3FWYA

Crystal structure of the l protein of rhodobacter sphaeroides light-independent protochlorophyllide reductase (bchl) with mgadp bound: a homologue of the nitrogenase fe protein
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
268
structure length
268
Chain Sequence
GAKVFAVYGKGGIGKSTTSSNLSAAFSILGKRVLQIGCDPKHDSTFTLTGSLVPTVIDVLKDVDFHPEELRPEDFVFEGFNGVMCVEAGGPPAGTGCGGYVVGQTVKLLKQHHLLDDTDVVIFDVLGDVVCGGFAAPLQHADQAVVVTANDFDSIYAMNRIIAAVQAKSKNYKVRLAGCVANRSRATDEVDRFCKETNFRRLAHMPDLDAIRRSRLKKKTLFEMDEDQDVLAARAEYIRLAESLWRGLDPIDPHSLPDRDIFELLGFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the L Protein of Rhodobacter sphaeroides Light-Independent Protochlorophyllide Reductase with MgADP Bound: A Homologue of the Nitrogenase Fe Protein.
pubmed doi rcsb
source organism Rhodobacter sphaeroides 2.4.1
molecule tags Oxidoreductase
molecule keywords Light-independent protochlorophyllide reductase iron-sulfur
total genus 93
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 1.3.7.7: Ferredoxin:protochlorophyllide reductase (ATP-dependent).
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00142 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fwyA00
4IOJA 2WPDA 2WWHA 4DLYA 2QTHA 1WXQA 4KSCA 1OXTA 1GP2A 1S2MA 1ZC3A 3HYRA 2IXGA 1DAHA 1T3LA 3CM0A 2JLWA 1RVDA 1IN7A 1JPJA 2XJ9A 3UK6A 1WMSA 4PPNA 4WXPA 4B43A 4XVUA 1ZRHA 3CRVA 4XH9B 3WHLA 3V9PA 5JCPA 1P9NA 5J5CA 1KI7A 2ORIA 3C7KA 3GQBA 3PR1A 4WZBE 4D0NA 4RFVA 1KTVA 3UWOA 1KI3A 2RHDA 2ZUBA 4HB0A 4B44A 2R6FA 1E0JA 3CRW1 3DMDA 3H84A 5G3YA 3SYLA 4JLDA 2IW3A 3R9XA 4F4IA 3U3MA 1G4AE 1TEVA 4GBMA 1E9BA 2VP9A 1RJ9A 2O8FA 4QBGB 1LFDB 2GTPA 3NBXX 3OE7D 5E7MA 2B92A 1COWD 1FPMA 4TL8A 4NPHA 1MO5A 4CW7A 3IBGA 1ZM2A 1CJUC 2OE2A 5FUWA 3O8RA 2O8EA 4D0GA 1QG2A 2WTUA 3LBHA 4M9SA 3THWB 3VHLB 3C5CA 3EXAA 4WAUA 1E79A 1Q0UA 1G1MA 1YZGA 4NH0A 2WJJA 2FFHA 1ZD9A 1VECA 5BN4A 3CPHA 1EX7A 2Q3FA 5B64A 3AVWA 2V7QD 1KMQA 4HB3A 4KYUA 4DCNA 2F1RA 3GMTA 1A1VA 4JSTA 4UNNA 3QQ5A 2RKOA 5HCNA 5IK2A 3KXIA 3LO5A 5ELXA 2ZJ5A 1QF9A 3SU8A 4ASUD 3SDZA 2FEOA 4M22A 3NHBA 4UJ3A 1GUAA 1P7CA 3K0EA 3P27A 1QHNA 2G0NA 4HUQB 3NWJA 4J0QA 3AVYA 1MO6A 3WY9A 3I3SR 1DARA 4JLPA 5F9FA 2EFEB 2D2FA 3W6OA 1RYFA 3I61A 2RGNA 3GLHE 1FQKA 4OYHA 2ZYTX 5EXPA 1P62B 2PX0A 4B6FA 3BBPA 5EP2A 3WMEA 3KKQA 1XFAA 5B2ZA 2WJVA 1RJ9B 1M7HA 4ZV4A 4M1WA 5HE9A 3G82C 5FOUA 3AH8A 5DN6D 5AUNB 1EWRA 5JRJA 3AVUA 121PA 1CRPA 3OIYA 3GFOA 4HAYA 4AKGA 3VR3A 1YR8A 2QMHA 4TMTA 3B7GA 5CYPA 1OH7A 4M8NE 5EP4A 2HLDD 4B48A 3RLFA 3PEVA 1NI3A 3SYNA 4DCUA 3CNNA 1OSNA 1R0YA 3LDAA 2CMKA 2WAYA 2ZPTX 1RKBA 3THYB 2ZJYA 5C46F 3IUYA 4QKQA 1HUQA 2QT0A 1E69A 2GVZC 3KQHA 3BS4A 2ZI6A 3FPAA 3ADCA 4UJ5A 1SQ5A 3RRZA 4W5JA 3WHKA 3VFDA 5DI9A 4B3FX 3KQNA 1TTTA 1D2EA 1P5ZB 4DJTA 5CK4A 2GILA 3WMGA 5UKDA 3U7EB 1G3IA 1BYIA 3GPLA 3MLEA 3EPHA 3L0IB 2XAUA 2H18A 2XZPA 2ZI7A 2EYUA 1MT0A 3TUJC 3ZVRA 3TMKA 5F3WB 1AKYA 1F5NA 4IJMA 3ZJYA 4BEBA 4OBEA 4OHVA 1G7CA 2XOKA 2YYZA 2Q3HA 3A36A 3GJ3A 5GVSA 4PSKA 1ZVQA 1GKUB 4CVNA 3AV0B 5AUQA 4DDVA 2PBRA 2CLSA 2FA9A 3OIVA 4M1KA 1TF2A 4FCTA 1E9AA 4MUAA 4EPTA 1GL6A 2GCNA 1Z07A 3CONA 2OESA 4GDFA 3BIFA 1Z6TA 2J7KA 3TKLA 1W49A 1GL9B 1H8HA 1F2TA 2ZR7A 4LSGA 1W5TA 1HQCA 2FOLA 1MRNA 3QOFA 4TQ9A 1AIPA 2OT3B 3R9WA 2CE7A 2CCGA 1ZYUA 3OEED 2VBCA 1XEXB 1Z63A 1G8GA 2J0QA 1OF1A 1U0LA 2QAJA 3WYFA 1XTIA 3QKSA 2ZUDA 1Z83A 2BBTA 4CRWB 1DS6A 4ZI3A 4Q00A 5CM8B 1CBUA 3VKWA 1LS1A 5JLJA 1YZQA 2AR7A 4EFLA 4PC3A 1E4YA 4YMVA 1CR1A 3U61B 2IHBA 2O8DB 1DAKA 4DUGA 1VCMA 1EXMA 3ZIAD 2W0MA 4G5SA 2NIPA 4KV9A 1XF9A 2ATXA 1L2TA 1NMYA 2D06A 5LBIA 4EIWA 2YOFA 3RRYA 4MQBA 2PMDA 1OFTA 1KGDA 1E2LA 1XD9A 4P4SA 4IXNA 5KUTA 4HAUA 2IEYA 3TSOA 3KQLA 2IXFA 2WOJA 1S0UA 3BD9A 2IYRA 4TYWA 4D26A 1F6BA 2KE5A 4JS0A 3DMNA 1BS1A 2JLSA 2YZ2A 1ZIPA 4LBWA 1CRQA 2OAQ1 2XSZA 2BV3A 2VRWA 4TMXA 2IL1A 1R7RA 1N5JA 1QZXA 1T8UA 1CR0A 4MGZR 1TQ4A 2WWYA 2KSQA 1UKZA 2ZROA 3NHAA 4QOSA 3SC3A 2R6CA 1T0HB 2G1KA 3B1VA 5JEEA 2JASA 2C8VA 3P4XA 4UNQA 2NTYC 1VIAA 1W48A 3LBIA 5AWFC 4TSFD 5JJKA 2C77A 3HWSA 2I1VB 4MYUA 1W36C 4Q03A 3E1SA 3ND8A 4MA4A 2Z4SA 1TMKA 1FNNA 2GF0A 1EESA 2BM0A 1CJTC 4BLRA 3SQWA 1P3JA 4DDWA 4BPBA 1KMHB 2WWXA 2C5LA 1G5PA 2GBLC 2IYQA 3PUZA 1KK1A 2EFGA 1E3MA 4G5GA 3FE2A 1TL7C 5JCZA 2GESA 4M21A 2BC9A 3K0AA 4QJ5A 4TMZA 1N5IA 2FE4A 4LJ5A 4Q4AB 2IS2A 3QEOA 4PHGA 3W90A 5K8LA 3IPXA 2QBYA 1KNQA 5JBQA 1S3SA 4C3ZA 5HZHA 1OIWA 1CKEA 2ONJA 3JVUA 1DAGA 3S1AA 1UKVY 1FUKA 2ZJ8A 4A8JC 2REXB 2KBEA 2C03A 3NKVA 3FKSA 1QVRA 4ZO4A 1NN5A 2J7PA 2ZM5A 4DDUA 4NDZA 5L3RA 3LQQA 1QVAA 2CLCX 3NC0C 4FMCF 3DO6A 5JI2E 4KFRA 2J0VA 3L0OA 3OE7A 4IVPA 2ONKA 4RY2A 2AK2A 4WW0A 1IBRA 3PCRB 2HT1A 4F92B 4FI3C 2AKAB 4N0EA 3VU9B 3MSXA 1G8PA 1XRJA 5G3ZA 1CEEA 3L82B 1KIMA 3IILA 2QRNA 4U5XA 2HDNB 2EW1A 2J0UA 3GJ6A 4HDOB 4NCKA 2FX3A 4Q1CA 3KL4A 4Q7LA 2HF9A 4JYBA 1HH4A 4XSHA 4KU4A 3BFXA 4R71A 1Q22A 1U8YA 2BCJQ 1AS3A 1KKMA 3GFTA 3TSZA 2O0HA 4JVLA 2FJUA 5FTJA 5FFMA 1JAHA 1ZUIA 5JEDA 4DLSA 2G1JA 3R8FA 5FPHA 4GPTA 3UG6A 2HEIA 3OAAD 1XTKA 5H1YA 5BQ5A 3T15A 3QXCA 3MWYW 3I62A 1OB5A 1J8YF 2AWOA 3RYTC 4KI0A 2QEQA 2XB2A 2XXAA 4MRPA 1RFLA 2VSXA 1HQYE 5TVKA 4TL7A 5C4MA 1G3RA 2BVNA 1DEKA 4DSUA 1ESMA 2VP4A 2RGEA 4PO8A 2F1JA 4IEIA 4P33A 3K0CC 4B33A 1Z22A 5BYKA 3NEYA 1E1RD 1ZM4A 5FPKA 4YONB 3RS4A 3K0SA 3TUIC 5KDDA 5G53C 1LS6A 4DXAA 3FKSD 2WV9A 4A82A 2ZITA 2ZAMA 2CNWA 4IVRA 3LQRA 1EK0A 2ZREA 3CWQA 2QT1A 4DB4A 1A82A 2QTFA 4QGHA 5C1BA 4QJ3A 1T0JB 2C96A 2IYLD 2P67A 4KVAA 4JT2A 4UNPA 4NCHA 3VR6A 1S9DA 3DHWC 4FMDF 1Z6AA 3FOZA 3VNVA 4AI6A 3QNUA 1E0KA 4FMBB 4NCJA 4PX9A 5JSZA 2KJQA 3A4NA 4C0QC 4L9WA 5LD2C 1OHHA 4LJ7A 3P26A 4LPKA 4NYIR 2RAPA 4ZIRB 4PTLA 1E2NA 3RHFA 2D7DA 2P6RA 3RANA 4AG6A 1SVWA 1IY0A 1VTKA 4N3NA 3QKSB 2F43B 2WIBA 1Z0IA 2O8BA 3DZDA 3MWKA 1KSHA 1XJCA 3X1DA 4DB2A 1ONBA 3GJ4A 3OIUA 3Q5DA 3VKHA 3QBTA 1AGRA 1Z5ZA 2W0SA 1W0JA 1XJ0A 2E1RA 1NIJA 2GJ8A 3MRSA 1E2DA 1TQ2A 2EYQA 5KDOA 1E0AA 4IOKA 2UZ3A 1N6HA 4H1UA 4XOIA 1Z08A 1JXMA 3SBEA 3ND9A 4B76A 3K9NA 1GNQA 4TLCA 3DL0A 1IY1A 4DSNA 5KO2A 4CGZA 1D5CA 1GKYA 1HT2E 3GLFE 2YKGA 3PQCA 1W1WA 2J41A 2XITA 3EZ6A 3QPVA 2A5JA 2WWIA 3RDPA 2ZTSA 1YZLA 1Z2AA 2YHSA 4OQMA 2YJTD 1W4CA 2EU8A 4BZQA 1Q3HA 4B47A 2GJSA 2XNDA 2NZJA 3BC1A 4BLSA 2B6HA 4O2RA 1NLZA 1G3MA 2KBFA 4KBGA 5ANRB 3I8XA 4C4PA 5A5GA 3AVQA 3BGWA 2CHGA 4LJYA 2P2LA 4RKFA 1C4OA 3A4MA 5D3MB 2H17A 1ZUNB 2YOHA 3K70B 1Z8FA 3AF4A 4AYTA 4JIMA 2WSSD 3UXMA 2FFQA 3RS5A 2VL7A 2BIFA 2OFWA 2AN9A 4DCTA 2NOAA 3T35A 2C9CA 4M1OA 2A2ZA 4LRWA 3GLFA 1GWNA 2WKQA 2XEXA 5JWHA 4MYHA 1S1MA 3L0PA 4AWXA 3K70C 3HJNA 3KKOA 2AX4A 2XNDD 4EJSC 1RE0A 1SVMA 5AJZA 2GCOA 1NN1A 4WA7A 3IIMA 4I1SA 4CT5A 4Q9HA 2HXSA 1OH8A 1JBKA 3PEUA 3IEUA 4AKHA 4DC9A 2VEDA 1CR4A 4DLRA 1YRBA 2W6ID 2ODBA 2MSCB 2WKPA 3K0AB 4DVGA 3REFA 5EE1A 1Z6YA 5FL7A 4JKIA 4RD1A 4RZ2A 4CEHB 4DT1A 2OZEA 3FHOA 1G16A 1RRFA 4QRHA 3KFVA 4NL4H 5KSZA 2ORVA 4WIAA 1MO4A 4KVGA 1CXZA 4W9MC 1WDTA 1KSJA 4US1R 2QUZA 1CR2A 3D31A 1YZTA 2YWGA 3M0EA 2JJ8A 1A5TA 2W83A 4OQNA 3TQCA 4LJ9A 1BYUA 1MOZA 3VU9A 3TUZC 1R8QA 4FW9A 5EXSA 4UXHA 3RS3A 3RWMB 3THOA 3FHCB 1Q57A 4I1VA 1QDEA 3W6PA 4OHXA 3C4JA 2RHMA 3VQTA 5KSPA 1YHNA 3FMPB 1NVUQ 1NJFA 1VYTA 4QC2A 1E2EA 4ESHA 1NN0A 3REGA 3SFZA 4DKXA 2WJHA 5JHHB 1Q12A 2ODNA 1G3UA 2PJZA 3SJAA 3RSLA 3DM5A 2PLFA 1Z0AA 5JJLA 1W46A 3AF0A 2XGJA 4Q7JB 1VYVA 4R98A 1W4BA 1XCPA 3BH0A 4M1MA 5FBLB 1DO2A 2IF0A 3VR1A 1KO5A 1IHUA 4Q1EA 3WP0A 2DR3A 4V02A 1OXXK 3H0KA 3AF1A 2XTNA 3OZXA 2ERYA 2ZYUX 5FOSA 1XJQA 1G3QA 1M7BA 2A30A 2QG6A 3CZQA 3GEEA 1JXOA 3T1QA 1TPZA 1KI9A 1AGPA 1XXHE 1OT3A 1AS0A 2IYWA 2V1XA 1K5DA 2NZ8A 4CEHA 2FN4A 1G19A 1S3GA 3A58B 2I4IA 3BOSA 3B9PA 4CDGA 2JJ2A 2OM2A 3TAHA 2WAXA 1ESNA 5TV2A 4LV8B 1KAGA 4QGFA 1U90A 1Q21A 3TNFA 1JB1A 1M8PA 5K8UA 3IPYA 3FTQA 5DIFA 3O8BA 4R7ZA 2ORWA 1VIYA 1DE0A 2AXNA 4XVQA 1L4YA 4L9SA 1LVGA 4RSGA 1NNEA 4R9UC 4V0MA 1US8B 4GP6A 3GLIB 4LDJA 2ZRAA 3N2EA 1XCGB 2JATA 4ZIRA 2P6UA 4YXWD 2IS4A 4X8OA 4A6XA 1VDZA 1WBBA 1UM8A 1OHHD 4HB4A 1VHTA 2CXXA 3Q9LA 2VPPA 4HAVA 4F4CA 3NDBB 1S8FA 3X1ZA 5EXTA 2ZE5A 2WOOA 1GOTA 1RRGA 3MWJA 3ETLA 1P2UA 2GAAA 2FDCA 1OH6A 4TQAA 3QBVA 4KODA 1SKYB 4PPFA 1T6NA 3HPRA 1L7VC 2CHVA 1CP2A 3QG1A 2FG5A 4AIIA 1NMXA 3GFPA 4JLKA 1SVKA 3TR5A 4Q4JB 5E95A 1SVIA 3O47A 2G83A 3NVAA 1GRNA 2REOA 3EPLA 1LV7A 3WXMA 5DN6A 4A8JB 4Z1MA 1KI1A 1NLYA 3EW9A 2XOKD 3W9YA 4LK2A 3MJRA 4GNKA 3PIRA 2Y8EA 5F9HA 5JS7A 3E5HA 4M9ZA 5G41A 5IDVA 4XWOA 3MGCA 1ZNYA 2VP6A 4LJ6A 1A4RA 4DCSA 4GOJA 3X1XA 4AKIA 1W2HA 1N6RA 2QENA 1Z0JA 3CO5A 3CBQA 4F91B 3KB2A 1R5OA 2FMXA 1G9XA 4DBLC 3KJEA 1F60A 4HAWA 2REBA 4Q4HB 4HYYA 5AUPB 4NHOA 1KMHA 2ASEA 2BMFA 1VPLA 3JZAA 2MSEB 3CF0A 1OFUX 3UPUA 1KNXA 4MDFA 4JLNA 1P73A 1E1QA 3F0TA 4Q4HA 4ON9A 1MABB 2OV2A 4Q48A 1ZCAA 4O2LA 4PXAA 2BJVA 4DRZA 4CZ2A 2FSFA 2X77A 1P9RA 1NKSA 2JJ2D 4IW3B 4GI7A 4MYCA 5G40A 3SNHA 1ZIOA 3GEIA 4V0OA 5IT5A 5FUYA 3I4LA 4TT3D 1GILA 1TEXA 3GLFB 3CRRA 5AUOB 4KO8A 1NVXQ 1QHHB 4C2UA 3HPQA 5H68A 2J45A 2BM1A 2GEUA 3LWNA 5B58C 2WJYA 5FI0B 3W8RA 4I4LA 1SXJA 1PVOA 1FTNA 4OQXA 1AZTA 4LHVA 2V55B 3CNOA 1II8A 2ZVQX 2XSZD 3FGNA 3ZZTA 4GZMA 1P60A 1XMSA 2NO7A 4LPSA 1D9XA 4O25A 4HLUA 4Y0VA 3ZYCA 2JIZD 3AUXA 1Q1BA 2OG2A 2ZSEA 3LLMA 2IBMA 2AFIE 4JLJA 4BEJA 1NRJB 3FFAA 3THYA 3Q7QA 5CB6A 1II8B 3QE0A 1T9HA 4TQUS 4BGDA 1QHGA 1GIAA 2GKSA 3VMFA 3QXXA 2WIAA 3NXSA 2X2EA 2NO0A 4QNMA 4B75A 3T06B 1WA5A 1E0SA 3HYTA 4LGMA 4PHTA 1R10A 4ILEA 5FOVA 2FZ4A 3LA6A 5DI3A 2Q6TA 4YC7A 3T34A 3VR5A 1E2QA 5CM9C 1V5WA 4G5QA 2XZLA 1G20E 5IK2D 4TLDA 2W2TA 3L8YA 2HLDA 2QM8A 1MV5A 3LLUA 2W6JA 1NKTA 1V43A 2PEZA 4OQFA 2QSYA 1WBDA 1KZGB 3QG5A 3OEHD 5JFGA 2IEZA 2PCJA 1OFIA 5JMTA 1YE8A 3T5GA 4IVQA 4TTQA 2A3RA 4ZCLA 1O3YA 1S1CA 1WE2A 2ZRFA 2ZRGA 1IAQA 4B3GA 1Z0FA 2QE7A 4NYMR 4OKSA 5CJPA 3DEFA 2HCBA 2CDNA 3U3OA 1W36D 4NYMQ 4LJ4A 4P0TA 2AKYA 2QRZA 3NBYC 4TL6A 1ANKA 1KOFA 2KB0A 2LWIA 821PA 3PEYA 2H57A 2OBLA 1DADA 3AVOA 4Q18A 2QPAA 1S9HA 2G9NA 1KJWA 1OXSC 1L8QA 1W0JD 4JL5A 3AVTA 1U9IA 4BQSA 3T5DA 4E22A 3GLHB 5CLQA 4TLEA 2D4HA 4EUNA 2J9RA 4LC0A 4URWR 4Z8XA 2MMGA 3NG1A 1QRAA 2GJAA 4LBVA 2GETA 2YVUA 2IHYA 1JEEA 2JDID 4YQFA 3GLGB 2JA1A 2WKRA 1W0KA 2PT5A 3T61A 2C9OA 4DLVA 4I99A 3TR0A 5J4HA 3B60A 3L0SA 4FCWA 4KJZA 2OXCA 1YKSA 2RH5A 3EZ7A 3K70D 1E2FA 2RGCA 1CS4C 4S35A 3ZH9B 3DDCA 1NVVQ 4YMSA 3TSWA 3GLIE 3H86A 1GTVA 1NY5A 1K6MA 2XB4A 2IT1A 4OI0A 2FEMA 4IDNA 2QAGB 2Z83A 1Z2CA 4YXWA 3QJYA 2B7BA 4M2LA 1UF9A 1XU4A 5DH9A 4HDQB 1M7GA 1R0XA 4JLMA 2IYVA 2FSGA 3RC3A 3SBDA 3BJIC 4G5RA 4FXPA 3W34A 3BB4A 1WF3A 3RRMA 5BW8A 1AS2A 1JI0A 1P72A 5L8VA 4RFSA 3ADDA 1KDOA 3T1VA 2FFBA 3B6EA 2VQSA 3PUYA 1HE8B 4XWAA 1U81A 1JQLB 1PJRA 2ZSAA 4W7SA 2YC4C 5FPTA 2V3CC 1NY6A 3NH6A 4P4UA 4P4TA 1WB9A 1H65A 4QJ4A 5BYJA 2GK7A 2XTMA 2OBNA 1R5BA 3Q8XB 4G0NA 3WYGA 3J81k 3FVQA 4K81B 1MRSA 4C7OB 2VA8A 1P2VA 4OK3A 2CCJA 4NBSA 1X8KA 2H5EA 4FMDB 1R4AA 4KAXA 1G64A 1HEIA 4KCGA 1Z29A 1IN8A 2CK3A 2AFHE 1M74A 2AK3A 3BXZA 4LYAA 4RJLA 3FFBA 4RCYA 2WHXA 3TBKA 3T12A 1SXJE 3FMIA 2IC5A 2BEJA 4POAA 3CNLA 1Z28A 2BOVA 3DKPA 1XD2B 5GVRA 2KWIA 2V9PA 5CYOA 2GEDA 1A2BA 3NEJA 2ZRPA 1FZQA 3TIFA 1OV4A 2RCNA 4ABYA 3SEAA 3UMRA 4C0BA 3A1TA 1P2SA 3MG9A 1KK0A 1TU3A 1E4VA 1TUIA 1KY3A 1XWIA 4MGYR 3CH4B 2R8RA 2C98A 1P2TA 4Q1FA 1ZUHA 1J8MF 3A1VA 3BK7A 4GSYA 3KQUA 1GM5A 2AXPA 3ZVLA 1GRRA 1J70A 2ZS8A 3B2EA 4EJSA 4NKRA 4A2QA 2CBZA 5KPJA 1YVDA 3SI7A 3B1ZA 4MGIR 2VYFA 2ZYVX 4ZCMA 1UAAA 1U8AA 3K0CA 1WQ1R 1F2TB 4D4JA 1AJEA 1FX0B 5B57C 3K1JA 3BWDD 1JALA 1BKDR 5J40A 4PHHA 1VCNA 1KAOA 3LXRA 3ZS8A 1DAFA 5BN3A 4PO9A 3QPUA 3VAAA 5L3SA 3EA0A 2ZSFA 4YDSA 3KTAB 4US2R 1TQDA 1D8TA 3C8UA 1ZC4A 3MFYA 4AG5A 4Q1AA 4LCBA 2GK6A 2VIIA 4XIGS 1UKYA 3B78A 2GWHA 5DYGA 1G41A 2WPDD 3JVVA 2EWWA 3LRPA 3L2OB 4JYCA 4A0FA 1JR3D 2N42A 2ODEA 2JCSA 2BHRA 3LY5A 2RGXA 2ZI3A 1NF3A 4DWJA 1E94E 1PUIA 1L4UA 3WNDA 1XZQA 4PZLA 4EPWA 1SHZA 3CRQA 3VNUA 4TYYA 5KDLA 1UDWA 4O3MA 4JBXA 3I8SA 4HDCA 5GJBA 4P4SB 2EFHB 3QF7A 3PXGA 2JAQA 2IYZA 2ZIAA 4A6PA 5DISB 2VTKA 3F3YA 3W3ZB 3AGPA 3EIQA 5FTMA 5GJVC 5DHFA 3TH5A 2O8EB 1YQTA 3LBNA 2Z5FA 4ZCIA 1P75A 2ZU6A 3AKDA 3THWA 3I1FA 2QSZA 1LTQA 3SFVA 2V54A 4A0HA 4B2LA 2QMEA 4BFTA 4JLVA 4QBHA 1KJYA 2P6NA 4X8HA 1DO0A 3PENA 4OHWA 4MKHA 3I5YA 3U44B 4KYIB 2FFAA 5TXGA 3SYKA 3V4RA 2VH5R 4TLAA 5M04A 1TNDA 1HV8A 4AYWA 3IEVA 1KO7A 4H9GA 4KFUA 3D7MA 4C0LA 1T91A 1Z6XA 3OFNA 1KI4A 2VSFA 2W2XA 2UZIR 4RD6A 3UIEA 1NP6A 1Z0KA 2ZRLA 2DFNA 3I72A 2RGGA 1OIVA 2HF8A 4TSFA 1H8ED 4X8LA 5DGXA 2GXQA 4WBSA 3B8HA 1HURA 1D9ZA 4PC1A 3QF4A 3SJZA 1ZCBA 3OIWA 3ZLJA 1G291 3GLGA 1W0KD 3SE0A 3UANA 3WBKA 3ZVNA 1TF5A 5CK5A 4DHEA 5JI3E 4FIDA 2RGBA 4JVSB 3SOPA 2JLVA 4JJKA 3S1AB 2NPIA 1N0VC 1ZINA 2ZRBA 4PPQA 4WZ6A 2ZSBA 5DYIA 1IJFA 2RB4A 1N25A 2V7QA 1UBEA 3TAUA 1ZM9A 4QM7A 1YU9A 4B2PA 3Q7PA 3PFIA 5BXQC 3KJHA 3KUCA 4HLDA 1NJGA 3R9IA 1KKLA 1K8RA 1AM4D 4AD8A 1NG1A 2OCBA 3GD7A 4FINA 3K8YA 4PC6A 2ZAOA 4B3DA 4NYIQ 4TMVA 2GZHA 1FX0A 3EARA 2WWWA 4QHSA 4A0RA 1SVOA 4PSVA 4Z1MD 1FUUA 3TW8B 5FH9A 4GOKA 4URYR 4BUJA 4NONA 3OHMA 4RFSB 5DNYB 2ANCA 3C14C 3LX5A 1R5NA 1T3HA 4DT1B 2HUPA 5F98A 4PAOA 4V0KA 4ZI2A 1G6HA 4O0MA 5FOXA 2A5FA 2QP3A 2WM9B 4KLZA 2QROA 2D7CA 2DBYA 1IXSB 2QGNA 1B23P 2QQEA 3OF5A 4RCZA 3CF2A 2HCJB 1DELA 3FHTA 3U3KA 2CL0X 1WCV1 4PC2A 2JJ1D 4BRWA 5E3HA 2FH5B 2J5XA 1XTQA 1CU1A 5HR5A 2F7SA 2J87A 2D3WA 4DUGD 1ZNZA 2BBWA 3RSOA 4GOXA 2O8CA 4CEJA 4PZZA 4Q66C 1ZBDA 2FV8A 5CITA 5FPSA 2SHKA 1SXJB 2P3SA 4JVMA 2ODWA 5KHOC 1E2MA 4ACBA 4DEXA 1W36B 4TWZA 4C0KA 3N70A 1XXHB 1ZU4A 4P31A 3DOFA 1AN0A 1JR3E 1Z06A 2YINC 4LX0A 4M9QA 3E70C 1QG4A 2F9MA 4OL0A 3GJ0A 5DO9A 3T1TA 5GADl 1IJEA 1KI8A 2Z6VA 1XXHA 5DE3A 2GAOA 3F8TA 3TGPA 1EG7A 1G7SA 2QAGC 1YRAA 3H2YA 5FTKA 4XWKA 4V0LA 2ZRIA 4C0HA 1TU4A 1W4RA 1A7JA 3W5IA 4NTZA 5EQTA 2MSDB 2ZI9A 1US8A 3GLIA 3TVDA 4OK5A 2A9KA 2ZRDA 2H92A 4BE7B 2J59A 1XTJA 4PR0A 2QMUA 3P20A 4B34A 4G3XA 4HLCA 4QHYA 1HY3A 1NVWQ 3E2IA 3R7WB 1OJLA 5FUXA 3SJCA 1GNRA 1XBTA 2ZQ5A 1N5KA 3ZIAA 2O8BB 1E1QD 2A7QA 1UBFA 2VF8A 2B7CA 2MMCA 3IHWA 4MH0R 4KSBA 4ZDIA 4C0AC 1ZD8A 2WSSA 2J0SA 4LV6A 1G8HA 1MKYA 3G5UA 5FR1A 4AK9A 1JJVA 4B32A 1IXRC 4JMPA 4MRNA 1IM2A 5AK0A 4JVNA 4N1AA 3EC2A 4JLBA 4TZ6A 3M4YA 2BKEA 2VLIA 5EP1A 2VF7A 4UQOA 1COWA 2ZJ2A 4A8JA 3BE4A 2VHQA 4YMWA 4B3XA 4V0NA 3K9HA 5AR1A 2OFXA 3I92A 4Q1BA 3ZZUA 1G7TA 3AKYA 4P3YA 4EDHA 5FBVB 1XTSA 2QE7D 2CVHA 2ZRKA 1XZPA 4E03A 1E99A 3A4LA 3QI2A 2W6IA 2OUKA 1DG3A 2R9VA 1E9DA 1N6PA 4XSGA 1D2MA 1DPFA 5K8IA 5AJYA 4RZXA 5LPNA 5HKKA 4TTRA 4UXIA 4K8OA 5JWRA 5D3MA 1KI6A 2Z0MA 2ZJZA 4CT4B 2GZAA 4TYNA 4IFBA 2VP5A 2GA8A 3AQ4A 1LNZA 2O5VA 4ZDJA 3FKQA 5C4GB 3EZ2A 4M1TA 4ZDKA 2G77B 2OXRA 2CL6X 3H1TA 2FPKA 4A15A 2YWEA 3K9LA 2JDIA 1BH2A 2F1HA 3IQWA 4ZPXA 3C15C 3QIAA 1XDBA 3CR7A 2NO1A 4MKFA 3X1WA 2XJ4A 3WBJA 2IX3A 1TF7A 2EVWX 3EG5A 1LY1A 3SZRA 1FL9A 2DFTA 3PUXA 4GMXA 4JJZA 5J4KA 2BCGY 3X2SA 2X2FA 4CEIA 1F2UA 4LJ8A 3FDIA 2C78A 3CRMA 3L43A 4BZXA 2IUSA 4FWIB 3RS7A 5HPYB 3ZD7A 3VX4A 2CJWA 1UEIA 5TDHA 4MUBA 4PQYA 1Q3TA 4BFXA 1GNPA 3M6AA 1KK2A 3N2IA 5FBQB 2AHOA 2WWFA 2GVDC 1RRPA 5KPDA 4A2PA 1JPNA 1EFTA 4JL8A 4XTRA 3GP8A 4B35A 1Q20A 2GZDA 1XP8A 3IHLA 4HZUB 2V4ZA 2ZYWX 4IDOA 4C30A 4XVRA 3V4FA 3IBYA 3AM1A 3VX3A 4BLPA 721PA 1W44A 2R2AA 3ZQ6A 1JJ7A 3NBFA 3ZD6A 1EX6A 5SZHB 2IWHA 4URZR 1KDPA 4IDQA 3BB1A 3AVPA 3KKMA 3ASZA 2GHIA 3PUWA 4EFNA 421PA 4OHZA 2BJWA 2WBLC 1CULC 1D6JA 1UEJA 1OXVA 5IF9A 3QKTA 4M1SA 5EE3A 3LD9A 4C0SA 4HAXA 4KITB 2RGAA 1W7AA 2BBOA 5TY0A 3CZPA 1SZPA 2GF9A 4LJAA 3DZ8A 1E32A 4HEJA 2QY9A 2W58A 4RD0A 2N1BA 1G17A 3H4MA 2B8TA 4A1FA 4EJSB 2G88A 5EP3A 5HTKA 4QBFA 2RGNC 1EFRA 3LX8A 2Q9BA 5CDFE 4QFMA 2CJWB 4R2HA 4JLOA 3Q5EA 2PZGA 1XNJA 1TADA 1UKEA 3BH6A 2A5YB 3Q85A 2N46A 3SHFA 4PFSA 3B85A 4WZAE 1WP9A 4JBWA 2IXEA 1RC8A 4LYHA 4NZYA 3IO3A 2VO1A 3VR2A 1UBCA 2X1VA 1OYWA 1E2GA 1UDXA 4DEYA 1E2KA 1PLLA 2QM7A 6Q21A 1PUJA 1G5RA 3LW7A 3A8TA 1VCOA 2DWOA 4NU0A 1FP6A 3GLHA 5JJIA 1FMLA 2F43A 1I4DD 3HP1A 5CIWA 4LYFA 3VHXA 2QNRA 1N0WA 4LBZA 4I1OA 2ZRHA 2Z43A 4Q02A 2A5GA 3AF2A 3Q72A 4NMMA 1RIFA 4TLBA 1GFIA 2O8DA 2IUUA 3A1SA 1RW4A 2F3RA 3PV0A 1XPOA 1Q1QA 3G0HA 5KSYA 2QU8A 2OO7A 4LUCA 3THXA 4ZKEA 3C16C 1KO1A 2ZRCA 1DVRA 3CUEF 3VTKA 1ZNXA 5J4YA 2O8FB 2Q0HA 4MRSA 5BWMA 3DOEA 4IDHA 1E9FA 2DFLA 4AURA 2FGJA 3RVBA 3A37A 3MD0A 1SXJD 1OE0A 3PUVA 4M53A 3U44A 4OI2A 2EQBA 2VHTA 3LAWA 1TAGA 4KFTA 1CLUA 2WMOB 5LD2B 1AQYA 4GRAA 3CF6R 1N6OA 2F9LA 1XMJA 4HB2A 4LOAA 1QHSA 1RZ3A 1UBGA 4D2IA 3ZQJA 4ITRC 4HI0E 1NBME 1FP7A 4PO1A 4A4DA 4D80A 2FSHA 5FL3A 4D6PA 5EE5B 4WXRA 3CX8A 1W4AA 2DPXA 1IN5A 1RYHA 1II0A 4DSOA 1MO3A 3AP3A 5CLLA 2ZJOA 3D8BA 2HYIC 4C2TA 4JLAA 2Q9CA 4Q1DA 2W2VA 3EWAA 2UKDA 1TQ6A 4D82A 1R0WA 3KX2A 1I4TD 3QF4B 1YZUA 3ASYA 2BDTA 4JL6A 5HCIA 5KNDA 5LB4A 2D62A 2C2HA 2ANBA 2P0EA 3BFKA 3LVRE 3MMPA 4D4LA 1CJKC 4U7DA 3L8ZA 4PHFA 4QGAA 4Q4AA 4DLTA 3EPJA 3OEEA 2FSIA 1S4QA 1ZM3A 1T4GA 3D6TB 2E87A 3R8CA 1F2UB 4BFSA 4IRUB 4KFSA 3GLGE 3QEJA 3EX7C 5KNCA 2JJ1A 2R6AA 1F3OA 4HLUC 5FR2A 4YDHB 1BMFA 4E09A 2IYXA 4E07A 1YR9A 4DLZA 1XPUA 3CB4A 1M2OB 4D81A 1KO8A 2V1UA 5CIQA 3CX6A 4X8MA 4M4SA 3UATA 3LV8A 2OLKA 3ZGXA 3TLXA 2AD5A 3KFXA 4IEEA 1ETUA 1R2QA 4Q7MB 4Z8YA 2IWRA 3EZFA 4B71A 4F4JA 4RKEA 3IDQA 4JBYA 2NO9A 2PH1A 4B6EA 4NYJR 2R65A 2GXUA 1O87A 1CIPA 3QVUA 1H8EA 5EZ5A 5FPYA 5JHGB 4Q9JA 5KNBA 2R62A 2GEVA 2H1LA 1U9IC 2IUTA 1J2JA 4I1UA 4LHZA 4PQFA 4Q47A 4HATA 2ZI4A 1XEWY 4M0LA 3I5XA 1E9RA 2G6BA 2O0JA 1NBMD 3P4YA 2NMVA 5EZ6B 3U7HB 1KY2A 1SULA 2A78A 5KYKA 1U0JA 4YMUA 1FFHA 4Q9IA 4AC9A 3DKVA 4FCVA 3U6BA 5JRZA 3GJ7A 1GSIA 2HV8A 3LFUA 5EUMA 4B74A 4XTCS 1UADA 1E1RA 3EPKA 4IOMA 2C99A 2XNSA 3U60B 1N6NA 4L8GA 1M1YE 1U2RA 1OXUA 1S96A 2OEPA 3OESA 4KBFA 5FL7D 4D0LB 1QHHA 3GJ8A 1JQJC 3B82A 2GXAA 1E98A 4TMKA 3CPJB 3BORA 4TT3A 5GJCA 1X8LA 2VP2A 3NBZC 4C0JA 1EFRD 1KYIA 3U4QB 2FU5C 1G7RA 3KKNA 3P32A 1FOEB 3K9GA 2FWRA 2P5SA 2JLZA 5IRCD 1UFQA 2WWGA 1XMVA 4QL3A 4S2EA 3EZ9A 3I73A 5H70A 4BZPA 3M1IA 4MKGA 1ZAKA 5KU1A 3IKJA 4LHYA 4EPYA 1GZSA 4P32A 3SJBA 5CJ2A 3CW2A 4BECA 1OB2A 2F3TA 1SGWA 3FWYA 1AA9A 1OLOA 4PPGA 4DZZA 1GITA 1FNMA 1DAEA 2W6JD 2QAGA 3QENA 4LHWA 4BLOA 4NCIA 1II9A 2H7VA 1YR6A 3KDSE 3W8NA 3FMFA 1ZU5A 2QP9X 1W47A 4AKEA 1HYQA 1VG9B 4DLUA 1IY2A 5DI3B 4C9BA 2IA5A 1BMFD 4QG7A 4UXJA 521PA 4CF7A 3RS0A 4B73A 3C41J 3P1JA 2PCLA 3UKDA 2AL7A 1P6XA 1GKIA 3NH9A 4RD2A 2UVQA 1E2IA 3A1WA 1VYUA 2IYSA 3B13B 5FBRB 1JNYA 1GAJA 2BEKA 3AP1A 2XX3A 4BASA 4R2IA 3U2QA 3U7FB 1EGAA 1X3SA 3LVQE 4FMCB 5FTNA 4BWYA 4OHYA 4RVCA 2J7PD 2H8KA 2JLYA 1X1SA 2ZI5A 2WVJA 3THXB 4RD3A 4E5UA 2OCPA 3GEHA 2DWQA 3U5ZB 3MWLA 4F93B 3K53A 1E2PA 4UNRA 2GXSA 2DB3A 4YMTA 4Z51A 3K0FA 1X6VA 4LV5B 5FOWA 2C04A 4K46A 1E96A 3MUFA 2HJGA 1AQUA 2LKDA 5SZIA 2Q21A 4ARZA 2RMKA 2NQ2C 4EKDA 2FPMA 5AJWA 4C7OA 1YJ5A 2F6RA 1MH1A 4DLXA 5E4FA 2B8WA 1YR7A 1MABA 3A6PC 3AP2A 1QHIA 4DSTA 2HJVA 4ASUA 4Q21A 221PA 2R6GA 1D2NA 1LW7A 1ZNWA 4DDTA 2AWNA 2FF7A 2ZJBA 3W6NA 3IIKA 1N6IA 5DHAA 2PZFA 3NDPA 3U3JA 4L15A 3ZVMA 3U7GA 3K09A 1K5GA 1JR3A 2XXAB 4H1VA 2JLUA 4Z54A 1SKQA 2O8CB 3GCGA 5C2JB 3ADBA 4AYXA 1E2HA 3KUDA 2E9SA 1N3BA 5H8WA 1OW3B 4OQLA 5F2EA 2QTVB 2V8OA 3UMFA 1IXZA 1H8HD 1XCMA 1X86B 4PC7A 1FMJA 1E79D 5A4JA 1AZSC 1E9EA 1E2JA 1W2GA 4UKDA 1KSGA 1VG8A 1SHKA 2BBSA 3I32A 1X8JA 1EFCA 2WZQA 1KJZA 4PAQA 2VHJA 1Z0DA 4PANA 3U4QA 4V03A 4PSAA 1VMAA 2LKCA 2ZS9A 2OILA 2BMEA 1IQPA 4L16A 1J99A 4RZUA 1C9KA 2QPTA 1TUEA 1T5LA 4JSYA 2DYKA 3EWSA 4L4UA 2GBLA 5JZVA 1NG9A 2QA5A 5J4VA 1YZNA 1GDDA 4UNSA 1VG0B 3W5JA 4BFZA 1XPRA 3ICEA 1HA3A 2BWJA 2NG1A 3IO5A 4URVR 5L3SB 3ICQB 2YC2C 2CEAA 2CL7X 5DLQC 3EA5A 2ZXUA 4F7WA 3KQKA 2G0TA 2Q9AA 3EASA 3KTAA 4BLQA 1XEFA 3ONWA 4IOLA 2VP0A 2B21A 3QKRA 4DIDA 2QP4A 4G1UC 2JLRA 3EC1A 5LDDC 2ZS7A 3MCAA 4ACAA 3CLVA 2D74A 2ATVA 2OFOA 4G01B 2IYYA 3OFND 1ELOA 4LY6A 1R0ZA 1C1YA 2ERXA 2WJGA 1ZD1A 2YWHA 2ZRNA 1UPTA 4WOPA 3SQXA 2GJKA 3R7WA 2WSMA 1G5TA 3PITA 1G18A 5LB2A 3WYAA 1NMZA 4OJQA 4Q9KA 1ODFA 5FI1B 5B30A 4MGKR 3NTUA 1G6OA 4Q19A 3RWOA 2CVFA 4RD4A 1GVNB 2K5UA 1P4SA 1N0UA 1DAIA 3SR0A 5AJXA 4KLNA 4Q4LA 5FBWB 3RRNA 4A0GA 5J47A 4XD7D 4ZKDA 3UMSA 4IDPA 1F48A 1SVLA 2PZEA 1CF4A 3ZDQA 2ZRJA 1Z6GA 3KB1A 2JIZA 4GZLA 1PZNA 1U98A 2VHUA 2EFDB 5L3QB 5D3QA 4Y0AA 3D3QA 1XTRA 4FWTA 2C9YA 1KHTA 2OCAA 2V6IA 5JSZB 3QXJA 3RABA 3UG7A 2EFCB 1U94A 1ZMXA 2PT7A 4BFYA 5BN5A 4HZIA 1AK2A 4CIDA 3IIJA 4Q5IA 5JWOA 4B2IA 1HE1C 3QKRB 3SN6A 1KI6B 3PG5A 1BIFA 3TQFA 4HUTA 5EE0A 4OJKA 5GJWC 1KDTA 4EQ6A 3LW8A 1IOZA 3AKCA 4NE2A 4QBIA 2CK3D 2WICA 3GJ5A 5HKKD 1ZW6A 2CLDX 4FD2A 4HAZA 2ZANA 1ZJ6A 4PQRA 3RS2A 4EFMA 1A2KC 3QPWA 2A5DA 1T5IA 5IHPA 1QHYA 1IN6A 2L0XA 3HDTA 4V0ME 1E9CA 5EJEA 4QM6A 3KJIA 1Y3AA 4BLTA 1KK3A 2QL6A 1VKJA 1G8YA 4MITA 1XEWX 2PL3A 2GJ9A 1IONA 1N6KA 5E7JA 1OFHA 2WJIA 2JLXA 3KXLA 2RGDA 2YV5A 4PZYA 1GL7A 2QN6A 3DPUA 4TZ0A 5E7IA 2YWFA 2XZOA 1I4LD 1ZP6A 2QORA 2ZRMA 4JZKA 3LXXA 4IHQA 5KTYA 1UJ2A 3JZMA 1R6BX 4L5BA 4LWZA 5EXXA 1RPZA 1KSFX 1X1RA 1Z3IX 3R20A 1FW6A 4B3CA 4GT1A 3AGQA 4HLQB 1LF0A 2FZLA 1B0UA 1OKKD 2P65A 2NGRA 3TVTA 1SVSA 4MRVA 1CTQA 1KI2A 3MJHA 2D2EA 5CB8A 3Q3JB 4QGGA 1CJMA 1XD8A 3PVSA 1BOFA 1I2DA 3CH5A 2DHRA 1G4UR 2ZJAA 3N5CA 4Q7KA 4FN5A 1MR3F 5JS8A 1IN4A 4ZDWA 1EFHA 2KI5A 4F38A 3B1XA 2JLQA 3HR7A 2BMJA 1DAMA 2JEOA 2ZSDA 4LZZA 5A0FA 4EQ6B 1R8SA 3SHWA 4HSEA 4LHXA 2GCPA 3ZZ0A 2IYUA 5K8TA 2GNOA 4LBYA 3WNCA 4M9XA 2I1QA 3HR8A 2X19A 4LYJA 1U8ZA 1U99A 4EPXA 2I3BA 2NO6A 1P9WA 5DSZA 4B3BA 4XJXA 3LNCA 2QBYB 1NSTA 3CPEA 4BFVA 1NBMA 3K09C 3GJXC 2Z4RA 4WVFA 2R44A 5L3QA 3HU3A 1PLKA 3KZ1E 4MKIA 5L3VA 4MDEA 4A36A 3PJRA 1OH5A 3WMFA 4QNRA 3QXSA 4N0DA 2WMNB 2IS6A 2F55A 1HT1E 4GFDA 1HTWA 3CR8A 3TW4A 4TL9A 1ZM7A 4TTPA 3SS8A 1G21E 1FTSA 3CWZA 1KDRA 3OEHA 4IKEA 2P5TB 2ECKA 3U3RA 1YZKA 2J0UB 2LCFA 2IYTA 2X8AA 1Q44A 4Q01A 4TYPA 3V00A 2JGNA 2F1IA 8OHMA 1XB2A 1JAIA 4RZ3A 4D4KA 1J90A 1SXJC 4BFUA 3BAFA 4A9AA 3QKUA 2CCKA 4ESVA 5FUVA 2NPFA 1OIXA 3KKPA 4Q4JA 3FB4A 4YLGA 3AUYA 2PJRA 3KXKA 1Z47A 3QXHA 4TYQA 2VHCA 5AJVB 4TN1A 1VG1A 3T1OA 1M34E 1QBKC 4DCVA 3FMOB 3ECCA 1Q1ZA 2QQ0A 4Q9LA 3B5JA 4MYTA 2J1LA 3PEWA 5SZJA 2ZU0C 1T8TA 5TB5A 1VCIA 3EAQA 1PV4A 621PA 1W5SA 2CNWD 2ZR0A 1NLFA 1FQJA 2ZUCA 2IF2A 1N2CE 2VSOA 1JEDA 5KSOA 2R6DA 3B1WA 4PAMA 4LI0A 3BH7A 1TX4B 2J46A 3O8DA 1DTSA 4US0R 2CE2X 4DLWA 2DFKB 3TE6A 1GG2A 1Q1EA 3CKLA 4OK6A 5JECA 1PLJA 1QHXA 3WP1B 5KOYA 1KZ7B 5FTLA 2ZE8A 4GP7A 5J4LA 2IK8A 4JT4A 2BKUA 2OSBA 2QI9C 1DG1G 1Y63A 3HU2A 1NL3A 5CDFA 3CIOA 3HU1A 2YOGA 2YNMA 2W00A 2ZR9A 2FNAA 4BFWA 4GMDA 4D4MA 1NSFA 4JKYA 5EE9A 5EUQB 3QY0A 3TJZA 3WNBA 1JR6A 4W5WA 1OKKA 2H16A 4QXAA 1N5LA 1EFUA 3C5HA 2PMKA 3IGFA 2ZVPX 1KO4A 4BRUA 2GDJA 4GL2A 2AD1A 3RNLA 4OI1A 1P61B 3NC1C 4G5OA 4EPRA 2OCYC 2GCOB 2J3EA 2TMKA 4MRRA 1NVVR 1VHLA 4A2WA 2OLJA 3ADKA 3EIHA 2ZEJA 2PX3A 2OHFA 4QHTA 1OPXA 3KJGA 3AB3A 3UWKA 3X1YA 2GRJA 4XD7A 3WRYC 4ARZB 2DWPA 1LF5A 1U0HC 1DBSA 2CHQA 3BB3A 5C18A 3EIEA 3O8CA 4NYJQ 4TMWA 3K0FB 2ZE6A 4U00A 3TK1A 4HZUA 3QUSA 3AF3A 3AKEA 5FOTA 3VR4A 4IXMA 4ERNA 3RC8A 1EWQA 3TRFA 4EPVA 4KXFB 3QSYA 5P21A 3B9QA 2FPLA 3BERA 5HE8A 1GRQA 5TMPA 5SZKB 2O52A 2BMDA 4IFEA 4M1YA 2IS1A 2HT6A 3B1YA 2QMOA 4U02A 1J7KA 4I81A 1WRBA 3AEZA 3LH5A 1XMIA 3DVLA 3F5FA 2PLRA 2Q3MA 3NIBA 3IQXA 4CEJB 2HYDA 2OBMA 1N6LA 3AVXA 2QZ4A 3RAPR 1M6NA 4OI4A 2ZE7A 3WRXC 2DCUA 4A92A 1E9SA 4URXR 1E6CA 1AKEA 1I2MA 2EWVA 3A1UA 3MAAC 4LC1A 2PEYA 4URUR 4HUQA 2V6JA 2HXYA 3BFVA 1CJVC 1XD2A 4NCNA 4DIEA 3BRWD 2C95A 2FGKA 1NIPA 1LB1B 2QPOA 4AY2A 4EAQA 4NP6A 4CEIB 3QVVA 3U6KA 3CX7A 2ZETA 1XEXA 2OAP1 2DY1A 3DM9B 1SKYE 3W3AA 3OAAA 1JECA 2QGZA 1NN3A 2G3YA 2XTZA 1RRCA 5TARA 2O0KA 1T3SA 4II7A 4W5HA 4CYMA 3VKGA 1DOAA 1XX6A 3FYHA 4KHZA 3ZS9A 3AVVA 4D25A 1BO6A 5HZKA 1G8FA 1OYYA
chains in the Genus database with same CATH superfamily
2XMCA 4MVJD 3T7RA 1U5AA 2PH5A 3E22B 2WPDA 2WWHA 3LHKA 2QTHA 1WXQA 4R1PA 3FSGA 5DGHA 1OXTA 2OV8A 4KQ9A 1PFKA 3HYRA 3VAZA 1GU1A 1T25A 1U6IA 4W9RA 4YAFA 4TVSA 3HK2A 5ENZA 4BIIA 3RJTA 3U80A 1IN7A 5LJIA 3UK6A 3WIVA 1Y37A 1RKXA 4P7FA 4R0VA 3CRVA 3GHHA 3WHLA 4Z1OA 1P9NA 3QKIA 1I6KA 4MI1A 1JG1A 1KI7A 4OJNA 5J5CA 1WP4A 4MUJA 5JSKA 1KTVA 5LXTB 3K3PA 4FI3F 2R6FA 3CRW1 3DAFA 1NBHA 1EIZA 2C2KA 4JDPA 2ENUA 3UWPA 4ES6A 3BT7A 3EN0A 3SYLA 4JLDA 4WDRA 1Y8QB 3F1KA 1TEVA 4M7OA 1E9BA 1ZK1A 2AIRA 4BNIA 1OXMA 3L49A 4QBGB 3F9IA 4IMIB 1I33A 4BCCA 3C1UA 4F46A 5E7MA 2C94A 4KK4A 5JE8A 4TL8A 4ARVA 1XELA 4EJ2A 3L4EA 3IBGA 5CIYA 4WMLA 1ZM2A 5ALMA 2NUPA 1OR8A 5AI9A 4L73A 4U7PB 4ER7A 1RZRD 3R41A 2WTUA 2DPMA 1R9NA 1L5QA 3CC8A 4N3CA 4M9SA 4P3NA 3D5QA 3RREA 1HTBA 1E63A 3EXAA 3O2SB 5GM1A 3T7IA 2TRSB 1FW8A 1N8SA 1Q0UA 4XYEA 4ZAFA 4NH0A 4DQUA 4RTNA 2FFHA 1U3UA 4F96A 1U2DA 3SXPA 4G0MA 1RIIA 4Q82A 5J1SB 4MTLA 1KFEB 3OPNA 4FWBA 3WDLA 3C1TA 2FX5A 3GVHA 3RAJA 1G5HA 1KPGA 1XQ1A 2DPHA 2ID8A 1SUPA 1NUQA 4WKPA 2VTBB 4N48A 1RHUA 4QD3A 3QQ5A 3EGXB 3MJEA 5IK2A 3VU0A 5BV2P 4GKJB 3FVWA 3USES 2ADFA 3QFHA 4NOKA 1QF9A 2FUG6 3C3BA 3TCXB 4E6EA 5EIBD 3NHBA 4UJ3A 3AU8A 1UPUA 2Y1WA 3K0EA 4R7GA 5BSMA 5BSRA 3W4KA 4D9NA 5BV8A 2R751 4IZHA 3UHAA 2GFQA 3NWJA 4RVFA 3AVYA 2YWRA 3WY9A 3Q9SA 2LIPA 1RYFA 3W6OA 1EKXA 1LI7A 4K1XA 4X0EA 4EGAA 1JLRA 4N49A 4OYHA 4E88A 5KNBH 5AKKA 2YFYA 1P62B 1BXZA 3A3YA 4N54A 4ANFA 2JGMA 5ALTA 3IUNA 3NONA 1XFAA 2OCXA 5B2ZA 3NTLA 1SOMA 1M7HA 4OGWA 1WD7A 2NUBA 4TN5A 5IH3A 1JXQA 5FJJA 5EKSA 3AH8A 2P6PA 2MR6A 1UXGA 1QKIA 3WXBA 2I3GA 4UBIA 3ZH2A 1JTFA 4MIYA 5AUNB 1J1ZA 1YB5A 4RXTA 1NPYA 3UJ9A 2DQKA 1REQB 2RG1A 4Q93A 2ZKIA 5LLSA 4UUNA 5I7AA 4OP2A 3BWMA 3LHFA 3M9XA 1C1XA 2RE8A 2FR0A 3PNOA 5TMDA 2IKQA 1YR8A 2PUHA 5CYPA 4QTZA 5ALYA 1MG5A 1UK8A 4M8NE 3S2UA 2P1DA 1XZHA 2HLDD 1WDKA 3GELA 2BGMA 3L41A 4R9SA 4TV8B 1DC3A 5FXMA 4B48A 3EXHB 5DPMA 2F4VB 3RVJA 3UMVA 3WFZA 4DCUA 1R0YA 2D1YA 4ZMSA 3MTGA 2CMKA 2WAYA 3DMYA 1UDBA 1PGPA 2FPOA 1HUQA 2I2DA 4JXXA 1E69A 1OAOA 3HO1A 3TNYA 4ZGBA 2BUBA 3ADCA 4KN5A 2ROQA 4O4HB 4G0XA 4MW5A 4FEEA 5DI9A 2JH8A 4AF8A 4DJTA 2GILA 1U0OC 4RSMA 2IOHA 2IELA 3SF0A 5C4IA 1WXIA 3CU5A 5L4SA 5JZMA 3MLEA 3TG2A 1Y1LA 4H0FA 3JD3A 2H18A 1E1MA 2I3AA 1W88B 2J5RA 3Q7RA 4XAQA 3ZE9A 1VGQA 1NPDA 2ODTX 2PV0A 4LXUA 3I6BA 2KM1A 4BEBA 3VVLA 4OBEA 2J9FA 2X8BA 4ND7A 3SHTA 3E3LA 4PSKA 1M9NA 2B5WA 3SX4A 3MS7A 1V6AA 3DTNA 5AUQA 2PBRA 1WZ2A 3A6JA 3IT0A 5IDYA 5TRTA 1KYVA 1TF2A 4MUAA 1A8SA 2GCNA 1Z07A 5DGCA 3DG9A 4RK4A 1PFYA 3IP8A 4F2PA 2UYCA 4GDFA 1JT9A 1W49A 1C7ZA 2ZR7A 3PJFA 4L8WB 4QLBA 5HFAA 1IDOA 1MRNA 3R7SA 2Q0QA 2ZTVA 2XLCA 2B37A 2I4LA 2J9ZB 2CCGA 5JAQA 1QUEA 2VBCA 1OX5A 4YAGA 3QLUC 1G8GA 3S4YA 2HSDA 1ZA2A 4DA0A 1H85A 4YFYA 4OOEA 1ID8A 2RKBA 1BOOA 3PNVA 2O7SA 2PGIA 1FJGB 4WLFA 2AI3A 5AOBA 1C7FA 1T1GA 1XZBA 2PVSA 4FHEA 5JLJA 4IWYA 3HI4A 4RIGA 3B3GA 1DQZA 4PZEA 1P0CA 1FY2A 2RC5A 4M0FA 4YAIA 1DAKA 1W75A 1AXEA 2K2WA 3D1JA 1EB9A 4JEMA 4RMJA 1VCMA 4JEUA 1NUSA 1EXMA 4GKAA 4HVAA 4CCWA 5DHTA 4EATA 3IVRA 1KH2A 5TEVA 1G1AA 2JFOA 3E22A 4AN0A 5LBIA 4EIWA 4GP9A 2XVYA 3ZXUB 3G6WA 3DDNA 4JQYA 3RRYA 4MQBA 2PMDA 3D6MA 2JAHA 4QJBA 1KGDA 1FRFS 4XDGA 4GEGA 1B15A 1XRMA 2CVPA 3DNMA 1N92A 3G2LA 1GR1A 1Z7EA 2EKBA 5REQA 3Q15C 4ZO9A 4BAZA 1Z4QA 1S0UA 4HV4A 5K6TA 1XA0A 2I34A 4D26A 2KE5A 1KEUA 1G66A 1O9BA 1BS1A 2V98A 2YZ2A 1ZIPA 3DMNA 4LBWA 1CRQA 4XX1A 4D5EA 4FS3A 1R7RA 4QT0A 1KWKA 1PWEA 2VKTA 1Q91A 2WWYA 1A69A 4AJJA 2KSQA 1MA0A 3SC3A 2R6CA 4PRZA 3W1VA 2G1KA 2COKA 5FI5A 3IP1A 3JTMA 4HNRA 4XDZA 3NX4A 1L7DA 2NTYC 4KQMA 3DPSA 1RE1A 1W48A 3FFTA 4EB3A 1YL5A 2I2WA 3BJRA 3WWPA 5AQ1A 2IEBA 3HWSA 3O95A 4L27A 4Q9NA 3UF0A 2Q46A 4AJHA 3U5TA 1W36C 3LY9A 4BMOB 2Q2WA 4GX0A 2ZTHA 3E1SA 5CLHA 3ND8A 4YFVA 3ZLVA 5EEHA 1LLDA 4WZAA 1JVBA 1DEXA 3HKDA 1FNNA 1O6BA 1Z88A 2J4FA 3EEFA 2BM0A 1CJTC 1G2OA 1TIKA 3KBBA 3OHSX 4REOA 2MSNA 2VKQA 3O21A 5KWSA 4DDWA 6REQA 2Q1TA 1KMHB 1CZKA 2I87A 5EGNA 4NFHA 4C5BA 1D04A 1J2TA 1KK1A 1YOVB 4YEDA 2EFGA 1QVVA 5IKPA 5FUMA 4B1FA 2BC9A 3GLSA 3K0AA 4JGBA 4RTLA 1JDBB 2WWVD 4TV9B 4KYTA 1N5IA 4W9NA 2R8BA 3EFEA 3UV3A 3V55A 4CKZA 3NTOA 1Y9DA 4O2BB 2B99A 2QBYA 3ZR4B 1KNQA 1QK5A 4WI1A 2FMKA 3FD8A 4LTMA 4GH5A 4I6JA 1T9AA 3RIHA 4A8JC 3MMSA 2KBEA 2C03A 2VG8A 3DDSA 3CRZA 1JE0A 3FKSA 1FP4B 2HB6A 2J3MA 2X0NA 3M1YA 4JI7B 3C6QA 3V8QA 1MOSA 3RFCA 3U4MA 2CDAA 2ZM5A 4B3RB 3DMRA 4UUPA 3IMFA 4J3FA 3H16A 3ZLJA 2CLCX 3DO6A 4E5DA 4KFRA 4BYGA 2P2DA 4ENUA 1KPHA 1DC6A 1Y1QA 1RWQA 3ZD9A 3OWXA 5AICA 4K28A 2HT1A 2I6GA 2X5KO 4F92B 2D1FA 4E5NA 4R51A 3AJRA 3R0IA 1GFZA 3QJ5A 3I09A 3L82B 5G3ZA 3HN6A 2B78A 3VXKA 3ECSA 2Z8YA 2QTMA 2HDNB 2J0UA 5TLSA 4FR2A 4NCKA 2DZDA 1YZFA 3ROMA 5KINB 4GX1A 1YU6A 2X14A 3LLSA 4OYRA 5JMPA 2CUTA 2VDJA 4QEDA 2X0JA 3BFXA 4N6GA 4QO7A 3FB1A 1RABA 2BCJQ 4ND5A 5E1OA 3TSZA 2WUGA 3L77A 2H9IA 3TJMA 4QIHA 5AVKA 4RGQA 1JAHA 1KEPA 3R7BA 3R8FA 1JHXA 3QE3A 4HNQA 2CHUA 4C3VA 4WPGA 1LV8A 1LGYA 1MEJA 1ARZA 4M8KA 3T15A 1YOVA 3ROPA 3ONFA 2FW8A 3I62A 1J8YF 2CJXA 4KI0A 4QODA 4QELA 4IIGA 1YD7A 3Q2OA 1N3IA 2Z09A 2XXAA 4AJ2A 1J9GA 2EWMA 4FBGA 1VKHA 1C50A 4B4KA 1HQYE 2ZBFA 5C4MA 1G3RA 2BVNA 1NTRA 4ALIA 2GBGA 3TLJA 1L5SA 3LCMA 1MVNA 2F1JA 4IEIA 4P33A 4B33A 1F8YA 1Z22A 3AEQB 4PVCA 4GR4A 4PX2A 4P54A 2IPLA 4TGLA 2HUNA 4K1LA 5ALQA 1XVIA 4V0QA 3FNFA 3ZHCA 5JQWA 3QUTA 5H3LA 1U0EA 1UP4A 2NYAA 2XGOA 3TS1A 1M0EA 1LS6A 2ZIFA 1E0DA 3FH0A 2WV9A 3FKSD 4A82A 5KBYA 1ST3A 2ATEA 1EH5A 2CNWA 3K9CA 1FA9A 4IVRA 3MCWA 3CWQA 5CYGA 4EUFA 4C6HA 4ARAA 4DB4A 2QTFA 3D3NA 4TS3A 4FOPA 2ABWA 3KPWA 5B7GA 3HB4X 2OM6A 1T0JB 3KD2A 3UTDA 1Z68A 4O3FA 1I7QB 1S9DA 3VNVA 3MB8A 1Q14A 3QNUA 3WKEA 3ZCQA 5JSZA 1NNI1 4C0QC 3A4NA 3TQIA 1TK3A 5ADUS 5BVHB 1TDJA 3SKVA 1GA1A 4AXXA 2PXAA 2RAPA 1CFZA 2DT8A 3OLWA 4PTLA 1W2WB 4BGUA 1FE8A 2P6RA 4RXUA 2IEIA 3F4KA 3KBOA 1SVWA 3A1EA 4X92A 5FCDA 2AQHA 1SMKA 3QKSB 1M76A 4DMKA 1J0CA 1PYDA 1WHTA 4D98A 4UFPA 3A25A 3EPPA 3K2EA 3UV7A 5CBKA 3O83A 1J7JA 4QJIA 1Z5ZA 3UPTA 1Q15A 3AWDA 3MRSA 4BNZA 4MAMA 1TQ2A 2EYQA 5KDOA 1JDSA 2R48A 1N6HA 4RIIA 4HX5A 5KEIA 5BQFA 4YA6A 3WGTA 4CG2A 2HWYA 3ND9A 4FONA 1DTWB 2HIMA 3RBXA 5JARA 4NFYA 1V8FA 1GFWA 4HRXA 4TLCA 4W8OA 4ENQA 1AKRA 1D5CA 1NVEA 2TSYB 3BMNA 4NBTA 3ZDZB 1Z7BA 1YJQA 1LJLA 2C5BA 4FGZA 4JK3A 1L5NA 3PQCA 3PDUA 3FRJA 1W1WA 4I5DA 2J41A 2R60A 2VJPA 3OZFA 1JQEA 3QY9A 2Y1LA 4RKYA 2Z3VA 2A5JA 3TLGA 1S2DA 3ZNOA 1L0BA 2GPBA 1GR0A 4YQZA 3HY4A 4BCDA 1V9SA 1RLIA 2EU8A 4I9HA 1Q3HA 2FR8C 4B47A 4BZQA 3OTOB 3JWPA 3PPXA 4QUKA 1V8ZA 2GZ3A 2YRWA 1WNFA 3UAYA 3R4CA 4OYYA 5ITZB 1VBNA 3IJRA 3EF1A 1KIAA 4LJYA 2P2LA 4WXEA 1NAIA 3L5OA 4HMQA 1FX1A 1F4VA 1L9XA 5D3MB 1QRRA 1Z8FA 2PWZA 3CMMA 1SXIA 3SEQA 3G2OA 3NYWA 4C04A 4WXYB 1EU1A 1A7KA 1UODA 1VMDA 3CN9A 3ZWMA 1M1NA 3MMXA 3PWTA 5HRUA 2OFWA 2AN9A 2O3RA 3BE5A 4IQ8A 4IIDA 1QIGA 4LSGA 4UUMA 5G4KA 1EM8B 4LRWA 3JQBC 3R77A 3GLFA 5EI5A 4RHUA 1Q0TA 3FWPA 1BVYF 4AWXA 3AV3A 3O93A 4AULA 2NZVG 3LK6A 5EN4A 1GG5A 2FPRA 3KSDO 2TMGA 3KKOA 4U1RA 3W7BA 2AX4A 5M29A 2X4DA 1DQYA 1RD4A 1RE0A 1SVMA 1YL7A 3GIDA 3D3WB 3NAQA 2GCOA 4CT5A 1Q6ZA 1RM4A 4ZK2A 3DXFA 4XB6B 5JZOA 3KEQA 1TAQA 5IKMA 4Q3DA 3T3IA 5E9WA 1CR4A 1TIBA 3AUUA 2WKPA 2CDCA 1H6BA 2FPGA 1KPIA 1HLPA 2XA9A 5JJBA 2VT2A 2GAFA 4YO8A 5FL7A 3TD6A 4UNIA 1AKMA 5CD9A 4DC1A 1FFYA 1NVMB 5EXEA 1DJQA 4DT1A 1EFVB 4XE5A 1NE2A 4DRXB 3D2AA 2J33A 3FHOA 3LLVA 3PE3A 1S2OA 3ZDCA 1GTG1 4NL4H 3M1AA 5EWLB 2QMQA 1MO4A 1WDMA 3G9UA 4KVGA 2VK8A 3FLAA 4B40A 3SX2A 3BXGA 1KSJA 1HXHA 4US1R 4WNIA 4KXLA 2QUZA 2YDXA 4J07A 2YWGA 4OMDA 5EYPB 1SQ6A 2W83A 4OQNA 1VPEA 5HFNA 1ABFA 4FUQA 3MTEA 2NTEA 4WZBA 1QOQB 1Y5LA 2JFVA 4UHBA 1DBPA 4K8RB 1SOUA 3THOA 1OQAA 1Q57A 1QDEA 3C74A 5AKEA 4DJDC 4ER3A 4OHXA 2D5IA 4MQEB 3FSJX 1KJ8A 3AZOA 5AESA 5KKNB 4OXRA 4HX9A 3WGOA 4MYRA 4AKTA 3UXHA 2QU7A 5FO0A 1VYTA 3EMKA 1QX4A 3H2HA 2QL7A 1Y8RB 3IUJA 4OHBA 1T29A 4DKXA 4RPIA 4P5PA 1H05A 1WXDA 3IVMA 4O4JF 3RSLA 4YIHA 1JZTA 1POWA 1LJ8A 3N76A 5JJLA 1W46A 1R3DA 4Q7JB 1VYVA 3C3XA 4BMYA 4JA2A 1C9NA 4H7PA 4M1MA 3BH0A 4B7AA 1QAMA 2I0FA 2AXEA 2QJTA 3IQDB 3L0BA 3MBIA 4MA0A 3SOZA 1CQIB 5KJCA 1GL3A 4JI2B 4IIJB 4ZVOA 1XU7A 4MHTA 4OP1A 2F1OA 3K2QA 4Y67A 1OXXK 4D8XA 5LMNB 2XTNA 2PMFA 4YCMA 3I4FA 2FPIA 5FOSA 1G3QA 3GEEA 1LJUA 3OQMA 1F1BA 4FQ5A 4AS2A 3EHEA 8ABPA 3LOUA 4MR8A 1U3GA 3DYBA 2V1XA 1OBFO 3RARA 2AB0A 1K5DA 2VCHA 2EV9A 1G19A 1S3GA 3FMGA 3A58B 3CEHA 3GH3A 3OPYB 3PVCA 1N2EA 3INNA 2OM2A 3TAHA 1OAAA 3G79A 1T24A 3DZFA 1NC1A 3EODA 4GI5A 4P3OA 3TXYA 4FR0A 4F2HA 2JK1A 2XECA 3FHJA 2D8MA 3E0QA 4QGFA 4F86A 1U90A 5IM4A 4M0KA 2HO4A 1MJNA 5KAMA 4PIVA 1JF8A 3EEIA 5J5VA 3TNFA 2F48A 1JLSA 5DIFA 3O8BA 1T9GR 1VIYA 2C3MA 4ISCA 4MKRA 3VR4D 4Y6OA 2HWXA 1K88A 2BFAA 1ZGZA 3VAYA 4RSGA 1OLXB 1E7YA 4V0MA 5ALWA 3WL4A 4BN5A 3KCQA 3LDFA 2I2AA 1AF4A 3LSYA 1DJLA 4GP6A 4MUEA 5DHQA 3GLIB 1O54A 1D1PA 1SC1A 2NNWB 2W9XA 2ZRAA 3EQ2A 4Q39A 1XCGB 4R5MA 5AKXA 4P0PB 1SRRA 1U7ZA 4KNVA 5TPWA 1UM8A 1QK3A 4R8RA 3RV3A 4MW0A 3UMJA 3ERCA 2BHTA 1QYVA 4MV7A 4F4CA 1GUFA 4KXVA 3VPAA 2BEUB 3DTVB 3HJTA 4M1EA 4ZVLA 3DLTA 5HIIA 4BQQA 2WHEA 2ZE5A 4RC9A 2B7LA 5EXTA 3NLLA 1X94A 2FEPA 4HOYA 4DUZB 2FDCA 3VR3D 3QBVA 1WAMA 1LWOA 1NQWA 1ZD5A 4G2NA 4EB6A 4EYOA 3KPYA 1CP2A 1HE5A 1SD2A 2ZYDA 3G2NA 4R81A 1QJCA 3GFPA 4JLKA 2QUJA 1EJ2A 3D0OA 4LGCA 2ZSKA 1QV7A 1FTQA 4Q4JB 4TQGA 5E95A 3ZY4A 1GQ2A 3AFNA 5REQB 1Z4JA 3EPLA 1MJHA 3KSAC 3C97A 3UAXA 3EW9A 3DT8A 2XCOA 1X14A 3AEKB 3ODGA 5F9HA 1K4KA 5HMLA 4LYEA 3EULA 5I01A 5JS7A 1QB8A 3TLKA 5G41A 2H7XA 3MGCA 5D6NA 2VCEA 5JROA 1I13A 3D6JA 4LHSA 4AMBA 2GOYA 2Q2QA 4BP3A 1WG8A 1MX3A 2O20A 2J6HA 3C4QA 4E08A 3BMOB 5KQGA 5JH7F 3CT4A 3CO5A 3UFXA 3KB2A 4ZTBA 4RVSA 1N1EA 1S01A 1EXVA 1M33A 1RXYA 2UZ1A 2BKAA 2REBA 2Q9UA 3RG2A 1WUKS 4HYYA 3JQGA 4Q4HB 4MS1B 5NLLA 4NHOA 3C6BA 4TZTA 2ASEA 4RDIA 4U9HS 5AHRA 4UQLA 1BDJA 3W9BA 1YJ8A 3B2NA 3UPUA 1OFUX 4UDOA 1E1QA 1TO1E 3VYWA 3M49A 1WTCA 2C29D 1MABB 3DR3A 2ORED 4AJ4A 1DXYA 1UIRA 4XYBA 1NXTA 4S04A 4DRZA 4R7TA 4V0SA 4CZ2A 1OAOC 4MWSA 4OY3A 2PPLA 4XB1A 3HWRA 1P9RA 5HJ2A 5D01A 1X80A 1ADJA 3D2BA 2C1ZA 5FUYA 5A0VA 3GROA 4MS4A 5HBGA 1C2TA 1YQWA 4J9VA 1V7ZA 5AUOB 5BSWA 5LM3A 5TT0A 4YP7A 1Z4KA 2NYVA 1R6VA 2PUJA 3OKFA 1SPXA 4Y1RA 2C7QA 5JATA 1NVXQ 1Z0SA 4KPFC 3HPQA 3LT5A 2J45A 2JCBA 1ACJA 5CH3A 5ALFA 4N3GA 5DBOA 4XIJA 2JGKA 3IPLA 3W8RA 3OLXA 1SXJA 4P58A 5EZQA 4OQXA 4BUCA 4LYYA 4GRIA 4HEA1 4QVKA 4CF6A 2V55B 3A0RB 3CNOA 1II8A 3FGNA 1GZ5A 4IAOA 3ZZTA 4LPSA 4AT1A 2BFEB 3JWEA 2VZEA 5T5QA 1CFJA 2PLNA 4MCAA 5U4QA 3R3WA 2QRHA 5KKCA 3IUEA 3GG2A 4QGBA 2OG2A 3G89A 3LLMA 2IBMA 2WAMA 5L7YA 4CDRA 5AOCA 3ZJ4A 3NVKI 5CNJA 1ISHA 3H97A 1XNRB 3SWWA 1T9HA 4TQUS 3HFJA 4BGDA 3OLQA 2CVOA 4PG5A 3E4CA 3GP3A 4UFOA 2BFOA 3DZBA 3VMFA 3FA2A 3QXXA 3K6KA 5BW5A 4R1UA 4EI8A 3EMVA 1A77A 3S40A 4B75A 1ATZA 3DCNA 4D9FA 4FGLA 1WA5A 2DJIA 2Q4DA 2Q7XA 5ALKA 4EW1A 1TAUA 3GQVA 1LBIA 5E1BA 1K75A 1F9EA 1T2CA 2PU5A 2XT0A 3MRXA 1C9JA 4G25A 3LA6A 1R3UA 1Y4ZA 2GVNA 2JCYA 2Q6TA 5CM9C 4BX0A 4G5QA 2XZLA 3QELA 5IK2D 4TLDA 2X7HA 1E6MA 2BM9A 2G72A 4S0XA 2PUFA 1DB3A 1ZVMA 3KZVA 1U2TA 2HJWA 3RUPA 5LYJF 3LLUA 4JNCA 3IPRA 3HO6A 4RHTA 3UUGA 1V43A 2Z57A 5I9TA 2DLCX 1QQ7A 1U2DC 2QSYA 3I8OA 4S0ZA 5LSAA 3OEHD 4KE6A 1YE8A 2IS2A 4IVQA 2WIKA 4ZCLA 1O3YA 1WE2A 2JIQA 3O4RA 4ESEA 1E1KA 1B41A 3OBBA 4M7PA 3G6KA 4NAHA 2VA9A 4KXYA 2H08A 4PHCA 4JR2A 3IOBA 2V45A 3IE0A 4B17A 4LJ4A 2QRZA 3IMEA 2IZ1A 3MQ2A 1KOFA 821PA 1YONA 2BFEA 1BMTA 2OORC 5H5JA 4DPKA 4ZJYA 2ZUWA 3TDNA 4M36A 1GGEA 1M6WA 1ZK4A 2WF6A 4C08A 2QPAA 5DBFA 2G9NA 3IE2A 4JL5A 4YB8A 2H4HA 5K99A 4MQUA 5J2TA 5CLQA 2NUTB 2D4HA 2RK6A 4DA4A 5JISA 2J9RA 2XYQA 1UM9B 2WSLA 5K01A 1P81A 3UJBA 1EE2A 2GJAA 4EI7A 1AZLA 1BE1A 4COOA 3N86A 2BEWA 2E49A 2RONA 2BFDB 3ZY6A 1FU7A 4YQFA 4CETA 4KN9S 1VJTA 1SNYA 3TBFA 5J4HA 1QSGA 3DZCA 5CDYA 2A35A 4FCWA 4KJZA 5DHRA 5FBZA 4YAKA 2RH5A 5JSUA 2BDUA 2YS7A 1JE1A 2OY0A 4GLOA 3RBZA 2RGCA 1CS4C 4CKWA 3I83A 2CF5A 4L22A 5A1TA 3F8SA 4KH0A 4LS3A 4MS4B 4Q7QA 1S8NA 2JH9A 3WRXA 1P0FA 5IZCA 1EUCA 1TM3E 1V6CA 2XDWA 1HDIA 2IT1A 4XQGA 5CYFA 2WF7A 2QAGB 3T7SA 2GARA 2Z83A 3QM1A 4X45A 5IEJA 2BFWA 2IBSA 4YXWA 4JI8B 1FVFA 2GN9A 3ED5A 5C0OE 4M2LA 2JK0A 4CLRB 3ZCXA 4ER0A 5A1JA 2YQ5A 3GT4A 3S27A 5CA1F 5DH9A 2Y66A 1M7GA 5CT5A 4PCLA 2GN4A 3RC3A 1KJJA 2HPZA 3L7KA 3E2MA 3L7OA 1E7WA 1WF3A 4LF6B 4U2BA 1SCBA 3SDSA 4YWHA 4TTAA 2FMFA 3ADDA 1LW6E 1YGYA 4ICIA 1VJ1A 1KP2A 4BDTA 3W5CA 4KAFA 3S0JA 1MU0A 1PTJA 4G4SO 2VQSA 1WS6A 3HRIA 1HE8B 5E9QA 2PSDA 4HXYA 1P0MA 2H2HA 2RH8A 3B3AA 4QXOA 4C7XA 1X7YA 4W7SA 1VL8A 2YC4C 3W78A 3WLLA 4ENWA 1RAIA 5L51A 1Y6GA 1QE0A 2FCRA 5ICCA 2LR0A 1P91A 1OZ0A 3MXTA 3JY6A 3NJ4A 4MJXA 3OECA 2HZ7A 4NXNB 2OXEA 2WTXA 3LOQA 4CM5A 6PFKA 3EFHA 3I2HA 3NPAA 1I5EA 1NMSA 3OIDA 4XYMA 5F2OA 4ZT5A 3J81k 3QYJA 1QG6A 5K8CA 3P4UA 5LBTA 1RLTA 2JHPA 2VA8A 2X3FA 5KHAA 1WSBA 2CCJA 4N7BA 2GEBA 1X8KA 4LZJA 4UBKA 2H5EA 4OXKA 4QPZA 3WQRA 1R88A 4KAXA 4RK1A 1RXWA 1G64A 1AUQA 1CR6A 1P6UA 2E6UX 3PXUA 1LRJA 4IDFA 3EGDB 1M74A 3LTEA 3MS4A 4LECA 4LRSB 4TRJA 5EZYB 3TOCA 4C01A 5G0VA 3MCUA 5LQRA 1Q50A 1TYDE 2OOSA 2OOKA 2R87A 2YR0A 2AN5A 3EW7A 4YUVA 5U1PA 2XE8A 4RTQA 4UZSA 4LFCB 2DUNA 1GGKA 2WHXA 1KC3A 3G2QA 3L40A 4FDUA 1TRHA 3FMIA 2JEZA 2IC5A 5LLDA 4RSHA 2WP8J 2WTMA 3HR4A 1XD2B 2ZATA 5GZ1A 1RQ7A 2I65A 3JYQA 5CYOA 1YJXA 2AVDA 1FZQA 4ABYA 2X0IA 3KQMA 4MPPA 3UMRA 4ZO7A 2IDJA 1P2SA 2XWSA 2XUKA 1QR2A 2E89A 4H7IA 3ICCA 3PF8A 4IKPA 4D4IA 2FXVA 4FOSA 4CQJA 2E48A 1TUIA 4BC1A 1QGYA 3MLAA 1VP3A 4E15A 3NKFA 1ZUHA 1Z6QA 3BK7A 3O9ZA 1HDEA 4GSYA 5EJAA 3KQUA 1GM5A 1AQJA 1GRRA 4G5HA 1J70A 3IQGX 4XZ3A 3ESXA 1P6QA 1M75A 1HKUA 3COYA 1SUFA 1UAGA 3OZTA 4MGIR 2VYFA 2ZYVX 4ZCMA 1TKAA 4L95C 3DUFA 3JYPA 1F1JA 1U8AA 4GWKA 1BGWA 1H4SA 3KAJA 1USGA 3PRJA 2OBXA 1VJ0A 1HM5A 3E9CA 5E6SA 3K1JA 2V65A 5BMOA 1TE2A 5KKAA 3V4VB 3MJTA 2DHDA 5FV4A 1BEZA 1MIOB 3LSTA 4P7KA 3UW3A 1W8DA 4BNJA 3ZS8A 4REQB 1SD5A 1V4NA 1RJDA 3DO8A 3OPQA 3JSAA 3EA0A 3Q3VA 4PO9A 3KTAB 1FYVA 4US2R 5F1KA 2HF2A 2ZYIA 1K06A 4QXMA 1G63A 4L8VA 2ZBVA 3B3JA 3E9RA 4LCBA 3K9FC 1UJ6A 3RC2A 3B8EA 1UKYA 1WBJB 4LOIA 2H52A 3BXFA 3SIXA 2WPDD 4U8HA 1Z8HA 3AM5A 2EWWA 3BAZA 2PT9A 2ET6A 4PYKA 4JYCA 4CMCA 4A0FA 3CX4A 1P19A 4JGIA 4MQEA 3AR6A 4J6EA 4YAOA 5F12A 2G9VA 2N42A 2I76A 2ODEA 2TYSB 1LC3A 3I9OA 4PFJA 3A3PA 1PUIA 4BOYA 3WNDA 4TKVA 1XZQA 1N9GA 3R0VA 1DIOB 4CKBB 1QVWA 2V97A 4F8EA 1B43A 2UDPA 3NHYA 4G8JA 2P4EA 2QL9A 4ZO8A 1UDWA 1NNUA 5GV8A 3ZU6A 3I37X 4R1SA 1CUXA 4JAVC 1SBYA 4BAGA 4HDCA 4P4SB 4U0KA 1RJWA 1BGXT 3QF7A 1AKTA 2IYZA 1TT5A 1XZ8A 3K1YA 3AGPA 3GD5A 5FTMA 1KEWA 2OK8A 2WC1A 3NW9A 4QOHA 5DHFA 3GK3A 4DGSA 1J23A 2WJ6A 4X6YA 4ER5A 1YQTA 3KG2A 1N78A 1HOXA 1H2WA 3LBNA 1ONPA 2Z5FA 5PNTA 2ZU6A 3GU3A 3I1FA 3GGDA 4I55A 5CVCA 2QSZA 3JAWB 3RUHA 2V54A 2FW0A 4A0HA 1OZFA 4BFTA 4J1SA 1KQFA 1DO0A 3PENA 4L3VA 4MKHA 3A26A 1YDFA 1LRLA 1R18A 3A2MA 4LWQA 1WZEA 1KEZA 1Z38A 2M32A 4WZAB 3ESCA 5J58A 3F5SA 4TLAA 5M04A 1GZ3A 2HL6A 3PHBE 4AYWA 3BD6A 5C1DA 5EQJB 1QH9A 4DPLA 3IEVA 1KO7A 1W34A 2F3QA 4H9GA 3FOWA 4KFUA 4U2CA 3DE0X 2WABA 4H7DA 4C0LA 3OFNA 3H4IA 1KI4A 1P74A 3MTAA 2DGDA 2UZIR 1SUDA 5D3ZA 1CYEA 2UVDA 1PV4A 3NETA 4JN6B 5KYUB 2RGGA 4ZJPA 3O4VA 4RA6A 2B20A 3UAWA 1BNCA 4X8LA 1JB9A 5CT8A 3HXTA 5CCDA 3KU4A 1D9ZA 4FEAA 2FYTA 3OIWA 3WV5A 3DL7A 3G3EA 2QT9A 4F9EA 3Q3GE 1G291 3TPFA 2IOFK 3L0ZA 3GLGA 3I34X 3FDZB 1W0KD 2OR3A 1QMGA 4MUIA 1MH9A 2GBPA 3TQOA 3WBKA 3H9QA 3ZVNA 1VDMA 3KRTA 1TF5A 4B3SB 4JVSB 3AU9A 3ORHA 1Q7BA 2WUEA 3HCBA 2ZT5A 5EMJA 5DYIA 4FOTA 4X1OA 1QIFA 5GONA 2GPTA 2XNKA 1PF7E 3CSSA 1ZM9A 2BZGA 1YU9A 3KSUA 1NOKA 3Q7PA 3PFIA 4DWVA 5TC4A 5GY7A 1GSAA 2O3SA 3AQIA 3IHTA 3TD9A 3N07A 4PU0A 4N9QA 4WFQA 2OCBA 5K3EA 3M9LA 3V6LA 4ALJA 1Z5UA 4HYQA 2YRXA 4B3DA 1FX0A 3IQZA 3E8XA 5F23A 3EARA 4D6YA 3BIOA 1CJBA 1OFVA 1JGTA 1RLMA 2JCGA 3LUKA 3OPXA 2YNMC 3ESRA 4F6RB 4X7MA 3JPWA 3OKAA 4GI3A 2UZ1B 1JWAB 3RUDA 2Q1WA 3HKCA 2NU7A 5BSHA 4YMLA 3BMQB 5F2KA 2GYWA 4JB8A 1O1YA 5A5FA 3FBGA 3K71B 4BNFA 3UZUA 4V0KA 4ZI2A 1HNWB 3BMOA 4X95A 2HM7A 4O0MA 1JL3A 2R4UA 2A5FA 4WY8A 4KLZA 3GFSA 4XR9A 1TRKA 2AMVA 1KYQA 3BK1A 3SMVA 2WTNA 4H4CA 1T35A 1Q0SA 1Z5VA 4MW7A 2QGNA 4YT8A 4BVLA 3RFXA 1ZKMA 2QQEA 4JT9A 2OHOA 3EVFA 1DELA 5C8VA 1U3WA 3MT0A 1KE1A 2LCQA 4YRBA 5JH7B 4RH0A 1WCV1 1JU9A 3Q8WA 1B0PA 4ZOLA 5D85A 5I9BA 3B6ZA 2WE7A 5C5EA 3FHLA 2J87A 3JARA 4RORA 1H3FA 1PDVA 4J0EA 1ZNZA 4IXTA 3RUEA 2VRCD 4ATNA 3LUPA 2WMDA 2XUGA 2P30A 2QX8A 4D9IA 2O7VA 3DLCA 3QV1A 3U49A 4CHTA 4FOLA 5HOEA 1NYLA 1W36B 4DEXA 3FF1A 4C0KA 5F64A 1IFXA 3BREA 4JV5B 1M8GA 3OFJA 3I64A 1ADGA 4MR8B 3OLZA 1Z06A 3CE6A 4M9QA 4OL0A 1QG4A 1XGKA 3WLJA 2FK7A 3CUSA 1DX6A 2VJYA 4EVRA 1UWLA 2OGSA 3B1KA 3I0NA 1IJEA 5DJ5A 1WETA 1HK7A 1FF9A 3TRKA 5JAOA 1JWLA 1G7SA 3BA1A 3VA7A 4GYWA 2YMLA 3OLVA 1LVHA 2G40A 4KL8S 1GGJA 2J6CA 1HL3A 3H2YA 1ZOPA 3DDZX 4NESA 4E2FA 3BM5A 4UVIA 2O0MA 1A4UA 1TU4A 3ZBQA 1QIKA 1Y3BE 5KI6A 2PX6A 5I5GA 2AFIA 1RCUA 2ZI9A 4MUNA 3FWKA 3UCXA 3GLIA 1YZYA 4DDHA 1T4CB 4IDCA 3RTBA 3TNJA 3ZKWA 2VJNA 2A9KA 4IH1A 1CUFA 1MDBA 1XTJA 2QMUA 1SXHA 4IV8A 4G3XA 1V5FA 1FU4A 4R1NA 4QHYA 1HY3A 3F71A 4H7HA 1NVWQ 4HT3B 5JYCA 3E2IA 4LYGA 4RKWA 3H7IA 3HKEA 3K5HA 1GNRA 3HYNA 4X1IA 5J59A 2NV2B 3TJRA 2FP3A 1Y82A 3OD1A 3M4JA 1T4MA 4KSBA 1SY7A 4PXSA 4WLNA 4WTOA 4R9NA 4ZQEA 2F67A 9ABPA 1V25A 3R3SA 3NEPX 1JJVA 4IIUA 4UAGA 4JMPA 4J8PA 4MGHA 3N3AC 1KVQA 5IWCA 1NYTA 2C83A 2C3YA 1OILA 2PUVA 1WXWA 3OMWA 1ZX1A 4LQDA 5G2OA 4DNPA 5KOJA 4TZ6A 7MHTA 4Q3KA 5DM70 5EP1A 4UQOA 1DT5A 4MS3A 3WTBA 1K3TA 3BE4A 4X54A 4B3XA 3V1LA 3G8YA 3M2TA 4QAJA 4KC0A 3UGTA 4EVSA 1FRQA 2OFXA 4TV8F 3I92A 1OGIA 3TCKA 4Q1BA 2FWAA 3LU1A 1G7TA 2P3LA 2ZIWB 4P3YA 1EVKA 2QOEA 3C6KA 3CNHA 1WCIB 4F4UA 3C6XA 4G2TA 1SRQA 1QFYA 3B48A 4LK3A 3VO2A 4E03A 2QLNA 3NAMA 1JPVA 1GGFA 2R9VA 1ULHA 1N6PA 2P4HX 5F3DA 1DPFA 3OOEA 2WNHA 3EY9A 4R2MA 1GCGA 5AJYA 4KTVE 1DQNA 1UFOA 5HKKA 1Q5PA 4TTRA 4FYPA 2BGWA