3FWYA

Crystal structure of the l protein of rhodobacter sphaeroides light-independent protochlorophyllide reductase (bchl) with mgadp bound: a homologue of the nitrogenase fe protein
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
268
structure length
268
Chain Sequence
GAKVFAVYGKGGIGKSTTSSNLSAAFSILGKRVLQIGCDPKHDSTFTLTGSLVPTVIDVLKDVDFHPEELRPEDFVFEGFNGVMCVEAGGPPAGTGCGGYVVGQTVKLLKQHHLLDDTDVVIFDVLGDVVCGGFAAPLQHADQAVVVTANDFDSIYAMNRIIAAVQAKSKNYKVRLAGCVANRSRATDEVDRFCKETNFRRLAHMPDLDAIRRSRLKKKTLFEMDEDQDVLAARAEYIRLAESLWRGLDPIDPHSLPDRDIFELLGFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light-independent protochlorophyllide reductase iron-sulfur
publication title Crystal Structure of the L Protein of Rhodobacter sphaeroides Light-Independent Protochlorophyllide Reductase with MgADP Bound: A Homologue of the Nitrogenase Fe Protein.
pubmed doi rcsb
source organism Rhodobacter sphaeroides 2.4.1
molecule tags Oxidoreductase
total genus 93
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 1.3.7.7: Ferredoxin:protochlorophyllide reductase (ATP-dependent).
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00142 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fwyA00
5FOVA 1F48A 4DCSA 1NN5A 2CVFA 2EYUA 2W58A 2VA8A 4JVLA 4ZDJA 3CRQA 3HR8A 1N6KA 1IONA 1Z6TA 3V9PA 5JEDA 1W0KD 1R0WA 521PA 3W8RA 5EXSA 4DT1B 1QHNA 1HUQA 1KKMA 1XEXB 2BWJA 4G01B 4IRUB 4DRZA 6Q21A 3NWJA 3H0KA 1PJRA 2EVWX 4HLCA 4RFVA 1G3RA 4OL0A 2H92A 4JSTA 4O2RA 5L3QB 1NN1A 3U3MA 3VU9A 2ORWA 4MGKR 4YMVA 2ZJYA 3K09C 4M4SA 3R7WB 4DJTA 3W6NA 4PR0A 4A8JB 2AD5A 4F38A 1Z6XA 3QI2A 1Z5ZA 3HDTA 1KK1A 3CF0A 3GJ0A 4JYBA 2SHKA 1KSFX 4EKDA 2A78A 1NLFA 4G5GA 3EAQA 3S1AA 1IY0A 2DWQA 2J87A 4I1VA 3BD9A 1E98A 2G0NA 2ZSDA 4GMXA 4P4TA 4P4SB 2JASA 3TAUA 1OLOA 1ZCAA 1MABB 2E87A 4NONA 4P32A 1KNQA 3QXHA 4IJMA 3NC0C 4QJ4A 4V0NA 4OI2A 1FZQA 2A9KA 3TBKA 1F2UA 1W44A 3OIVA 5E7IA 1DPFA 1S4QA 3R9WA 4M1SA 4V0OA 1OFTA 4CIDA 5JCPA 4AIIA 3R9XA 4KLNA 2XXAA 4A1FA 3L0PA 4P3YA 2A5FA 4XWAA 3UANA 4BFVA 2FWRA 2ZRNA 3PUYA 4LYFA 1JQLB 2HEIA 1Q0UA 1Q20A 4P0TA 1CF4A 3HR7A 2JA1A 2D62A 3Q7QA 1JQJC 3TR0A 1N5JA 4AK9A 1TQ2A 3M4YA 2DWPA 2FOLA 1VMAA 3UG7A 4DXAA 5JRZA 4PC1A 4DLRA 2OFXA 3I62A 2F43A 1II8A 3KFXA 4MUAA 2NTYC 3GLHB 1LF5A 1OIWA 2ODWA 5EZ6B 2Z4RA 5E7MA 4TT3A 3CONA 2HDNB 2JAQA 4CF7A 1ZU5A 3KJIA 1DADA 2D74A 2O8DB 2XTMA 3WRXC 2WWWA 1DARA 4TMXA 1LS6A 1UKVY 4ASUD 3SE0A 3EZ7A 2C9YA 2F7SA 4TLDA 4O3MA 4QM6A 1D9ZA 1QHSA 5FBWB 2OCBA 2W2XA 3KJEA 3AUYA 3SDZA 2OAP1 3TRFA 2VP0A 1Z47A 1ZM2A 3BOSA 3MJHA 3GJ5A 1JJ7A 4FMCB 5B30A 4NPHA 3CH5A 5KSPA 1S2MA 2Y8EA 4PZZA 1FTNA 4MUBA 4Q9HA 1KI2A 1TU3A 5FUYA 4ABYA 4EJSC 3DOEA 4QFMA 2ZYWX 1E2NA 4A0GA 2FFHA 2P67A 3SI7A 1NKTA 2WJGA 1XFAA 3SOPA 3C5CA 3X1WA 5KSOA 2HF8A 2EU8A 3I8SA 3BS4A 2PL3A 1CLUA 3A36A 2GJAA 1Z6AA 2OSBA 2VHCA 3VKWA 4KU4A 1F5NA 3NBYC 5SZIA 1HQCA 3R7WA 3P26A 2PLFA 4H9GA 4TT3D 4WA7A 1VYUA 4GI7A 3H4MA 4I1SA 2VO1A 2GXSA 4IXMA 4KI0A 4AYXA 4DWJA 3RSOA 4A8JA 4TYWA 1TADA 3L8ZA 4CT4B 4TQ9A 5CYOA 4JT2A 1HY3A 1SXJD 2YWGA 2ZRKA 3CBQA 1DTSA 4EUNA 2RHMA 2R6FA 2WWHA 1DAEA 3DVLA 3VTKA 2AN9A 2GCOA 5DNYB 3O8RA 3VNVA 2J46A 1U90A 2ZU0C 1OH8A 1I2MA 4P4SA 2HV8A 4TL8A 4BLPA 1FPMA 5E4FA 2WKPA 5JZVA 3THYB 4JLNA 1FMLA 1WDTA 2CCGA 2IX3A 4ZDWA 4BE7B 4LX0A 3KL4A 2O8CB 3LBNA 3E70C 3RS4A 2JCSA 2F3RA 2GCNA 4NYJR 2OCAA 2J0VA 2ERXA 4PQYA 4PZYA 3VKGA 3O8BA 1OF1A 5F2EA 4BLRA 2D4HA 821PA 5KSYA 4KFSA 1T3LA 1CRQA 2REXB 4D25A 2G6BA 2MMGA 4HSEA 4X8MA 4G5RA 4Q4LA 1Y63A 4HDCA 1FOEB 1II0A 2ZRCA 5CIWA 3P32A 5FOTA 1JBKA 4Q1EA 4AG6A 2ZRAA 4B6FA 2AFHE 2LKDA 2WJYA 1X1RA 4A2WA 2BEKA 2YC4C 5CJ2A 4AC9A 3K09A 3MFYA 3EZ6A 3L0IB 1R4AA 1KDPA 2FFBA 4JLBA 4BRWA 4BASA 3K0SA 4KV9A 3GLHA 3PEWA 3AM1A 5FUWA 1OIXA 3TQFA 1UADA 1UBCA 1KNXA 2J7PA 4JL8A 4LYJA 2YC2C 1N6LA 1KGDA 2FSIA 3KFVA 4QM7A 2ZROA 3AF2A 3U3OA 4JVNA 2WJJA 2FZLA 4M0LA 3TH5A 5JI3E 5EUMA 2XB2A 2IUTA 2RMKA 3MMPA 4JL5A 1SGWA 3SNHA 1AGRA 1VG1A 4JLPA 4B3FX 3NH9A 1OV4A 4Q66C 4B34A 4TTQA 2G77B 1AZSC 3EW9A 1U8YA 2P5SA 1ZUNB 2V4ZA 4QGHA 3K0CA 3H2YA 2GJ9A 2QPOA 1XZQA 3DDCA 3AQ4A 3PIRA 4OQFA 1E96A 5J5CA 1W0JA 3SJAA 5C4MA 4D80A 1KI6B 2YKGA 4ILEA 3LX8A 5JMTA 1YZUA 2Z83A 3CR8A 3D7MA 1ZNXA 3OEED 4FD2A 1NN3A 4D4MA 5CM8B 4JLKA 3UIEA 2P5TB 5FL3A 1SVWA 1PV4A 4FINA 4LK2A 2ZRHA 4E03A 3E1SA 2C95A 3ZD7A 4R71A 1ZM7A 4TYYA 2ZAMA 5A0FA 3AP3A 3SFVA 3UATA 1ODFA 3VNUA 3GD7A 2D3WA 3HWSA 2R44A 3ZVRA 4OI4A 1NSTA 1WRBA 1W4BA 1MH1A 3ZVMA 1QDEA 2GA8A 3AP1A 1Q44A 4G5SA 2PLRA 4DSUA 2JJ2A 3BH6A 4C2TA 3THOA 1B0UA 1B23P 2QAGC 2YZ2A 1AK2A 1R0ZA 2C5LA 2QPTA 4RD0A 5AK0A 2ZQ5A 4FWIB 4AD8A 3TUIC 3FYHA 1N6RA 1SKQA 3KQUA 1NMYA 1YR7A 4W5WA 3MWJA 3THYA 2J0UB 1DE0A 4F7WA 1LS1A 1T9HA 2PJZA 1AGPA 3LFUA 2RGCA 4JT4A 3UWKA 2O8CA 2V1UA 3A1WA 2BMJA 1G17A 4A2QA 1W0JD 3GLFB 3GLFE 1NBMA 4Q00A 1L4YA 1P9WA 1NL3A 2DFTA 1U9IC 5JLJA 2FPLA 1OXSC 2VYFA 4CVNA 3QF4B 1MRSA 4C0AC 1G41A 1XRJA 1U8ZA 2MSCB 3DKPA 2IEYA 2ZSBA 2IUUA 4URZR 2Z6VA 5G53C 3EXAA 1CJKC 5D3QA 4LWZA 1M2OB 4AY2A 2IBMA 1D6JA 4DCVA 5C18A 2PMDA 4LHXA 1NF3A 4CEHB 3ZZ0A 3GQBA 2JJ2D 2BJVA 1YZKA 2A30A 2VSFA 3B1ZA 2FSFA 2CK3A 2QNRA 1CTQA 5AJZA 5L8VA 4BZPA 2W2TA 1NP6A 4HAZA 1P5ZB 3QVUA 1UKYA 2UVQA 1TU4A 1UBGA 3THWA 4G0NA 4BLQA 5HKKA 3TR5A 1M74A 3VR6A 1J8MF 1XEWY 4A0FA 4A82A 3GFTA 4GDFA 3MWKA 2WM9B 3IO5A 5A4JA 3FE2A 1OH6A 2JEOA 1GL7A 1XTSA 1H8HA 4D4JA 1GP2A 2A5JA 1ZC4A 2V7QD 5DE3A 5FBVB 4PX9A 4CYMA 2OBMA 1G291 1MRNA 1G6OA 5KNCA 2YVUA 4HATA 2NZ8A 5FOWA 1W46A 1T3HA 3FMOB 4DKXA 3E2IA 4HEJA 4JVMA 1YRBA 2GZDA 3AKDA 1MV5A 4L9WA 4D0GA 4Q1AA 3PUWA 4OI0A 3BJIC 1KJWA 1KI6A 2CBZA 4MYUA 3SYKA 1VECA 1A7JA 5J4VA 1DO2A 3IHLA 1ONBA 1OE0A 1P9RA 1ESNA 2Z4SA 2YNMA 3QUSA 2CK3D 2QI9C 3QKRB 2VHUA 2AX4A 3E5HA 3FOZA 1NJGA 1VHLA 4LPSA 4HYYA 4ESHA 5CLQA 1N6HA 2BMEA 3JZAA 1E4YA 4LCBA 5FR2A 1AKYA 1XEWX 2OO7A 1NSFA 1E1QA 3QPVA 1FFHA 2XX3A 4WW0A 1XMJA 1EFCA 4IHQA 4I1UA 4H1UA 5E3HA 1H8HD 4B3CA 1WQ1R 1D5CA 1Y3AA 1YKSA 2ZS8A 4BFTA 3PR1A 2BBTA 4Q02A 2J0QA 3ZIAA 5B57C 5JI2E 2C98A 1SHZA 2ZRBA 1OPXA 1EFTA 2J0UA 4QXAA 3A4LA 4CRWB 3K53A 1G8FA 5JFGA 5F3WB 4DSNA 3PEYA 3IBYA 1BH2A 1P9NA 3QOFA 3T34A 2PT7A 2CCJA 1G3QA 4GRAA 3CX8A 4FCTA 3V4RA 2O8EB 3CPJB 4Q4JA 421PA 3K0FB 2QP9X 3P27A 5L3RA 4NBSA 4YLGA 1CBUA 1R5BA 3RAPR 3LBHA 5C4GB 5BWMA 1JR6A 3VX4A 4MKHA 4RY2A 5IK2A 4WBSA 5JECA 2FJUA 3TIFA 3R20A 3HPQA 621PA 4YXWA 1XJQA 3TKLA 4C0SA 1ZVQA 5SZJA 4CEHA 2E1RA 1PLJA 3RHFA 2WSMA 3PUVA 4JVSB 1G1MA 3CF6R 4XSHA 3WP0A 2LKCA 5FOXA 3ZIAD 1IY1A 5LBIA 1VPLA 2W6JA 2WZQA 1NJFA 2YOFA 3R8CA 3W3ZB 3X2SA 1N2CE 3QPUA 3ZGXA 2GXAA 4W5JA 5EXXA 3D6TB 1ZUHA 2OXRA 4LJ7A 2QAGA 2IYXA 2QTVB 2C96A 2V54A 3LNCA 4LJAA 4M1TA 5K8LA 3THXB 3SN6A 3U7GA 1ZMXA 4W5HA 4RSGA 3QJYA 5EE1A 3GEHA 2AR7A 4PAMA 1OFHA 4QGAA 1W36C 2JLZA 2IT1A 3CZQA 4AKGA 4HZIA 3SFZA 1YE8A 4QHSA 1KMQA 3A4MA 5FTMA 4Q01A 4E07A 1E2DA 2FPKA 2W6ID 2F6RA 2ORIA 2O0JA 2P6NA 4G5QA 2R2AA 2ZTSA 3TK1A 4NZYA 5EJEA 5IK2D 4M53A 4FWTA 4Q48A 2KB0A 3PV0A 4YXWD 4P33A 2P0EA 2Q3MA 3B82A 3LVRE 5DN6A 3SJCA 2WWFA 1NY6A 4TMKA 2H1LA 2QAJA 3QKRA 2JLUA 1CJUC 3UXMA 5JBQA 2I3BA 2AKAB 2V9PA 4A92A 1M6NA 1JECA 2IF0A 2ZI9A 2W6JD 3QKUA 4POAA 4YC7A 1FNNA 2HLDA 4CEIB 3ASZA 1CJMA 4TTRA 4Q7KA 3QSYA 3C8UA 3GFPA 4BFXA 4A4DA 121PA 2FFQA 1FUKA 3RS7A 5K8TA 1KTVA 1VIYA 5DLQC 5FTLA 1G8YA 1Z0JA 4LJ9A 4DUGD 1KI7A 2V6JA 3CZPA 4MDEA 2OZEA 4PPQA 2JJ1D 3UMRA 5KNDA 4DLXA 1A2KC 3B78A 2QRZA 4OJKA 1S1MA 5TV2A 5HCNA 2JLQA 3O47A 3ADBA 1ZP6A 2OLKA 2EW1A 1Q1ZA 3SHFA 1KIMA 1KMHA 4BFSA 4C0LA 5DN6D 1YZLA 1IOZA 3CH4B 4JIMA 4W9MC 2IHYA 1SVOA 2F55A 3K0AA 1K8RA 3IEVA 4GMDA 3K0FA 1COWA 4UXIA 1SQ5A 3SYLA 1GKUB 1KZ7B 1XZPA 3IBGA 4PO1A 1IN5A 4MH0R 2HLDD 5KHOC 2BVNA 2DY1A 4ERNA 2GEVA 4II7A 1NVVR 2G1JA 5LB4A 5CIQA 4AKHA 2QTFA 1R0YA 1FQJA 3UWOA 2WWGA 5HPYB 4K46A 1HT2E 1T6NA 2FPMA 2GAAA 2IA5A 1J90A 2JGNA 2W83A 1IN4A 1RYFA 2IYTA 2A5DA 1SXJC 2NO0A 2X2EA 4FIDA 2ZYUX 2P2LA 1G8HA 4XD7D 1LY1A 3JVVA 4N0DA 2YWFA 3TW4A 1JR3E 3CRRA 5GJVC 4F4IA 2WWXA 2ZR0A 3THXA 3L0OA 2GHIA 3H84A 4RZUA 3Q5DA 3H86A 5FTNA 3KUDA 3C4JA 1VTKA 4PO9A 1A2BA 2PH1A 2ZI3A 3BXZA 4M1YA 3TSZA 2KBFA 4TZ6A 1A5TA 1U8AA 2IYZA 3LD9A 1SHKA 4BLOA 1X8KA 4EFLA 1DAHA 4ESVA 2CHQA 3DM5A 1GM5A 1J7KA 2ZETA 3MSXA 3OZXA 1U0JA 1W0KA 5KPJA 4OYHA 3VX3A 2J59A 3RC3A 2Z0MA 4PSVA 3QPWA 4YQFA 4BRUA 3I5XA 2RAPA 4PSAA 4WXPA 4A8JC 4BPBA 4Z54A 5IT5A 1QHGA 5FR1A 1Z3IX 1F60A 3EA5A 5GADl 3AF3A 1GIAA 3L0SA 4O2LA 2UKDA 3N2EA 5JSZB 5AUPB 4U02A 2GETA 4LHZA 4URUR 1W2HA 3BWDD 2R6GA 2R62A 2EYQA 2QSYA 3K70B 3VMFA 1Z6GA 1MOZA 4MQBA 3F0TA 3FHCB 1SVSA 3Q3JB 4NTZA 1VCIA 1TQ6A 1XX6A 2BKEA 5HE8A 1BIFA 2HT6A 4JYCA 1QHHB 1GKYA 4RZ2A 1E99A 3I3SR 3WYAA 3BB1A 3N2IA 3KDSE 4RD3A 2YWEA 1XU4A 2CE2X 3T5DA 4U5XA 4Q18A 4JJZA 5GJBA 1XXHA 2H18A 2ZS7A 3MD0A 4AI6A 2IYVA 4LHWA 1FW6A 1CULC 3OHMA 1E2JA 1S0UA 1HURA 4FN5A 4TL9A 2EQBA 1NLZA 1ZYUA 2BBWA 4U00A 1N0VC 3KZ1E 2VHJA 2VTKA 3BC1A 4NYJQ 3EC1A 1GL9B 3ZD6A 4QJ3A 1WMSA 1HV8A 2IXGA 5CB8A 4B3XA 2QL6A 5CITA 2QBYB 4JL6A 3RRMA 3PUXA 2QPAA 1U0LA 4D81A 4XVUA 3GJ7A 4L4UA 2ASEA 4MYCA 3FDIA 3AVUA 5K8UA 3B9PA 2J5XA 2ZJAA 4KFRA 1VG9B 3GLGB 4JJKA 3GLGE 1UPTA 3GCGA 2BM0A 3PITA 2XZLA 5FI1B 1DOAA 2IYUA 4IDHA 5J4LA 2UZ3A 4LBZA 4PHHA 5TARA 1T8TA 2Q3FA 5CK4A 4MA4A 4TMTA 1QHIA 2JDID 1GG2A 2VQSA 1OHHA 4Q03A 2NO1A 3T06B 4BFWA 1F2TB 4D2IA 1RJ9A 1N6IA 3F3YA 5JWHA 4MRPA 1XD2B 4KJZA 1W36D 2QE7A 4Q7LA 5K8IA 1C9KA 4PSKA 4Q1FA 5G40A 1EESA 4ASUA 3K1JA 1IXRC 4B75A 4GP6A 3ZS9A 1G3UA 3K0CC 2PZGA 1P75A 3CNLA 2BKUA 4ON9A 2W0MA 5HCIA 1BYUA 2J45A 4LJYA 2IYRA 2QU8A 3QG5A 1GAJA 1E0KA 4IW3B 1G19A 4I4LA 1RRCA 4DDUA 4A2PA 4JLVA 3WHKA 4JKYA 4LV5B 5DSZA 4A15A 4QBFA 3Q5EA 3CX6A 2ZRJA 1HH4A 4Q1BA 2V55B 4HUQB 4WZAE 4ZPXA 3K9LA 1C4OA 3RC8A 2FSHA 1E3MA 3CRVA 4DSOA 3GMTA 1Z0AA 2N46A 1KDTA 1YR8A 2CL0X 4B44A 1OHHD 3VAAA 3NH6A 5JSZA 1JR3D 3AVPA 5BQ5A 4L15A 5CDFA 1Z8FA 2FFAA 2CL7X 4QOSA 3SQWA 3B1VA 2AFIE 1V43A 2QE7D 4I1OA 4MRRA 4DLVA 1SXJA 4TL7A 2XEXA 1PUIA 4S2EA 4LOAA 1UFQA 1XJCA 2GK6A 2QP4A 1QHHA 5DI3B 2PEYA 2FZ4A 5CM9C 3CW2A 1X8JA 1HE8B 2OCPA 3IPYA 3KXLA 1OXTA 4B43A 3TUZC 1N3BA 4LV8B 3B1WA 3PVSA 2J7KA 4TLAA 3IILA 3FKQA 2P6RA 4DSTA 2FNAA 2NIPA 4TSFD 4N1AA 1GFIA 4R2IA 1CR2A 4DT1A 1ZW6A 1E9BA 1NLYA 4O25A 1XEXA 5KOYA 1RPZA 1TX4B 2ZEJA 4QHTA 1KZGB 3UMSA 2AK3A 4AKEA 4GNKA 1RC8A 4ZI2A 1Q1EA 5L3QA 1G6HA 2FGKA 2Z5FA 3X1XA 1G5PA 2WIAA 3M1IA 1Z83A 1E9FA 5J4HA 3K70D 4DB4A 4RZ3A 5FPHA 1YZTA 2ZRLA 1NKSA 3HYRA 1KO8A 3W5IA 3U7HB 1W48A 4BECA 2PZFA 4YMSA 5SZHB 2IWRA 1OH5A 2CVHA 3GEEA 4IXNA 3NVAA 3TVDA 1MABA 1Q12A 2YINC 3CM0A 1F2TA 2ZRPA 1KAGA 1TUIA 4HDQB 1JI0A 1XD2A 3ADKA 2XJ9A 3HJNA 2FSGA 4WXRA 1U81A 3T1QA 1E79A 4JBWA 4GOJA 1N25A 2RGEA 3SZRA 4TYQA 4F92B 3BB3A 2ZANA 1E9SA 1E1RA 3V00A 2CLDX 4OHWA 5FTKA 3SBEA 2JIZD 3SYNA 1RFLA 4DIEA 1PLKA 3BH7A 3QXXA 2B7BA 4A36A 4M1WA 2FH5B 1IHUA 4C0QC 4M9QA 1NVWQ 3LXXA 1GOTA 4FCWA 4XVRA 1WE2A 4V0LA 1GILA 4E22A 1IXZA 4HB3A 3AVVA 3LY5A 3T1OA 3ZH9B 3AEZA 2CXXA 3GJ3A 1US8B 3OEEA 2OBLA 4F4JA 3VR4A 4LC0A 4DCTA 4Z1MD 1XEFA 2P3SA 2QEQA 2WVJA 5CK5A 4JBXA 3ECCA 3D8BA 1E2MA 1SVLA 4XWOA 4JLAA 2WSSD 1IQPA 1YVDA 2EFCB 2O8DA 3NG1A 4Q4HB 1DAFA 1JJVA 4P31A 1JNYA 4EAQA 1I4LD 1E69A 2H7VA 4KODA 1E79D 5TB5A 4D0NA 3CUEF 3ADDA 4NE2A 4XIGS 2ONJA 5FPTA 3I5YA 1E1RD 4A9AA 4URVR 2RGBA 3AVTA 1P2UA 3ADCA 5KDOA 4DDTA 1YJ5A 5EE3A 3U3JA 2F9LA 1G7RA 3LQRA 1W5SA 1QHYA 1R10A 1AJEA 2Q3HA 3PQCA 5KPDA 3CPHA 2F3TA 2OFOA 2VSXA 3GLIE 3LLUA 1JAIA 1M1YE 4B48A 4TTPA 1I4DD 2Q6TA 2BOVA 1SVKA 3SJBA 4IDOA 2JLSA 4PAQA 5H1YA 4V02A 5J47A 4D4KA 2C77A 5FPKA 3QF7A 3IGFA 2ZSFA 2OILA 4LJ5A 3DEFA 2GZHA 1CR4A 4EPYA 1TUEA 2ZSAA 3B7GA 5G41A 3FKSD 3MAAC 3G5UA 1N5LA 4B74A 1DBSA 3U7FB 2ZI7A 3W3AA 1NMXA 4C0HA 2PCLA 5H8WA 4KO8A 5J4YA 3VKHA 2F1RA 3ICQB 2ATVA 1XMSA 2D7CA 3NBFA 1RIFA 4KHZA 2BBSA 2OESA 1WA5A 1MO4A 4OBEA 1U2RA 4AYWA 5F9HA 1FTSA 4JZKA 1G7SA 3AGQA 4RZXA 3A1VA 1NNEA 3J81k 5EE5B 4QBGB 3K9HA 1SVMA 4NCJA 3BFXA 4KAXA 5BN5A 3TNFA 2ZIAA 3KKNA 1DAKA 4QRHA 2V7QA 1KI8A 4ZDKA 5JEEA 3ZVLA 1Z2AA 3AVOA 4L8GA 4A0RA 1R2QA 1YHNA 2HT1A 4PPFA 3WYFA 3TLXA 3MLEA 2OLJA 4LBVA 4MGZR 1EFHA 3SQXA 3NBXX 3PXGA 3EG5A 2XGJA 1L2TA 4JBYA 1T0HB 2NPIA 3DMNA 2RGDA 3KQHA 4IVRA 5EXTA 4M1OA 2RHDA 2BDTA 2FDCA 2OHFA 4AG5A 2Q21A 4F91B 1US8A 1VYVA 4CW7A 3PUZA 3IQWA 3A37A 1H8EA 3CX7A 3B1YA 5BN3A 3B8HA 4LYHA 3CNNA 1QVRA 1V5WA 1J70A 2TMKA 4RD4A 1TQ4A 2ZJBA 4Q4HA 4ZCLA 1NI3A 3L43A 1FQKA 4M8NE 3AKCA 3LO5A 1Z22A 1SULA 4XSGA 1K6MA 2ZUDA 3DM9B 4B71A 5J4KA 5M04A 2H17A 2WWIA 3NEJA 2YOHA 1MO6A 1E2GA 4BEBA 2AWNA 4MITA 1U98A 4X8LA 1T8UA 2GBLC 1HQYE 2ZREA 4IVQA 4MKFA 4YONB 1I2DA 3GJ6A 4NL4H 4XTCS 4UXJA 5IHPA 2ODNA 2VP5A 5KO2A 3AVWA 4M1MA 2IHBA 2QORA 3I4LA 1R6BX 3EPHA 4GBMA 1AS3A 1ZC3A 4FMCF 4CEJB 5P21A 4LYAA 1W5TA 4HB2A 2BJWA 3VR2A 1LFDB 721PA 4F93B 2CL6X 2K5UA 4JLJA 1P2SA 1LB1B 4Q7JB 1BS1A 1ESMA 5B58C 3ZDQA 1WP9A 2P65A 4MYTA 1S96A 1YZNA 4RFSB 2Q0HA 4MGYR 1H8ED 2AD1A 2A5YB 1ZNYA 1P60A 2DPXA 2FEMA 1NRJB 1DAMA 3TAHA 2VP4A 3W6OA 1NVXQ 3B9QA 4OQLA 2KWIA 5AUQA 3M6AA 1DEKA 3KJHA 1AKEA 1RRGA 1ZD1A 5JHHB 1XMIA 1X1SA 4Y0AA 1P4SA 1CJTC 1XJ0A 4D26A 1ZNZA 1G4AE 4WAUA 3ZS8A 4PAOA 2IYYA 1AZTA 1RKBA 4LV6A 1KJYA 3QQ5A 5TMPA 3LDAA 5LDDC 3QXSA 4QC2A 2DFLA 4OI1A 2C99A 1S3SA 3BK7A 3HYTA 5AJVB 1Z6YA 4TLBA 2GRJA 3P1JA 4EPWA 1CJVC 5EE0A 3W34A 5H68A 3EPLA 3QE0A 1P2TA 5EP3A 1XTJA 1P73A 4DEYA 3GLFA 2IW3A 2XAUA 3KX2A 4NH0A 1QHXA 2NPFA 5KDLA 3TGPA 3ZQ6A 2G0TA 4LPKA 1LF0A 4UKDA 4AWXA 2V1XA 1R8QA 3QF4A 5JHGB 2QTHA 1XPRA 3AF4A 3GJ4A 3JZMA 2W6IA 3AVYA 2O8BB 1M7GA 1OIVA 1CS4C 3EZ2A 3RSLA 1SVIA 5EZ5A 4LY6A 1KI3A 5FPSA 1N5KA 1IXSB 3SU8A 4US1R 1WXQA 5LD2B 5EP4A 2H16A 2GILA 3MGCA 4FW9A 4KLZA 3EC2A 2X77A 4RKFA 4JLMA 3AP2A 1LW7A 1LTQA 2QGNA 4GSYA 4LC1A 4ZCIA 2RGNC 2X8AA 3V4FA 3WMFA 4L9SA 4DC9A 4XH9B 1GWNA 1DS6A 3AVXA 4XVQA 4DVGA 2O8FB 3EASA 5EP2A 3VR1A 2A5GA 5BN4A 1U94A 3O8DA 2H5EA 4MYHA 2IXEA 1O3YA 5B64A 3I8XA 4I99A 5FOUA 4DUGA 5JS7A 3KXKA 2JJ1A 3LW7A 3KXIA 1PVOA 2ZSEA 3QXCA 3FFBA 4V0ME 1YU9A 3IDQA 3G0HA 2ZM5A 1WBDA 1GDDA 1D2MA 1E2LA 1CR0A 5L3SB 1M34E 4DLZA 1CU1A 5TY0A 2B6HA 4BQSA 4CDGA 4FXPA 3QKSB 2VSOA 4KXFB 3BORA 4D6PA 5JS8A 1G18A 3K9NA 5FBRB 5HTKA 2XTZA 4RFSA 1XTIA 2XITA 1IJEA 5SZKB 3C7KA 3U6BA 2E9SA 1P72A 2O0KA 4P4UA 2ZPTX 2ZRIA 2V8OA 5D3MB 2IYSA 2VP2A 1VCMA 4B3BA 1E32A 3SJZA 1OB5A 2F1JA 2ZITA 3SC3A 1YZQA 3EZ9A 4NCNA 2D7DA 4JMPA 1T91A 1OKKA 3EARA 3OE7A 2IYLD 2EWWA 1G3IA 2F9MA 1Z06A 1RRFA 1KO1A 4XD7A 3A1TA 2IYQA 3KB1A 1IN8A 3EIQA 4JLOA 5AWFC 3VR3A 1WCV1 2OEPA 2MSEB 1G7CA 4W7SA 3GJ8A 4FMDB 5GJCA 2GBLA 3WBKA 1BYIA 1FUUA 4HI0E 5KUTA 4Y0VA 1FMJA 3CR7A 2YWHA 4OQXA 2KJQA 3VHLB 4Q1DA 4TWZA 4QG7A 3KKOA 4ITRC 5FBQB 2O8EA 4LJ6A 1N6NA 1AN0A 2XOKA 4A6PA 4C0JA 1ZM3A 2QMUA 1GNQA 3CIOA 5JRJA 4Q9KA 2WJHA 5G3YA 2Q9BA 2DWOA 4MGIR 1W1WA 3BAFA 4EPRA 1W7AA 4RKEA 1XXHE 1UJ2A 2WPDD 1S8FA 1CIPA 3FMPB 5AJWA 4RD6A 1HA3A 3Q9LA 1ZJ6A 1OKKD 2PT5A 1OXVA 3GJXC 3OE7D 4C30A 4Q1CA 1VCNA 4EQ6B 3EPKA 3EWSA 4Q5IA 2PEZA 2ZRMA 4DB2A 1ZAKA 3K70C 3MUFA 1J99A 4K8OA 2RGGA 3Q72A 4HAWA 4XOIA 1MO5A 3ZJYA 3RABA 1XD8A 3A58B 1GUAA 1N6PA 4IDPA 3VU9B 4JLDA 5AUNB 4OQMA 2ZJ8A 3PENA 2I4IA 3JVUA 2FF7A 1QG4A 1FL9A 2WIBA 2BM1A 2O8FA 4GOXA 5TDHA 4KYUA 2VF8A 3RS5A 1P62B 3REFA 4PC7A 3WNBA 3NBZC 2HUPA 3W5JA 3CRW1 2ZUBA 1CKEA 1JEDA 1DAGA 2PBRA 1E9DA 2RB4A 1L4UA 2C9CA 2XOKD 4EPVA 3BIFA 1QZXA 4YDSA 1BKDR 1E9AA 3LW8A 2JATA 1IAQA 1W47A 2ZI5A 1XWIA 2NMVA 3QKSA 4JSYA 1YR9A 1UEIA 3LA6A 4HZUB 4N0EA 1K5DA 3U4QB 1KK2A 3O8CA 5DI9A 3BGWA 2XXAB 4GL2A 2J41A 2VLIA 4YMUA 2ZJ5A 1AS0A 1E0AA 1I4TD 1M8PA 4TYNA 5DHFA 5D3MA 1TMKA 4R2HA 2X2FA 4Z8XA 2WICA 4UXHA 2AXNA 2XNDA 2G88A 3ETLA 1RVDA 1ZIPA 3I92A 3T61A 4CEIA 1JXOA 4V0KA 1HYQA 3U3KA 1BO6A 3RRZA 3EX7C 4PFSA 1ZD8A 1FP6A 2YHSA 4B2PA 3EIHA 3EZFA 3LQQA 1OYWA 3L82B 1P7CA 1UKEA 4L16A 2XNSA 5L3VA 2BMFA 2RGNA 1C1YA 4E5UA 1QRAA 2F43B 1P6XA 2JDIA 5FUVA 5CJPA 3REGA 3QBVA 4M9ZA 4GZMA 2PJRA 2QT1A 1G4UR 1OXXK 4URWR 3WYGA 3AH8A 3QG1A 2JLRA 3U44B 5CDFE 2HYIC 1QBKC 1XPUA 5FTJA 2IXFA 2VHTA 1UBEA 3D3QA 3KUCA 2GF9A 5EQTA 1A1VA 1UBFA 1XMVA 2A2ZA 2OXCA 1SXJE 1E9CA 1S9HA 2XSZA 3NXSA 1KJZA 3IEUA 2CLSA 3A1UA 3CF2A 4GPTA 1LV7A 2BIFA 2I1QA 2JJ8A 3C16C 1U0HC 3I32A 2D2FA 2DBYA 4RVCA 5E7JA 4KITB 4TZ0A 2X19A 4ZV4A 3WY9A 5BXQC 3CWZA 4Q21A 2ZYVX 4BFZA 4GT1A 8OHMA 1CP2A 2BHRA 2XNDD 3HP1A 4GZLA 2NZJA 3FHTA 1XD9A 3PJRA 1R5NA 3RWMB 3ZQJA 4M22A 3RS0A 1XDBA 4QBHA 2HF9A 5FFMA 3N70A 2QM8A 2F1HA 4TMWA 3NDPA 1P3JA 4PC3A 4HAVA 1X6VA 4KSBA 4JKIA 5IF9A 4EQ6A 4H1VA 3TVTA 2B8WA 1EG7A 1CRPA 4UNPA 4DDVA 3KQKA 5BW8A 2O52A 3ASYA 4M1KA 4OK6A 1KY3A 1JALA 4TQUS 1KAOA 2FE4A 4X8HA 2KBEA 4YMTA 1JR3A 4NKRA 3RLFA 1EK0A 4M9SA 4X8OA 3T35A 5E95A 2GXQA 1NVUQ 2NO9A 3DL0A 3EWAA 3FTQA 4G5OA 1UDXA 2ZI6A 2ZI4A 1XP8A 2GJKA 3OAAA 2PZEA 1IY2A 2XSZD 3TJZA 2JLVA 3LVQE 4KFTA 1T5LA 4PPGA 2QQ0A 3A6PC 2ZR9A 3FMIA 3QNUA 4QNRA 3OIUA 2GCOB 2H8KA 4BLSA 1VDZA 4WZ6A 1E4VA 2B7CA 3DPUA 3LV8A 4UNQA 2C78A 4TSFA 4PHFA 2FU5C 1MT0A 2OUKA 4IEEA 2IWHA 3X1ZA 4PXAA 4HZUA 4PTLA 4YDHB 2QSZA 2DB3A 4XJXA 2GJ8A 3U4QA 3ICEA 4QJ5A 2ZVQX 5B2ZA 1AS2A 3NC1C 1G5TA 2DFNA 1XPOA 4OHYA 4KVAA 1VKJA 3B5JA 1CXZA 3QENA 2L0XA 1G20E 3BFVA 1Q1QA 4PZLA 4BLTA 1W4CA 3MCAA 2QMOA 3KJGA 4AYTA 3VFDA 4B32A 2G1KA 2RGAA 5CYPA 5DO9A 4RD2A 2ERYA 3MWLA 1SKYB 1ELOA 1SKYE 4HB4A 4KBFA 2WAXA 3VHXA 2ZE7A 2C04A 4NCKA 4TLCA 1NG1A 1LVGA 2CNWA 2XJ4A 4ACAA 3R8FA 2QUZA 3LBIA 4DIDA 2GTPA 2WAYA 2LCFA 3OAAD 4YMWA 3WHLA 1AA9A 2VEDA 4FMBB 4KVGA 1GKIA 1XF9A 5KNBA 3OIWA 3VQTA 4I81A 5FBLB 3T1VA 4F4CA 3GLHE 4BUJA 2KI5A 3FB4A 1DAIA 4Q7MB 4IFBA 3U44A 3C5HA 3P4YA 1IM2A 1OW3B 5JWRA 4MRNA 3PG5A 2XZOA 3X1YA 4B35A 1DG1G 3AKYA 3BBPA 4GFDA 3U61B 4QHYA 2BMDA 1KKLA 1LNZA 3FHOA 3QBTA 4G3XA 2J3EA 2QA5A 3GPLA 3FWYA 4FMDF 3NIBA 2JIZA 2QY9A 2WMNB 4MKGA 4TN1A 5AR1A 4D4LA 2HCJB 3IUYA 4LHYA 4NCHA 2QBYA 4IDNA 5AJYA 4QKQA 1IN7A 3T1TA 2BBOA 2C2HA 2HCBA 4NYIR 3B13B 3W8NA 2O0HA 4HLQB 3AKEA 2CNWD 4OHXA 3GLGA 3AV0B 1OT3A 2KE5A 1PLLA 2OE2A 2YYZA 4NYMR 3UPUA 3L8YA 2CHGA 3RNLA 5KTYA 3DO6A 2GEDA 2MMCA 1HE1C 2F1IA 3B1XA 1J8YF 4Z1MA 1Z0KA 3OF5A 4QGGA 2O5VA 4IFEA 2PCJA 1ETUA 4C7OB 1AIPA 4PC2A 1Q22A 3KQNA 2FMXA 2GZAA 4LBYA 4EPXA 2WSSA 2WWYA 2VF7A 2CEAA 1Z08A 2EWVA 3OFNA 2G9NA 1D8TA 1Z0DA 2VL7A 4DCUA 1EFUA 1R0XA 3AF0A 2QT0A 2ZR7A 3MWYW 3WRYC 2W0SA 2FV8A 1QF9A 4BFYA 2NGRA 4LRWA 3QY0A 2RCNA 5H70A 1YQTA 5FUXA 4HAXA 1TNDA 3SEAA 2EFHB 3DOFA 3HU1A 1TF5A 2HYDA 1N0UA 2QQEA 5DIFA 4ACBA 5ANRB 1EX6A 1P2VA 2QENA 1FX0B 1X86B 2GK7A 3RRNA 4BZQA 4CGZA 2B92A 2ZJOA 2NO7A 4HUQA 1NBME 2DFKB 1KI9A 2FG5A 4TQAA 1DO0A 2ODEA 3AF1A 5C2JB 4LI0A 4PANA 3MG9A 4EJSB 1DG3A 2BCJQ 4NCIA 3G82C 2HXYA 1WB9A 3MRSA 1KSHA 4DBLC 4WZBE 3FKSA 2WV9A 2WJIA 2X1VA 1VG0B 2ZU6A 3FFAA 4WIAA 4WOPA 3WMGA 1VHTA 3OFND 4B3DA 3RYTC 3WNDA 4ARZB 5AUOB 5LPNA 4HLDA 1E2EA 1OSNA 3W6PA 3IHWA 5JJLA 5DI3A 4N3NA 2NOAA 5KU1A 1IJFA 3ND8A 1FNMA 2HXSA 4R98A 4ZIRB 2ANCA 1Q57A 1QG2A 3MJRA 1O87A 2ATXA 4OJQA 1VYTA 2KSQA 5JCZA 3THWB 2GJSA 3M0EA 4R9UC 1EFRA 1MR3F 3I72A 3K8YA 1KYIA 2GF0A 2GXUA 2XB4A 2J0SA 1EWRA 3GLIB 3PCRB 1F3OA 2A7QA 1KOFA 3IIMA 1XNJA 2ZAOA 4FCVA 2R8RA 4TLEA 4A0HA 4KBGA 1Z2CA 2VRWA 3RVBA 3A4NA 3LLMA 4C9BA 2IEZA 5F9FA 1EGAA 2H57A 5HR5A 1K5GA 4D0LB 2VHQA 2VPPA 1KI4A 1OXUA 5DYGA 1NN0A 2BC9A 2C03A 5UKDA 3IQXA 2PX3A 2QROA 3ND9A 4B2IA 3D31A 2VBCA 1N5IA 2GWHA 4XTRA 4KFUA 4UNNA 4HAYA 4DEXA 3B85A 3NDBB 1KO7A 3T5GA 3BB4A 4NU0A 4EIWA 3GP8A 2C8VA 3CWQA 3C14C 4LBWA 3HPRA 4RCZA 4C7OA 3ZZUA 4LZZA 1R8SA 3I61A 1T0JB 4LDJA 5HZHA 4PPNA 2J7PD 1E0JA 1EFRD 3RDPA 3RS2A 4G1UC 4QNMA 2AHOA 2WOJA 3DKVA 1HTWA 1BMFA 1KSGA 2D2EA 1A4RA 1CR1A 1E2QA 3GFOA 3F8TA 3LWNA 3NHBA 1XTQA 2UZIR 3CPEA 3FPAA 2IL1A 3UK6A 3U6KA 3ZYCA 2IUSA 3ONWA 2VIIA 3KQLA 3GEIA 3WNCA 1OH7A 4HLUC 3Q7PA 2QP3A 1FX0A 2NG1A 4DLYA 4BEJA 2AKYA 1R7RA 2ZUCA 1Q21A 4PQRA 3A8TA 2R9VA 2FA9A 3X1DA 1J2JA 1NY5A 1OB2A 3TUJC 1II9A 4B73A 1JPJA 1EWQA 3BFKA 4EFMA 3U2QA 1R5OA 4NDZA 3NEYA 2JLXA 4EJSA 4Q4JB 2GVDC 1MKYA 2A3RA 2WOOA 1DELA 1JB1A 1NMZA 1E2HA 1WF3A 2ANBA 4M2LA 4UQOA 1G8GA 2IS1A 2CMKA 2D06A 3C15C 4DLTA 3BE4A 1E0SA 1S9DA 5C46F 1U99A 2OFWA 1KHTA 1Z07A 4IOMA 4ARZA 5A5GA 1GTVA 3AUXA 4Q47A 2BEJA 2WKQA 3W9YA 1HEIA 1BMFD 3QVVA 2BV3A 3T12A 4A6XA 4CT5A 4EPTA 4TL6A 4Z8YA 1TEXA 3BH0A 1P61B 3IPXA 4ZIRA 3UMFA 4PC6A 5LB2A 1NG9A 1L8QA 5CLLA 4GP7A 1H65A 4UJ3A 3UKDA 2FEOA 3WMEA 3CLVA 4IOJA 4O0MA 4Q4AB 2GVZC 4LHVA 1GRRA 1ZM4A 2GEUA 4UJ5A 4S35A 4PO8A 4XWKA 5HZKA 2ZXUA 2QAGB 3DZDA 3GLIA 4HUTA 2JLYA 4TYPA 3AB3A 2EFGA 4DLUA 1UAAA 1AQUA 4OQNA 1NBMD 4IDQA 1Z0IA 4MRSA 3LRPA 4M21A 1XCGB 4Q9JA 4C4PA 1E2IA 3W90A 2WTUA 5EP1A 1OFIA 1KO4A 1YR6A 1NIPA 1G7TA 2R6CA 5GVSA 3IIKA 4OK3A 5LD2C 4LGMA 1Z29A 3CRMA 3ZZTA 2ONKA 1IN6A 3U3RA 1HT1E 1NVVQ 2B21A 3WBJA 2WJVA 1ZINA 4DZZA 2HJGA 2ZE6A 2YV5A 2REBA 1F6BA 4U7DA 3RWOA 3NHAA 1KK3A 2VP6A 3CNOA 4ZI3A 1ZD9A 3DHWC 3F5FA 4ZKEA 2Q9CA 3Q8XB 1YRAA 1TAGA 221PA 1EX7A 2CJWB 3P20A 1ZM9A 4NP6A 2J1LA 5HKKD 4ZDIA 4URXR 1G5RA 2YJTD 3KKMA 1N0WA 2DR3A 2V3CC 1W2GA 4EDHA 1ZCBA 4BZXA 3KTAB 1W4RA 1JXMA 5KYKA 4US0R 1ZRHA 4B6EA 1OFUX 2JLWA 1G16A 4PQFA 4KSCA 5HE9A 1G8PA 4LJ8A 3U60B 2CE7A 2FN4A 2WMOB 3TQCA 2ZVPX 2AL7A 3ZLJA 4RCYA 1TQDA 1KK0A 4UNRA 4C0BA 2ZRDA 2Z43A 4FI3C 4V03A 1JAHA 1KMHB 5FPYA 4OHVA 2RKOA 1E2FA 2AK2A 3UG6A 1RZ3A 4MDFA 2IYWA 3LAWA 1VCOA 2ZJ2A 1XCMA 1JPNA 3K0AB 1UEJA 5JJKA 1D2EA 1W49A 4IKEA 2QN6A 2VH5R 2W00A 3TW8B 1GITA 5F98A 3CO5A 5BYKA 1FP7A 3IIJA 1YZGA 2GKSA 3KKPA 5TVKA 4JS0A 1E1QD 4Q9IA 1ZIOA 2GCPA 4NHOA 2MSDB 2ZS9A 3T15A 3OEHA 2NQ2C 1Z63A 2FGJA 5FH9A 2B8TA 3TSOA 2R65A 3N5CA 3RS3A 1E2PA 1KY2A 1UM8A 4B33A 3B60A 1KI1A 4Q9LA 1X3SA 1ZUIA 4M9XA 2WBLC 4Q4AA 3Q85A 2RGXA 4CEJA 3SR0A 1ZNWA 1S3GA 1TF7A 1GRNA 2PMKA 5EUQB 1XTKA 1TL7C 2OAQ1 2AWOA 4LSGA 4IOLA 2G3YA 1RYHA 2XZPA 4NMMA 1DVRA 1T3SA 2ZE5A 1E6CA 4HLUA 1E9EA 2CDNA 3P4XA 2V6IA 2N42A 3B2EA 5JWOA 2ZYTX 4B76A 4TMVA 4MRVA 1NIJA 5FI0B 5TXGA 1BOFA 3BERA 4KYIB 4TMZA 1G9XA 1U9IA 3TSWA 2WPDA 1X8LA 4BGDA 1XBTA 1ANKA 5IDVA 5IRCD 4US2R 1OYYA 4ZKDA 3OEHD 1D2NA 2LWIA 2QGZA 4PHGA 2IF2A 2GAOA 1TF2A 2DYKA 2OCYC 3DZ8A 2IS4A 3WP1B 3K9GA 2YOGA 3HU2A 3A1SA 3RANA 2ZE8A 2DCUA 2EFEB 1GZSA 2CJWA 2OG2A 3FVQA 2G83A 1RRPA 1OJLA 2OT3B 3C41J 4C2UA 3DMDA 4RD1A 4URYR 3IKJA 1VG8A 3PEUA 3PFIA 4OKSA 1G21E 1M7HA 3I73A 3QIAA 2QG6A 5DHAA 1ZBDA 4C3ZA 3SS8A 3AVQA 3QEJA 1Z28A 3KTAA 4WVFA 2XTNA 5G3ZA 2QZ4A 3QXJA 4QBIA 4E09A 3FMFA 4MKIA 1A82A 4DLWA 1S1CA 4L5BA 4UNSA 3TE6A 4DLSA 1UF9A 3I1FA 1PUJA 2QRNA 2O8BA 3TMKA 4D82A 2FX3A 2NO6A 4HAUA 4B3GA 3LH5A 1G3MA 1XXHB 5AJXA 5FL7A 1W36B 2OBNA 5DGXA 1GRQA 5CB6A 4ZCMA 3K0EA 3EA0A 4EFNA 1GVNB 1M7BA 1GL6A 2VP9A 1GSIA 4ZO4A 4GOKA 1T4GA 2IS6A 5C1BA 1PZNA 4LJ4A 5DYIA 2REOA 1MO3A 3U7EB 4QGFA 4IVPA 1EXMA 3PEVA 1VIAA 3L2OB 1WBBA 1GNPA 1L7VC 4HB0A 5JJIA 2QM7A 4BWYA 3LXRA 4K81B 1KDOA 2DHRA 3VR5A 4B47A 4RJLA 2R6DA 2R6AA 2WKRA 3EIEA 1TEVA 1AQYA 2OM2A 4B2LA 1KDRA 2WHXA 3NTUA 3S1AB 3OESA 3ZVNA 3IO3A 1Q1BA 3OIYA 5EE9A 5EXPA 4V0MA 2QMEA 3R9IA 3RRYA 1E9RA 2ZRGA 2ZJZA 2Q9AA 3LX5A 3U5ZB 2W2VA 2C9OA 1RJ9B 2GDJA 5L3SA 2RH5A 3BRWD 4AURA 4CZ2A 4J0QA 4IOKA 4Z51A 5FL7D 1UKZA 4R7ZA 2ODBA 1F2UB 2IS2A 3KB2A 4HDOB 3CKLA 2CLCX 2OV2A 5KDDA 4C0KA 1D9XA 1COWD 2BCGY 1T5IA 2HJVA 4IEIA 4NYIQ 4PHTA 3EPJA 5ELXA 2EFDB 1XB2A 3WXMA 3B6EA 3FGNA 3NKVA 1G64A 1CEEA 2N1BA 4BFUA 5KSZA 5GJWC 5DH9A 1E94E 4NYMQ 1GNRA 4DCNA 3KKQA 2J9RA 2GESA 1JEEA 1Q3HA 1ZU4A 1TPZA 1QVAA 4OK5A 2IC5A 1II8B 1KO5A 2IK8A 1SZPA 3HU3A 5J40A 1RE0A 1RW4A 4OHZA 2AXPA 1UDWA 1W4AA 1E2KA 1XTRA 4KCGA 2ZRFA 3CB4A 2ORVA 1N6OA 2PX0A 4DHEA 4LUCA 1KSJA 4AKIA 2I1VB 1AM4D 2CCKA 2GNOA 1SXJB 1Q3TA 5BYJA 2ECKA 4Q19A 2CHVA 3AGPA 5DISB 3SHWA 1TTTA 3QKTA 5GVRA 3SBDA 4QL3A 5FOSA 1XCPA 2P6UA 3QEOA 3H1TA 1IBRA 2QMHA 1Z0FA 4DDWA
chains in the Genus database with same CATH superfamily
1ZHHA 1F48A 3RVKA 2P4HX 2ADMA 2AGVA 1OU0A 2I8LA 2OFPA 3CVWA 3W05A 3FUCA 2NAFA 2QHXA 1T26A 2D1FA 3JYOA 4O5OA 3LK7A 1GCUA 3KSBC 2BISA 2XMRA 4FGUA 2EKPA 4JNKA 3TB4A 3PNMA 2IXDA 1KKMA 3ZWVA 2WNIA 1AN9A 1T2NA 3FCEA 5L4SA 3H0KA 1PJRA 1M8JA 1G3RA 1M0SA 4AY3A 2QVBA 2B0CA 4QU8A 1B6SA 4JSTA 4YMLA 1V0JA 2XB9A 1GZUA 3L77A 5AJTA 3U3MA 1I6MA 4MGKR 4URFA 4DJTA 5IBPA 1KYTA 2DRIA 1YDHA 2VAVA 5LZ4A 3QI2A 1Z5ZA 3HDTA 3MGGA 3CRZA 3GJ0A 2WSBA 1N8TA 4JYBA 4IXTA 3T4PA 2A6PA 3VISA 2NU6B 4NMXB 2C4UA 3ZZNA 2A78A 3UB4A 1IY0A 2PXXA 2ZSDA 2XVAA 5EGSA 3H2KA 4P4TA 3VDNB 3AU8A 2AF4C 1KYZA 3EIXA 1RKQA 1N7JA 1ODTC 1ZRNA 4F5YA 1MABB 4KPYA 2XUDA 4HEHA 2ZBGA 3DO8A 1KNQA 1AKQA 4NV0A 4K6FA 4PFKA 5JASA 1W44A 4HMPA 1GAQA 1NJ1A 4S1WA 1DPFA 4BXOB 3WIVA 4E3WA 5F5XA 1IG3A 2ST1A 4MA5A 5BOVA 3R9WA 1Z38A 4V0OA 5JCPA 3H1EA 1FBNA 3NWPA 3PC4A 3CEJA 4CUKA 5KWIA 3MD9A 1Z15A 4L2IA 2R1TA 1OGYA 4O1IA 4BFVA 1JSRA 3ZJ5A 3DTVB 5E1OA 3NASA 3RAGA 2Y77A 3JRXA 4PYRA 1JQLB 5EWMA 4AP6A 4D4HA 2D13A 1Q0UA 4YR7A 2CBGA 3L40A 3Q8WA 4EUSA 2JGIA 3ZR4B 1NVKA 5PGMA 2FSUA 2DWPA 1L4HA 2ZRQA 1Z7YA 3L7CA 2CUKA 5KYNA 1KTIA 3ZTTA 2P2DA 1UK9A 4INJA 1VMAA 5FTWA 4DXAA 1RI1A 4U7FA 2JFQA 1EGHA 2O2CA 3N74A 2YWDA 4H7EA 4K2HA 3ZE1B 1O0BA 1J1ZA 3PLNA 4NS4A 3I62A 2NTYC 2AW5A 3M82A 5EZ6B 2RHOA 4GBGA 1FCJA 4TT3A 2VJNA 2PSSA 2VJLA 2HDNB 3QLVC 4IL5A 3V7YA 2A1IA 1ZU5A 3CO0S 4BQFA 1H23A 2CF6A 1Q2UA 3T7AA 2GPWA 4M99A 1E5QA 4ZK6A 2XTMA 4CQLA 3WRXC 2UVDA 2WWWA 3D2AA 3EDRA 4UPDA 4GMGA 4TMXA 4J1TC 2C9YA 2CXUA 3O74A 1D9ZA 5JCJA 5BSFA 2OCBA 1E8DA 2AJCA 3AUYA 1V26A 4W1SA 4R2LA 4CM6A 1LDEA 2HBYA 5JAMA 1Z47A 2F2TA 1LBTA 3GJ5A 4O02B 3HBMA 1FF9A 3FPCA 4MP3A 3D3JA 4NPHA 3R1IA 1PV2A 2Q9UA 5KSPA 3ZBQA 1GCAA 4E30A 5MN5A 3KB8A 3EULA 4B7AA 1DKPA 2W2KA 4YQYA 2EFYA 4LTMA 2CMHA 2CKMA 2Q4RA 4RPHA 5ALHA 5K0BA 3EJ6A 4IUBS 4NC9A 5FUYA 1ACLA 1DOZA 2QRHA 4EJSC 4QFMA 1A9PA 2BZSA 4PQGA 3MJFA 2GN8A 4R41A 5K3AA 1E2NA 3SJ7A 1M6YA 4A0GA 4C6TB 2IIBA 3EMVA 5MHTA 1RPNA 1WTAA 1NVEA 1ZCZA 4HQOA 2HF8A 1MMFB 2EU8A 1ISMA 3I8SA 3IP5A 4HWPA 4UULA 2VJDA 3U7IA 2GJAA 1Z37A 4JASB 1L5KA 2VHCA 3VKWA 4O59O 1F5NA 3CXRA 4NU6A 4IIYA 4RSHA 4MCJA 4TT3D 2PLFA 2Y92A 4IXMA 2VO1A 2GXSA 4WBNF 5BQXA 3L8ZA 3DZKA 1ZI8A 2VXCA 3HBJA 2BCEA 2ZRKA 1ZONA 3TTUA 3N0XA 3CBQA 1DTSA 5DLEA 3UFBA 2UU9B 3URMA 5LIRA 4DV1B 3ZCRA 5EMJA 5JCJD 2I6SA 3RYHA 3S2SA 5C52B 1ISGA 1KS9A 2J46A 3VOSA 3FCXA 4CMCA 1I2MA 1YONA 4M89A 4P4SA 4PV7A 1QJ4A 5AQ1A 5JNTA 2ZBEA 1L4MA 2G5CA 2HA4A 2JARA 4FJ0A 2Q5EA 4OPMA 3RARA 3PGKA 3DLBA 2WKPA 3DZGA 4GHWA 2HNAA 3MRXA 3THYB 4QPPA 1OAAA 1KYXA 1U9YA 1WDTA 1PJQA 3BK2A 3EMDA 3HFGA 3LRTA 3PNQA 1K7EB 3ZHSA 2IX3A 1X15A 4LX0A 3HCOA 1WHSB 1IPHA 4U2KA 3EXIB 3RS4A 3T41A 4DMUB 3G2MA 1SWVA 2GCNA 3EFOB 1I4OA 4QRDA 3QV2A 3RK4A 4JP3A 5C7LO 1AZWA 4C5BA 2HZ7A 3VC7A 3VKGA 3NFYA 4OGKA 2FW8A 2OTCA 3H65A 4MO2A 2D4HA 821PA 2XQGA 2NTNA 4D25A 4P36A 2MMGA 4ZOLA 2QUIA 1J1IA 3ESRA 4X8MA 3KTFA 1OX4B 5BRJA 3ADOA 4OGWA 3H18A 1Y63A 4WZBB 1FOEB 1AA6A 2ZRCA 4N01A 2PT6A 2YNMC 5KAPA 1JBKA 2ID9A 2LTAA 2W7TA 4RVNA 1AKRA 2AN1A 2XMBA 1GZ5A 1M1ZA 1X3LA 2Z8XA 4XIIA 1JFVA 1K4MA 2GCEA 4AG6A 4AO7A 3SR3A 4B6FA 2W2NA 5AKLA 3TKAA 4A2WA 5C7OO 5KTSA 1UODA 2YC4C 4UHCA 4AC9A 1YHYA 4CMIA 1KDPA 4RQAA 2FFBA 3U1VA 4BRWA 1ECPA 4RAQA 1Z2EA 5ARCA 1F12A 3Q3GE 5FUWA 3ZKWB 2VQEB 3U81A 3OD1A 2YC2C 3O4HA 2FSIA 5D3ZA 1PT7A 1I5OA 3LQ2A 3A6DA 3GAZA 4QM7A 2ECOA 5BSKA 4QLBA 1R4ZA 3OIGA 2G63A 1XV5A 3JTEA 1QV6A 5AICA 2VQFB 2XB2A 1S8AA 2IUTA 3QLUC 1UMDA 4CMBA 1WUIS 4AMZA 3AIMA 2JAPA 3SGLA 4B3FX 3NH9A 3LY9A 1V1RA 4ZI7B 4B34A 2O2GA 3GIDA 3HB1A 3O2NA 1J5PA 4XDZA 3NKFA 4XJVA 2R8OA 4XQ0A 3EW9A 4HDRA 2Q28A 2MINA 1U8YA 1MOQA 3SG0A 3EXFA 2W6MA 5KKNB 3SPXA 4DCPA 4E32A 4J7UA 1RWQA 2GJ9A 4V2UA 4L02A 5C4MA 3CE9A 5ILQA 4F6RA 4QDZA 5IKPA 3IEMA 2GN1A 1NJ5A 3HNRA 3CR8A 3D7MA 3EGEA 4HQFA 2QRVA 4CKBA 2IDKA 2QLNA 2DJ5A 2RGWA 4EUEA 1FQWA 3B8EA 3P5BA 3TLEA 4BNWA 1UXGA 3RNOA 1EBFA 5FL3A 3PQ2A 4FINA 3E1SA 2JB9A 3KV1A 1O5OA 4Q9NA 4ENQA 5IJ0A 4P84A 3T0FA 3VNUA 1KR2A 4FC7A 1GSHA 4JUFA 3ZVRA 4H6VA 1P9OA 5TQ0A 1CZRA 1U7HA 2GA8A 2PZKA 2UAGA 4LDAA 2PLRA 4DSUA 4RX1A 4W6ZA 3PQ8A 1XNGA 1V8ZA 2K7ZA 5LP6A 2HHCA 2QAGC 1MJHA 2YZ2A 1R0ZA 4DBLE 1EJBA 1B7GO 1DTWB 4AD8A 5CYFA 4RL4A 1XZBA 1HOTA 2D00A 4MP6A 1SAYA 1ZK1A 5H9VA 3KEFA 1RSZA 1YHZA 2ZTVA 1UPFA 4UHEA 3UTDA 4BQOA 1TDJA 3OA0A 4IFIA 3TGWA 1WKVA 1TK9A 4F3TA 2BMJA 3D4IA 3D64A 1IG0A 3P9SA 1E7SA 3GLFB 1C7EA 1NBMA 1TZ2A 4D41A 1DC4A 1V37A 1NL3A 1KL7A 1QMPA 2YFYA 1L7MA 3T9CA 4FOTA 4HDNA 1AK9A 2WJ6A 2PG3A 1C7ZA 3A6EA 3ZHCA 1PE0A 4IIEA 1MRSA 2YXNA 3RVRA 2H51A 2VSQA 4TGLA 3NIFB 5FLXA 1S8OA 1ZSVA 2BF4A 1U8ZA 2B3DA 2IYNA 3E7XA 2OGWA 2PKXA 1P1FA 2VJYA 2MSCB 3F8WA 3M33A 3OMLA 1RC0A 2IEYA 3OG9A 3PTLA 4LWOA 2Z6VA 4URZR 3VTAA 5B7NA 1M10A 5G53C 4OU5A 3HFRA 4AY2A 1PN3A 1P1IA 1FB5A 1UXKA 2F3PA 4CIXA 3HRKA 4LHXA 3DMFA 2BFMA 1A9ZA 2DEUA 1PAUA 1J2UA 4OXXA 2IE8A 4CEHB 3FTPA 1PSWA 3B1ZA 2FSFA 4WDQA 5CHEA 4WKOA 1TM3E 1NP6A 3DPIA 2UVQA 3PXUA 3H42B 3TS1A 3FNBA 2VA9A 1YS6A 4HV4A 5HKKA 4P5PA 4YFYA 1GV0A 2HMTA 4R7TA 2GERA 5J23A 4K86A 3MWKA 2WM9B 1QTRA 2BUAA 4IILA 5F1OA 5JOQA 1U8EA 4YRZA 3DOJA 3DVQX 2H1IA 1V3VA 3R6WA 3Q1KA 4O4LB 2A5JA 4D4JA 3ZK8A 5THQA 3KT3A 3DQPA 3GDOA 2IUFA 4JP1A 4CYMA 5HKAA 3MCWA 5B1HA 5DYNA 1JG3A 5CDGA 4JYAB 2ZG6A 5FOWA 3UEOA 5CA1B 5IH7A 4B8YA 1T3HA 1ONSA 2JIMA 2LDBA 4Z49A 3G9ZA 3AKDA 2GZDA 3ANLA 3KUUA 2FSVA 3HYNA 1WSBA 1CZHA 3P0RA 3QZUA 4YAJA 4QGBA 4CG3A 1TM5E 1M73E 4L9WA 4D0GA 1F4PA 4Q1AA 1V35A 4KQHA 1H2HA 1HFJA 2GD6A 4P54A 3K0HA 3TOXA 2C57A 2H5LA 5HBGA 3RVDA 5LXTA 1KI6A 3DCNA 1WUTA 1EGQA 4YDRA 2Q2QA 1U8TA 2EZ4A 4MYUA 2HL6A 5E4JA 1VECA 1NW4A 1OE0A 1P9RA 2RH9B 1QP0A 4ZEOA 4FZRA 5I8PA 3TZ6A 4EFKA 2CFOA 5IAJA 1ONOA 3E5HA 2FRDA 3E9CA 2X4LA 4N6OA 3L8MA 1NI4B 2GN2A 4LNHA 4WFJA 1XMOB 4FGLA 3TDKA 1P1RA 5EMHA 5CLQA 3VU0A 3JZAA 3KLBA 4EW1A 2XE6A 3PFNA 5EKDA 4EGFA 5KKCA 1KEEA 3AEKB 1NSFA 1THZA 2B9EA 4LGVA 1FFHA 1H6AA 1V3UA 3IUPA 2YDXA 2GO7A 4RK0A 1XMJA 4X93A 4RMNA 1A9TA 3NB0A 3MMZA 3TX2A 3OEWA 5E3HA 4O4IB 4MX8A 1TW2A 5JALA 5P8WA 4B3CA 2MYUA 2HW8A 5FCDA 1Y3AA 3M3HA 2BBTA 3CMCO 4KQIA 3W9UA 3GUYA 4HGZA 3ZIAA 3WLEA 3HI4A 4D44A 3FPGA 3OP1A 2FMIA 5B57C 4EQZA 5J2TA 2C98A 2HLHA 4QPCA 2ZRBA 4LSMA 1EFTA 1QORA 2IY9A 2J0UA 4JCOA 4A0QA 4AB1A 3K53A 4NFHA 3RAFC 4AZ0A 3SBOA 1UP4A 1ZK4A 4XASA 1UBKS 2R7NA 4BQPA 1YD7A 1ULBA 3UT5A 1NUAA 4D9JA 2MSLA 3IBYA 1BH2A 1Y8RB 2XGGA 3EZNA 4D6YA 4B6RA 3DDUA 2J6IA 3QOFA 3T34A 4W5QA 1X13A 2C7GA 2I4TA 1Q77A 3JALA 4GRAA 4FCTA 4N0MA 1X1EA 4R2KA 3T7RA 2O8EB 2HIHA 3R6DA 4W63A 3R5KA 1PIWA 1F0NA 3K0FB 4O2AA 2QP9X 5FNVF 5L3RA 2BGGA 4NBSA 3RAPR 2R1UA 3WDKA 3LBHA 3S5JA 3K6SB 2I7XA 2PNJA 1QH0A 3LUGA 1CY6A 2BI7A 2R8PA 2JK0A 4W1RA 5C31A 2R0QC 4MEAA 3R7FA 1E18A 5SY6A 4O2BA 1W9HA 1XJQA 3D4OA 3EGDB 4Q3DA 4HQRA 3TKLA 4GKJB 5B3JC 4GRDA 5HDBB 1YIOA 1VPVA 2XMSA 3ZOKA 2XYRA 5IMBA 1JFFB 1CUXA 1YGYA 2FQYA 4LFAB 2J3KA 3BICA 4XSHA 4ZJYA 2O3TA 1X94A 2VDNB 4V0SA 2IYPA 2LKCA 2CJYA 3MT9A 5FOXA 3ZIAD 3COJA 3QPCA 5EIWA 3DZIA 2EX4A 2H1HA 1CUUA 1KXJA 1VPLA 2P68A 5LBIA 1N2CE 4OX9B 4I4NA 1JZSA 3NOXA 2DBVO 4G9BA 4MB2A 2GXAA 3HLYA 5TPWA 2QB5A 3BYZA 2QTVB 3MBIA 4FILA 3L0CA 4LJAA 4DEVA 2ZT5A 3SN6A 1C9YA 3DAOA 1ZMXA 3G2IA 3U7GA 2EF0A 3G2NA 3IODA 4RSGA 5DLYA 5U1PA 3RFVA 4L73A 2RHGB 4PSUA 3IVAA 1MQ9A 3QELA 2JFGA 4YYEA 2BF7A 2IT1A 4COKA 2X5KO 3DBLA 4HZIA 4Y7CA 3TLCA 3RKRA 4DW8A 3PK0A 1MJGM 1V25A 1G4HA 2QTZA 3B2QA 4X91A 4E07A 1TO2E 3F7NA 4L5JA 1LRLA 3WQQA 2WB4A 4TS4A 5JZ9A 4J03A 3VPAA 1SKAA 1Z39A 2FSPA 1XVTA 3HU5A 4NFYA 4WXYB 4FWTA 3PV0A 5FLYA 3UXYA 4R9VA 3MCTA 3GZTB 3IP9A 4BUCA 2Q3MA 2D6FA 2H4XA 5DN6A 4JA0A 1YBFA 2C94A 2WWFA 1NPYA 1KDZA 1OR8A 1M2EA 3VOAA 2JLUA 3WWPA 1F7UA 3K0BA 4HNQA 5E2AA 4H1TA 3HJFA 2B6NA 4KIFA 4GX2A 1N32B 5DJ5A 3DE3X 2V9PA 3U19A 1N2IA 1DLJA 4GM0A 4RNDB 2B4YA 4POAA 2OCGA 2C7BA 3HJGA 4C2AA 4OOFA 1FNNA 1R9JA 1BW9B 2VZLA 3TD9A 1XZGA 4TTRA 2MR6A 3IKMB 5K6AC 2HAEA 3QSYA 1QQ7A 3GFPA 2QVXX 1KQOA 2QU7A 4FE7A 4Q05A 3RQSA 3TFWA 2FFQA 4CM9D 3RS7A 1OJ7A 4Z1OA 3OT5A 5K8TA 5CPFA 2JGFA 4U2CA 1YOVA 1A95A 5KC8A 4B6PA 5K5EA 3N2YA 3ZW8A 1G8YA 1HT0A 1Z0JA 4MIKA 4F2HA 1LBEA 3CZPA 1TPYA 1PG2A 3WBFA 3G0GA 3V4OA 5LBUA 1PG5A 2JIOA 1A2KC 2RK3A 4OJYA 1U28C 3CUUA 5HCNA 1V7QA 3D7KA 1VB5A 3F3KA 4CR7A 4ZANA 1PJBA 4YT8A 4YDQA 4G81A 5BQPA 1FNCA 2O2SA 4BFSA 10MHA 4H7KA 5DN6D 4JBNA 3OOWA 3ZDBA 4FCCA 1FX1A 4MP8A 3GB9A 1K8RA 1WO8A 2J9GA 4GQAA 1Z2OX 4IIHA 4UAGA 3KYDB 1SZJG 1JMVA 1L1EA 3MS2A 3JQ7B 1QHFA 1EE2A 2R8BA 3ESZA 4UXIA 5HF9A 1TMYA 4P53A 1QGUA 4C08A 5F64A 1OBOA 4GBED 4FBMA 1GFZA 1V2GA 3G0CA 5K03A 3KJNA 1TMGE 2DY1A 2V5VA 3I05A 4NOLA 2XVZA 1JPVA 1QZUA 1NVVR 2VDLB 3BJEA 4X7RA 1E5LA 1G8AA 3DT9A 2OUIA 5CIQA 5LB4A 1FEZA 5T4HA 3SYRA 1DKRA 4BJ5A 4AKHA 3PE6A 4ADSG 5HPYB 1QTIA 4WUVA 1FSGA 4K46A 4PBTA 1T6NA 1R12A 3SXJA 5T3UA 3KL2A 1XP5A 2JGNA 4C04A 1T36A 3L07A 1SC9A 4ND8B 1E6WA 1U7WA 3C48A 4FIDA 2ZYUX 4PAGA 2I91A 4RM3A 1RDFA 1FXUA 1G8HA 3O90A 1BX1A 1PR4A 1CJBA 1AHIA 3JVVA 4N0DA 5C51B 3HXQA 3ZCPA 1JFLA 1XT6A 3CBGA 4RA9B 5TF4A 3R8XA 1B6RA 4IHAA 4ZHQA 5LL6P 1JDUA 3PIDA 1V3TA 2G67A 3LKZA 3P71T 1J06A 4CQMA 1DJLA 4NPAA 2GHIA 2PX4A 5FHQA 4CG2A 4KYVA 5JLAA 2Z1NA 1IFXA 2EXXA 5KNBH 4WOCA 1FDRA 1VTKA 2HV9A 4XX0B 1KOJA 1A2BA 5DTEA 1U8AA 2WKSA 4GX1A 2IYZA 3HP4A 1Y1RA 4BLOA 4EUKA 1GL3A 2O3RA 3EQ9A 2WYWA 1I2ZA 4OHBA 1J7KA 3NCTA 4K6HA 2LGJA 2XHEA 3OZXA 4MLCA 4K5QA 4QJIA 1U0JA 3TRHA 5C5IA 4KXVA 4MR7B 3VX3A 2X8LA 1KEZA 1PV1A 1YZ3A 2NZXA 2RG7A 3H8VA 4OH1A 3RYIB 1JXAA 3VXKA 2QUAA 3I5XA 4PG6A 5A0VA 4WXPA 3LLSA 4Z54A 3VH4A 1Q0ZA 3C6MA 1QHGA 4BNHA 3OHPA 1N5DA 3RIEA 4FGSA 1SXIA 3RRFA 4MJLA 4V24A 4F0JA 1VDMA 3INRA 1GIAA 2ILTA 4KK4A 2ZUVA 3N2EA 3SEQA 4DHWA 5JSZB 4EG4A 1G21A 2OWDA 2R62A 3ABRB 2R4UA 3K70B 4CQMD 1Z6GA 3LUPA 4UHKA 4YJGB 1SVSA 3Q3JB 4ND4A 3NT4A 1XX6A 1NR1A 1SPBS 2BKEA 3FSRA 2V7BA 4JYCA 4KIJA 5FV4A 4YJ2A 1GKYA 5EJMA 2HBQA 1VPTA 3I3SR 3BB1A 3GA5A 3ILHA 1H66A 5COAA 4R8KA 3KDSE 4FUTA 2YWEA 3ZE8A 4UMVA 4PNEA 1MAVA 1EH5A 2MSNA 3LC1O 5BURA 2PU5A 1WDMA 3FCUB 1QPBA 4S1TA 4U5XA 4GOMD 4AUEA 5GJBA 3IDAA 2JCYA 3AR5A 1Y6FA 5LOVA 1H0HA 4JENA 3DEYX 4UAUA 4YCJA 2GPAA 1ZEJA 3KWJA 1RACA 5BO5A 1FW6A 3DXYA 1GTRA 1DBIA 2QRKA 2Q2VA 2O23A 5CDYA 1MO2A 1NLZA 1PJLA 4ZA2A 3WV4A 3Q0IA 2CC2A 4CKYA 1ESEA 4KXXA 3LWZA 3KZ1E 4R1OA 3FZGA 4DTCA 1BU5A 1QGZA 1WMSA 5CXSA 1K7FB 2IXGA 3L6UA 2JGDA 3SHVA 3O2JA 6CHYA 2QL6A 3PZRA 5BSGA 4Y7DA 2WP0A 3JSXA 3UUGA 2QPAA 1OY1A 1U0LA 3OFJA 4D81A 1DL5A 5BSVA 2PKQP 3G2HA 2ASEA 2IU0A 5BW6B 4OATA 4JJ8A 3AVUA 1JMYA 1R37A 4NX2A 2J5XA 4BIMA 4KFRA 2WTMA 5A71A 1UXOA 3PFFA 2IODA 3NTRA 1QH1A 1RP7A 1UPTA 3GCGA 3NM6B 4NXNB 1UBTS 1YWGO 1GTJ1 3PIIA 4UUMA 5DP1A 1CY7A 1DOAA 3GV0A 4DCJA 4J90A 6REQA 2GEBA 3H6KA 2ARKA 2UZ3A 1PK8A 1AC5A 3SY8A 3RU7A 3ORYA 5CK4A 4TMTA 3FSEA 1E6UA 2VNKA 2D0OB 4H7HA 1F2TB 3QU7A 5HFJA 2IXBA 1N6IA 2RGUA 5JWHA 4DDHA 4P7KA 4D8XA 1VPDA 2HRRA 1SVNA 4JC4A 1GV1A 4KJZA 2XVXA 3K32A 1FS5A 1L0BA 3TQRA 1GPWB 1CV2A 3MTJA 3V4ZA 4EJFA 1EESA 1E61A 5K0EA 2IZ6A 3OFSA 1NDQA 1J2RA 1XRLA 1EFPB 3F9RA 3PT5A 3AU9A 1DQNA 4ARUA 3O4JA 2FDXA 1RT9A 4WTOA 3H8SA 4FR2A 1BYUA 1TA0A 2GM9A 4A23A 1H94A 4MVJH 4GMHA 4A0SA 4MS1B 2H8GA 1PD1A 2D4AA 2IYRA 4MRMB 2Q7DA 2YIDA 3CZCA 4CF4A 4MNTA 3ZBTA 5J58A 3L93A 4RE5A 4D0RA 4IQGA 4PZAA 3GT3A 2KMLA 4JKYA 2RFLA 5B37A 3Q2IA 1JQKA 1HBJA 3TD2A 4E2ZA 5CCBA 1IYZA 2B3TA 2WU3A 1HH4A 5FD8A 4LOLA 2V6MA 4FLMA 4XARA 4CF5A 5F78A 2A84A 1C4OA 1QO7A 3I2IA 3FN4A 3BDVA 2OBYA 4F9FA 2FN7A 4DSOA 4W9NA 4ZYXA 5COQA 1XSEA 5AVKA 4B44A 1PNOA 3DBRA 3HRHA 2CDRA 1QB8A 1QKJA 2F48A 2O4UX 3D54D 2Q0SA 4IFTA 2X13A 4LISA 5BQ5A 5EHXA 4KFCA 3HXOA 1A97A 1JE1A 2VOJA 5ENVA 1C3XA 2AHRA 2NQTA 3WV5A 2AFIE 4QJBA 1YTUA 4HQ6A 3S2IA 5ILGA 1I01A 5MF6A 1RBMA 3IBFA 2WDPA 1K97A 1UFQA 2D0DA 1YNOA 3QVXA 5AMXA 1NQXA 2QP4A 5DI3B 5CM9C 2BN4A 4UPVA 5REQA 1HE8B 1MC4A 3V2UA 3TXXA 5A03A 3D81A 2YMMA 4IDAA 4INOA 4J07A 5BOSB 1OBVA 4HS9A 1EP9A 4LXQA 4TLMB 4UVEA 1KYQA 2VHWA 3KTOA 4MVJE 4YLYA 2IZZA 2XVMA 1MEEA 1SOAA 4OA8A 4N1AA 2AZ4A 3I4FA 3EIOA 2DLDA 1YB7A 4GLLA 3DNFA 3TJRA 1ZW6A 5KOYA 2Z8ZA 5JS6A 2AR0A 2PUEA 4QTUB 3W06A 4BVHA 2G06A 2PKEA 4NEQA 1D2RA 1KZGB 2AK3A 2PN1A 2KS6A 3G5LA 4INPA 1C9DB 3DT6A 1HDGO 3TNDA 3W2FA 4DCCA 3WQRA 1G6HA 2E4YA 3FGZA 5E8JA 1Y3CE 2OMKA 3N8HA 2FY8A 1EIZA 1E5XA 2P7IA 4L4XA 4J4TA 1L7DA 5DCUA 3WGOA 1B3RA 1W35A 2CXSA 4YUZA 1RWBA 1W8IA 1Z83A 2VNSA 3HI6A 3Q6IA 3QTTA 5CW2A 1GD1O 3UGQA 4KXMA 2H4HA 2NU6A 2OC4A 4KTVE 2O3QA 1X1DA 1YZTA 1ATZA 1KZ6A 3OZFA 4X63A 1KAQA 3MWEB 2VNIA 5HQ3B 2HH9A 1T4BA 4RU1A 1O6GA 2RK6A 4Y0NA 1OH5A 4Z0NA 4YRJA 1FTWA 3GEEA 4IXNA 4WNAA 1MEJA 1Q3KA 3JQAA 2PGJA 3NVAA 3O3OB 4XB1A 5ECGC 1MABA 4Z0PA 1AHNA 3ZK9A 4QPDA 4X41A 3DTTA 1KQ3A 1J0CA 2CMGA 2OCIA 1SELA 4HDQB 1XD2A 3ADKA 2XJ9A 5EFOA 4KMSA 1K8YB 4P1ZA 5BN5B 1QQAA 3GROA 3T1QA 3TG2A 1QLHA 2A67A 1N25A 4B09A 4BXOA 1DKLA 2QDKA 3LX4A 4DM7A 4TYQA 2ZANA 4A2CA 1NUHA 3NTXA 4FZJA 5HFNA 2OD7A 3AJDA 4AKSA 2JIZD 2C4WA 3EGCA 4M0MA 3DTVA 4ROTA 2PTGA 2WWVD 2C4VA 2Q99A 1XYVA 1IHUA 2JBAA 4G5YA 3G2JA 2Q49A 4F12A 1OFVA 5BWLA 4HRYA 1O0SA 4G0MA 3LXXA 4KEAA 3CZRA 3KP1A 4TV8A 2ODQA 1RJGA 1GILA 5E6RB 3V8PA 3PC8C 3MQFA 2EIXA 2QSUA 3O0TA 2WD8A 3AVVA 4NZOA 3LY5A 3TLYA 4IIGA 4DR5B 2WWTA 5ECYA 1L5VA 1S3IA 4Q4DA 1OLXA 2O4CA 1HDYA 2JBHA 3RIMA 4V1CB 4Z1MD 1XEFA 4X5OA 3IKTA 2P3SA 2VDWA 2HGZA 2VTDA 3ECCA 3JQAD 1QWOA 1MZVA 2C5AA 4XWOA 2JGAA 3U17A 1U0SY 5KCZA 4MICA 1ZJJA 1IQPA 2WSSD 2OV4A 3KE9A 1T1RA 1L5FA 1QSGA 4FHFA 1QCDA 4L5YA 4Q4HB 1JJVA 1WMDA 4EYSA 1JNYA 4RV5A 1SXQA 1G59A 1S2OA 4D0NA 1L5HB 5TB5A 3W5SA 1TCUA 2B4QA 1PR3A 1JEYA 2DLCX 3S2FA 3OQ1A 3F5MA 4I5IA 5LZ9A 3BXXA 2NVWA 2FW6A 1JYFA 4MEBA 4Y9TA 4ZWNA 5I7AA 4A9AA 4OBXA 2B2NA 4MTCA 1TD9A 2F1OA 3FI0A 3OCVA 2CKDA 3L8FA 4EMBA 3IKLA 2C42A 3I6YA 4G8BA 2CSUA 1OZ0A 2XD4A 3JQFC 5EE3A 5ICFA 4EZIA 4DDTA 1G7RA 1B3BA 1QHYA 3LHIA 3H5AA 4G0PA 1AJEA 4ZCRA 3WL6A 3OHSX 5D5HA 1IHDA 1WIWA 3AI3A 1U2GA 5D86A 2EF1A 3NHPA 2H1CA 2RHWA 2QR5A 3AIOA 1I4DD 3QEKA 4UTRA 1SVKA 1NX9A 2C2OA 2YRWA 3SJBA 4COOA 3PUJA 1XVIA 4ZZ2A 4G89A 2HB6A 4YJDA 1JKMA 3A1NA 2E37A 1CEQA 1X7HA 2Q5JA 3M5DA 4V02A 3HE3A 4DMGA 4KMMA 5BW5A 1L7AA 3MIZA 3OQNA 3QF7A 4QFDA 2O7NA 3F4KA 3GBSA 4U8HA 5EYPB 1CY2A 4CCSA 3P2MA 1LSOA 2YJ3A 4Y2JA 4YUYA 6ABPA 4IDFA 4LMBA 3GQVA 4G56A 1HNNA 2J09A 1TUEA 2PRKA 2YH2A 3K30A 3NLLA 3PWSA 3RH0A 1DG9A 4B84A 1X7XA 2F8MA 2NV6A 4P7JA 4MGEA 3USCS 5JTTA 4AJLA 3NUZA 2C4HA 3C43A 3S68A 1XMSA 2D7CA 3NBFA 4G25A 4BX3A 1MO4A 1U7UA 2O8VA 2AEJA 4RZXA 3AGQA 1BFDA 4I2VA 5K0CA 4LVUA 3TBHA 5EE5B 4LYEA 1PZHA 1AMOA 4X65B 3VRHA 4DSZA 4FE3A 3IOCA 4D9FA 3BFXA 4EJMA 1FVOA 3QY9A 4B5KA 2WHPA 2DGDA 1WHSA 2C5FA 3W2EA 4N7BA 3L6CA 3U7RA 3EXIA 3DL7A 3MT0A 3EFOA 1AUPA 1MGOA 1URPA 3KKNA 3WWEA 2AYZA 2PKYX 4Y2HA 4BJ6A 3BWCA 5JEEA 1KU0A 1Q19A 5KOJB 1V11A 4A0RA 2ZVDA 1G9TA 1T9KA 2WAOA 1V8BA 4FEEA 1HRKA 5DW0A 4ROSA 5F12A 4MWSA 3MLEA 3VZPA 1XKQA 1EFHA 1Z6QA 3NBXX 1JR4A 3EG5A 3PL5A 4LXIA 3M6FA 4N5MA 4ZJPA 2XGJA 1LRJA 2HTEA 1YRHA 3KQPA 5GAJA 3DMRA 5KSWB 1T1EA 2QJTA 3OE5A 1HE2A 3H97A 3TOVA 2DPLA 4JODA 2WU4A 5C34B 3ITDA 1IAVA 4YRFA 3KQHA 1WB4A 5LWHA 3E48A 4M1OA 2FR8C 1NVTA 2BDTA 2OHFA 2QG4A 4WN3A 1RYBA 1VYVA 2H1RA 3Q0EA 4C14A 4CW7A 1K98A 2A9OA 1P5HA 2VZEA 3BRQA 4E2YA 2GPNA 3PFWO 4RK4A 3A37A 5EJ7A 3KUXA 5SV2A 1E1CB 5D6OA 3ZKWA 4R40A 4HYEA 2F00A 2BR3A 2OBFA 2RJ3A 2B1IA 4L50A 2GCGA 3OLWA 1UM9B 1T6BY 1J70A 2ETVA 3EVGA 3IXLA 2OO3A 1X42A 2JANA 1TQ4A 3JQ9A 4J9UE 4WOBA 4ZCLA 4B0OA 3L43A 3LO5A 4ZVRA 3EYWA 1Z22A 2I6XA 4Y9RA 2GN9A 4K88A 2H17A 3UOAB 2YOHA 4L57A 4BEBA 3C3YA 3H1BA 4YV0A 3K8OE 2BL4A 1U98A 3AEXA 2DUWA 3KE8A 4IVQA 4IHJF 4MKFA 4XQEA 4ZD6A 3U1TA 4F7DA 3IAS6 4NL4H 1HYEA 4XTCS 2GX6A 2JRLA 2VP5A 1ZVKA 2JS7A 4KRYA 2C3UA 3PD0A 4NBNA 2WQZA 4CE6A 3P96A 3IVCA 4PN7A 2OZPA 4E7PA 4F97A 1KVTA 4KLCA 4BUZA 4HKTA 2NYAA 4HNTA 1W5TA 1XYGA 2BJWA 4HB2A 1LFDB 4M1QA 1BEUB 3BBLA 5EQJB 1XNHA 1ESMA 3LPDA 3UYKA 2P65A 1I9GA 1ZMOA 1S96A 4RGVA 3ZDQA 4PCVA 1SU6A 1ISHA 1PCXA 4MGYR 3FUXA 2HPAA 1W29A 1MX3A 1W94A 2JL1A 1C0LA 1PKXA 2FSSA 2ZYGA 2DPXA 3LDGA 1GPAA 1PEDA 3V8QA 1DAMA 1DUVG 4KQWA 4WCFC 3TAHA 3W6OA 1PS9A 3CJQA 3MOGA 4M0DA 3GXBA 2Y99A 1DJQA 1PR9A 2G4LA 2Z2IA 3MMSA 4I3FA 5AUQA 1YB6A 3RBXA 1KWGA 3HUTA 4JWKA 1XMIA 2DUJA 3O9VA 5AI4A 4ZFNA 3SZLA 7MDHA 4L8FA 4WAUA 3VSBA 4B87A 1HC7A 2V7WA 3M1YA 3SIXA 1SHTX 3UV3A 5C4IA 4DMFA 2IZ7A 4LV6A 3QQ5A 2FJ0A 2BP7B 5JSKA 1YFLA 3R3WA 2HSDA 1YDEA 4QC2A 2H2DA 3N7AA 3RSFA 3BK7A 2ZZMA 2B30A 2YQZA 3ETDA 4MLDA 3NJRA 3OQMA 4N03A 4IUYA 3I6BA 1P2TA 1I3NA 4TQGA 4XDHA 1Y5IA 3GVXA 3KQMA 2E5LB 4JSRA 1BD4A 3M8KA 1ODSA 4C5AA 3GLFA 2R97A 3ZG6A 2G70A 5FUMA 3TGPA 1X19A 1EXWA 3G2OA 4TZTA 3O83A 1H42A 3A1CA 4MV4A 1LF0A 1JDTA 3LGAA 4UKDA 4AWXA 4HTFB 2FXVA 4TSKA 4X7BA 3FHLA 4YTEA 4AJPA 2D1SA 2C7PA 2WFMA 1H6DA 3AF4A 4OCZA 3ET4A 2X5XA 3T9FA 3LP5A 3URKA 2R66A 1U80A 2W6IA 3UJ7A 3OA2A 4UOEA 1SVIA 4KDCA 1Y8ZA 1I0LA 1ZO8A 2PD3A 4LY6A 1KI3A 5DPMA 4PZPA 2CUTA 2IPLA 3QVSA 1QP8A 4EYGA 1SCBA 4YAWA 1Y9EA 3E9QA 3GCWA 3H2GA 2AG1A 1OWLA 4Q24A 1D0VA 3DC7A 4JLMA 4NBKA 5FFFA 4ZCPA 4GPIB 3RGGA 4AF7A 2Z1DA 3DBVO 4EHHA 4S05A 5T8KA 1LTQA 4C05A 4D5GA 1NYQA 1N2CB 3LQ1A 1O6CA 4ZCIA 2VBIA 1T10A 4MMZB 4CL3A 3WMFA 3B3FA 4L9SA 3V2HA 4QARA 1GU7A 4UBOA 2QD2A 5BQ3A 2OAEA 4XVQA 4YH1A 2PXCA 3EASA 3Q3EA 4H7JA 4I9NA 4JEHA 4UHDA 2WABA 2PKCA 3M81A 4NOKA 4O4LA 3VR1A 2F62A 4KXWA 1VFPA 1EM8A 2IXEA 3BE5A 1H1DA 1WAMA 4GC5A 4U0JA 4G6ZA 5FOUA 2EBUA 4TVBA 4MA0A 2JJ1A 2YHIB 3GRCA 3RBZA 2SICE 3G2LA 3KQSA 3GA0A 4JN6B 4QUKA 4MB6A 4F8EA 1IOWA 1YS4A 1D2MA 1CR0A 5L3SB 1CU1A 1R8YA 2JJQA 1FW8A 2R7AA 3X1MA 4BVBA 1W6UA 5AIAA 3BORA 1QE5A 2YIMA 5JS8A 5KIAA 2WY2D 1C8BA 1L4NA 2G08A 3PHIA 2JGRA 4IY1A 4L0DA 3RFUA 3NMUF 3D9QX 3OZWA 3VZCA 2YY7A 5JQGB 1HNZB 3HBLA 2O0KA 4XQGA 1NI4A 1VA4A 5BY2A 2ZPTX 4FGKA 3L4BA 4UZSA 3B5EA 5C1IA 2IYSA 4IUCS 5DNVA 1O58A 1ZSYA 1VCMA 5I8WA 1G8SA 4CM8B 5JMOA