchl) with mgadp bound: a homologue of the nitrogenase fe protein
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
268
structure length
268
Chain Sequence
b'GAKVFAVYGKGGIGKSTTSSNLSAAFSILGKRVLQIGCDPKHDSTFTLTGSLVPTVIDVLKDVDFHPEELRPEDFVFEGFNGVMCVEAGGPPAGTGCGGYVVGQTVKLLKQHHLLDDTDVVIFDVLGDVVCGGFAAPLQHADQAVVVTANDFDSIYAMNRIIAAVQAKSKNYKVRLAGCVANRSRATDEVDRFCKETNFRRLAHMPDLDAIRRSRLKKKTLFEMDEDQDVLAARAEYIRLAESLWRGLDPIDPHSLPDRDIFELLGFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light-independent protochlorophyllide reductase iron-sulfur
publication title Crystal Structure of the L Protein of Rhodobacter sphaeroides Light-Independent Protochlorophyllide Reductase with MgADP Bound: A Homologue of the Nitrogenase Fe Protein.
pubmed doi rcsb
source organism Rhodobacter sphaeroides 2.4.1
molecule tags Oxidoreductase
total genus 93
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 1.3.7.7: Ferredoxin:protochlorophyllide reductase (ATP-dependent).
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00142 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fwyA00
1SZPA 1P4SA 1ZVQA 4JYBA 2MSEB 2QTVB 2RGEA 4G1UC 4C0JA 3DZ8A 5HKKA 2R6DA 4HLUC 5D3MA 4QHYA 4TSFD 1EFTA 3BERA 1JAHA 3PENA 4EJSA 2A5GA 1F3OA 3C15C 2Q9CA 3B1ZA 4AI6A 1FQKA 4M53A 1KDOA 3WBKA 3ZVNA 1R0WA 4O2RA 1EFHA 1F5NA 3ICQB 2XB4A 3ADKA 3GPLA 4JSTA 2CHVA 3KZ1E 1FOEB 2JJ1D 3TKLA 1NNEA 3R8FA 1Z28A 2QEQA 4YMVA 4R2IA 1Q3TA 3FMPB 2RKOA 1LB1B 4HUTA 1SHZA 3RSLA 1XMIA 3WRYC 3DZDA 1ESNA 2O0HA 4GMDA 3SJBA 4IDOA 1VDZA 2O8CA 3QNUA 2VIIA 3FOZA 1VHLA 1AKYA 2ZQ5A 3CX7A 4JVNA 4NKRA 1E2QA 5JECA 1NF3A 5CJPA 2HJGA 1OXXK 1FZQA 1IOZA 3IILA 2DWQA 1AS2A 3AB3A 1XJQA 5AJZA 3SJZA 3B78A 1GOTA 2VL7A 4H1UA 3V4FA 1B0UA 3ZS8A 4Z54A 2QP9X 5IK2D 3AQ4A 2A3RA 4DEYA 4DDTA 3OFNA 4Q7LA 1ZC4A 3A36A 4TL8A 4Q47A 1HQCA 1XEWY 1VECA 2AX4A 3VAAA 3DMNA 3SBDA 1GUAA 4FXPA 4I1OA 4O0MA 1OFTA 3DDCA 1D6JA 2XX3A 4MYCA 4PFSA 2ZI9A 1MO3A 3IIKA 2DB3A 4Q01A 1XTSA 3GJ8A 1YR8A 2JLRA 2VRWA 3LDAA 4FN5A 4PQRA 1OB5A 3LNCA 1ZNWA 2HJVA 1LF5A 3KX2A 1WP9A 4MKIA 2PJRA 3T5GA 4M1TA 1W5SA 5EP4A 2ZE5A 5AUOB 1GNRA 3EX7C 1HQYE 3D7MA 4QHSA 3U3OA 5AUPB 5KNBA 4N3NA 4JVMA 1G291 5JZVA 4JLJA 5EP1A 1FQJA 4BRWA 3N5CA 2QRNA 2KB0A 3GLFA 1S1CA 1XEFA 4BLTA 1W36C 1XF9A 4JIMA 2ZRAA 5DYGA 4BZPA 2I4IA 2ZE8A 2V6IA 1NG1A 2IYLD 1COWA 1OIVA 1OYYA 1KO4A 3BH7A 3NBFA 2OM2A 2BIFA 4HUQA 3ZZTA 3L0OA 3PEUA 4L9WA 4Q9JA 4DDUA 4B3FX 2JLWA 4DB2A 1NLZA 4C0SA 1MABA 5KPDA 3ADDA 2Z83A 2ONKA 1S9HA 2GJ8A 5IDVA 2Z5FA 2GESA 1VG8A 3TUIC 3U3MA 2IYUA 2ZJAA 2DFNA 3SC3A 2ERXA 2O5VA 1KI7A 4V0ME 1F48A 3NBYC 5CIWA 5KHOC 4IKEA 2F1HA 3KKQA 3BFKA 3RLFA 1KSHA 4TLAA 3VNUA 5DISB 4XIGS 1QHSA 2D2EA 3EPKA 1UDWA 2QROA 2ZRMA 1JPNA 1O3YA 5CITA 1DPFA 1A2KC 3HWSA 4ARZB 1CLUA 4TTPA 4JJZA 1RE0A 4D4MA 2PX3A 2WHXA 4PTLA 4HDQB 4V02A 2QQEA 4TYNA 1ZJ6A 5CYOA 1G64A 2G1JA 4QRHA 2GK7A 1XD2A 1QF9A 4KSBA 1W46A 2X77A 2OV2A 3HU2A 1H8HD 4MYHA 2VO1A 3NBXX 3FHCB 5F9HA 4MGYR 3TH5A 4P0TA 3U7EB 2ANCA 4OQNA 1E9BA 4X8OA 2MSCB 4GOJA 4IRUB 3W6PA 4A2WA 4KU4A 2VF7A 2QL6A 1P3JA 2VSOA 3DKVA 1GRNA 4MUBA 1NVVQ 3B7GA 2YWGA 4IEIA 4PPGA 1E2IA 4NYIR 621PA 1R2QA 5B58C 4F93B 1KO1A 3BE4A 1QHYA 2R6GA 4WW0A 2LWIA 2CL6X 3KUCA 3VX3A 4TLDA 3L0PA 2QA5A 2JJ8A 2XNSA 3FKSA 2AR7A 4PPFA 4YONB 4YQFA 2JJ2D 3P32A 3I32A 1OXVA 3B1VA 1XB2A 1IN8A 3W8RA 1U8YA 5EXSA 4RZXA 4KITB 3U6KA 2O8FA 2J46A 4BWYA 1JECA 3AKDA 3CF6R 5CYPA 1E0AA 3ONWA 4HDCA 3AGPA 2GCOA 5CB8A 2GBLA 1GKUB 1OXSC 2BVNA 2GRJA 821PA 5KYKA 1YR6A 3FDIA 3IO5A 4LBVA 2FJUA 3FWYA 5FBQB 2BBWA 2R65A 2GXUA 3I3SR 4RD3A 5H8WA 2XB2A 1Z22A 3QG5A 2R6FA 3PUWA 2D7CA 2ZETA 3NBZC 4DLWA 4PAMA 2ANBA 1ZBDA 5FBVB 5DI9A 4M2LA 4KJZA 2ZE6A 4D81A 2H1LA 1ELOA 4O25A 5EXPA 2J0UA 521PA 1Z8FA 1JEEA 1YVDA 3OE7A 5FL3A 3RS3A 3BJIC 3KL4A 4B75A 3QJYA 3WY9A 2D4HA 3CB4A 4DLXA 5KDDA 3AF2A 2XSZD 5JLJA 2J7PD 4RD6A 1RJ9A 5HTKA 3AUXA 1NKSA 4BLSA 3R20A 2D74A 3E5HA 3E2IA 3P4YA 1E99A 4K8OA 2XTMA 3CW2A 1AN0A 1G7TA 1TEVA 2GK6A 1E1RA 2Q21A 2BWJA 3A1UA 2A5JA 2AXNA 1Q1QA 2IEZA 2G88A 1L2TA 2A5DA 4HZUA 4Q1EA 1DO2A 1XJCA 4PQFA 3TSZA 4D2IA 4DKXA 5KDOA 2WJGA 2X19A 4QM6A 4CEIA 1DG1G 3PUVA 5FPYA 2MMGA 3AF4A 3OESA 1BS1A 2WWHA 5G40A 4BLPA 1TQ2A 5EE1A 2IS1A 3WHKA 1KK2A 4EUNA 2FDCA 4LZZA 1J70A 1NVXQ 1Q3HA 2C77A 3CIOA 3Q5DA 4NCNA 4F91B 1CU1A 2VH5R 2ZSDA 1JR3A 3QVVA 3T61A 2O8EA 1NSTA 1RVDA 1QHNA 5CM9C 1W4RA 2AKAB 2IF0A 5JJKA 1W0KA 2ZS7A 2DCUA 4OJQA 5FH9A 2WM9B 221PA 2OILA 2QY9A 3ASYA 3BORA 3I4LA 3VFDA 2QMOA 3CH5A 3H0KA 1II8A 4MRPA 1R7RA 5KSPA 1G7RA 2AN9A 3LLUA 2WWFA 2VHJA 2YOHA 3B82A 3QOFA 1CF4A 1TTTA 2EYUA 3THYA 5L3QB 1FP6A 3CX6A 1CJVC 4B3BA 4ZDJA 2P67A 1IY0A 2AFHE 1NMZA 2ZRFA 1KZ7B 2PH1A 5DLQC 5J5CA 2QPOA 5J47A 4MDEA 1KAGA 1QRAA 4HB2A 4IVQA 5CM8B 1F2TA 1OV4A 3LX8A 1RW4A 2ZJOA 3B1XA 3AVUA 2FV8A 2FSIA 2I3BA 1YZLA 2G0NA 2ZJ2A 2JATA 2NG1A 5BW8A 3NH6A 3EIEA 3DHWC 4DUGD 3OIUA 1QHHB 2QBYA 2AHOA 3CPHA 1A4RA 1T3SA 4B71A 4X8LA 4N0DA 5JS7A 1F6BA 3WBJA 4DCNA 2H17A 2ZRHA 1SGWA 3TLXA 1UBEA 4RKEA 3MD0A 4MGKR 6Q21A 4DSTA 2HLDA 2V54A 3EPJA 3K0CA 2QZ4A 3EWSA 5JMTA 2ZYTX 1EK0A 3G0HA 4TWZA 2IUTA 5EUMA 1CRQA 5TARA 1TADA 1OE0A 4ZKDA 4I1VA 3K0FA 4WZAE 1U0LA 3LD9A 2ZJYA 1N6LA 1OFHA 3BRWD 3Q72A 3AF1A 4ACAA 2C9OA 3SS8A 3RS5A 1S0UA 2FNAA 3QSYA 2O8BA 3F0TA 2ZS8A 1XTIA 2F43B 3NKVA 4M9XA 1OB2A 2LKDA 2EFDB 4ABYA 2IA5A 2CE7A 2RCNA 1Q1BA 4A2QA 4A6XA 1OKKA 3I62A 1UADA 3EC1A 4E07A 4DDVA 3KXIA 5GJWC 1C1YA 1VMAA 4MH0R 4XWAA 2IS4A 4CZ2A 2J0SA 3CH4B 4IXMA 5AUNB 3TQCA 4PO8A 4E5UA 1IN5A 1CR1A 2YWHA 1ZNYA 2DWOA 2OXCA 2XJ9A 2ZU6A 3LBNA 4FI3C 1R0ZA 5EUQB 1MOZA 2Z6VA 1OHHD 2DWPA 4EPRA 2HXSA 1WF3A 3GEHA 2REXB 3I5YA 4ZI2A 1X6VA 2CK3D 2YJTD 2C78A 4CEHA 2WTUA 2WPDD 4L15A 4C2TA 4HLCA 1W1WA 2BMDA 5BQ5A 1JJVA 2H16A 4NE2A 5TB5A 4B2LA 4D0LB 1GWNA 1FX0B 1U0JA 1E2MA 1O87A 4AC9A 2ZI6A 4B76A 2J5XA 2QMUA 4Q4AB 2QENA 2ECKA 2A78A 1T5IA 4EQ6A 5JRZA 5DI3A 5DN6D 2QGZA 3AF3A 4Q4JB 5TVKA 1XTJA 2FZLA 5CJ2A 1RC8A 2GILA 2J1LA 4R9UC 2ZTSA 3W6NA 4O3MA 2WV9A 1N6NA 3IBYA 2GVZC 3KQUA 4Z51A 3CRRA 1P2VA 4ASUD 3AV0B 2XOKD 3LLMA 1MO4A 3VTKA 2GBLC 3THWB 4IFEA 3KKNA 4WXPA 2RGCA 1DEKA 1G16A 2PMKA 5FTKA 3NG1A 2QAGB 5AJVB 2P6RA 1I2MA 3F3YA 1Y3AA 5CIQA 2IS6A 2ZAMA 3V4RA 2FGJA 3AUYA 1ZAKA 4PAOA 3KDSE 1DVRA 1Z47A 5J4YA 5JHGB 3NEJA 5EZ6B 4M9ZA 1HT1E 1OW3B 1SXJD 4LC0A 3J81k 1KZGB 3HJNA 2ZUBA 3K0EA 1E2HA 1U81A 2AXPA 3MFYA 5C2JB 3BB1A 2ZANA 4PR0A 3DOEA 3UK6A 2JLZA 4K46A 3KXLA 1G6HA 1P2SA 2CMKA 4ESVA 4RFSB 1MO5A 4B32A 3I73A 1NBMD 5FI1B 1CS4C 2WSSD 3P26A 1NN1A 3SNHA 1OH7A 1T91A 4P32A 2C2HA 1U90A 2GXAA 1DAHA 4FCTA 1GFIA 2BBTA 4HATA 4C3ZA 2WAXA 5B57C 3FYHA 1Z08A 4ZDWA 4DSNA 1J8MF 2VSXA 5IT5A 5F98A 1P7CA 4L4UA 4URYR 3P4XA 1FW6A 3BB3A 1FTSA 3TUJC 4IW3B 4HLQB 4TMVA 4UQOA 1XTQA 4ITRC 4AKEA 2CNWD 1N25A 1Z5ZA 3EZ2A 3OF5A 4WBSA 1T3LA 1WB9A 1SXJB 4IOLA 3X1ZA 3U60B 3U3JA 1GNQA 2ZM5A 2JIZA 1OIWA 4FW9A 4KODA 4UXIA 1KMHB 3GFOA 2BMEA 4IHQA 1X3SA 3UWOA 2FZ4A 4MGIR 1KI8A 5M04A 5D3MB 4C9BA 1H8EA 2ORVA 2NQ2C 1U99A 2F7SA 1UBFA 3R9XA 1F2UA 1MH1A 2ZI3A 1P73A 2AL7A 2IF2A 3CR8A 4ILEA 4A0RA 3OEEA 2RB4A 4XVUA 3FMIA 3TAUA 3SJCA 4LJ5A 4UNSA 1IXZA 2N42A 3ECCA 4XOIA 2NZ8A 4BE7B 1GAJA 2R8RA 3OFND 1YU9A 3PQCA 4DCTA 4F7WA 3PIRA 4PANA 1P5ZB 3EZ9A 4Q7JB 1OXTA 5EE0A 4F4IA 4X8HA 4IJMA 1P60A 4IDPA 1ZYUA 1XFAA 1GKIA 3A58B 4TQ9A 4DBLC 3B6EA 2ZU0C 4B3DA 1OIXA 4XD7D 3IIMA 1HEIA 5E4FA 1WMSA 5FTNA 3O8CA 1DAMA 1UPTA 1E1QA 4N1AA 1TQDA 3BS4A 4BUJA 5IHPA 4V0MA 1E0SA 1AQUA 3ZVLA 1ONBA 5A5GA 4M0LA 1OYWA 2ZYUX 1WE2A 2GJAA 3H4MA 2W0MA 3L8ZA 5FPKA 2RGXA 3P27A 3MMPA 2F1IA 1XZQA 5GVSA 3IEUA 3AH8A 4PO1A 1NP6A 2D62A 3GQBA 4HZIA 2G9NA 1FMJA 3KTAB 3U5ZB 3EA5A 3K0CC 1R10A 1XD9A 2XEXA 5HPYB 4OK3A 2GNOA 4JJKA 3B5JA 2BC9A 1KY3A 4A0GA 1ZM7A 1T3HA 4U02A 4IDNA 2HDNB 3EA0A 4BFZA 1NY5A 5JS8A 1GNPA 1II0A 4Q7KA 1D2EA 1S9DA 3WYFA 1ZM4A 2R6CA 3TSOA 4BLOA 1CJUC 1N0WA 2HUPA 3W9YA 1SKQA 1TF2A 1U0HC 1XCGB 4EAQA 4CEJB 1EWQA 1D2MA 2VTKA 2Q6TA 3EZFA 2PZEA 3C5HA 4OHZA 3I5XA 4LJ7A 2QI9C 4ACBA 2J41A 3SOPA 3MJHA 3ND8A 4PSVA 2EFCB 3VMFA 4AYWA 5HE8A 3DL0A 4Z8YA 4GOKA 1SVMA 4KLNA 1XMSA 1JEDA 3DEFA 2F9LA 1KY2A 3HU3A 5FOVA 4YXWA 3CUEF 1MO6A 1T6NA 3PEVA 4I4LA 4PHGA 3B1WA 4JBYA 4FIDA 3GLHB 1JNYA 4MA4A 2HT6A 3VQTA 1TU3A 3WP1B 1E9RA 2ZIAA 2GCPA 4FCWA 3CPEA 2JCSA 3R7WB 1TX4B 1XTRA 1GIAA 3THXB 3VR2A 3AVTA 2QAJA 3IDQA 2QPAA 2DFKB 2ZR7A 4Q21A 1BMFD 2JAQA 3LW8A 2CJWB 4URUR 5EXXA 5E7JA 4ZDKA 4Q02A 1US8B 1Q44A 3LXXA 4LWZA 3SEAA 3WRXC 3QG1A 1E94E 2WJYA 3QKRA 4JLDA 4LV8B 1UF9A 2YWEA 3QI2A 3MWJA 5J4LA 1G4UR 1M74A 1K5GA 3DPUA 3VU9A 1M7HA 4LHXA 3RYTC 1UEJA 1BH2A 4XSHA 5AJXA 4KLZA 4QC2A 4QNRA 2PEYA 1N6IA 2H5EA 4NL4H 1DELA 3SYLA 3ICEA 2XITA 1XPUA 2GHIA 1E2PA 1XEXB 1JQLB 1CKEA 3GEEA 3U4QB 1KJWA 1XCPA 1ZM3A 3K0AB 4TYQA 4WVFA 3VX4A 1R8QA 1AGPA 4RSGA 4OHWA 1HYQA 2JASA 5LPNA 3REFA 3PEWA 1CR4A 3CF2A 1FNNA 1E2DA 5LB2A 3SBEA 2XXAA 3IGFA 4JS0A 2W6JA 4TMTA 4RD1A 3RWMB 3VR6A 2FSFA 2GXSA 3LXRA 4OI2A 4OK5A 2OG2A 5FR2A 1UKEA 1AQYA 3SFZA 1ZCBA 4RVCA 1U94A 1G8GA 1VIAA 1GZSA 4OQFA 1G8PA 4BECA 4GP6A 1NG9A 3GP8A 4B34A 5JCPA 3BK7A 3PV0A 4QOSA 2WJVA 3S1AB 1Z6AA 3L0SA 1E79D 2ASEA 3U61B 4RKFA 4C2UA 1OSNA 3A4NA 4TMZA 1AJEA 2B7CA 5GJCA 4M1SA 5TMPA 4ZDIA 4YMWA 4PC3A 2Y8EA 3CX8A 3T1OA 1R5NA 1S3SA 5AWFC 1RRFA 2ZRKA 3DMDA 2XZPA 3QEJA 1NVUQ 4LYHA 3GJ7A 3LFUA 3Q7QA 3LWNA 2WIBA 2JDIA 5FL7D 4US0R 2BOVA 4Q4HA 4QJ5A 3RNLA 3OIVA 4TTRA 1KDTA 5FUWA 4GL2A 4D4JA 4E09A 1N6PA 5GJVC 1VYVA 3QUSA 1N6KA 2QSYA 3CZQA 2FH5B 1TNDA 5DE3A 5C4MA 3MWLA 4DEXA 1RJ9B 4PZYA 4JYCA 1L7VC 3GLIB 3HPRA 3QBTA 2BKUA 2XNDA 4OQLA 3UXMA 2BJWA 3C16C 2ZI7A 2IHYA 4PZZA 5JCZA 3GJ3A 2ZVQX 2FPLA 2V3CC 1CTQA 4QXAA 1ZU4A 3QIAA 4CRWB 1P2TA 3CNLA 4LOAA 2P0EA 4GI7A 3K9HA 2JLUA 1KK1A 3CNOA 3NC1C 1KGDA 5SZHB 4D25A 1KJYA 3VNVA 5L3SA 3GJ4A 1WDTA 2ORIA 1CJKC 1G4AE 3H86A 2V1XA 3UIEA 3X1DA 2CLCX 1FNMA 5E7IA 2RGBA 1AZSC 4V0LA 4CIDA 2QMEA 3W34A 4CGZA 3R9WA 1ZM9A 2W6ID 3A1SA 3FVQA 4S2EA 2HXYA 4M9QA 1KNQA 4E22A 2ZYVX 1CJTC 1JR6A 1G7SA 2KBFA 3LV8A 2G83A 3DO6A 5H1YA 2ZR0A 2QE7A 1E2KA 2CCJA 3M1IA 3QPWA 1NN3A 1I2DA 3W6OA 1AGRA 2NZJA 2Z4RA 3CR7A 4EPXA 2BMJA 4LJ8A 4Q19A 3SHFA 2YC2C 1QBKC 4WZBE 4M1YA 5TDHA 1N5IA 3B85A 2B21A 5L3RA 1F2TB 3BAFA 4QKQA 1R0YA 5FR1A 1TUIA 4KSCA 4Y0VA 3EASA 3L0IB 3KXKA 1JXMA 2PCLA 2P5TB 4GP7A 1Y63A 4DXAA 2D2FA 3PVSA 4OI1A 4G5SA 4HDOB 3CNNA 4Q03A 4NZYA 1Z0JA 3VKHA 4CDGA 2QBYB 4NYJQ 2H18A 2ODWA 4PC7A 2GEVA 2O8DB 4LJAA 1J2JA 4DZZA 2IYWA 2WJIA 5C18A 4AY2A 3CO5A 1LV7A 1XMVA 1KYIA 1YZUA 1KO7A 2UKDA 4RD0A 2E87A 1T5LA 4TYPA 4FCVA 1GG2A 4LUCA 1QG4A 3AVOA 3NTUA 4LV5B 4QBFA 5KO2A 4G5QA 3RVBA 3ZVMA 2A2ZA 1W48A 1EFRA 4G5OA 1PLKA 2J59A 3FGNA 5J4VA 3T35A 1Q22A 3GJXC 4QGFA 1YJ5A 1I4TD 1X1SA 4PC1A 4Q66C 1P6XA 2WOJA 2XTZA 2YINC 2QU8A 1LS6A 1S3GA 3KFVA 2BHRA 1Q12A 4NYMQ 1KJZA 1HT2E 4LJ9A 3FFAA 4XTCS 4AYTA 3TRFA 5BN5A 5KNCA 1LF0A 3H84A 3JZMA 5EQTA 2EW1A 4Z8XA 4HAXA 3AVVA 1JPJA 4KFSA 1LFDB 4LBYA 3ADBA 2IHBA 3OIWA 4KFTA 4Y0AA 4TL6A 2JLYA 5BYKA 3QE0A 3K70D 2VP0A 4G5RA 3OEHD 1PJRA 1UM8A 1IN4A 2CVHA 3VHXA 2CLDX 1P75A 1RIFA 2F3TA 2GEDA 4IEEA 1QDEA 3ZVRA 3EG5A 2GAOA 2NOAA 5HZHA 2HCBA 1LNZA 3A1VA 1SVSA 4MRNA 4MGZR 4B47A 3PEYA 3HDTA 2V7QD 4EJSC 2GAAA 3T15A 1G17A 1PLJA 2A30A 4LPSA 1QVAA 4FMBB 4JLBA 3IUYA 4BLRA 3RANA 4Z1MD 3TVDA 4QJ3A 4TSFA 4HYYA 3U44B 2RMKA 5JSZB 1VCNA 3QEOA 4GFDA 4P4UA 3QQ5A 3K70B 5JRJA 1S96A 3GLGA 1FL9A 1NL3A 2CHGA 3CRQA 4C7OB 2IYSA 3N70A 4M1WA 2IS2A 5E7MA 2WWYA 4WAUA 4URXR 2IEYA 4MUAA 3I8SA 5F9FA 4U00A 4JT2A 2K5UA 1E2EA 4L5BA 2WMNB 1N5LA 2P5SA 1ZCAA 2Z0MA 1PUJA 5LBIA 3SR0A 1PLLA 2VPPA 1N6RA 4V0KA 1SXJE 4A6PA 4B48A 4DJTA 2W83A 4RD4A 2R62A 1YR7A 3M6AA 2KI5A 4BGDA 4W7SA 1AA9A 1H8ED 4S35A 1DAFA 3GMTA 3CF0A 1Z83A 1KTVA 3QKUA 3TNFA 4DB4A 2HT1A 4B74A 1RRPA 3U7FB 4B44A 1NBME 4IDQA 3SN6A 3W5JA 2BM0A 2FFAA 3KKPA 3FMFA 4UNPA 1W0JD 2X8AA 4V0OA 5LD2C 3AVPA 4Q9IA 1PV4A 3MLEA 2V1UA 4YDSA 4NMMA 1VYTA 4D6PA 4CW7A 5IK2A 3IO3A 2Q3HA 4JVSB 3RHFA 1KI2A 1KK3A 3RC3A 3N2IA 3DVLA 1ANKA 3BFVA 1G19A 5EZ5A 1SKYB 4WZ6A 1CP2A 2C9YA 4W9MC 4EFNA 3SFVA 1QZXA 1E9SA 2WSMA 2H92A 1G3UA 1XXHB 1E32A 1YZKA 3SE0A 4TT3D 1W36D 2KWIA 2JLQA 2ZRDA 3QF4B 5DHFA 4GZMA 3MRSA 3X2SA 3KKOA 3P20A 2WZQA 4HAYA 4RD2A 3GFPA 2OAQ1 4QL3A 1Z6YA 3AVXA 5GADl 1HA3A 2VP4A 4RZ2A 4DLYA 2GETA 2REOA 4PC2A 1A1VA 3R9IA 2C95A 121PA 2GZAA 3MWKA 4OI0A 1DARA 3SQXA 1ZINA 1G7CA 4ZPXA 4HB4A 1IXRC 2OLJA 4ARZA 4A15A 4O2LA 3BOSA 3X1YA 1MR3F 2YKGA 1E9CA 3O8RA 3AP3A 3I92A 2NPFA 4TYYA 3SQWA 3L43A 2ZVPX 2FEMA 2O0JA 2RGAA 4M22A 3TJZA 3X1WA 5AJWA 3JZAA 3WXMA 3AVQA 4MDFA 5FOWA 1I4LD 1A82A 1KI6B 3B60A 1W36B 5G3YA 5B2ZA 2O0KA 1N6HA 2YOGA 5EP2A 5ELXA 1TF7A 3M4YA 4GBMA 4ZCMA 1WA5A 1Z0KA 4OQMA 3EW9A 1EWRA 1IJEA 1N5KA 2RGDA 2J87A 2FWRA 2ZEJA 3B13B 3OAAD 1AKEA 1TL7C 5D3QA 2OCYC 2MSDB 3ZJYA 1JJ7A 3KQLA 5CDFA 4C0AC 3IPYA 4B6FA 1D9XA 4QBHA 3RDPA 4IOJA 2V4ZA 4WXRA 4B33A 1X86B 4P4SB 2CXXA 3WYAA 1TU4A 1YR9A 2FEOA 5EXTA 4NYJR 1DE0A 4LHZA 2ZI5A 2TMKA 4G01B 1W49A 3T34A 4JLAA 8OHMA 3RAPR 1M7BA 3K09A 4XWOA 2J45A 2AWNA 3CWZA 5ANRB 2ODBA 4QHTA 2J3EA 1G5TA 2QT0A 4PXAA 1H8HA 3GLHE 1NN0A 1JI0A 5DO9A 5KUTA 2DR3A 2V55B 3FE2A 4B3CA 2HF8A 1W2GA 1NVWQ 2PLFA 5FPSA 2ORWA 4XVQA 5DYIA 1NVVR 3FB4A 4D0GA 4KBFA 2QG6A 1KSJA 3QXSA 4NCHA 2PCJA 4AG6A 1V43A 1P9WA 2JJ2A 1FP7A 1OFUX 2OXRA 2OESA 4NCJA 4ZIRB 3ZIAD 1DAEA 1II9A 4XSGA 4JLKA 2EWVA 3FHOA 3VKGA 4DC9A 1Z0IA 3RS4A 1RFLA 2AD1A 2PLRA 3ZZUA 4UKDA 3T1VA 1R8SA 3BWDD 4DT1B 2H7VA 2IC5A 2ZRGA 4MYTA 5FPTA 4GDFA 4EPWA 1AS0A 1G3QA 1E9DA 2KJQA 4R7ZA 2P65A 4DRZA 1EFUA 2QSZA 1OH8A 1VHTA 5EP3A 2NMVA 3H2YA 3BFXA 3HYTA 2OLKA 1SULA 3BB4A 3ND9A 4AKHA 2C99A 5HKKD 1J7KA 3LAWA 2GTPA 4P3YA 1ETUA 3T06B 3U7GA 2DPXA 2IYZA 1ZC3A 1NLFA 2G6BA 1SQ5A 1HUQA 1YE8A 4H1VA 4JL6A 3ZDQA 1E98A 1S4QA 1VPLA 5JHHB 2XAUA 4RY2A 1VYUA 1XRJA 2VHTA 4DSUA 2A7QA 2VP5A 1GL9B 1TF5A 5FTMA 3BC1A 4QM7A 1IXSB 3RS2A 5JBQA 2XSZA 3TW8B 2J7PA 2F1JA 5FBRB 1UFQA 4A0FA 3C41J 3UG6A 3D6TB 5IRCD 1IHUA 2MMCA 2W58A 3MAAC 4LI0A 3PG5A 4B73A 3ETLA 1KOFA 4BEBA 5H70A 1BKDR 4CVNA 3PCRB 2OT3B 3BH6A 2EFGA 4QGGA 5L3QA 1GM5A 1NKTA 1EFCA 1Z3IX 3K9LA 3TR5A 3C5CA 2OCBA 1NJFA 1P9NA 2YC4C 3HR8A 2NIPA 3PITA 2KE5A 1KI1A 1XNJA 2FOLA 4I1UA 3SI7A 1HY3A 2P6UA 4JBWA 4ON9A 4POAA 4BZQA 4EFLA 3BBPA 4EJSB 1B23P 2ZITA 2X2FA 2OE2A 3TMKA 5FOUA 4BFXA 4LHWA 3ZGXA 1XPRA 3KB2A 4TL9A 1G3RA 3D8BA 1DAGA 1QHHA 1R4AA 1NRJB 1R5OA 5JI3E 2HYDA 4F4JA 3GLIE 2PX0A 1HE1C 2GWHA 2QPTA 3AKCA 1RRGA 1XBTA 2Q9AA 3K53A 4NH0A 5KPJA 3NH9A 4W5JA 2O8CB 3U3KA 1S8FA 1GL6A 2FMXA 2FG5A 4LDJA 2WWWA 3AVWA 1NI3A 2B8TA 2W2VA 5KSYA 5A0FA 2QMHA 3FTQA 4YC7A 2DYKA 5F3WB 1KI4A 2IYQA 2RGNA 4A0HA 3KJIA 4BFWA 3K9GA 2YWFA 2L0XA 2NO9A 3ADCA 1COWD 4BFTA 5FOXA 1R0XA 2GXQA 1ZUIA 2O52A 4PSKA 2F43A 5LB4A 4XWKA 3SYNA 3QENA 2CEAA 2ONJA 3RABA 3KFXA 4LSGA 4DUGA 1G41A 5L3VA 3SU8A 5GVRA 3AP1A 2CE2X 3ZYCA 3QKSA 1R6BX 1T0JB 5LD2B 3QY0A 1J99A 1MKYA 4Q18A 4CT5A 2EU8A 4U7DA 1DTSA 1DAIA 4EPYA 4XH9B 3V00A 4BFYA 2VP2A 1ZIOA 4JKIA 1TMKA 2GJ9A 5DH9A 5BWMA 5AJYA 3EARA 4AURA 1ZIPA 4OI4A 1LY1A 4ZI3A 4M21A 2JEOA 3GLFB 1Q21A 1IN7A 1VCMA 4LY6A 2B92A 2ZE7A 3KKMA 3U3RA 4DVGA 3KQHA 2FU5C 2WWIA 3LX5A 4HUQB 3KQKA 1DG3A 3KJHA 2PT7A 2BCJQ 1X8LA 4LYJA 3REGA 1LW7A 3LA6A 1KIMA 4PO9A 1MABB 3AKEA 1FX0A 4JL8A 4US2R 5UKDA 4AIIA 1FUKA 3A1TA 5J4KA 3EC2A 2GVDC 2HF9A 2C03A 3GFTA 4Q4AA 1S1MA 2E9SA 3T5DA 1T0HB 2OAP1 1CIPA 3AVYA 4M8NE 4OKSA 1ESMA 2WWGA 5J4HA 2FFQA 3MUFA 4EIWA 1SVOA 4RCYA 1OHHA 3K09C 2IWRA 2GKSA 1E96A 1HH4A 4QFMA 1VG9B 2ATVA 2OBMA 1E6CA 4M1MA 2CK3A 2LCFA 2RHDA 2EQBA 3THWA 2OCPA 3FKSD 4MKGA 2ZRJA 4B43A 1EFRD 2WPDA 1WQ1R 2FN4A 3CRVA 4TLCA 2QAGA 3V9PA 4FWTA 1ZMXA 4DLSA 1C4OA 1QHXA 3NXSA 2GJSA 1CR2A 4HAWA 4OBEA 1OFIA 2DY1A 1BIFA 3RRMA 1KK0A 1XD2B 3B8HA 2Q0HA 1PUIA 4KCGA 4V03A 3GCGA 1Z06A 4WIAA 5DN6A 1M7GA 4ESHA 5K8TA 1T4GA 1ZD8A 3KJEA 4DIDA 3KUDA 1Z07A 3VR5A 4RFSA 3FMOB 1XP8A 3EPHA 1SVIA 1X1RA 1G3IA 5K8UA 3TQFA 1N3BA 2B6HA 2J7KA 3O47A 4TLEA 4ASUA 4NTZA 2XOKA 2JLSA 1VCIA 1E0KA 1W2HA 3EXAA 1UDXA 2QTFA 4PPQA 4C4PA 4AKGA 5KDLA 2W2XA 2ZRBA 4LV6A 4JT4A 4MRVA 4YMTA 2BDTA 3OE7D 4DIEA 5JWRA 4BQSA 1P9RA 4NDZA 2O8FB 4F38A 1SXJA 3Q85A 5G53C 1X8JA 5HZKA 2Z4SA 1KMHA 4LJ4A 3RS7A 2GCOB 3EIHA 3HPQA 4BFSA 3A4LA 2AD5A 4NCIA 4OHVA 1NBMA 3IQWA 4AD8A 2IYYA 2QN6A 2WKRA 1E1RD 2ZAOA 2QNRA 2WSSA 4FINA 2BJVA 3GEIA 1FUUA 4GSYA 4OHYA 4QGHA 4Q1BA 3TE6A 3NDBB 1UAAA 3WNCA 2ZJ5A 1W4BA 1L4YA 1Q1EA 1T8TA 1OF1A 4IFBA 1IJFA 2YYZA 2ZXUA 4LK2A 3HU1A 1ODFA 4JKYA 2J0UB 4JLNA 2H57A 3TAHA 5FBWB 2VHCA 1JR3D 2IXEA 4Q1CA 5SZKB 3D3QA 4A8JA 2G0TA 2BMFA 2RGGA 2CNWA 1HTWA 4DCVA 2PL3A 1W0KD 1KI3A 3ASZA 2CDNA 4LJYA 1QG2A 1CULC 2OEPA 4R2HA 4LC1A 1FTNA 3G5UA 3PXGA 4Q1DA 2IXFA 1IN6A 4FD2A 3MCAA 2ODNA 1NMXA 3CWQA 1Q20A 2UZ3A 4HZUB 1ZU5A 1PZNA 3GLGB 4N0EA 2OSBA 2VHUA 4CEIB 2GJKA 4EKDA 1ZUNB 4IDHA 4DLVA 1YRBA 4HB0A 2WJJA 3KTAA 5HE9A 4Q1FA 3B9QA 3I72A 1Z2AA 2R6AA 2KSQA 1SKYE 1JBKA 2O8EB 1RRCA 2RGNC 1NY6A 4TN1A 5DGXA 4L8GA 4XD7A 2BEJA 5CK4A 1XXHE 2OFOA 3A37A 3QF7A 4PZLA 3SDZA 1ZNZA 1G18A 1HURA 3U6BA 4HB3A 3KQNA 1II8B 4PC6A 4A1FA 4PHHA 2HLDD 3HR7A 4CEJA 3THYB 4HLDA 4A9AA 3K9NA 1CR0A 2EFEB 3NC0C 4EFMA 4MRRA 3WP0A 1N6OA 1XTKA 4TMKA 1E2LA 1G8YA 1Z6TA 2R2AA 2PJZA 2G3YA 2YOFA 5H68A 4C0LA 3UMRA 5C4GB 4QBIA 2FGKA 2NO6A 4A2PA 4BFUA 2ZRNA 5FUXA 4TL7A 2J0VA 1UBCA 4JLVA 5JEDA 4GNKA 4Q1AA 3CLVA 3IKJA 3BXZA 1OKKD 2FFBA 3PUYA 1JXOA 2FX3A 3UPUA 4OHXA 1XPOA 3WMFA 4PSAA 3GLHA 4NU0A 1KAOA 2IYXA 421PA 3K0SA 2PZFA 2XJ4A 4W5HA 4JLPA 4LBZA 3KJGA 1W5TA 2OCAA 5C1BA 1G3MA 2RH5A 2ZR9A 4JSYA 3R7WA 4JL5A 3TSWA 4LBWA 3THXA 4CT4B 2CHQA 1XZPA 3IQXA 1G8FA 2EFHB 2GF9A 3QVUA 2UVQA 1NMYA 2ZJZA 3K0FB 2PZGA 1C9KA 2CJWA 4AG5A 4BEJA 4BRUA 3FFBA 3UKDA 3PJRA 5G41A 1US8A 2ZSFA 2QP3A 2P3SA 4KVAA 1L4UA 3L82B 3AF0A 4NCKA 2O8BB 4JLMA 4US1R 4DLRA 1PVOA 2FPMA 4A92A 4G0NA 4U5XA 1DS6A 3QBVA 2GZDA 1XEXA 4NONA 3A4MA 3CKLA 3W90A 3TGPA 4JLOA 3U4QA 4KYUA 2HCJB 3K0AA 4M1KA 4LX0A 3MGCA 3RRZA 1Z2CA 1NJGA 5F2EA 2WJHA 2QAGC 1CJMA 5JEEA 2F1RA 4MKFA 5FI0B 2C9CA 1Q1ZA 2HV8A 2W2TA 5HCNA 1CXZA 2QUZA 3DKPA 5E3HA 1OPXA 4B3GA 1K6MA 5K8LA 2ZJBA 1BMFA 2VYFA 1HE8B 1MRSA 1QVRA 4FMDB 3QKTA 1JAIA 5B64A 2ZSEA 4BLQA 5CK5A 4TTQA 3X1XA 1D9ZA 4FMDF 2OFXA 4MITA 2C5LA 4CEHB 2OHFA 3EAQA 1OT3A 2RHMA 1G5PA 3W3ZB 2QRZA 3S1AA 1BO6A 1RKBA 3ZQ6A 1ZUHA 5CDFE 4LJ6A 4BFVA 3B9PA 4Q9HA 1G1MA 4HAVA 1U9IA 4KV9A 2CL0X 2NGRA 4QG7A 3LQQA 4F92B 3QXCA 1A7JA 1N5JA 1M6NA 1KKMA 2A5YB 5DNYB 5JJIA 1G8HA 1Z0AA 4I81A 2WKPA 3RC8A 4EQ6B 1Q57A 5EE3A 5DI3B 4HEJA 2F55A 4AKIA 2G77B 3DOFA 4G5GA 1CEEA 2OBLA 1OLOA 4HSEA 5BXQC 1CBUA 4GZLA 4NBSA 2W0SA 1GRRA 4DCUA 1P2UA 4KO8A 1SXJC 2YVUA 4F4CA 3OIYA 4DLZA 1E9FA 4NHOA 4ZCLA 3WYGA 4W5WA 1D5CA 1P72A 2DFLA 4E03A 4JMPA 1R5BA 4EDHA 4UJ5A 3IBGA 4RCZA 1LTQA 1E79A 1VKJA 1DOAA 1YZGA 2PMDA 4M1OA 1OH6A 2JJ1A 1YZNA 3NHBA 3LY5A 4Q9KA 3UMFA 2ERYA 5KSZA 1W47A 3CONA 3LBIA 4I99A 3GLIA 2XGJA 2C98A 3EZ6A 3UANA 2FA9A 3Q7PA 3AP2A 4FWIB 4JZKA 4RZUA 3CBQA 2JIZD 2QGNA 5FOSA 1J8YF 2WIAA 1KNXA 2FSHA 3N2EA 1YQTA 3DM9B 2NO1A 4P31A 4A8JC 1D8TA 5FBLB 1K5DA 5FL7A 1XX6A 3NDPA 1J90A 3OEED 2NPIA 2FE4A 3ZS9A 3ZLJA 2ZRPA 2XTNA 4LGMA 5G3ZA 4C0QC 1U8AA 3ZD6A 1AIPA 2Q3FA 4G3XA 4UXJA 5JFGA 3QPVA 3CRW1 1YZTA 2KBEA 1GILA 1ZD9A 2ZRIA 3NIBA 1OH5A 1A2BA 2SHKA 3QPUA 2X1VA 1E2NA 2P6NA 4YMSA 4I1SA 4KAXA 1AM4D 2C8VA 3JVVA 3PUXA 2JLXA 2XZLA 3K8YA 1UKZA 1N0VC 2NO7A 2IBMA 3C7KA 2JA1A 1E1QD 1SVLA 1VCOA 1EG7A 1XU4A 3E70C 3LVQE 3QXJA 4Q00A 4H9GA 2PT5A 2A9KA 4Q5IA 1VG1A 1F2UB 1W4AA 3VR1A 5DIFA 3AM1A 4AYXA 2ODEA 4BASA 3MSXA 4KXFB 1UBGA 1ZRHA 2B8WA 2ZSBA 4HAUA 5FOTA 4A4DA 3AGQA 3RS0A 4WOPA 1M2OB 4HI0E 3VHLB 4LPKA 4YLGA 3FHTA 4JBXA 2W6IA 2RAPA 2VEDA 2AKYA 3A8TA 1M8PA 3JVUA 5DSZA 1KMQA 3WMEA 4Q9LA 4X8MA 2O8DA 2DBYA 2P2LA 1G5RA 2DFTA 1E4VA 2ZYWX 1M1YE 3MJRA 2LKCA 2J0QA 5CLQA 1GKYA 1VIYA 4IOKA 1BYIA 4QBGB 3I8XA 4LYFA 1WRBA 2CLSA 5J40A 5KU1A 2DHRA 2N46A 5L8VA 1JALA 1MT0A 3MG9A 4DWJA 1XWIA 2WAYA 4NPHA 3D31A 2VF8A 1FMLA 5JWOA 3GLFE 2OO7A 3LVRE 1UJ2A 5EE9A 2IW3A 2IK8A 4ZKEA 1GTVA 2CL7X 1IBRA 1LVGA 5FUYA 5KTYA 2GF0A 2EYQA 4D26A 1GVNB 4PX9A 4D80A 2JLVA 5SZIA 2NO0A 3RSOA 3FKQA 4C0BA 3QKSB 1GDDA 1QHGA 2Z43A 1DO0A 4PHFA 4YXWD 5JI2E 1DADA 4IXNA 1KO8A 2OBNA 2VP6A 3SYKA 2PEZA 3Q5EA 2IL1A 3GD7A 2CBZA 1W7AA 3UMSA 4P4TA 1KSFX 4XTRA 1BYUA 2WOOA 1E4YA 1KHTA 2V9PA 4AWXA 1F60A 1XEWX 2VA8A 1ZP6A 4OL0A 5FPHA 4P33A 4C0HA 3CRMA 3Q8XB 5C46F 1X8KA 3BH0A 4KFRA 2FFHA 4YMUA 1Z63A 4WA7A 1IONA 1JQJC 3P1JA 4K81B 4ZCIA 1KI9A 1SVWA 1BOFA 1QHIA 2FF7A 2V6JA 2IUSA 2GDJA 2IYTA 3VR3A 4XJXA 2ZPTX 4DCSA 1T8UA 5DHAA 4A82A 4RFVA 1KDPA 1RYFA 1TAGA 2OZEA 1Z6XA 1VG0B 5BN4A 2IYVA 1E2JA 2C96A 5KSOA 5TV2A 1YZQA 4QJ4A 5JWHA 1E3MA 2ZUCA 3M0EA 1RPZA 3ZH9B 4URVR 4NYMR 3IHWA 2GEUA 2QT1A 2VQSA 2ZI4A 1U9IC 2XZOA 4MRSA 2IWHA 5SZJA 2W6JD 3U44A 1EESA 4II7A 4GMXA 5JSZA 4KVGA 1IQPA 3WNBA 3CM0A 1XJ0A 2N1BA 4HAZA 3F5FA 3IIJA 3OEHA 2AK2A 1W4CA 1E9AA 5HCIA 3TIFA 3THOA 3VKWA 1DBSA 4D82A 5B30A 4C7OA 1XD8A 2AK3A 5FTJA 3QKRB 4KI0A 5BYJA 1P62B 1U98A 1NLYA 3QXHA 3NWJA 3W5IA 4KFUA 4PPNA 2BV3A 3VU9B 2YHSA 2BBOA 5FUVA 4URZR 1YKSA 3RWOA 2D7DA 3W3AA 4HLUA 4URWR 3B2EA 4ZO4A 3WHLA 4DLTA 3GJ0A 4RJLA 3HP1A 1U2RA 1KDRA 2Q3MA 2V7QA 1VTKA 5LDDC 3L8YA 5TY0A 1WCV1 4R71A 3WMGA 4GPTA 1AS3A 4ZV4A 1ZM2A 3QXXA 1KSGA 1RYHA 4TZ6A 4Z1MA 2XXAB 1IY1A 3T1TA 4LYAA 1WBDA 5P21A 3CZPA 2VLIA 2WKQA 4LRWA 3W8NA 4BZXA 1YRAA 2JDID 1OJLA 2VP9A 3B1YA 3BGWA 5JJLA 2F6RA 3NEYA 3A6PC 2EVWX 1G21E 2X2EA 4J0QA 1WBBA 4OQXA 4B2IA 4QNMA 4DHEA 1S2MA 3GJ6A 4LCBA 1NN5A 4Q4LA 5K8IA 2AWOA 1EGAA 3UATA 1XDBA 4UNNA 4NP6A 2BKEA 2OFWA 1XXHA 2BM1A 3TUZC 2JGNA 2ZUDA 4UNQA 3ZD7A 4Q7MB 2ZS9A 1GITA 1KO5A 3NVAA 1AK2A 2XNDD 4TMWA 3QF4A 1H65A 5E95A 2A5FA 1TPZA 2QM7A 1SHKA 2NTYC 2QP4A 3UG7A 4EPTA 5AK0A 1TUEA 2I1VB 3WNDA 2QM8A 3GJ5A 2YZ2A 4BPBA 3HYRA 3EIQA 1IM2A 1P61B 4UJ3A 1W0JA 4CYMA 1EX7A 3BIFA 2PBRA 3GLGE 4Q4HB 2Q9BA 3I61A 4FMCB 2OUKA 4KBGA 3IPXA 3LQRA 1W44A 2VBCA 4FMCF 5EJEA 4GT1A 1GP2A 1UKVY 4A8JB 5CLLA 1TEXA 1E0JA 4KYIB 2BBSA 1GRQA 2D06A 4TLBA 4A36A 4C0KA 3O8BA 1JR3E 5A4JA 1ZD1A 3BD9A 4M4SA 1E9EA 4L16A 1KI6A 4R98A 1NIJA 4TQUS 3UWKA 4TT3A 1DAKA 1Q0UA 3DM5A 3Q3JB 3T12A 4IVRA 1CRPA 3CPJB 4IVPA 2HEIA 4C30A 1GSIA 4MQBA 3TVTA 4RZ3A 1MV5A 2QE7D 3L2OB 5FTLA 4TQAA 1AZTA 4D0NA 1E69A 3O8DA 2C04A 2ZRCA 3T1QA 2UZIR 1UEIA 3Q9LA 2WICA 3H1TA 1EXMA 2BCGY 2REBA 2YV5A 3LO5A 5L3SB 4DLUA 3ZQJA 4TYWA 4Q48A 3LBHA 4P4SA 2V8OA 3EWAA 2IX3A 3TR0A 1XCMA 3OHMA 2ZRLA 1NIPA 4KHZA 1XMJA 3I1FA 3TW4A 5IF9A 1N0UA 3FPAA 3K1JA 3SZRA 3EZ7A 2WBLC 3TK1A 5AUQA 1FFHA 2VSFA 4L9SA 3LRPA 1E2GA 4B35A 3F8TA 2FPKA 1TQ4A 2H8KA 2B7BA 4EPVA 3R8CA 4B3XA 1KKLA 3PUZA 4ERNA 2QORA 2EWWA 2ZSAA 2ATXA 2ZJ8A 3IEVA 3IHLA 1NSFA 4MKHA 5KNDA 2QTHA 3LW7A 3C4JA 4Q4JA 1Z29A 1G9XA 4PAQA 3C8UA 2WMOB 4M9SA 2R44A 3OAAA 4QGAA 2ZREA 4XVRA 3RRYA 4D4KA 3PFIA 4NYIQ 2CCKA 3VR4A 1T9HA 2CVFA 1EX6A 2D3WA 4LHYA 4TMXA 3G82C 3U7HB 4ZIRA 3ZZ0A 1Z0FA 5GJBA 1G20E 1ZW6A 1Z6GA 2AFIE 3MWYW 1N2CE 2BEKA 2VHQA 4B6EA 2IYRA 2F9MA 1I4DD 4DT1A 2CCGA 1JB1A 1V5WA 3NHAA 3SJAA 5FFMA 1RZ3A 1U8ZA 2GZHA 4GRAA 4IOMA 3U2QA 4CF7A 1MRNA 4OYHA 2W00A 3AEZA 1Z0DA 2QQ0A 3AKYA 3KB1A 3E1SA 2G1KA 2WWXA 1K8RA 3C14C 1HV8A 1ZNXA 1IAQA 2I1QA 2YNMA 4UNRA 1YHNA 1LS1A 2IXGA 5TXGA 5KOYA 4AK9A 2WVJA 1OXUA 2GA8A 2GCNA 1L8QA 4YDHB 2IUUA 3OZXA 5EE5B 2ZROA 3SHWA 2E1RA 1E2FA 1UKYA 4DDWA 5AR1A 4MYUA 721PA 3ZIAA 3PR1A 4UXHA 1GL7A 4V0NA 1G6OA 1M34E 2HYIC 3EPLA 4PQYA 1TQ6A 1IY2A 4OK6A 3LH5A 1A5TA 2R9VA 2IT1A 3A1WA 2FSGA 3TBKA 4DSOA 1FPMA 3RRNA 1D2NA 4JVLA 3K70C 4D4LA 2J9RA 5CB6A 4B2PA 4OJKA 5BN3A 2F3RA 5HR5A 4GOXA 4TZ0A 1SVKA 4PHTA 1WXQA 4LHVA
chains in the Genus database with same CATH superfamily
2RHTA 1RP1A 3Q1KA 1JR6A 2E82A 1O97C 2MSEB 2QTVB 2WYIA 4G1UC 1OXKB 1T9AA 5BN5B 4W7IA 1YUNA 4ND8A 4H35A 5BOSA 1JIKA 1P8JA 3H0CA 4HBGA 3AFMA 3DZ8A 3Q12A 3OHPA 4YAFA 2R6DA 1AVTA 3WWCA 1EFTA 1X7ZB 3MTIA 1JR2A 2ZZKA 1H6CA 1A4IA 2A5GA 3B1ZA 1FQKA 4M53A 4BVAA 3ZWWA 2D4AA 1KJIA 3K0BA 3ICQB 2VK4A 3ADKA 4Y9TA 1UPXA 4OGGA 3TKLA 1J4AA 1Y7LA 2GXAA 1IJKA 3L01A 1C8KA 2VUUA 3DVAB 1SRRA 1UDCA 4MQ6A 1YB5A 4ZEOA 3P9RA 4HUTA 4RNDB 2C92A 2VZ9A 2CXOA 4CQMA 3F5SA 4F3TA 3BBLA 1SHZA 1ZN7A 3WRYC 1HDRA 1SHTX 4U7HA 3SJBA 3TOVA 4E3WA 1QH0A 1HE2A 3AIMA 4FBLA 5EVCA 1H2ZA 1VHLA 1PQWA 2ZWAA 1AUOA 3WSVA 2GT1A 3C1TA 4QSMA 3AX6A 4QPNA 4U7FA 4Y67A 3O1JC 5JSFA 1O95A 3JQ7B 3OUZA 1FZQA 1BVYF 3DDOA 3LQFA 2F2TA 4MWDA 2QPLA 3KLMX 1H2WA 5DWDA 3DBRB 2JI7A 4KWCA 4PVCA 4ZYWA 2DPMA 3BSSA 3R5KA 4I7EA 1P0FA 4Y2SA 2E4WA 2PAAA 3H9UA 4F0JA 1C7FA 2P79A 1PK7A 2QP9X 4UEWA 3CLSD 2IZ0A 3MCUA 4DREA 2BFDA 5IC4A 4Q7LA 4X24A 1TKRA 4QEKA 2HB6A 3M34A 4RM2A 3ET4A 2AX4A 1XEWY 4TL8A 5KCZA 5KQSA 4FXPA 5CVDA 1XL1A 3UT5A 2XX3A 1HDEA 2XVXA 1VBFA 1KC3A 2CFRA 4Q01A 1SQ6A 4J29A 3ZH2A 3UK2A 4ZVQA 3GGGA 3GJ8A 2JLRA 2VRWA 4U63A 1OB5A 2JAUA 5I7RA 1LF5A 3IRUA 3KX2A 1WP9A 5AI9A 4BQFA 4E4TA 5JD5A 2JBAA 5EP4A 2ZE5A 3EG9B 3Q7SA 1SC6A 2XE4A 3G23A 4W5NA 1X94A 4QHSA 5AUPB 4I1PA 4JVMA 5BYAA 4HNSA 4JLJA 2WYUA 5EP1A 3N5CA 2KB0A 1V8DA 3CT6A 4ADSG 1XEFA 2B30A 3L04A 5C3MA 3EHEA 1Z7WA 3H5AA 4Y6PA 2V6IA 2R11A 1JAYA 4V38A 1NG1A 3SIRA 1S6YA 3BH7A 3OFVA 3NBFA 3DUWA 2ZJFA 1EUZA 4BBJA 4RW0A 4BNHA 2R5FA 3VPBA 3PEUA 5GINE 4L9WA 4DDUA 4DB2A 4XQGA 5KWJA 3TIGA 4ZZ2A 1CRLA 4D3SA 2UUOA 5ALIA 1JQ3A 1MABA 4UCXA 5DBFA 2YASA 3NHLA 4QOHA 3RFXA 1BJTA 1QVZA 2Z83A 5KB3A 2Z5FA 5DHTA 1VG8A 4OXQA 3RBXA 2VBFA 3GJQA 4DM3A 2ZJAA 3IHTA 3KR9A 5DULA 5IBPA 2NUAB 5IXYA 2WMDA 1ORWA 3M6IA 4GMKA 1VBMA 1EWYA 2XTJA 3UQYS 3MAGA 1LFAA 1JF8A 4AMGA 1Z88A 4A3SA 2OK8A 1G55A 3A3NA 2IXAA 3BFKA 1TTQB 3A0RB 4INAA 4TLAA 1TE2A 4X1YA 3W7BA 2H65A 1QH8B 3KT8A 1LVHA 2HUNA 1W76A 1UJMA 1SA0A 1UBTS 3CO0S 4X71A 3QYPA 1S3FA 2SKDA 3JQGB 2A33A 4BGUA 3P0IA 1MHPA 5AYVA 1NU8A 1JPNA 3HMKA 1Y8ZA 1XDWA 1UK9A 4DYDA 5CITA 3OMWA 2W37A 5EC8A 4GM4A 1A2KC 1YB4A 4OQYA 5AW9A 5CUQA 3S5UA 1RE0A 3DHYA 4ZARA 5BR8B 4C2AA 2WHXA 4PTLA 4EHAA 3QX3A 1CYEA 3QMMA 3B38A 1QB7A 3LRTA 4MS4A 2DKNA 1OU4A 3LWDA 2OCXA 5IFLA 3Q10A 1L5ZA 4KSBA 4EHDA 1W8DA 4FR2A 4MYHA 3F3KA 4UM7A 4UBIA 2VO1A 3NBXX 3ROGA 4ERXA 3ITDA 3T0FA 2BAGA 2Q6IA 3AEXA 4HEA6 1KF0A 4OQNA 4X8OA 1OTHA 4KU4A 3ZHVA 2EFYA 2VSOA 4GI2A 1GRNA 2RK6A 1QGAA 3G7UA 1GJRA 4DBVO 1QC5A 1QTIA 3FZYA 1E2IA 5B58C 2BN4A 2WSIA 4F93B 5BSKA 3RI3A 5FHRA 3E22A 4ZFNA 4B0PA 3HY4A 3EBOA 1AQ6A 4QGBA 5KQGA 3URKA 4KBYA 2A86A 5FB3A 1C7ZA 1QJCA 4RMGA 3P32A 1DAPA 3JQ9A 1IPFA 2A14A 4JZYA 4JP1A 1A2OA 1IN8A 1ORVA 1LQUA 3MBIA 1U8YA 1EFKA 1SIWA 1FVHA 3PPYA 3LOUA 4E6PA 3V46A 1FYDA 3U6KA 3BICA 1ZVVA 4ZYXA 3C6QA 4S04A 4ZT7A 5TS2A 4BX9A 1CZOA 2ACEA 2AOWA 4R05A 2B9VA 3PCTA 2Z8YM 3PIDA 5JVDF 4XQ9A 3AGPA 2X9NA 4LX8A 4MGHA 1L4MA 1ECCA 1OXSC 2BVNA 2GRJA 4Z9YA 1IXYA 2P78A 1YR6A 4LMBA 3PC3A 5HF6A 2Q5OA 2BBWA 3SFTA 1ICIA 2PMCA 5FTWA 4AJLA 5D85A 3SNKA 5EWMB 4WSOA 2PQMA 2EP7A 3QG5A 2VT2A 3WGMA 1FFAA 3IMEA 3JWJA 1SCUB 1KFBB 4DLWA 4EVRA 2AQ8A 4K6OA 4CF3A 1ZBDA 3QTTA 4RGQA 5ES3A 2HRBA 2IXTA 4M2LA 1JT9A 2ZE6A 3WGKA 2H1LA 1C7RA 2M32A 4O25A 5EXPA 4RF3A 4RKYA 521PA 5AFSA 2HM7A 1Z8FA 4BP9A 3HYLA 3OE7A 2JIPA 3RS3A 3QJ5A 3KE9A 1S01A 3TKYA 1TZBA 2D4HA 2GN0A 2G5TA 5DK6A 3SX0A 1GY8A 4DLXA 3CWCA 4BQEA 1E5LA 1SUPA 1MB3A 5JLJA 3NAMA 5KDDA 3UHOA 4C89A 3D8SA 3W77A 4IH1A 3EEOA 2D7JA 5HTKA 4ZEWA 3TM4A 3QLEA 2X58A 4EVIA 3KPYA 5B53A 3E5HA 2UUCB 2OD7A 3DEJA 4NY1A 4CG3A 4ZGWA 1RJEA 4K8OA 4OHFA 4E2YA 4GR5A 2QXYA 3CW2A 4KC0A 1M8JA 2GK6A 1E1RA 4D6YA 3J7AC 2IEZA 2JBWA 2PRIA 2G88A 3FBTA 4DM7A 5L51A 1X3LA 3VC1A 4ZHQF 1WUHS 3PUVA 1YVRA 4ECAA 1CVIA 3AF4A 3OESA 5E2IA 3RRFA 1BS1A 3ZWVA 4OGFA 2WWHA 1O4VA 5H4GA 1GTZA 3NP9A 3A31A 2X3FA 4RK4A 4EUNA 2NXNA 1YQQA 2C77A 1Q3HA 3CIOA 2GX6A 4WLOA 5HS6A 1V16A 2EDCA 2X3UA 2C2XA 1O95C 4I8DA 3UMGA 3S7ZA 4MR9B 3QVVA 3RQIA 4KMMA 1RAIA 1RVDA 1QHNA 5CM9C 1W4RA 2WY2D 2Q45A 4X60A 4XOUA 1FTYA 5BSRA 1T1EA 3WGHA 3LOPA 1AOXA 4OJQA 3AM4A 4DDMA 5FH9A 5I45A 3BORA 3E9QA 1MN6A 1IEVA 2QY9A 3ASYA 4EUSA 3CH5A 3G3EA 1YJXA 1AX9A 3GZ4A 1R7RA 3H0KA 4FJ1A 1W59A 3FJOA 1G7RA 5KSPA 1CB0A 5HFJA 2YOHA 2VHJA 3DV2A 4YPOA 5IXJA 3IUPA 4D79A 4Y2HA 1CF4A 1FU7A 2EYUA 3ZCVA 1NNLA 1MT3A 3CX6A 4B3BA 1QK5A 1V1MB 2P67A 1IY0A 1KEVA 5E9QA 4K87A 2VDNB 4YJFB 2FEPA 2ZRFA 5DLQC 3W2TA 2HWUA 5CHYA 5J5CA 1SBNE 1KAGA 1ENOA 1QRAA 2WILA 4HB2A 4LOLA 4G0WA 1F2TA 1GCAA 5KSWB 4L74A 3B1XA 5A2GA 3FPJA 4QAJA 3ZCUA 4H7FA 4ABTA 3L7OA 1STOA 4CM4A 3GRUA 2I3BA 3USZA 1RC1A 1LK7A 2OCKA 1IMJA 1Y8QB 2HMVA 3WLFA 4BNTA 5BW8A 3EIEA 3QPDA 4DUGD 2C0CA 1P2BA 1M1NA 2H07A 4N76A 2R6HA 4B71A 5JPIA 2LGJA 1NI4B 4X8LA 5JS7A 1F6BA 1MP0A 3IIIA 3WBJA 4BQRA 3LTNC 3T3OA 2H17A 3K31A 3R3JA 1GKKA 3KBOA 3BA6A 2P9EA 3G0IA 2GO1A 3D3NA 1YDMA 3LPAA 4MGKR 4B87A 6Q21A 4A23A 1FY2A 2PZJA 1MX1A 2CXUA 4ER7A 1R5JA 4D7AA 1TUGA 3G0HA 2M98A 2VPYA 2IUTA 4U9IS 4WZBB 4ZKDA 4K9RA 3COPA 1RZRA 3H04A 4GYKA 4CLDA 2PK3A 3AF1A 3CRZA 1T35A 4NVRA 1B8VA 2G63A 3FNBA 5HDQA 5LA6F 3RT1A 4DIKA 3EGIA 1IBKB 4KFCA 2XF2A 2HBRA 4X7BA 2ODTX 1DO8A 1ZDMA 2HXGA 2LKDA 4ABYA 4BO1A 2CNBA 1N2CA 1UKBA 4DE5A 1F8YA 1OKKA 4A26A 1MX9A 1UADA 1EBBA 3DE7X 3PS9A 3EC1A 5D84A 4RVFA 1NUQA 2FPUA 2GM5A 1VMAA 2VPXA 4XWAA 2A67A 4IXDA 1YZYA 1M1ZA 2B0CA 2XUGA 3WGVA 4DV7B 1T2EA 4DMMA 3VC2A 4IXMA 4JXXA 2OQVA 3GFSA 2RH9B 4MZXA 5AUNB 3A2MA 4UW9A 3HEBA 4E15A 1IN5A 1CR1A 3OD1A 5KKNB 1Q5PA 2YWHA 1XTZA 4JOCA 4NS1A 5I4KA 5K3FA 1EWKA 4JI4B 4B7ZA 4FI3C 4LF7B 2HPHA 1ZJWA 1OHHD 1WDLA 2DWPA 4XLLA 2NU7A 2HXSA 1GNTA 2VDQB 3GEHA 5KNDH 3C0KA 1JG6A 4X61A 4W5RA 3I5YA 2OB1A 2NYRA 1N2XA 3EN0A 3EQ6A 1X6VA 4YJ2F 3VSAA 4EG6A 4ZI2A 2HSGA 3PQ8A 3FNHA 4R2WA 3HB1A 3H9GA 2CK3D 2YJTD 3S6JA 4DLPA 2W90A 2C78A 3HBLA 3MB5A 3RUIA 2JI9A 3HXTA 2DG2A 4YUWA 1K0UA 4L15A 1M34A 4NBNA 4TVKA 4C2TA 4UM5A 5GONF 4X9XA 3DMHA 1SHLA 2BMDA 4L5IA 4GGPA 3VZBA 1J1IA 1ITZA 1NC3A 4OIMA 3KU1A 2WG2A 1GWNA 1FX0B 3K5IA 4MULA 1U0JA 1GT91 1O87A 3TRJA 1GGHA 4B76A 2FW7A 5DHQA 2AG0A 4KYTA 1IMOA 2A78A 3HSYA 3SR3A 3E9CA 1YVPA 2VWQA 5EINA 5DN6D 3AHIA 3JQ9C 1KQFA 3UJ8A 2WA2A 4I4TB 2VI5A 3TTXA 1SQFA 5FP0A 4QTUB 2R0QC 4DIOA 2II6A 5CJ2A 2WPNA 4YV2A 2GILA 2Q4RA 3HEMA 3CH6A 1CUGA 5DNWA 5HIAA 3IBYA 3HBMA 4YRPA 4L02A 3B51X 2Q8QA 2NUTA 4PZDA 3JQDA 4IIVA 3AM3A 1CUJA 3P9KA 3M9XA 1MO4A 3A3YA 4F9TA 1DRUA 4FCCA 3EODA 1DEXA 3VTKA 3UCXA 4IFEA 2A9JA 4D56A 4P22A 1AKWA 1DEKA 1G16A 1NVTA 4K05A 5HS4A 5FTKA 3EQ7A 3UC5A 2QAGB 1I2MA 2GYUA 3F3YA 1U3CA 2Z1NA 4FR0A 4MVJM 4PYKA 2XB8A 3AUYA 3OQBA 4I08A 1DFHA 3R76A 1Z47A 4U39A 1LWOA 5C0OE 1HT1E 1OW3B 4WLNA 5EHIA 1NWHA 3HJNA 4LOKA 4X85A 5KWSA 1MPTA 2ZUBA 5DT9A 3JQCA 4HNRA 3HHPA 2EX0A 3MFYA 2YCBA 2QTGA 1ZH0A 3DOEA 1XFDA 2JLZA 1P2SA 2CMKA 1H3FA 1FSPA 3I73A 1NBMD 3IPRA 5FI1B 4AM8A 4G2TA 1CS4C 4HNUA 3COJA 2Q62A 1IHYA 1TLFA 1X13A 2Z5GA 4DSAA 1L1RA 1XRSB 3QFSA 4P3PA 2CV0A 4UPVA 1U90A 5CB0A 5ICEA 4KWTA 3GNTA 2WAXA 2PGLA 2ZBDA 3FYHA 5CR9A 4Z4CA 2P9CA 3L9XA 2XADA 5IT5A 5F98A 2X0NA 1WVGA 4JEMA 1GPJA 2CFCA 2R1VB 3BB3A 3BGVA 1FTSA 3GYGA 4N03A 3RK1A 4BBAA 4HLQB 3HM9A 2VTBA 4W9RA 1JN0A 3WGJA 4UQOA 4K1LA 4EHNA 1R0RE 3TQQA 5AQEA 1M6EX 3IAUA 3EZ2A 4GLOA 4WBSA 1T3LA 1JMYA 2IV3A 4AY5A 1VIDA 2GPWA 5FOQA 3RVOA 2C3YA 3U60B 2NX2A 4UXIA 3UZUA 1C3OA 4CCYB 3OX1A 2ATIA 3NS7A 1C9DB 4IWNA 1TZJA 1KI8A 1OX5A 4J0JA 1BX0A 4QODA 1JHVA 2D1SA 2NQ2C 1EFAA 2F7SA 3WHIA 1F2UA 4N0QA 2IPNA 2NSHA 2JHCA 2QF7A 2XNCA 2ZI3A 3LPNA 5B36A 1O94D 4E4YA 5LYJB 4G0VA 4ZJUA 4PF1A 2RB4A 1I33A 3FMIA 3EVZA 4QO7A 4IF4A 5CTJA 3KRTA 1SVNA 2OYSA 3ENWA 4LJ5A 1IXZA 2N42A 5F12A 1FFYA 5C35A 1RLUA 2KLBA 3BN3A 4RX1A 3NPAA 4R1SA 3BWYA 4BP3A 4DCTA 5ALFA 3R9KA 7ABPA 4XE5A 5H9WA 5KTRA 2IHUA 1P5ZB 4LF9B 2ZP1A 5DHUA 1NUTA 3D4LA 4AZ3B 1K7YA 4XCVA 1P60A 1RJDA 1ZMTA 4L51A 1ZYUA 1UAGA 5LU8A 4PNPA 3W4KA 3E61A 4OATA 3K1AA 3KDPA 1P33A 1N2HA 2AUMA 3IR7A 3VZSA 5FWYB 1IY9A 2ZU0C 3CUWA 4X6UA 4XD7D 3RODA 3IIMA 4BKOA 2E4XA 4CL3A 1UPTA 3B3QA 4N1AA 5ECYA 4BUJA 5IHPA 2XUFA 4IFTA 4V0MA 3KSRA 1Y5IA 1MZVA 2FUCA 2H0QA 2HY7A 2JH3A 4IR7A 1MXFA 1Z56C 2J6IA 4A73A 5A5GA 5JYEA 2ZUFA 1X15A 2YHIA 1WXWA 4XARA 5CT9A 3O31A 2JCGA 1AKVA 4MJXA 4Z2YA 3NMUF 2W0MA 1N5DA 3KTOA 4L08A 3G17A 2F90A 4BEWA 3I9FA 1L5SA 3AH8A 3TIIA 3GQBA 2D62A 3H5LA 4HZIA 5TEWA 5CXQA 1KMIY 2B3TA 3ZOKA 3QK7A 2I5PO 3EA5A 3FFXA 3B1FA 1YWGO 3AESB 3GRVA 1CNEA 1BHSA 4YRRA 2FQXA 4N40A 4OK3A 1N2JA 5FULA 2DLCX 2BC9A 1GPKA 1KQNA 1T3HA 5EYPA 4BB9A 2HDNB 1QQ6A 4EHBA 1YRYE 3KS9A 4U2GA 1II0A 3B48A 2PXCA 4U8GA 5D6NA 3WYFA 2G0AA 1N0WA 3OUTA 1NRIA 1QLWA 1Q77A 1V7QA 2W4QA 4I8XA 4NE9A 4TZTA 1TF2A 1CG6A 2VYVA 3L5KA 3PE6A 1LVUA 4K8RB 3H2HA 5BRJA 2A9FA 2AQIA 2O3UA 3N05A 1D2MA 1NAHA 2Q6TA 1I3LA 1P45A 3EZFA 1NJ1A 3IQHX 2PZEA 3QW2A 4H6XA 1U9JA 2HLHA 2YJGA 1I7DA 2J41A 3UAYA 4CLRA 2AEJA 2C3OA 3ND8A 3OCUA 4N01A 2Q07A 3NANA 1L4NA 1QYCA 4AYWA 4F9GA 3WNZA 4MR8A 1PFKA 3ND5A 3IPAA 3E3AA 3VOAA 5LMNB 4LZAA 4N41A 1ST2A 1ONPA 1D1PA 1EB8A 3OI7A 5GOZA 1DC3A 2HNAA 1IBCA 3BIWA 3GGOA 5EZQA 3KIPA 1U0RA 1UBRS 1Q16A 2FUKA 1KY2A 5FOVA 1BU8A 4JQSA 3U31A 4NBLA 1OBFO 1MO6A 3G79A 3K30A 4KXXA 4OOFA 4TV9A 3UNXA 4JBYA 5ALWA 4FXOA 3MZ0A 1RVV1 3D6AA 3PNVA 2I7XA 4KZKA 3EGDB 4C5BA 1JPUA 1VKOA 3F96A 1XG5A 1AQJA 1QM5A 3WP1B 1PFYA 2NV0A 1U6IA 3PB3A 2GCPA 1PHRA 4UVIA 1YS6A 2JCSA 2OORA 5BUSA 3H5NA 2F3UA 3MJSA 4ZOQI 3VR2A 3THXB 3W04A 3BMCB 3LCCA 2GBCA 3ZXIA 2F3QA 2QPAA 1YDFA 5TPZA 2ZR7A 2I4LA 4QTXA 3FVWA 4KQ9A 4ZOCA 5C8YA 1T2UA 1YVEI 5F7XA 2CVZA 1DX4A 5LQKA 2B4KA 1ZWKA 3LPMA 1FQWA 3N58A 3DFZA 4IV0A 4R8RA 5T6BA 4LWZA 3SEAA 3UT0A 3M1LA 1E94E 3A6HA 3OPYI 1XQVA 2BRUA 3O03A 3QKRA 4X97A 1Q0LA 1UF9A 2J3LA 2YWEA 4N7JA 5SYAA 3MWJA 1ORIA 2IHZA 3N3AC 3ZWXA 3VO2A 1K27A 1K5GA 1M7HA 4LHXA 5AJXA 1U5CA 4KKXB 3NM6B 3QQPA 4XSHA 1JSLA 1N6IA 3X1KA 2H5EA 2VZLA 4X45A 5T57A 3ZK7A 1NDHA 3OQJA 1PGQA 3ZWDA 2CLOB 1XEXB 3BMNB 3L7YA 5BNZA 3GVIA 3EQ2A 5K0CA 3JD4A 3UKJA 1KJWA 1XZLA 3ZNOA 4BWFB 1MPXA 1ZM3A 4FHGA 4I5IA 4TYQA 3VX4A 1R8QA 1V3QE 2X15A 3IR5A 3WWOA 1EQUA 4F2WA 2GM9A 4DARA 1HYQA 5LPNA 3CJQA 3PEWA 1CYDA 3WIEA 5JROA 1C3EA 2XXAA 3IGFA 4JS0A 3O2NA 4Z9FA 1JMKC 1C4WA 4CF5A 4ZZ0A 3ZKWB 16PKA 4Q1VA 3RWMB 2I1WA 1N9KA 2FSFA 5LQDA 2GXSA 2H1FA 3N7TA 2PH5A 3BPSA 3UV3A 1M0SA 3VISA 1FFXB 4J16A 4YAWA 3GD5A 1VL0A 5FR2A 3G49A 1ZGCA 4DILA 2JA2A 5C8ZA 1GFZA 1YDHA 3PGKA 1FTWA 2DBZA 3M4XA 1C9YA 4K03A 4LCJA 1G8GA 4XASA 1GZSA 2DCMA 4CG2A 1NG9A 1EFLA 3IQGX 4IHJA 4YGYA 3GP8A 4DFDA 4B34A 2P7IA 3UM9A 5JCPA 4P80A 2BR3A 4QOSA 4XFKA 4DQLA 3V8BA 3KYDB 3S1AB 3TOXA 3FPCA 4BX3A 4AJ4A 2AVNA 1SU4A 4JB8A 1Q6YA 3HVRA 1Y0BA 5FLKA 1XA0A 2PDAA 1KMCA 1JDVA 4MW7A 3GI1A 1A96A 1VHDA 3OPNA 4YMWA 5DGTA 2Y8EA 5AWFC 2CV2A 2I54A 4XFDA 5AW7A 4IQFA 2ZRKA 3DMDA 3BE4A 2XZPA 2Q7OE 4BO8A 1HM5A 1R9MA 3RVSA 4LYHA 3M1YA 2SCUA 1MH9A 3LFUA 4AJIA 5JNVA 1LPBB 4JYZA 4E08A 3DVSX 4CTKA 3H5RA 2JDIA 3QNMA 2GRUA 4US0R 4QJ5A 3RNLA 3TDMA 4EY7A 1UQTA 5BMVB 4YJGB 2M6KA 1KDTA 4OL9A 3JAKA 1V26A 1VYVA 4RVGA 4OHPA 4C7XA 3DYVA 3QW4B 4X1IB 2FH5B 2YWBA 2WU0A 4S1PA 5KTTA 1CUCA 3MYRA 3Q2OA 2OFFA 2PKXA 2QMYA 4DEXA 4UHDA 1SUIA 4PZYA 2WF8A 4J1NA 2ZYRA 4WCDA 5AI0A 2XGMA 3NU1A 1OZGA 1OFUA 2B7LA 2LDBA 3T52A 4C87A 4PZZA 4ETMA 3HI6A 1ZY2A 4YRFA 1XSEA 2ZVQX 2B1GA 2FPLA 3AG6A 2V3CC 2J08A 3DE0X 3A4IA 4QXAA 1PGPA 1JFSA 3CNLA 4DCJA 4LW8A 3L8CA 3B8EA 2P0EA 1DKQA 2XYVA 3ZDZB 4W5OA 5EJ7A 1KK1A 3R1IA 3NC1C 4UAVA 4JQYA 4WZAA 5KS2A 5SZHB 4YAUA 5LP6A 4PU0A 2H4HA 3GJ4A 1PWEA 1QRDA 3T0IA 5REQA 2VYQA 1C1DB 2H7XA 3LF1A 1YKFA 5AKGA 3UIEA 4QICA 4AY6A 2H2IA 1QHFA 1VHQA 2CLCX 2FPGA 3LM8A 1E3EA 1AZSC 1Q0HA 1RS0A 1SEVA 4O2AF 4G85A 4CIDA 3IALA 2EV9A 3E7FA 5K8CA 1B14A 1IAVA 3EGXB 3HL4A 4R1MA 5ALKA 5SY9A 1ZM9A 2B8NA 2V7EA 3NRCA 3QVJA 5C7YA 2JIMA 4J9UE 1FVFA 1X14A 4NRDA 1KNQA 4E22A 1Y4DE 3RSQA 3ZE6A 1BFKA 2ZPAA 3CBGA 1AHNA 1RABA 2KBFA 4HQKA 5FF9A 2G83A 3S2ZA 4PYIA 2BISA 4BLUA 4RL6A 3WAKA 3DLIA 4D1YA 5H1YA 3G0GA 2YV2A 3SHQA 2CCJA 1AQIA 3NWEA 4PLFA 1NN3A 4ZHSA 4P3OA 2NZJA 2Z4RA 1L4BA 4UATA 4Q19A 5IVKA 3AB7A 3R0QA 4M0DA 3BWVA 5ALOA 3BXPA 5B7GA 4M1YA 1YB7A 5DOZA 4IXWA 5DV9A 2B21A 4A10A 5CA0A 4R0NA 1F2TB 4D5GA 2GLUA 1RWQA 3LECA 3L4SO 3LYHA 4JC5A 2OBXA 3AMVA 1ESDA 3TW0A 3F73A 2PCLA 1PS0A 4EI9A 4OI1A 2C0PA 4V3CA 3EFHA 2Q1XA 3CNNA 4NZYA 3COYA 3RG8A 2QLLA 4J9VA 3STVA 1Z15A 3AB8A 4ARCA 2A0XA 3FYDA 3MVEA 4NC9A 4DMUB 4DQVA 3ECAA 3AHGA 5ESRA 3LGSA 1V6CA 3N39C 4RTOA 2H18A 2WHRA 2FR1A 2C4UA 3MTAA 1OC4A 1RPJA 1O8BA 3GJZA 4LJAA 4BGEA 2NP6A 1JWBB 2WT8A 2E4UA 2R5WA 3R09A 4H4CA 4M60A 5F73A 4D9CA 1ODIA 4TWBA 4BXOB 1NW5A 1RR6A 1Y6ZA 4J7AA 4XM2A 3S68A 1YZUA 3CJTA 1DU4A 1R0BA 1ULAA 4X95A 3RTGA 2CJYA 2EATA 3WJ1A 2YR0A 4C6TA 4PRLA 3N86A 4IGFA 1T5LA 1Y82A 4BCDA 2AR0A 5CLIA 2GASA 3NDRA 3W2EA 4O4JF 4QBFA 5HUQA 4G5QA 2DLDA 2OLEA 2JRLA 2BLLA 1GADO 1CP3A 1YK1A 2IQIA 1NLUA 2ETXA 2IZOA 1IOLA 2OB2A 2OORC 3FWZA 3VTZA 5HX7A 5B1YA 3MQ4A 1MORA 1ID8A 3K7EA 3OU6A 3HH8A 5ERGB 3F98A 1T9ZA 5J4VA 1VRCA 2GZMA 2YNMC 1T9GS 3R7DA 4O8CA 1I4TD 3G0CA 1BCSA 1WXFA 5ED4A 1P6XA 3LZCA 4MIOA 1LWNA 2BUBA 2XTZA 2YINC 1SWVA 3CTMA 2P4QA 3ND7A 4FNGA 1QIGA 4N49A 3IUSA 2RGWA 2BRUC 3L1HA 2ZUEA 3OE4A 2CHUA 3AIKA 3FFAA 2VZ8A 1GU1A 1LF0A 1OXBB 2XQIA 3H84A 5FCDA 4Z8XA 3AVVA 1PR1A 4LBYA 4ZI7B 2PXAA 2ACWA 4KFTA 5MN5A 4Y0AA 2Y77A 4TL6A 1ZX1A 1IEQA 4RZQA 1PG2A 1SQGA 3K4HA 2BGMA 4H31A 1RYEA 2W2LA 1Y3FE 4LCEA 4E5KA 5BYKA 1IVSA 3ZJTA 3OEHD 1OWPA 2CLHB 1UM8A 2W6MA 1IN4A 1IB6A 4G2NA 2FETA 4L4ZA 4URHA 3VHXA 1ZEJA 2CLDX 1LDGA 3FGZA 3L41A 4G0YA 4HOYA 1ADFA 1RIFA 1TO1E 3KSUA 1J0EA 1QDEA 3MJTA 3NKFA 2ZT6A 1T2AA 5A6SA 4AT1A 4I2NA 3MQFA 4Q4CA 4AJKA 1MNAA 1FVOA 4I9UA 1JHDA 4J16C 3A1VA 1SVSA 2XOEA 3HSSA 4HDRA 4M7PA 1HMYA 3GJSA 4K6FA 4MJ7A 3PXXA 3PEYA 1Q7BA 2FHSA 1Z5PA 2V7QD 4L9RA 4WDRA 5EJAA 3E7PA 5BN4B 1XTVA 1G17A 2BTOA 4I36A 4L4XA 5JMPA 3WZ2A 5ARDA 4JUDX 1EG2A 1UAYA 4Z1MD 3IUYA 3O7WA 3P9QA 3RANA 2M2IA 3HXMA 3EH1A 1RADA 2ISQA 1WCXA 3D9QX 3NGXA 4TSFA 1AGXA 5AJUA 3VKUA 4CIAA 3L0BA 2AUTA 3HUUA 3Q87B 4GFDA 1HR0B 4P4UA 4YRAA 4JJAA 2FK7A 2EIHA 4RJKA 1S96A 1FL9A 2OHVA 2V6BA 3H6GA 4PRZA 4ZK6A 4TKLA 3LVBA 1I2AA 2CWDA 4AP6A 3V7UA 3ENQA 5I47A 2F3PA 3SX4A 4M8KA 4RZSA 4URXR 2IEYA 2G70A 4IGAA 5DGIA 3DH0A 5F9FA 1T1SA 5IVHA 4KV7A 1E2EA 3PBKA 2OQ2A 3LGAA 3B9RA 2P5SA 4YRBA 1TUBB 2GYVA 2H5IA 4WN9A 3SR0A 5EAIA 2QLMA 4Q34A 1T9BA 1GPUA 1YACA 2W83A 2Q4DA 2R62A 5HRUA 1T5BA 1U6JA 4MVCA 5C5IA 1N2ZA 4YGXB 5DSTA 5B1DA 1DJOA 4BGDA 3N8KA 4PSCA 1C30A 1QH9A 4R68A 2F59A 5DX8A 1DAFA 3GMTA 4B74A 3BTSA 2ISSD 4G65A 4B6SA 1YR1A 2P77A 2Z9CA 5IDWA 1J2RA 3URMA 1QYWA 3EMDA 3WLJA 3VSDA 1L7PA 3E58A 4RXUA 5F7JA 3AG5A 3DWGA 4BEJA 4MAAA 5LD2C 2J3JA 3IAHA 4R83A 4DR3B 1NMEA 4YDSA 4ANFA 3RJZA 1AT1A 1I7SB 3D2CA 1ISGA 5IK2A 1XGKA 4JVSB 5H59A 1PJTA 1DCFA 3L1UA 3RC3A 4MB0A 3NYQA 2IP1A 3EXEA 5BNWA 1G19A 5EZ5A 3MERA 5LP6C 1SKYB 4WZ6A 2C9YA 2P30A 3A9RA 3KT0A 4HH0A 1RMTA 4EFNA 1E9SA 1TK2A 1HMPA 2Q5QA 4I6EA 5AM2A 5C52B 1XXHB 5A5EA 2AOTA 3AR2A 3SZ3A 1XMQB 4TT3D 4DRXA 1H2RS 3RVLA 2JLQA 3B36A 4KN9S 2KMLA 3QF4B 2A94A 2RG1A 3WJAA 4IZIA 4K3VA 4WOCA 3X2SA 2CHEA 5KOHA 3P20A 4HAYA 3AJAA 4JNCA 3SS9X 3L8DA 3GFPA 3ML1A 2VPZA 1W35A 3O93A 4JGBA 4J4BA 4JBLA 5CMLA 5GADl 1HA3A 1M67A 3VDMA 4DLYA 2QUIA 4PC2A 1MO2A 2YIMA 2C95A 4W5TA 3WDSA 3HCOA 3OZIA 4KN6A 3H2IA 1DX6A 2YS6A 1Q1AA 3N8HA 3FLBA 2E21A 2YKGA 1FDVA 2XXBA 1DCTA 3GF4A 4HQRA 3L43A 2I71A 3PDJA 3X1WA 5K0GA 3TJZA 3ITNA 3JZAA 4FB4A 3WXMA 2VT6A 1GAQA 3QELA 5D6OA 5T4BA 4F71A 3IIEA 1MOPA 1PJ2A 1Z4KA 5TGTA 4L8FA 1O8CA 3IMCA 1YAJA 2PU5A 1USWA 5G3YA 1LRLA 4FDUA 4H7KA 4PRKA 1EZ4A 2O0KA 5EP2A 2YOGA 3ZI4A 2VK8A 5FHQA 1TF7A 3M4YA 3DYBA 2PIDA 1L5FA 1Z0KA 3JQAD 3SQNA 1EWRA 4PBRA 3LE8A 5BQXA 4DTIA 1ZSNA 3WL8A 2EWMA 4OHMA 4ND1A 2ZEJA 1KDVA 3OAAD 1TL7C 3FTDA 2VRBA 3PFHA 5EMLA 2MSDB 4BQQA 4CM7A 3ROXA 1LI4A 4B8WA 4UPDA 2JFHA 5CDFA 4AU1A 3IPYA 1IWOA 4LIPD 4B6FA 2B98A 4Y1GA 5CEFA 3WL5A 2X22A 3RDPA 4HGZA 2DOKA 5A4IS 1X86B 2YTZA 4BKQA 3H11A 1JRLA 1YR9A 5FQNA 3A6ZA 2BFEB 2PVSA 5EXTA 4HNTA 2X5OA 1QO0A 4KZPA 2C7RA 1P1FA 1CW2B 3ZWBA 1ODJA 4Q93A 2GZSA 2TMKA 1U9YA 4L4YA 4C43A 3T34A 1A5ZA 4JLAA 2GN8A 2BGGA 2J45A 1V9CA 2D59A 5I8PA 2ODBA 4G4JA 3WSTA 1M72A 3UH1A 5F76A 1H8HA 4XDZA 4CLEA 4EFDA 4YRSA 1EWTA 1JI0A 3HJCA 3NW9A 3OM9A 4PZ9A 1KS9A 5AI4A 4EELA 1VL5A 1G8SA 2MT9A 4B3CA 3JQAB 3CGWA 4EG4A 3MWEB 1W8IA 4HMQA 1W2GA 2Z6AA 2ORWA 2Q5JA 4MQFA 4HT3B 3I0NA 2Z9DA 3UWPA 2YNMD 4PLWA 1H5QA 2PRZA 3MWDA 2M9MA 4D0GA 3IBTA 1D7OA 1AXGA 1QE5A 1XVVA 2K4MA 3HADA 3VTAA 4DGQA 4NCHA 4AG6A 2PMWB 1M2HA 3DFKA 1A88A 1RI4A 4TM7A 4B31A 4IKOA 5HTOA 1YMVA 1OFUX 2BTQB 2OESA 3TFOA 1II9A 5I9IA 4KQXA 2EWVA 1VA4A 4DC9A 1QO7A 4GS5A 1HF3A 3R3YA 2PKYX 3RS4A 3GPIA 1CHNA 4LQCA 1IVNA 5D01A 5THKA 3C87A 4G0XA 4BMPB 2HMYB 4CQLA 1N9GB 2HCRA 3V8VA 4GDFA 1JKMA 4K1XA 4UTPA 5A03A 3OO0A 3UV7A 1E9DA 4LK3A 5K3CA 2P65A 3V6LA 1EFUA 1HWYA 4XGQA 4DRZA 4FBMA 1JIIA 4WESB 2W6QA 5CTAA 2UZ0A 1DINA 2E18A 2RHJA 2NMVA 3GRKA 4D46A 2YYSA 2FVYA 2OLKA 3H1FA 1QP0A 2JEZA 4G81A 5KZMB 3ND9A 5HIKA 2CNDA 3DMGA 4MWCA 4P3YA 4KR6A 4FX5A 3DUFB 1Y37A 4UC0A 4C22A 3E5MA 2DPXA 2IYZA 5HJ5A 1FDRA 1ZC3A 4FE7A 3KYJB 2OGZA 2RHLA 3QU7A 1GGVA 1HUQA 4H1VA 4D4IA 1WB4A 2QJOA 4DMGA 5CVCA 4RY2A 1H6DA 5HFNA 3U81A 1XRJA 2VHTA 1LBTA 4MARA 3C7CB 1UH5A 4L4UA 4QQFA 1IXSB 5HJ2A 1WUJS 3QFRA 4HUJA 4OM7A 4LWPA 3AHJA 3BD6A 3TL3A 2Z09A 4D8XA 4R84A 4UULA 2C42A 2J7PA 2XKJE 1YNOA 2F1JA 2X1HA 1M3SA 3KBBA 6ADHA 2ONZA 1IHDA 3C41J 3SEQA 1MG5A 2F9FA 2ZATA 3D6TB 4FKBA 5BSVA 3P94A 4M86A 2W71A 4HDKB 2MMCA 1VJ0A 1ES9A 4LQDA 5A3RA 4XRGA 3A2LA 2FN3A 3ESZA 1AO0A 3EAGA 2J4CA 5L3QA 3KOOA 4ZODA 4YAKA 3MJFA 5CDUA 1NKTA 3A2NA 4IGIA 3C5CA 2C5EA 1RCFA 5JMOA 5LXTB 3TOCA 2NIPA 3LUFA 5AVZA 2V7BA 1R8YA 2FOLA 1XNJA 4LY9A 1HY3A 2P6UA 1B23P 1DCKA 2JHAA 1WZCA 3A14A