3FX3A

Structure of a putative camp-binding regulatory protein from silicibacter pomeroyi dss-3
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
223
structure length
218
Chain Sequence
HEAQKAIARNSLLIRSLPEQHVDALLSQAVWRSYDRGETLFLQEEKAQAIHVVIDGWVKLFRMTPTGSEAVVSVFTRGESFGEAVALRNTPYPVSAEAVTPCEVMHIPSPVFVSLMRRDPEICISILATTFGHLHSLVAQLEQLKAQTGAQRVAEFLLELCDCEVTLPYDKMLIAGRLGMKPESLSRAFSRLKAAGVTVKRNHAEIEDIALLRDYAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a putative cAMP-binding regulatory protein from Silicibacter pomeroyi DSS-3
rcsb
molecule keywords Cyclic nucleotide-binding protein
molecule tags Camp-binding protein
source organism Ruegeria pomeroyi
total genus 65
structure length 218
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fx3A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3fx3A01
1T0FA 3KGLA 4KMUX 1NXMA 1JHHA 4XETA 5HS9A 1P4AA 5JR3A 2HOEA 2K9ZA 3T1BA 3WGIA 1BOAA 4HF1A 5CVIA 4I0AA 4HF2A 1Q1HA 1S3JA 2OZJA 4GYIA 3HIFA 3GWZA 4MNUA 1YUDA 4M72A 4YFNF 2O8XA 3K1MA 2MA3A 1MJ9A 3E5QA 4FAHA 3M70A 3KE2A 2C0ZA 4RAZA 4M9XA 3KETA 1LVAA 1K78B 4IEOA 3ELNA 2V79A 2CWEA 5J8CA 1ODDA 1O5LA 4Q0UA 4WWCA 1TQ5A 2H09A 2YX7A 4YFXF 3D5LA 4LMYA 1O4TA 4I2OA 2NAZA 3WW2A 3WE2A 2EWNA 2B9UA 4I01A 1LR5A 3F72A 4ZU7A 4LB5A 3NJZA 2QENA 4OIRF 2DPUA 4CZZA 4F7ZA 3ISPA 3NQOA 2E1CA 1J7KA 1R7JA 3BPVA 4Q5SF 3H7YA 2Q30A 3LAGA 1BC8C 4FX4A 4P55A 4KIBA 1J3PA 4A0ZA 4DNCA 3ELKA 1LNWA 2F2EA 1EYBA 1U5TC 1DGRA 3GX4X 3K2ZA 5L3BA 1ZLJA 2M8EA 3JTGA 3T8TA 1I27A 3R4KA 1U8RA 5K5RA 3FZ3A 3E5UA 2DFIA 1DP7P 1ZZ6A 3GYDA 4BYYA 6PAXA 4JQFA 3CEWA 2QQBA 4KMFA 1KQ8A 2EV5A 2KJCA 5AIPA 1YFYA 4G7HF 4ON0A 3TGNA 4ZYEA 1I6XA 5I0SA 5DCFA 2EAAA 1Q5OA 3H92A 4CICA 3H7JA 1OFNA 4IEVA 1B4AA 1SFEA 3SQNA 3NW4A 2EFOA 2K27A 2XIGA 5E1WA 3U0ZA 1RNLA 4LULA 3EHKA 1PP8F 1PM7A 2IA1A 2L4MA 3ECHA 1YIOA 1WA4A 4HVOA 3BP8A 4X6RB 1XDUA 5KHJA 2CGPA 2HS5A 1XMAA 2RQPA 3J80K 4Z82A 3H50A 3U9GA 2DBBA 2EK5A 2MD5A 3M1EA 4LK1F 3SCHA 2STWA 4YIIA 3O3KA 2QJVA 4QXKA 5T3NA 3L09A 1CAVB 3WE3A 1LEAA 4L0YB 3DL3A 1QO0D 2PJPA 3E6BA 4IETA 2F5FA 3I4PA 3LA3A 2FRHA 1KYZA 4MV2A 2QVOA 4IRIA 3TKYA 5FO5A 4AVAA 1FI2A 4UNOA 3VFZA 1G3YA 4PCQA 3JZVA 1FYLA 4L0ZB 3RJPA 4XFBA 1PP7U 2WFPA 2RKHA 4HA8A 4M9SA 4HDUA 3M8EA 3C1DA 3I71A 1O57A 4JTNA 3C3VA 2IXHA 2OD5A 4KICA 4XF9A 2F5DA 4MQVA 2ET7A 2G9WA 2FBIA 1ZYRF 1J3QA 3F3XA 4Y13A 4Q0QA 4UHTA 4NB5A 1S6LA 3FX3A 1UD1A 2DCTA 4EJUA 1BIBA 4HLXA 2CSOA 1R00A 3C3WA 2FBKA 1XGMA 3KP4A 3E97A 5D4SA 1KU7A 5LHIA 4IEXA 1P6RA 1I1SA 4HN1A 2KJBA 4FHTA 3BJOA 3RYKA 3BZ6A 3V8JA 4UVBA 3SHFA 1Z05A 1YO5C 1D3YA 1FC3A 4R52A 1OYIA 1XN7A 4XF1A 2VT2A 3CUQB 5HLGA 2W84A 2EB7A 2OPKA 5KHKA 4LEJA 2KKOA 5D5XB 4HVQA 2WTEA 2A6HF 1GXPA 2GH2A 3RKWA 4IHSA 3ES1A 1O7LA 5A2QZ 4UVCA 1MDMB 4QGLA 1GQHA 1QBJA 1RZ4A 4WX9A 2HQNA 1YG2A 2IXIA 3SXYA 4ETSA 2ESNA 1TLHB 5ILSA 3D0SA 1Z9CA 1WWXA 2LF7A 1ZVFA 1XGSA 2MPFA 4G7ZF 3OOPA 3FE5A 1ZGJA 4MQ9F 3V8LA 3JAMZ 2Q0OA 3PLQA 2V1XA 4RGSA 2QBYB 1WI9A 5FDBA 5I0RA 4P9FA 4A0XA 5E17F 1ZZCA 3MWMA 4HDVA 4EWAA 2MLKA 2J5OA 3SFZA 1ZZ9A 4ZU4A 2A68F 5LEJA 4IESA 2H0VA 4M73A 4EVIA 3ZP5A 2F5EA 1TBXA 3GO5A 1YWKA 1Z6TA 2P7VB 2DQRA 3L2HA 2P4WA 3F8BA 1T38A 1LDDA 4KN4X 5HOOA 3TQNA 5FCCA 1YW7A 2P17A 4XFHA 4KL1A 2ZKLA 4U0YA 4GCVA 5FFZA 4A6DA 2F4PA 3J81Z 1ZN2A 2IT0A 3JW4A 1JHFA 4ZYHA 4QM9A 3MYXA 3RDIA 1LQ1A 2QLZA 1X7NA 3B02A 4HX4A 1GQGA 1HW2A 2FE3A 2IA2A 2Q2EA 1IRFA 3CF6E 5KHHA 4L9NA 5CADA 1YW9A 4RB2C 1KYWA 2K4JA 1IN7A 1F4KA 2DT5A 1YLLA 1LJ9A 5LLQA 2QYOA 5I93A 1QY4A 5BPDA 3TOAA 3LFKA 3WTXC 4MGZE 2C6YA 3IC7A 1S8NA 2XAQA 4M74A 2BV6A 2Q0AA 3ZQ7A 1FNNA 2HQRA 3O6BB 3T8RA 4PIXA 4BH9A 1UFMA 4I0BA 1OD5A 2HGCA 1J59A 1DZRA 3N97A 4KYWA 2RV8A 2K7LA 4KWJA 3CJXA 2O1QA 4MH0E 2UY9A 2D5HA 1G3WA 5L3DA 2D1VA 3KCCA 5TJJA 4B29A 2ZMEB 3COAC 2ATFA 3SZTA 4CDGA 4M6XA 5BPXA 3W6KB 2KIUA 2MBFA 5JAXA 1Z7UA 4B09A 3IIAA 3FMRA 4NQWA 4HLYA 1TNTA 5HDKA 1FZPB 4Q29A 2CYYA 3SZPA 1YYVA 4GO1A 2Z5UA 1Q43A 2Z2SB 3WTZA 4KUMA 5HI0A 5JR7B 2OQRA 2PBIA 2BNMA 4UVAA 5JCTA 4Q47A 5I8SA 1VR3A 1CX4A 1R23A 1U12A 3EUHA 5BQTA 5HLHA 4I09A 2XHKA 1Y3TA 2PAEA 4R1HA 1SAXA 3FM5A 2W85A 4G7OF 5AIQA 1P2FA 3LAJA 5D5WB 1ZRDA 5H6RA 4HX8A 4IRHA 1XD7A 1WKMA 2VBXA 1LDKB 1TQIA 5E1RA 3V4GA 4ZZDA 2L54A 1SEFA 5F1RA 3I5UA 4EJVA 4Q0SA 1FY7A 1FYKA 4BQAA 2HKOA 3KLOA 3CLOA 2W24A 3LSTA 3T5XA 1RL3A 5K5QA 3HTUA 1RTVA 2HZTA 1GHCA 2V09A 2COMA 2H6BA 3L7WA 1DPRA 1S7AA 1K6OA 2E7XA 3WTTC 3HYIA 1O3RA 2ZBKA 1IUYA 3SMHA 1SD7A 1W5SA 5ICFA 5DD8A 1EV7A 3MEXA 3LQQA 2PN6A 2I45A 2PG4A 4O9EA 4LJZF 2VBZA 2FMYA 4RGXA 4HBLA 3S7EA 3ZN1A 4IJAA 3PVBB 5BUVA 5H20A 5FFXA 4CO8A 1ZZBA 2DW4A 2OZUA 2ZJ2A 3RYRA 3V7SA 2FSWA 2OQGA 1RI7A 2ISZA 2STTA 3KGZA 2P5KA 1B6AA 1F5TA 1USSA 3ES4A 4TV7A 3HT2A 2DTRA 4META 2B0LA 4A5NA 4QMAA 5K5OA 3CUOA 1D8JA 1FSHA 4AQ2A 5LEKA 3DEUA 4ENNA 3HRSA 4LA2A 2XV4S 5IT9Z 2XAJA 1E2XA 1TW2A 3F23A 2NS0A 2EJRA 1CAVA 4KFCA 1CAXA 1FX7A 4MX3A 3NEUA 4MHGA 4Q0PA 4GXOA 5AVPA 1ZZ8A 4I02A 2GZWA 4EMSA 1G6NA 2ELHA 5HDNA 5FQ0B 1WGPA 3U11A 3CL1A 3NKTA 4AVBA 3OGJA 5CU1A 4ZH4F 1XGOA 3KLNA 3KP7A 5FLIA 4U88A 4IERA 3FZVA 3DKWA 1BC7C 4Z07A 4BXUA 3E3VA 1KGSA 4NHJA 2A3SA 3DN7A 4CXFA 3DP7A 4U7DA 2CAVA 2A6EF 3BROA 4D7SA 2K0GA 2GC1A 3CLPA 4ONUA 3ZMVA 5LRRA 1ZZ7A 1VTNC 5DYMA 4QLCU 4RB0A 4L5JA 2FBHA 2PHDA 5K1YA 4LA3A 2XGXA 1ZAOA 3FFQA 3FWEA 1L3JA 1U5TB 3J80Z 3RKYA 4Q4ZF 4HW0A 1EH6A 1MJAA 3HTSB 1LRHA 2BNOA 2JRTA 2QNKA 1IN6A 4LG0A 3K9TA 1USTA 1YS6A 5D6FA 2UYBA 2HYFA 4LLLA 2P6SA 3DPTA 1TTYA 3IKTA 4LGWA 4RD7A 4KU8A 3VEPA 2FXAA 3S0MA 1D8KA 3I53A 3CUQA 1ZX5A 2HYGD 2RNJA 3NL1A 1H9TA 3BY6A 3DPLC 3KP3A 1TQMA 3GFIA 1QXJA 1IXSB 1U2WA 1CAUB 2KXLA 1UPIA 2O3FA 1SQ4A 4JK1X 2FEZA 4AIJA 4HV6A 4UBGA 3CO6C 1WLTA 3H9AA 4EM2A 4MTDA 4KDPA 3WTYC 1Z6RA 2HTJA 1DGWA 2QUFA 3EBRA 3QPTA 4XLPF 3GW2A 1R1TA 1W7PA 4AIKA 4PDKA 3NSTA 1QPMA 2EA2A 4H7LA 3GEZA 2YU3A 4XFIA 3V7CA 2FA5A 1R36A 1NE6A 4HN0A 1YHFA 4Q0VA 1P4WA 2HJIA 3EQLF 3HQXA 4ORFA 2ACJA 2ZNZA 1OYWA 4QGNA 1BI1A 1J3RA 5J48A 4IHTA 4EJWA 1Z1DA 3MZHA 4G94A 4LK0F 1R58A 2OA2A 3O2PE 2IPQX 2EA7A 3LA2A 3F22A 3BPZA 2AXLA 1TW3A 2DLLA 2NNNA 5FLXK 2MNGA 2M45A 4ENMA 1MJBA 2O03A 1Q3EA 1QZZA 3L00A 2VONA 2OU2A 2J5PA 3WTWC 2E1NA 3QRFF 4CYDA 2DPDA 1ZGAA 4M6YA 2F5CA 3JTHA 3EQEA 2BEOA 2LKPA 1B59A 3WGGA 4I98B 2QCSB 1XSXA 3L9FA 2B5HA 3SHRA 2VQAA 2Y0OA 2QQAA 2YSRA 3IDCB 4Y15A 1Z91A 3QPHA 3TO7A 2XUBA 2DK5A 1FYMA 2PTMA 2K4BA 2HDCA 1KQ9A 3HRMA 1E17A 1MKMA 4B8XA 3EYIA 4EWEA 2JTVA 2CG4A 3BPXA 3S2WA 5J7MA 2GC0A 3OTFA 2EFPA 3Q9VA 5JSOA 4LUKA 5E20A 2UY8A 4LTAA 3V8KA 1CGPA 3OD0A 2IC1A 3MCZA 2PYTA 3QAHA 1SD4A 1EY2A 1J5YA 1CF7A 2UZKA 2XAFA 4YSFA 1X3UA 1IPJA 1H0MA 1HW1A 3IKVA 4U7BA 4IEUA 2KIFA 3E6DA 5FPXA 4HQEA 2FQPA 5DUKA 4EGYA 2QZ8A 4YARA 1CAWA 4J1XA 1DZTA 2XROA 4KIFA 3P7NA 1FBUA 5D1IA 3IRQA 4YRDA 4P9GA 3K69A 1B1BA 3ROUA 4PZJA 2V6CA 3AAFA 3GXOA 1ZRRA 2G7HA 4L9VA 2JPCA 2ZFWA 1PDNC 1SFXA 2PQ8A 2Z99A 1KU9A 5FPZA 5LGTA 1QWRA 2UXNA 1A04A 1BBYA 3RIRA 5EFUA 4HBNA 3M7GA 3OCPA 4IEPA 4HAMA 1D5VA 3LWFA 1L3LA 1T39A 4GYGA 3M9AA 3FMSA 2MH2A 1KU2A 1FPQA 3BJ6A 2VC1A 2GWRA 4PIYA 2NRAC 4S04A 4MEYF 3RPQA 3HOSA 2OBPA 1BIAA 2QDRA 2D5FA 4AVCA 1H1MA 1IPKA 2X0LA 2BE5F 5DCMA 4LB6B 3BDDA 1F9NA 1QNTA 5CJ9A 2IP2A 1STZA 4IF4A 1ON2A 2V1DA 1W4MA 5CYVA 4KIGA 4EQQA 5K8SA 5DD4A 4HOBA 3C18A 1S7OA 3R6SA 4HYEA 2V1UA 3GZ6A 4IEWA 4Q48A 2PHLA 3H1YA 4WXCA 4FBFA 2CV6A 5HDGA 3T0YA 2JPBA 3GZ5A 4PJYA 4P5OA 3KSCA 2B8MA 3I7DA 1ZG3A 1IXRC 3TO6A 1SMTA 4U0WA 2LDUA 4QGMA 1HBXG 5JHUA 3KZYA 2LNBA 4Y17A 4I3PA 1OPCA 1TNSA 1R5HA 2ZCWA 3ML6A 3RPUA 3I0TA 2AS5F 4L9TA 1ZG1A 4A0YA 5A2QK 4OU0A 5CVUA 4XFFA 3ACLA 4IEZA 4NVPA 2WC2A 3CO2A 4WZCA 4HMZA 1FOKA 2MHFA 1KQ0A 3F8NA 3NVCA 2NNYA 1K78A 4EM0B 4KU7A 1KU3A 5KBFA 3P9KA 1SFUA 2EA4A 1BI0A 1J1LA 4HVRA 2R7FA 3FF5A 4K8FA 1EP0A 1UIJA 2P5LC 4O9GA 1SD5A 3FJSA 3JAMK 1XCBA 1V70A 3WW4A 2YPRA 5D8KB 1S29A 3KP5A 5D6EA 4UXAA 2VOPA 4HX7A 5KHIA 2D45A 3EYYA 4ESBA 3LWCA 1ZREA 2CQKA 3JSPA 4EV0A 3I58A 2K02A 4OIPF 5JVTA 1IN8A 1LKNA 3VHRA 5J6XA 4N9HA 4HLTA 1YQAA 2UWMA 2XLFA 2GAUA 3M3IA 3BALA 2D2WA 5BXXA 3G73A 2XAHA 3QP5A 4MGYE 2UXXA 3J81K 3H8UA 2ZKZA 3FXQA 3RYPA 1H1IA 1YW8A 3IBMA 4F8AA 2IRFG 2HKXA 1XSDA 4BIFA 3FXUA 3WTSC 4EGZA 4EJTA 2Z69A 1YFXA 2EFQA 1W7PD 1OYYA 3HUGA 3HHGA 3QP6A 3RKXA 5EEHA 2FNPA 3ETQA 2VBWA 3B73A 1XRUA 3KFWX 5L3EA 2PAKA 5I0UA 1IXCA 2GXGA 1K79A 2PMHA 3R60A 1WQ2A 1FBQA 3TNQA 1ZLKA 5F64A 1BJAA 2XAGA 1EH8A 1FLIA 1JUHA 5ERIA 1EH7A 5ED4A 2VE9A 2VC0A 3F6VA 2P6TA 5HS8A 4S05A 1U6GA 1IN5A 4ESJA 1IF1A 3WGHA 4MGIE 2O61A 1HXDA 4PIZA 3S7IA 2CO5A 4ASNA 4AWXB 5E8IA 4ESFA 2DI3A 4XSXF 3U10A 4A5MA 4EROA 3GFMA 5FGMA 2QQ9A 4IVNA 5E18F 2XLGA 1X8MA 3N4MA 4XF4A 3FXRA 1O3TA 1C0WA 4LUMA 5E8GA 2K86A 5D5VB 4IEQA 3ST7A 3H3UA 1U78A 2DO7A 1BI2A 1X8EA 3BB6A 5I91A 4XSZF 2Y48A 2M5WA 3IWZA 2Q4SA 3F8FA 4GGGA 1U3EM 3J7AO 4OFGA 2O6GE 5E1XA 2HFHA 2HR3A 4AIHA 4XRFA 5F6FA 2H27A 1O3SA 4I7HA 4OIQF 4XFGA 1V3FA 4YNIA 2PMUA 1OMIA 2EVXA 4L5IA 4IEYA 4WXDA 4D0PA 3WTVC 4G8XA 2L01A 4BAYA 4WF2A 5CVJA 2CFXA 1RGSA 2Q1ZB 5FD5A 3HSFA 3W6JB 2Y75A 4IRGA 1OI6A 2CAUA 4GULA 4MEXF 3Q5FA 2RN7A 4Z2YA 3WU0A 1VJ2A 3U1DA 2FU4A 5L3FA 2BGCA 2XLAA 4MTEA 3I59B 1PUEE 4XF3A 2CW0F 2L02A 5FLXZ 3RTRA 5IT3A 1FT9A 2VODA 1RUOA 2IXLA 3M8FA 4WBBA 4P96A 4CHUA 2KRFA 1WSUA 4HV5A 4UV8A 2GA2A 4ENJA 3UKVA 2Q8KA 4G6DA 2GA1A 5BMZA 4ZYGA 1GVJA 2P7CB 1Y9QA 4L2NA 3KP6A 1J75A 1LB2A 3K1PA 2FOKA 5LHGA 2XKOA 2PEXA 3LQRA 5JFRA 3HRTA 3H1MA 3HHHA 4OIOF 2R3SA 3D82A 1MDMA 4WVZA 3GVAA 4OMZA 1WRJA 1UHWA 5LGUA 4EM1A 1O3QA 2ETHA 4JBAA 4R79A 1T98A 4D7TA 4XLNF 2TDXA 3NRVA 5IT9K 3GBFA 2VOOA 2L3DA 1XMKA 3EO6A 2DQLA 1ZARA 4O6JA 2QWWA 4E2SA 1T6SA 1XE7A 3WODF 1BI3A 2JT1A 1L0OC 2ZNYA 2W25A 2VN2A 2ZO4A 1MD0A 2DAOA 3VODA 2QBYA 3REOA 4MGRA 3OF1A 3MAJA 4HF0A 5I8TA 3TO9A 1G3SA 5BPIA 4TLFA 3ZMUA 3ULQB 4AXOA 1ZG5A 4UUVA 1REPC 1FBSA 4BHBA 3E5XA 2FF4A 2H6CA 2W57A 1XGNA 3P9IA 3HOTA 4RAYA 3D0JA 1B9MA 5DUIA 1BN5A 5LRSA 1FXZA 4E2GA 5JSPA 2D40A 1FWZA 3K0LA 3MFKA 2R7DA 3GUDA 4LFUA 1H9GA 1EPZA 2EV6A 5D8LB 2OAZA 3GYHX 2PI0A 2NYXA 3FHIB 1R1VA 3DXJF 3ZN0A 3IRRA 1OR7A 4DQ2A 1QXRA 1Y0UA 2MH9A 4J1WA 3GFLA 1SMYF 5C8WA 4HSLA 3I54A 1R5GA 3TDUC 3IHUA 4U0VA 5L3CA 1NHAA 2VBYA 5E16A 3LAPA 2RDPA 2GIVA 2MC3A 4EJOA 3PQJA 4E2QA 1CAXB 2HWVA 5KK1A 1ONVA 1ON1A 2BNNA 2HTSA 1IRGA 3ZDSA 4BHCA 4X6QB 3QOPA 4WK8F 4O5VA 3MPBA 1F1ZA 2IJLA 4HQMA 1JXSA 2PFWA 4ZZLA 3RI4A 5E1ZB 4XBFA 1QZYA 1HSJA 2HEOA 1UHMA 2UYAA 1J9IA 3DV8A 1IZ1A 5KHGA 2ZMEA 4LLNA 4RB3C 3GF2A 1FSEA 2P8TA 2E7WA 2FMLA 4YYOA 3VOEA 3CJNA 2OZ6A 1YLFA 4OOIA 2IXKA 3LA7A 1YFUA 2WV0A 1YFWA 2N7GA 3BU7A 1P4XA 4UXNA 3PQKA 1FP2A 2Y0MA 5H6QA 1YFHA 3QACA 5ILUA 4MUVA 3TNPB 3G3ZA 1XDSA 1VP6A 5L3GA 2M87A 4R8HA 4YFKF 1GXQA 4K2EA 2VECA 3IDBB 2ISYA 2VE8A 4KWLA 2RGVA 5DDGA 1R22A 2E9QA 2GXBA 3ZMZA 1QQIA 2A07F 2PA7A 1W5TA 2Z33A 3ZMTA 4LG0B 5D5UB 3IWFA 3EDPA 4DINB 2XKPA 4N9IA 2X4HA 5CLSA 5DEQA 1XB4A 4EWDA 4AVPA 2IXJA 2RC4A 1P92A 5JSRA 2VPVA 5C6CA 5HVQC 3C7JA 3GFJA 3BOQA 3V7RA 2EV0A 1IAWA 3ZMSA 4JV4A 4L11A 5FB2A 2QM3A 2IXCA 1ZRFA 4XFCA 4KA4A 1AOYA 3TDZC 3F21A 4LD5A 2VXZA 5CVVA 1MGTA 2XASA 3CO7C 2Z3YA 1NE4A 3HSEA 3BJAA 4MZUA 1ZRCA 2ETEA 3FHZA 1W7PB 1DPUA 2IA0A 4A6EA 4M71A 1UB9A 3CUQC 4A2UA 2FQ3A 4UBHA 4XF0A 3L2CA 3E6CC 1LDJA 2PAMA 2JZYA 2LSOA 2GQQA 3KMHA 1HSTA 5CVRA 3ZMDA 5EZWA 4OMYA 2EFNA 1XCVA 3KZZA 1ZH5A 3R0AA 2O0YA 2V9VA 4G9YA 4QX5A 3SXWA 1NZCA 5FLHA 4L18B 3BWGA 2D93A 3RZZA 4KNYA 1J2XA 3EETA 3I64A 3IL2A 3Q9SA 2IW5A 3O14A 1SFNA 4YG2F 3USSA 1LEBA 1RUNA 5HS7A 3LZZA 4RB1A 5FQ0A 2ADUA 3F8MA 1KA8A 3ABUA 1G4DA 3E6MA 3WG9A 3FM3A 1I5ZA 2MLGA 4E70A 4O3MA 2G7UA 1IN4A 2M1BA 3RNSA 4YIFA 4AQ6A 4WCGA 3ZPLA 1JGSA 4XEZA 1V4RA 5EEGA 3SCGA 2O8QA 2GC2A 1DDNA 1PMIA 5BY5A 1FP1D 2ET1A 5HLIA 2VT3A 5BV6A 5LGNA 4JVAA 5LBQA 1UCRA 2OYZA 1HKQA 4RGUA 4A12A 1DUXC 2XVCA 2PQQA 4KN7X 3H1WA 5FLJA 4ENKA 2L4AA 3PFIA 1ZHFA 5J8FA 2YX4A 2P5VA 4BNCA 1U5TA 5BOXA 1NYWA 3KP2A 4BHPA 2XRNA 3H3ZA 2IVMA 3I59A 2A5YB 4OINF 3EJKA 1UIKA 2D1HA 2GC3A 1IW7F 2A61A 2FNAA 5I0TA 1HKTA 1R1UA 4JTOA 1ULYA 1B9NA 1I1GA 1CF7B 4FX0A 4IPAA 1BM9A 3MQ0A 1J0RA 4HSJA 2EFWA 1K7AA 2XL7A 1J58A 3WW1A 3MDPA 5TRDA 1CAWB 1UW8A 3DFGA 1HW5A 2DK8A 1QGPA 5J3UA 3KEQA 4LLGF 4M9ZA 1X82A 4RS8A 3ABTA 5KVRA 1CAUA 3WW3A 5AONA 3WTUC 3ERED 1O5UA 4WXHA 3GLXA 5DV5A 3BCWA 2ZXJA 3CTAA 3HT1A 2BYVE 1UCXA 2A69F 4KT5C 2QVSB 4H0EA 1G3TA 3OV8A 5ICGA 5I8YA 1RC6A 2LF8A 1HQCA 4MGKE 1YTYA 2WWYA 3G7DA 2Z9OA 2PLYA 5D4RA 3SCFA 4ZU5A 2JSCA 4CGZA 2KIMA 4AD9A 2GU9A 4FAGA 1T2KA 2BBYA 1RIOH 4XFAA 3R61A 3TOBA 2H94A 2DU9A 1JE8A 4PGGA 2M30A 2XL9A 3R0JA 1MZBA 3FMQA 4ZYDA 5JI6A 3F6OA 5ILVA 4UV9A 3F8CA 3CDHA 2YR2A 4IXAA 3U2RA 3QU6A 5DCMB 4P9UA 4L9JA 3DF8A 1OKRA 2RVCA 5ICEA 3JSOA 4RGRA 5BS6A 1ZNPA 2ESHA 4G6QA 4FT8A 4PGHA 3K1NA 3DQVC 5LHHA 1XE8A 4KWKA 4OLLA 3UKNA 2OA4A 1AWCA 1HKSA 4QWQA 5ICCA 3LOIA 4HZFA 3QU3A 4N0BA 3VB2A 3PNAA 1O7FA 1TQPA 3KEOA 3HSRA 1XSVA 1SD6A 4QM8A 2PFBA 3P9CA 3ECOA 3WU1B 3UKTA 1YS7A 3MZYA 3HRUA 4LLOA 5FD6A
chains in the Genus database with same CATH superfamily
1XMXA 4PQ9A 3KGLA 1JU4A 1NXMA 1G2HA 3WX5A 2DA4A 1P4AA 2HOEA 2K9ZA 4N7IA 2XXZA 3WGIA 1MBEA 4YWAA 1GNZA 1DGRN 1LU1A 4HF1A 5CVIA 4XLCA 3QH6A 5G05L 1TEIA 4M3GA 4M72A 1QHHD 2BWCA 1PMJX 2R4GA 4N4NB 4WVMB 2HWC1 5ABJC 2A6TA 2LFBA 3M70A 2QCOA 2R7XA 4RAZA 1LVAA 3V56A 3ELNA 4R4XA 1JI6A 2V79A 2CWEA 1K3IA 3JBG2 2WKKA 1RESA 2M7BA 5J8CA 4XBQA 4XRSA 2COBA 3BN6A 1VNDA 2VL8A 4ITCA 3CP8A 1PGL1 3K70D 1BA5A 1W1WE 2DU1A 2YX7A 5CZKA 1JZ7A 2R5ZB 4LMYA 2EWNA 5FZ0A 1BJZA 4LG3A 4HOOA 4I01A 5LD2C 4TN7A 1PUFA 2LP0A 2PMZN 5M5WJ 4LB5A 2DPUA 3K4NA 1H8AC 4F7ZA 5HCFA 3I9V2 2E1CA 1RUD3 2DV9A 4AVVA 5FBZA 2Q30A 3LAGA 4NPMA 3ZYBA 2XWJB 5E3LA 4HRIA 4A93J 3ZXFA 3ELKA 1LEDA 2ZEXA 2BVLA 1U5TC 1DGRA 1JYIA 3HOUJ 4Q8LA 1D1AA 1EJ9A 3Q9OA 2BP6A 3ZRGA 1DP7P 3HUGB 1SVLA 1WUVA 4JGYC 3CEWA 4Q4X2 1QOTA 5A7PA 2EV5A 3L9JT 3O1TA 3ZFGB 4XJAA 3WG4A 4GH4A 1I6XA 5I0SA 2JDPA 4KMQA 2VUMJ 3H92A 4CICA 2Y31A 1OFNA 4IEVA 1UU4A 4XCBA 1BMV2 2JJ6A 5E1WA 3U0ZA 4MHRA 1NLSA 1K5MB 3T4VA 2LR8A 1YIOA 4YW6A 1DQ0A 1OCPA 2HS5A 2WADA 3KQRA 5FUNA 3X29B 3HNBM 1R71A 4GZ9A 1GSLA 4E7IA 5IP7J 2VZOA 1CZTA 3J7HA 4FTSA 1HRI3 1AHDP 3ZIWA 3FHAA 3POSA 2PJPA 4XIKA 1GNYA 4IETA 2RAEA 1PGW1 3LA3A 1TT5B 4BY7J 4DRRA 3S93A 1X1CA 1FI2A 1U5XA 1IV8A 3JZVA 2HU9A 1FYLA 3RGBA 2DN0A 2LW8A 4AHWA 1LVKA 1PP7U 3M3EA 2RKHA 1E3OC 4BJTA 3M8EA 3I71A 3ACGA 1O57A 4LLFA 4BDZA 2BERA 2FCVA 4AGVA 1H2LA 4KICA 3OYAA 4XF9A 2KQRA 3RS6A 1VBA2 2R7UA 4AI8A 2GN3A 1V54H 4LMFA 3IZOA 3HM5A 1J3QA 3AZWA 3F3XA 4Q0QA 2CU7A 2VNVA 4CCKA 2GBYA 2DCTA 1JUMA 1R00A 3B3QE 1Z0HA 2XUMA 4NBQA 3KP4A 4AQTA 5D4SA 1RUH3 3BR0A 3WF0A 3CBNA 2LC2A 5EP9A 5J1YA 1AR83 2WBMA 3GMEA 3ABLH 1XU1A 2W9XA 1E5SA 1Z05A 1O4YA 4KJZA 5IUQA 2WINB 4Y5Z0 1STMA 4ZTJA 2OPKA 2DYCA 3OYNA 2KKOA 1YE9A 3OGSA 4IQPA 3GTKJ 2HPMA 4ASMB 4IV1A 1GXPA 4DXSA 4UVCA 1SHWB 1U9NA 3VKMA 3ZR5A 1QBJA 1OCOH 3FXMA 4D7NA 4Y7NJ 4I3GA 1FOYA 1APLC 1NCRB 2FHRA 4QB6A 2OPTA 5FYYA 2OTLI 2YDEA 2LF7A 3UETA 1QF3A 4D0QA 2MPFA 2BBVA 3V64A 4AI0A 5FJKA 4C91A 1COV2 1POV3 1W36D 2V1XA 2QBYB 2DFFA 3RQIA 1A8MA 1WI9A 3WQ0A 3ZXKA 1SFKA 1YOVB 4RFRB 5GPAA 4DZGA 2DURA 5CKMA 2MLKA 4ZU4A 1WLWA 2CGOA 2X6OA 1AR72 2L7KA 2H0VA 4IUGA 2FBEA 1HOMA 3G71I 4NWWA 1YWKA 1Z6TA 3HMYA 4Y26A 2DQRA 3L2HA 5HOOA 3BR5A 2ARAA 2ZKLA 2Y6JA 3K4KA 2HEWF 4MOAA 1ZELA 4GCVA 5GAEJ 2IT0A 2B45X 3WLUA 2PMWB 4ASKA 3RDIA 1H8TC 2GH8A 3FDYA 3ZFFA 4XUQA 1DYKA 3S17J 1HW2A 2FX0A 2IA2A 5IVCA 4L9NA 1XNDA 1XNTA 3DYMA 3OG2A 2PHFA 3ZLIA 2K4JA 2QYOA 5BPDA 2AQFA 3TOAA 3WTXC 3K2AA 4COVA 1JYNA 2C6YA 2JB8A 4CDWA 2JA5J 5J3LA 3WDTA 3ZSKA 1A6IA 3N97A 2O8KA 4KYWA 3PJRA 2K7LA 5FZIA 3ZSEA 2Y34A 4R4ZA 1G3WA 5JOXA 5L3DA 2R7VA 4B29A 2XR4A 2QA4I 3COAC 4WV8A 2ZABA 4CDGA 2K9SA 3WQ7A 3W6KB 1KEXA 1UMHA 2KIUA 1WGXA 1CR7A 4XN0A 2HWC3 5HDKA 5CPRB 1IRZA 2AHQA 3VDDA 2Z2SB 3WTZA 4KUMA 3AKPA 5HI0A 2OQRA 4FCYA 4AF9A 5JCTA 4Q47A 4CCMA 1U12A 1G9AA 1UXXX 3EUHA 5BQTA 5HLHA 4DBQA 3M3YJ 1IGNA 4QHBA 1Y3TA 1RUG1 1SAXA 3FM5A 5AIQA 1YHQI 1CIYA 3ENRA 1F43A 3NMBA 2ZX4A 2GIZA 5H6RA 5FWEA 3HGYA 1XD7A 4X1EA 1TQIA 3RJ2X 5FKBA 3PVOA 2VASA 1W8NA 3I5UA 4Q0SA 2XMLA 3VD5A 4NMIA 4OQ9A 2W24A 3CF2A 3T5XA 1G8XA 1OHFA 3QBQA 3ZN6A 4J6GA 4RLQA 3HYIA 1EV11 4CUAA 1O3RA 2ZBKA 1IUYA 1W5SA 5DD8A 1EV7A 3LQQA 3GALA 1OKQA 2PN6A 1QJZA 1XSRA 5IP6A 2W87A 3C2HA 3I2JA 2VKVA 3ZN1A 5L7OB 1N1TA 2UWCA 5FFXA 5TGTA 4YZ3A 1VQ9I 2OZUA 3LL7A 3N9PA 2FCTA 3V7SA 2OJED 1MNEA 3LDKA 2ISZA 2STTA 1F5TA 4FPJA 4RQPB 4AEJA 3HT2A 1W04A 3H5AA 1ODMA 4B8EA 2B0LA 4KG8A 5K5OA 4AQ2A 5GZGA 2RR11 3HRSA 2Y6FA 2R30A 4LA2A 2EJRA 3VBOA 1ONAA 4KFCA 5A7WA 2CRGA 4QPWA 5F5AA 3CJTB 2WLQA 1ZZ8A 2A7AA 4E7JA 5F5CA 1VQNI 5FQ0B 3U11A 1FIPA 2W46A 5CU1A 5FLIA 1OISA 3WQ1A 4IERA 5A3NA 3DKWA 3VD9A 5M5YJ 4Q4Y1 3FXLA 3VDCA 1QNYA 4Z07A 5FYIA 3E3VA 1QNWA 3BZKA 5T55A 2A3SA 3I2OA 2ZSIB 3LSKA 1PIV2 3DN7A 3GNEA 3RFRA 4R9CA 1ETQA 3DPRC 4YM1A 1PZ9A 2CU5A 3CLPA 3K4JA 2DFBA 4TWTA 5DYMA 1AYM1 2RMU1 5CISA 1IQDC 4RB0A 5FZAA 2LY2A 3VBUC 3M1CA 2I74A 1ZAOA 4AYUA 3FWEA 1HDPA 2NPIA 1L3JA 5CBLA 4DZJA 5A1FA 2VOVA 4HW0A 5FKOA 4S0HB 1W6OB 5L9RA 5FRMA 1YIJI 5IJRA 1WJCA 1NK2P 2JRTA 2QNKA 1GWMA 3MPPG 5FLMJ 1USTA 1UWWA 2HYFA 3U78A 4BXSV 2P6SA 4XHXA 5IVBA 2VUCA 1UF2C 3VEPA 2FXAA 3S0MA 1UMQA 1ZX5A 4K9SA 1AXZA 4YRVA 1OQ1A 3NL1A 4C90A 1H89C 1LFUP 5KXCA 3I55I 1IXSB 4HK8A 1KDKA 4RR3B 1CAUB 2KXLA 3GZNB 3SISA 3BGAA 5IP9J 2IS4A 3GCWA 1VQ8I 2K40A 1TWFJ 3OYCA 2KMUA 4MTDA 3LSEA 2HTJA 1DGWA 5EJ1B 5HCBA 3RRDA 5CA6A 4ATEA 4KQ7A 4AIKA 4ITVA 1KDMA 4RS5B 2D3RA 1JYVA 4M3CE 2X05A 3MV01 3FUQA 1A34A 5JVGF 3LSMA 2VJXA 1I50J 5EEAA 1P4WA 2RS11 2HJIA 3TYJA 3W21A 4E4HA 3HQXA 4ORFA 2ENRA 1OYWA 2Y26A 4MFDA 3S1QJ 2ZHLA 4IHTA 4AGGA 3A01A 2VCAA 4M00A 4X6AJ 1V6NA 3O2PE 3HPHA 3N3HA 1LHVA 2AXLA 1TW3A 4Q4W2 4II2A 2O03A 3M8LA 1Q3EA 2LG4A 1ZKGA 2J5PA 1LOFC 3QRFF 5FY0A 5FAXA 5C8CC 4M6YA 5JWPA 3IUOA 1B59A 5FV3A 4XHBA 5T5PA 4I98B 1XSXA 1W6PA 1ITYA 4CDQB 1TNRA 2Y0OA 2ID4A 3AG3H 4IQ4A 1IO2A 1WFXA 3QPHA 3TO7A 5J36A 1MSFC 5FKCA 1D4M2 1HJGA 3L2YA 1FYMA 5F1JA 1AVBA 2HDCA 2VLAA 1UY0A 2WNUA 1KQ9A 3DYOA 3PL8A 4XJZA 4UUSA 1XE0A 1ULCA 3S2WA 5KCMA 5J7MA 3TEWA 5F2SA 3GJAA 3W59A 4CDUB 4B7EA 2UY8A 1MBFA 3NV2A 2HQ5A 5FZ1A 1DYOA 1JBCA 2PYTA 4AFMA 1R1A2 5L36A 2XAFA 5BNPA 1IPJA 4U7BA 2YFZA 3VBFC 1Y6IA 2JVHA 1OC1A 3S5AA 2WAQN 1VBB2 2WFF1 2ZAHA 4Z1VA 4CYCB 4EGYA 4OMCA 1PVC2 4YARA 4J1XA 4IE7A 2X1CA 4JZRA 1D0YA 2MEV1 3O1PA 4P9XA 1IQAA 2YS9A 1W2OA 2WQZC 1M4WA 3PURA 3QODA 4P9WA 2ZGNA 2Y9ZA 3IRQA 4YRDA 3BCBA 3K69A 1RUC2 2X1EA 1OA3A 1RXFA 2FCUA 3WEZA 1RUG3 5LATA 2XQRA 5FKKA 5JMCA 2Q8CA 4L9VA 4GRIA 4JKKA 3ILRA 3DBRB 3LB9A 2JG8B 1KU9A 3FLTA 3OB8A 2WZR1 2E1MB 2Z79A 5J4VA 2MW8A 2ZTNA 1L3LA 3NAPB 1L7QA 4LIVA 1PM4A 3M9AA 5C71A 2CWMA 2MH2A 1KU2A 4QPOA 4Y22A 4S04A 4NRMA 2DVGA 1EV13 3BG9A 2J1TA 3HOSA 1BIAA 2C4XA 1TME1 2D5FA 2F6BA 1BBT2 4AVCA 4RA2A 3LSGA 5EWSA 2P6CA 4DW6A 1ENQA 5DCMA 2B4KA 1F2NA 1F9NA 1QNTA 4M3CA 5FMCA 3LEGA 4DY5A 5CJ9A 4RHV3 4NIGA 2MABA 1ON2A 2JDKA 2V1DA 1BEV1 5DD4A 2PJRA 3DEWA 1BCXA 2UWBA 1FIAA 3B7MA 2C9AA 1IKQA 4FSJA 3WHUA 4IEWA 2BBAA 3H1YA 4IHXA 5GTHC 2DMNA 2XC7A 3RZDJ 2C1FA 4GQ7A 1QMJA 1QJU2 1K4SA 2VC9A 1ULDA 4JX5A 4P5OA 2RR13 2W1WA 2XOMA 3I7DA 3AG2H 4V1PA 3M4OJ 1BKZA 1IXRC 4QGMA 2YC2A 5JHUA 2ZOEB 3KZYA 4M3BA 2ZCWA 2XJSA 4LHKA 1R49A 4C3JJ 4L9TA 5A2QK 3H0GJ 4Q4Y3 1TWHJ 4IOAF 2WC2A 2WO2A 3CO2A 4WVMA 5FP7A 3M1HA 1FOKA 3W3CA 3F8NA 4OUMA 5EJCA 1Q8QA 3L2QA 5KBFA 1RHI1 2HOSA 5KAFC 4RGAA 1WLDA 3FF5A 2YBKA 2ZGUA 1AYM3 2RMU3 2R5ZA 2G0EA 2VULA 2J1RA 4DMIA 1S29A 1A78A 4UXAA 1AJKA 3HVDA 5KHIA 3LWCA 3I58A 3KVAA 3MFAA 1X19A 3RZKA 5JVTA 1IN8A 1WBFA 1DIWA 4JX6A 2DF7A 1H9WA 5KXBA 1PVEA 4YFWA 1QJX2 4A3IJ 3M3IA 2YU1A 5JZGB 5DMYA 5A3PA 4BQOA 2ZKZA 2X09A 4CCDA 4F8AA 3X2QH 4YVWB 3I3MA 2IRFG 2EZLA 5K7ZA 3JBG1 2ADDA 3WUCA 2L9VA 2PHUA 1GV9A 3U21A 2EFQA 1NQDA 3HUGA 3MLJA 2YC4A 2VH9A 3ETQA 2VBWA 3B73A 1W5CC 1GUIA 3JRGA 3ZFGA 3OGRA 2GXGA 1LOBA 2PMHA 1LHOA 1OCCH 2BRTA 1WQ2A 1ZLKA 4ZC3A 1JUHA 4DFSA 4YW5A 2VC0A 1WMEA 3F6VA 1SEUA 4S05A 4ESJA 3O1MA 1T33A 3CC4I 1K5MA 2OUMA 2K9LA 2PHTA 2RS13 2CO5A 4ASNA 1CZVA 1MMDA 1NG7A 4XSXF 3U10A 3C7EA 4EROA 1GV2A 1E5HA 3R4DB 1PYVA 1RUE2 4LHNA 1X8MA 3GHNA 2RDNA 3GTGJ 1N3OA 2ES3A 3TEDA 4NHXA 3ZFEC 1FJLA 2NS8A 2LY9A 1X8EA 3HKZN 1T95A 4Q4X1 5FK7A 5ANNA 2Y48A 2WBKA 2B7YA 2J1EA 2Q2EB 3IWZA 3JCIA 3DCFA 2HYXA 3F8FA 4GGGA 4Y1XA 1JOJA 1MEC2 4K7JA 2HLEA 5JVVA 2HFHA 5FRAA 4L9BA 1DU6A 5EZGA 4AEDC 1XNKA 5F6FA 1H6YA 1O3SA 4OIQF 3GTLJ 2ZJRF 2KR2A 5C9AB 4XXPA 4IE0A 3K10A 2A75A 1APNA 4TXWA 4IEYA 1LUJB 3JRIA 5CVJA 2Q1ZB 1Z78A 3HSFA 3I3QA 2VO5A 2TEPA 4MEXF 3Q5FA 2RN7A 4Z2YA 2W94A 3U1DA 2FU4A 5L3FA 2BGCA 4B4QA 1ULFA 3T09A 2XVKA 3LD8A 2ARXA 3OIOA 2CW0F 1VI0A 1XYNA 4LBNA 3QOEA 2BDRA 1POGA 4N8MA 4YFZA 4JRLA 1ND2C 1W2UA 5J37A 1ZBE1 3J4UH 1XPWA 1Z7LA 2GA2A 4ENJA 3UKVA 2Q8KA 3K2OA 1GVJA 4L2NA 1SBFA 3KP6A 1J75A 1O8SA 3T3YA 5LHGA 3I2KA 1JZ2A 2WFF3 3LQRA 1OCRH 4MGTA 3HRTA 3H1MA 4DEVA 3E0JB 4HT1T 4WVZA 2MEV3 4OMZA 3ZQGA 4D7TA 1RVF2 4CCCA 3A21A 2M4GA 1GWLA 2ZACA 3A22A 4KH9A 5IT9K 2DDUA 3EO6A 2AQEA 3HOVJ 4A3FJ 4E2SA 2CHHA 5GPCA 2QEXI 3AP9A 1HC8A 2W1SA 3BTYA 2JT1A 1L0OC 5FZCA 2VN2A 2QBYA 3CMAI 2WL1A 3MAJA 2WZR3 3MIGA 3TO9A 4P9JA 2VOWA 3W6VA 3ULQB 1REPC 1KD7A 2ADEA 3P9IA 3PDQA 4RAYA 1Q8PA 3D0JA 3HB9A 3PM1A 5JSPA 2ARCA 3TAYA 4COZA 1CQ9A 3K0LA 2AYHA 1TME3 4ET7A 2RJLA 1UKRA 3GUDA 1EPZA 4BXXJ 3CCVI 2NYXA 2NZ9A 3DUIA 3DXJF 3ZN0A 4DEQA 4A41A 1OR7A 1MBGA 2EICA 1QXRA 1Y0UA 5K7PA 3CCUI 1BEV3 1WBLA 2VL4A 1COV1 2VOXA 3CJQB 2QSHX 4X8PA 1S0BA 3BG3A 1QU0A 1E5IA 4W50A 5KK1A 4GJZA 2ZGQA 2BNNA 2HTSA 2X1DA 1AR71 2E5ZA 4A3JJ 3EUKL 3POYA 3O1UA 4QB2A 3K77A 4Q26A 1QZYA 5B1BH 4CDXC 5F0CA 2L7MP 4J25A 1MMSA 1J9IA 4A6OA 4IZZA 5IY5H 5JIAA 2Y2ZA 5LK5A 1W8ZA 2OPWA 2E7WA 2JDZA 4OUSA 1YLFA 3HXLA 1MQTB 5GLWA 4O61A 4NROA 1YFWA 1HF0A 1OFCX 3D3AA 2N7GA 3BU7A 2XJRA 3PQKA 1FP2A 2ICWG 1RHI3 4LO7A 2O5RA 3TNPB 1DGWX 1LE8B 4QD2A 2P3YA 2HZDA 2ISYA 2VE8A 2V26A 4CZSA 1UXZA 4XMIA 2CQ7A 2PA7A 3VDBA 4LG0B 1W9SA 2FZ1A 5D5UB 3LQCA 4UW4A 1G7YA 3PNYA 2A3YA 4EWDA 4AVPA 2IXJA 4I76A 2WSUA 5CFCC 2DFEA 2XB6C 5FFOC 4NOTA 4AHXA 5C6CA 3BTLA 3IMMA 3KV9A 1IAWA 4JV4A 2A71A 1X9PA 5FB2A 2QM3A 1G9FA 2IXCA 4XFCA 3ZOBA 4LD5A 2VXZA 3JBG3 1MGTA 2XASA 2VTXA 1B35C 5HV4A 1FOXA 5FP9A 2W3JA 3A0BC 1LNSA 2IGMA 4YW2A 1VE0A 3FN9A 1W3VA 5L7OA 4A6EA 3TEXA 3CUQC 1V6JA 3KZ4C 1DDLA 5A6YA 2Z1DA 2R7QA 4A2UA 4UBHA 2O9LA 2E19A 1ZA4A 2AREA 4PBPA 3T0DA 1JTYA 4MGQA 5J40A 1WCQA 3E6CC 1FMD2 4OZXA 2GQQA 4RQPA 1HSTA 3ZMDA 4U36A 4O65A 4IHYA 5KR7A 2EFNA 1C5IA 1K42A 5DUXA 4UY8I 5H9PA 1MVQA 3O1VA 3RWNA 3A0NA 4OMDA 4YVSB 3SXWA 2P3IA 1NZCA 3PNVA 4D6QA 5FZ8A 4KNYA 5E89A 3EETA 3I64A 1CN1A 2IW5A 3O14A 4DXZA 3DBHB 1X3ZB 1SFNA 1L7LA 1W6MB 4YW3A 3USSA 3HWJA 1QHGA 1RUNA 1NA1C 4OHXA 5HS7A 3VBUA 5FQ0A 4CU8A 1JH5A 3AJYA 1JOBA 1G4DA 1IRXA 4HL0A 4Q4X3 1FTTA 4E70A 1QOSA 4HANA 2XQXA 2G7UA 3N9QA 4QXCA 1JGSA 1U0JA 5EEGA 1PMIA 5BY5A 1FP1D 1CIWA 3TW6A 2Y0SN 4X8NA 5SV5A 1UCRA 3OOUA 4L8QA 2Y0IA 4KN7X 3N36A 3H1WA 2ORXA 5FMOS 1G8WA 2P5VA 1MMNA 5BOXA 4P9YA 3C7OA 4LNVA 3RMXA 3I59A 2A5YB 2H1LA 4W6XA 3S32A 2GC3A 1IW7F 5LZ6A 3ZR6A 3BODA 2TUNA 1I3QJ 2E34A 1W90A 4I99C 4CH7A 1B9NA 4FX0A 3DTKA 4IPAA 1MPXA 2R0FA 4HSJA 1K7AA 1J58A 2YC0A 2E2IJ 2WO3A 3ITQA 1DU3D 2DVDA 3VKNA 1BVP1 3MDPA 1SPPB 2WNVB 3Q8AA 1ZBE3 1UW8A 1HW5A 5HV0A 5J3UA 2GM4A 2VZ3A 4RR3A 1LHUA 3ABTA 1GZCA 1CAUA 4CEYB 3WNLA 1C57A 5FXWA 3W58A 3FKIJ 3B01A 4G6TB 3A0HC 4AEKA 1UOFA 1LOGA 4HPQA 1AUYA 1G3TA 2ZGKA 3VBRB 1RC6A 2LF8A 4N43B 2RDSA 4MGKE 1OD3A 1YTYA 4QX2A 1BOBA 3RKQA 3K70C 2JSCA 1GOFA 2GDFA 5DAQA 2GU9A 2O7OA 1T2KA 3I56I 1RIOH 4GB32 2H94A 2E53A 5AVAA 4CCEA 2M30A 3R0JA 3BI3A 4W8JA 5C3PA 4FI9A 2I5UA 1WH5A 2YBSA 2D98A 4CP1A 5C33A 1O4XA 4X0GA 2EIKH 4UB6C 3CHXA 4HSRA 1TMF2 1PGSA 5DAXA 2VW1A 4L9JA 3DF8A 1WCUA 4WVWA 3H5NA 3PO3J 4ZHNA 5JHFA 1ZNPA 2ESHA 3P1IA 4BQ3A 3DQVC 5LHHA 1XE8A 4OLLA 3AKQA 2G4IA 2OA4A 1AWCA 3OEBA 3K4CA 2G1MA 1SLLA 3VB2A 3PNAA 4CDQA 3HJEA 3MF9A 1TQPA 1COV3 1W9WA 2QUOA 2BY1A 1V55H 3NJXA 1MZ5A 4QQOA 4QM8A 3JRFA 2DOFA 2C6SA 3GZEA 1T0FA 1LCLA 1MH4A 5JR3A 1AR73 1X4OA 4OAZA 4XZUG 4A44A 1F9KA 2H0BA 4Q4W1 1S3JA 3KT7A 4YZ2A 3IKWA 4MNUA 1S4CA 3W5NA 4KBZA 4YFNF 2VOTA 4CDUA 1W8FA 3JQXA 3HPNA 4L99A 2HWB2 3KETA 3AYAA 2CTVA 1W2NA 3CZ6A 4UOJA 1ODDA 2J22A 2GNTA 1DBNA 3BR1A 1I6HJ 2VGDA 4D94A 3D5LA 4XJ9A 3N7KA 3ZXEA 1AL0G 1OJLA 5A7NA 3WW2A 3WE2A 4MXWB 3IMNA 1DCSA 3BR3A 2WAOA 3F72A 2R062 4W6YA 4OIRF 5A33B 3OUIA 4CZZA 4JX0A 3FUOA 1XB9A 3VZKA 2BY3A 1R7JA 5A3OA 1YJKA 3S6PA 1SLIA 4KIBA 2VTXJ 1J3PA 3VBHB 5C7GA 5DG1A 3QYBA 4Y52J 1P7IA 5L3BA 1OH4A 2AENA 2Y33A 1R1A1 1D0ZA 3M07A 3NAPA 2BY0A 2ZS6B 4NRPA 2FDJA 3AL0C 4BYYA 6PAXA 1I1EA 1VBB1 4JQFA 5FXXA 5AIPA 1YFYA 3CQZJ 5LWBA 4IE4A 2EXHA 4CP9B 2GOXB 3BT9A 2YGLA 2QFEA 1SFEA 1RUC1 4XUNA 4URTA 2K27A 2JK3A 1PX4A 3EHKA 3BIEA 2P0WA 1PP8F 1PM7A 4XRMA 5JOWA 2R92J 5KHJA 4BM8A 5C3SA 4QXHA 2DBBA 2EK5A 4XORA 3M1EA 3OD4A 3SCHA 4JYKA 4E7LA 1VF9A 2QJVA 4P08A 3S1RJ 3JREA 1NG0A 1KS5A 4UFJA 1QO0D 1UY3A 3E6BA 2BW3B 3DEMA 2FRHA 1KYZA 1C8M2 1QU3A 4FTEA 1VQ5I 1W36C 2ME0A 3TKYA 4IRIA 4AVAA 1JMUB 4UNOA 1G3YA 4PCQA 2L9NA 1QHDA 2ZX1A 2LROA 2JENA 2A3WA 3TBDA 2WFPA 4HA8A 3SH3A 3C1DA 5J09A 1WJFA 5JI7A 3C3VA 2IXHA 3NV4A 3PTRB 1R082 5BNNC 2RDRA 3B6AA 1W99A 2FBIA 1AKHB 4Y13A 4BL0B 4UHTA 3BZCA 4MSVA 1BIBA 4HLXA 2CSOA 3CCMI 3C3WA 5L9BA 5KXEA 1PK6C 3E97A 1KU7A 1R1ZA 3K4MA 5LHIA 4FOQA 3AJZA 5F0FA 3GZAA 4HN1A 2KJBA 4JC1A 3BJOA 3BZ6A 3ILFA 1YO5C 4Y3OA 2VMDA 4XAEA 2EIJH 4UUTA 2BFUS 2VMHA 2IS1A 3ASNH 1OYIA 4XF1A 2VT2A 2W84A 2EB7A 5DPNA 4LBLA 5D5XB 2JG9B 4M3CF 1VQKI 4YVWA 5F3IA 2QZ3A 5EJZB 1GDTA 1GZ9A 2CH0A 4QGLA 4WX9A 4DUVA 1F36A 5IW0A 1WLCA 2HQNA 2A5WA 2X48A 2VUJA 3KV5A 3AG4H 3PTYA 1ZYBA 1WWXA 3OSFA 4PLMA 2YPJA 1XGSA 4UT5A 3HNMA 1LULA 3OOPA 5IVFA 1ZGJA 3ZSLA 4CU9A 3JAMZ 2VZUA 2Q0OA 1Y8QB 5FDBA 2BTVC 4P9FA 4K20A 4NE9A 4EWAA 3SFZA 2DDBA 5LEJA 1RUF2 2E7QA 3QQAA 3ZN4A 3JRHA 4C3HJ 3GO5A 1AHSA 2P4WA 2VVDA 2KIQA 4KN4X 1YW7A 4Z92B 1HB1A 3PIOF 4U0YA 3C2UA 4NN0A 3UV9A 1VQ4I 2F4PA 2JMWA 3NV1A 3DBLB 1AJOA 4E7ZA 4A7ZA 3MYXA 3K7AJ 2V5YA 3JCUC 4FVVA 4Q2FA 2Q2EA 2RM22 1GP4A 1DU0A 5CADA 4QQHA 3WP3A 2DT5A 5BNOB 1LJ9A 2K2SA 1QY4A 1UU6A 2W39A 2YV8A 4MGZE 4GH4C 1S8NA 1GV5A 3ZQHA 1HQWA 5C9AA 3O6BB 3T8RA 1IOAA 2LUWA 1OD5A 2HGCA 3P6BA 1FATA 1RUE1 4M01A 3CJXA 1RJ8A 4NR1A 3OBZA 2JDUA 1Y9MA 2YXSA 2XDVA 3PIGA 3WHTA 2ATFA 3VBSB 4Q4W3 5BPXA 2J1SA 3F2ZA 2R042 1MS0A 2ZZQA 3A23A 3FMRA 3BOWA 3JD72 1GZWB 1FZPB 2VQGA 1VAMA 1MEC1 1W2TA 3WVJA 4Q29A 1O4ZA 1IG3A 2NVQJ 2A6VA 4UVAA 1RYYA 4DS0A 2XF5A 4XNFA 4WM8A 1CX4A 3TP3A 3NWKA 1FPN2 4F52A 1LFBA 2XHKA 2LREA 4GMP1 4R1HA 4NHLA 1P2FA 1NUKA 5E8AA 4D69A 2VBXA 2VB6A 1VRH1 4M3DA 3DEEA 5A32B 5F1RA 4EJVA 1TZOA 2VKDA 2HKOA 3KLOA 1V00A 2O8OA 1BHGA 1Y1WJ 2J1AA 1GHCA 2V09A 3L7WA 4FQGA 2VBPA 4RL7A 2LK2A 5FO8B 3WTTC 1AR92 5CG8A 1QXPA 1SZBA 2BXZA 3H0DA 3UKGA 5ICFA 2YUEA 3MEXA 4UW6A 1R1A3 1WJ5A 1W8TA 2G9GA 4C2TA 2VBZA 1AXYA 2FMYA 4RGXA 4GA9A 3HBLA 1VBB3 5BUVA 4LBKA 1Y8RB 3VHPA 2DW4A 5DXDA 2IGKA 3VWBA 2OQGA 2HDWA 2TCTA 4IV1C 1RVF1 5LFAA 3KGZA 2EIEA 2P5KA 3BR2A 1B6AA 2E2JJ 3W2WA 2RDQA 1D2QA 1RUC3 3N9LA 4K3UA 3ZSJA 2DTRA 1OOPB 4META 3ZYRA 4XJWA 2ID3A 5LASA 2ZMKA 5A3WA 5FO9B 2I10A 1ULPA 2XPWA 3H5RA 2ILMA 4AE2A 2W52A 4BB3A 2DA7A 2XV4S 2XAJA 1TW2A 2WQ8A 2NM1A 5F3EA 1CAVA 1X9TA 1FX7A 4MX3A 3NEUA 2LTPA 2YU2A 4Q4V1 4UFLA 4XUOA 2GZWA 4EMSA 1ZR2A 2DVFA 1MS4A 4A3XA 3CL1A 3NKTA 4CUGA 3ZYIB 3OGJA 4ZH4F 3KP7A 3MMYB 1AX2A 5LCWL 1W0PA 1TZLA 5FLVA 3THCA 2XB0X 3AMQA 4YGCA 4PI2A 1KGSA 1I3HA 2YZ4A 4LHLA 4XOPA 4U7DA 3CDZB 3DXUA 4FETA 2A6EF 5GTIC 5M5XJ 3LNQA 1RB8G 2K0GA 3VKOA 1MQTA 2DU0A 2GC1A 1ZZ7A 4ONUA 2E36A 1IDZA 5IK5A 1ERDA 1JJ6C 4J19A 1ZK8A 5CFCA 3A2KA 1NCQB 3JB8A 3ZFFC 1C3HA 4LA3A 2XPJA 1V5GA 3M2MA 4JAAA 1LE8A 4Q4ZF 1EH6A 4XVHA 2FJ1A 1PMHX 3HTSB 2VCCA 3A4UA 3RZOJ 5IATA 3S3OA 1PJRA 3OWTA 4CDWC 1VQLI 2VZPA 4LG0A 5A6ZA 3UGGA 4LLLA 1HX6A 4G12A 3AMPA 4PF5A 3T4HB 1TTYA 3IKTA 1JHNA 4KU8A 2W92A 3CUQA 1RR8C 1C28A 5DZEA 1H9TA 3EMRA 1TQMA 4P00B 3GZUC 4LHSA 4C0HA 4XPVA 2JIJA 1U2WA 1LOAA 1NT0A 4HONA 3MIDA 1WD4A 4AIJA 1Q8VA 2Q8DA 1WLTA 3H9AA 1S0CA 4EM2A 4KDPA 1Z6RA 2QUFA 2R0QC 3EBRA 3QPTA 1UYPA 3VDDC 2TBVA 3I3BA 4PDKA 2EA2A 2EZHA 2ZEYA 2QQMA 2DTWA 4AI3A 2RG4A 2ZEWA 1H2NA 5EHDA 4XUPA 1CONA 4HN0A 1OQDA 1YHFA 4Q0VA 2K46A 3IB3A 2ZGPA 3AX4A 5FZOB 2ZNZA 4QGNA 1H1AA 3ERMA 2JA7J 1J3RA 2AZ5A 4SBVA 5J48A 5KAIC 4D6SA 3ZYHA 1OKOA 3K6GA 3MLKA 2VNRA 3OYDA 3WCSA 3K4LA 4PDWC 5KWRA 3I2HA 4YVSA 4A3ZA 3BPZA 1TC3C 3IDEA 2DLLA 4MFEA 2D97A 2MNGA 2M45A 2E63A 3KPHA 4ENMA 1MJBA 2E35A 1W6MA 3L00A 2VONA 3T30A 2D6MA 3TOJA 1CQTA 4CYDA 3E7LA 1ULGA 3JTHA 3EQEA 1ZBA1 1VPHA 5ACA2 4YGDA 3LF7A 3WINE 3LE0A 2RS31 1EAH2 3NNGA 5FZHA 5CYYA 3SHRA 2G9FA 5HBAA 1J1TA 5HXVA 4PUSA 2VQAA 3PIJA 2YSRA 1FMD1 1BQPA 1E3PA 4QX3A 4ARXA 4AL9A 1UG0A 1UO9A 2PTMA 1M1EB 4MYEA 3HRMA 1AL22 2VQHA 1YX3A 1RUE3 3CCQI 4L92A 3Q9VA 4BQ5A 5JSOA 4LUKA 5E20A 4LTAA 3V8KA 4ZS2A 3D1NI 1S55A 3OD0A 3VBOC 3MCZA 1H88C 3WG3A 1EY2A 3S30A 2BVVA 4AG4A 4A3GJ 1UJ8A 3BCAA 2UZKA 5IK8A 1H0MA 4GFBA 2XWBB 5FPXA 1MEC3 1N75A 1SPPA 2WNVA 1MNDA 4P14A 3LSHA 3DKXA 1NQJA 2X6XA 2JJ7A 3EYPA 3CESA 1AF9A 3P7NA 1FBUA 5D1IA 2EILH 3MW4A 2HWE2 4P9GA 5EYRA 4JX4A 4NRQA 4GMP3 4PZJA 4NHMA 4XOTA 2XJVA 3GBGA 3JUUA 2E1OA 4BZ4A 4N43A 2JPCA 2PQ8A 4AI2A 2KPMA 2IFWA 1L7RA 5FPZA 3SC7X 2UXNA 3PSIA 1TE1B 3OCPA 3CJIB 4IEPA 3BR6A 4HXCA 1D5VA 1NX9A 1T39A 2HQAA 4GYGA 3KV6A 3GDBA 1SACA 2WRAA 2GOMA 1Y43B 3DXTA 2GWRA 5F32A 1K45A 5GZCA 5K0UB 3T0BA 1OQEA 4BJ6C 3J7MA 3AFHA 4OHYA 3ZXDA 3DTEA 4GJYA 3BDDA 1ACIA 4IXLA 2F4OB 1STZA 3J7ZI 1XXNA 4CSWA 1EF4A 2K9NA 4BQ1A 3NNJA 2ME6A 4KIGA 3WR0A 2CUZA 4HOBA 1RVF3 1S7OA 1QJY2 4L97A 3R6SA 3PUBA 4BE2A 4OWRB 2PHLA 2LBFB 2JD4A 4U87A 3Q8FA 3AM2A 3J7LA 5B2GB 2CV6A 3JRBA 3T0YA 4GB31 4PJYA 1V6OA 4V2WA 4C1XA 3IAM2 2B8MA 3GTMJ 2IS2A 2MSYA 3VLBB 4Q4V3 1SMTA 1IDYA 1HBXG 1Z3XA 2QKLB 1MW7A 4Y17A 1OPCA 1TNSA 3WZ1A 3RPUA 3VGIA 1N77A 5C4XJ 2EZIA 2AS5F 2BXYA 3ZQLA 1ZG1A 1DP0A 4DXRA 2IBDA 4TTGA 4NVPA 4WZCA 2HWF2 4HMZA 4M3EA 3TEYA 2WT1A 3KV4A 4NWVA 3WDXA 5DUWA 1UX7A 2EA4A 1UZZA 1BI0A 2VY0A 1UZ0A 2R7FA 3MICA 4PJMA 4K8FA 1KGYA 3UR3C 2P5LC 2MG4A 4O9GA 1YJWI 3FJSA 3VKLA 3PFYA 1XCBA 2J1UA 1HRV2 5D6EA 1PZ7A 4MLOA 3O1OA 2D45A 1Z7S1 4ESBA 4EZHA 4CPBA 4YELA 5A33A 4LT5A 4CZCA 4RBOA 1BK0A 4N9HA 4HLTA 1GBGA 2UWMA 3BTZA 1RMU2 3BALA 4BBRJ 4JDOA 5BXXA 4ARYA 3G73A 2D6OX 3VBHA 5FYCA 2WNUC 3QP5A 3B93A 1D5YA 2VTFA 3KIOA 3RYPA 1DHKB 3IBMA 2HWB1 3FLRA 2VAUA 3S3MA 2WV1A 4BIFA 3FL7A 3WTSC 2E33A 1SLCA 2Z69A 1YFXA 2R49A 2B46X 4NO4A 5DM7F 3QP6A 5FKMA 1XNAA 2EXJA 5L3EA 5BNPC 1JKRC 2PAKA 3MD2A 3H9GA 2R061 4CA0A 2JN6A 3VZLA 1KFXL 1FLIA 4JHTA 3ABMH 2XJQA 3KT4A 1V0AA 1CD3G 3U1XA 1S7EA 1XNBA 1IF1A 2XONA 1S2KA 4Y4YA 4ESFA 1ASJ2 4A5MA 1ETOA 1V6LA 1JS9A 2VMEA 2D5VA 3FBIB 1WJAA 5E18F 3OY9A 2P1BA 1RUJ2 3FXRA 5BNNA 4P9IA 4E8CA 2CW7A 4LUMA 2IGNA 1BR1A 3ZGKA 2WN2A 2CDOA 3GHMA 3ST7A 1SBDA 2ZJCA 3CMGA 3H3UA 4YG0A 4CEWB 1BI2A 2BW3A 3MW3A 3D4KA 1D7PM 1NXD1 2VCBA 1U3EM 3J7AO 2BUKA 5C3QA 2FDHA 4S2FA 1W0UA 3THDA 1FNYA 1H4GA 4ZDOA 1ZBA3 2NQYA 3OPWA 2VKEA 1DQUA 2DT6A 2WABA 4II3A 2RS33 4I7HA 4XFGA 2AEZA 2KISA 2PMUA 2A3XA 2A73B 1V6KA 3SKVA 3U75A 4WXDA 1RPWA 1FMD3 4B1MA 1AKHA 1UNBA 3WTVC 2R7RA 3A0KA 1GLNA 2CFXA 1RGSA 3G1MA 3SEPA 3W6JB 5A7SA 1Y7BA 3J7AY 1W9YA 2VZRA 3K51A 5E79C 3WU0A 2DA1A 2W48A 3RSJA 1AX1A 5JOYA 1PUEE 3IAQA 3NO8A 1C8M1 1RUOA 2IXLA 3M8FA 1S5LC 2DCYA 4P96A 4CHUA 2CUJA 4HNUA 1A5JA 1WSUA 1RKTA 4UV8A 4B4RA 2W1OA 5A7QA 2X6WA 2GA1A 4ZYGA 1Y9QA 3RZHA 2JG9A 4QPGB 2IXSA 2FOKA 4TLGA 4FFHA 3OL4A 2PEXA 1B72B 4BXFA 3D82A 2K3PA 2WWUA 4QX8A 4JKLA 1UHWA 3ZOIA 3VDXA 1GOGA 5IWFA 3O8HA 3VD7A 2CWSA 4N90A 2Y60A 3GBFA 2L3DA 5EV7A 1XMKA 5FYTA 1LGNA 1ZARA 1T6SA 1S1AA 1XE7A 3WODF 5J47A 2R1DA 1IS6A 1LENA 5FP4A 1MD0A 5J98B 2RJ2A 1TNFA 2EIDA 2RNGA 4OI0A 4HF0A 1G3SA 4ABZA 3ZMUA 5F04A 5HLTA 1FBSA 3E5XA 2FF4A 1PZ8A 3ZQFA 3CQOA 4OCTA 1N1SA 2CSGA 1XGNA 1QA6A 2VU9A 3HOTA 3GZTB 3BU0A 1FXZA 1VAKA 2D40A 2B42B 3S1NJ 1OT5A 1CJDA 1FWZA 1SFYA 3MUY1 2R1BA 3MFKA 5C4WB 4LFUA 2EV6A 2OAZA 3AXDA 3HN1A 4YG3A 2PMZA 1BYHA 2K9MA 3ZQCA 5ERLA 3LPFA 3IRRA 4DQ2A 3PUQA 2MH9A 4NPLA 3GFLA 5BNOA 4HSLA 3I54A 4KISA 4QWNA 1FX5A 5EIYB 1DLCA 3ETPA 3K4BA 4LPLA 4Q27A 3ZFGC 1I39A 3O1RA 2WYSA 2CQNA 2HWVA 5EGOB 4PJ0C 2BZTA 4DJAA 4X6QB 3I3DA 4DPNA 4GB33 4O5VA 4B44A 3RPUD 1K5MC 4ZZLA 3WXPA 4Y33A 3BIWE 4CCOA 2ZGLA 1UHMA 1D0GA 3DV8A 2DTYA 4IGPA 2JA2A 5KHGA 3HBZA 4LLNA 3VBSA 3GF2A 1FSEA 2FMLA 4YYOA 3VOEA 2V4AA 4AQSA 1A35A 3ZXJA 3VZJA 3GCXA 5JUVA 2DVBA 4OOIA 4JGZB 3KF5A 2RM21 5IVEA 1P4XA 4QKFA 1Y1VJ 2X6YA 3PO2J 1T8IA 5ILUA 1K83J 4BACA 4C30A 1VP6A 3BG6A 4CPBD 3JB4C 4K2EA 2VECA 3IDBB 4GKXA 4KWUA 2RGVA 5DDGA 1HCRA 4XDPA 2GMPA 1QQIA 4GD4A 1GKBA 2Z33A 1Z7S3 5TISC 5IFTA 1NOVA 3N9OA 3VHOA 4DINB 4N9IA 4R9DA 2X4HA 2NN8A 5A32A 4QDSA 2RC4A 1P92A 2DVAA 3B9IA 2WAAA 1YNAA 2VPVA 1WPKA 2KD7A 5HVQC 1XC6A 1K5JA 3JD71 1SLAA 1UX6A 4KA4A 2HWB3 3H8XA 3D5OA 4AFDA 1XG1A 3AKTA 4QHZA 2M0CA 2JWTA 1W9FA 2XBO2 2DCJA 3WHCA 2ETEA 4BDYA 2VZVA 1IV6A 2ZX2A 3BUCA 2X5IB 1YQCA 2DUPA 3AYDA 3DLLF 2JSPA 1E0EA 2R063 4EN9B 1YIPA 2D6KA 3D6EA 3KMHA 1OOPA 5EZWA 1TVGA 4OMYA 1Z3YA 1F15A 3S14J 2CFOA 2O0YA 2V9VA 4QX5A 4Z6YA 3TB0A 2RS52 2WNEA 3BWGA 2D93A 3RJRA 3RZZA 5FMBA 3B9CA 1DGRM 5L19A 1UOGA 2PLV2 4YG2F 4BE0A 4XKCA 5AC92 4PFOA 4XRSG 4UYBA 1RJ7A 3G1OA 1KA8A 2EIGA 4D6RA 4O7XA 2ZFUA 3SLIA 3NQHA 2VOKA 3DLAA 3DYPA 1YJNI 5BYNA 2MLGA 1GWKA 4XQWA 2M1BA 2D7FA 4YIFA 3ZPLA 1R4NB 2ECCA 3I2GA 1V4RA 5C5TA 2O8QA 2GC2A 2LMDA 3AP4A 5HLIA 2VT3A 4QSHA 5BV6A 5LGNA 1OUXA 5D8AB 2OYZA 2XVCA 1H4HA 1NCQA 2L4AA 5EJ3A 1OR7C 5F6KA 4IEJA 1U5IA 2K3FA 4KG0A 5J8FA 1TWGJ 4EEFG 4XQ4A 3TWIA 1GANA 4DYCA 3R0RA 2IVIB 3CU7A 1UIKA 5FZKA 2D1HA 2V7FA 3BTAA 4PK4A 3WU2C 4WM7B 1HKTA 3NNLA 4JTOA 2KRCA 1SVOA 3I4IA 1W8HA 2HPIA 3M4FA 1C8M3 2A70A 2XL7A 3WW1A 5J96B 3FMGA 2VR4A 2GP5A 1CAWB 1N25A 3N9NA 2DK8A 3ABZA 2ZA9A 3KEQA 4XABA 4RS8A 3IV5A 4FISA 5AONA 3WTUC 3J8F2 3O0WA 1D0XA 4LQRA 3HD8B 4DUWA 4L5EA 1WJEA 2R071 2NOGA 3RZGA 2BYVE 3OEAA 4PDWA 4KT5C 2VD7A 2W00A 4F55A 4IO9F 3HDDA 2WWYA 5FZBA 4GMP0 2Z9OA 2CV1A 3WV6A 3GTQJ 4ZU5A 4BY1J 2OV7A 3KLSA 4M4RA 1W05A 3FIWA 1NK3P 1HB3A 4LO6B 5A1AA 1Y4WA 4QU2A 3R61A 2LYCA 2DUQA 4KGGA 1US3A 2KDZA 5B4NA 1JE8A 2D6PA 1OLMA 1IKPA 3FMQA 2VXDA 1VBD1 3F6OA 1UAIA 4RHV1 3U2RA 3OPZA 4C2MJ 1T2XA 5L9VA 3AZXA 1U9OA 3GF6A 3H9JA 1TWAJ 5ICEA 3JSOA 2CQXA 4UAPA 2ELKA 1SDDB 4G6QA 4FT8A 2JQ7A 4PGHA 1PO22 4LK7A 1QH7A 3K1NA 5LA1A 4FO9A 3UKNA 1UZWA 3LOIA 2HI3A 2P2KA 1UQXA 2BPA2 3CCYA 3HOBA 4FQZA 2QQWA 3AP5A 1MMGA 4XN3A 4ISRA 4NNJA 3AZZA 3FKJA 3HSRA 2CYFA 3HBKA 5L7OC 3OYMA 3WF3A 5FZDA 4BBSJ 4PI0A 1OF3A 1SD6A 2ZBJA 1FMVA 3BYWA 4QB1A 1YS7A 3MZYA 3B69A 3FK6A 2KHMA 2IVJA 1JHHA 4XETA 5HS9A 3USUB 4B7KA 1RUG2 1RRJA 1JKPC 4ZDLA 4RQPC 3RMYA 3MI8A 1X4PA 4I0AA 1Q1HA 2DA6A 2OZJA 4GYIA 3CCSI 3BLYA 3NNMA 3VN4A 2O8XA 2WAFA 3OYIA 3K1MA 4W97A 1JUSA 3E5QA 4FAHA 2AO9A 1E3HA 2C0ZA 3PUSA 2OUHA 1K78B 2W1UA 1VQMI 5ACA1 1O5LA 4WWCA 5CAZA 1EAH1 2RM23 4XJUA 2DYSH 2GMEA 4YFXF 3GCMA 4KNCA 1IUFA 4UI9L 1O4TA 4I2OA 1ND3B 1V9U1 3RI8A 4IE6A 4BQXA 3VL8A 4ZU7A 3K46A 3WNNA 3ISPA 1LHNA 3NQOA 1J7KA 4RFT0 2KFDA 3BPVA 3DF0A 3S5QA 1ULEA 4NIHA 1LAJA 3H7YA 1HQNA 2JE7A 3KB5A 4FX4A 4P55A 2M34A 4W1UA 1FMWA 2WZEA 4A0ZA 4QPIB 3T2TA 1Z21A 2F2EA 4FQ4A 4RDUA 3GX4X 2F17A 3K2ZA 3KS7A 1ZLJA 1R9TJ 2NVTJ 1W6NB 3CJIA 2IS6A 3JTGA 1I27A 3MLLA 1U8RA 2R043 5K5RA 4OVEA 3FZ3A 3E5UA 3JD73 3V42A 1Q8SA 3GYDA 1WMXA 3T0AA 4LOSA 5K0UA 4Y5SA 1VZ0A 4G7HF 4E4ZA 3RQ0A 4ZYEA 3JRCA 2EAAA 1Q5OA 5FREA 3ONQA 4DZPA 3WOGA 3KT1A 1FPN3 3H7JA 4FPYA 1B4AA 1LODA 4RR3C 3NW4A 3KEYA 1O91A 3BPSA 2P81A 2EFOA 1QDCA 1VQ7I 3IT8A 1RNLA 3WUDA 2UV1A 4HVOA 2IA1A 3ECHA 1WA4A 5E3OA 2QKDA 3BP8A 2CQQA 2VMIA 3ESWB 1DLLA 4PHZA 3QYEA 1XMAA 4P02B 2ORZA 4Z82A 4D8MA 3H50A 4DOUA 3U9GA 2QF7A 3O1SA 5K7FA 2LBFA 4BJ0A 3I2FA 4LK1F 3UK9A 5ISLA 4D1QA 4RS5C 3WDVA 3U37A 4YIIA 5GM0A 1JT0A 3CC7I 4QXKA 5T3NA 3WD5A 1UG2A 5A7WB 3WE3A 5C70A 1LEAA 4L0YB 1JZ3A 4JQTA 4F92B 1H30A 4MV2A 4P5YA 4D7YA 3H35A 1W03A 5FO5A 3BTXA 3ECQA 1ZQ3P 3FC0A 2R32A 5LA0A 3RJPA 2VJIA 4COUA 4M9SA 4HDUA 1IPSA 4N53B 1SBEA 1O59A 5FOBB 5IT6A 2ZKNA 5JI9A 1WW4A 2OD5A 1ALYA 3CLQA 4MQVA 5GLTA 5FYZA 1QJY1 4BLJA 2LS6A 3OYWB 5CKNA 4LO4B 3DGTA 1S6LA 4CUBA 5LY1A 2QQOA 4A3KJ 4HFSA 2BVBA 2QQKA 4LBOA 3BTIA 2FBKA 2R7TA 1XGMA 3OUHA 4V2FA 2BW8A 3ZXAC 1NG6A 3UGHA 3D8CA 3B00A 4IEXA 4CDQC 4FPGA 5C3OA 3HOXJ 1PO11 4FHTA 4LBMA 5LY2A 1OUSA 1W6QB 2VIXA 2Y69H 3V8JA 1T0FC 3SHFA 4CU6A 5DABA 1D3YA 3BVCA 1FC3A 4R52A 1YYNA 4UFMA 2VNGA 2R7ZJ 4A4AA 5HLGA 2R0HA 2HWF1 5KHKA 3S8PA 3PMSA 4LEJA 1HB4A 4UB8C 1A6CA 2WTEA 3AKZA 2A6HF 1S2BA 1A3KA 4IV3B 3ES1A 4EN8B 3KZIC 1RZ4A 1WMFA 3T2PA 4CDUC 3AXEA 5KHDA 2HDDA 4ZDPA 4ETSA 2ESNA 5FZ4A 2JECA 3J7NA 4MIMA 3CC2I 2DA3A 1HRV1 1Z9CA 1ZVFA 2R073 1YX5A 4G7ZF 4F91B 3KYDB 1F8VA 1W9TA 3V8LA 1JKOC 3UGFA 2B39A 4H14A 2XGEA 4RGSA 5GAGJ 3RG0A 2JA8J 5AFEA 4HG6B 1ZZCA 2YPDA 4QDRA 1VBC2 3MWMA 1OLQA 1LHWA 4JP0A 1RMU1 2Y6GA 5E3NA 3OYEA 3HZJA 4M73A 3FXKA 4EVIA 3ZP5A 1LECA 2BVMA 4K21A 2P7VB 1R4MB 1T38A 4OI4A 1LDDA 3TQNA 5FCCA 2H1KA 2P17A 4KL1A 1VBD3 2JG8C 5FXZA 2WAQA 5FFZA 1YRNA 4XLAA 3J81Z 3JW4A 3S2DJ 3WG1A 2DA2A 4ZYHA 4CEWA 1KJRA 2E1MC 3U14A 1T6BX 3AK0A 1KJLA 1X7NA 3PL0A 3B02A 1K12A 2D43A 5FOJB 1ZGWA 1GQGA 4FPLA 3NAPC 1IRFA 4RB2C 1KYWA 3NWSA 1IN7A 1F4KA 4XJ8A 5LLQA 3LIHA 3LFKA 4YLZA 2BFUL 3IC7A 2WFF2 5H9RA 4M74A 1MS5A 2BV6A 1PHMA 2Q0AA 3ZQ7A 3O12A 2HQRA 4W6WA 3S1MJ 3A02A 4BH9A 3AVSA 1ORKA 2R5YB 1Y56A 1ASJ1 2VG9A 4FPEA 4YZ5A 1YI7A 4KWJA 3CP2A 3VZNA 5IK4A 4JOMA 4HNVA 1IHMA 1O8PA 1Q56A 2UY9A 5GZFA 3CDLA 3Q8BA 2YB7A 4KT6A 1Z77A 5DQ0A 2ZMEB 5F5QA 3APBA 3WHBA 3SZTA 1QVUA 3OL3A 2YHJA 2IAIA 3I3LA 4Q8KA 3PJYA 2L5QA 2MBFA 2VMFA 5JAXA 3KHCA 3IIAA 4HLYA 2ZJPF 1G59A 1TNTA 3DTIA 4XCAA 2D44A 1ENSA 1KZHA 3MHZA 2Z5UA 2Z4FA 1XX5A 1Q43A 5ACA3 2PBIA 2BNMA 1HDKA 1EAH3 1VR3A 4P9LA 3AYCA 2E26A 1GOHA 2QQJA 2VVFA 4P5HA 1TME2 1B72A 2ZAAA 1H8VA 1V9U3 2FZ2A 2PAEA 5CFDB 2W85A 5IYBJ 3OS2A 1C8NA 1JUIA 1ZRDA 4CCLA 2KA3A 4IRHA 1LDKB 2HBUA 5E1RA 3RSNA 2IFRA 3POFA 3V4GA 1BEV2 1QJEA 2L54A 1QDOA 1AL23 5LW9A 5FJHA 1FY7A 4AVZA 1FYKA 4BQAA 2V6EA 4XICA 3LSTA 1RL3A 1Y0NA 5K5QA 1RTVA 3KCXA 2H6BA 1DPRA 1S7AA 2E7XA 2KZGA 3PUIA 1IS3A 3ATGA 1SD7A 1QRYA 2A6ZA 4BUPA 3CD6I 2C24A 4O9EA 1MMAA 2GXAA 1YRZA 4A6SA 2DA5A 2DJNA 1JODA 3C8XA 4GAZA 4IJAA 3PVBB 5JZGC 3SZGA 1ZZBA 2J1VA 4FOVA 2E31A 2ZJ2A 2DMQA 3RYRA 5C4WA 4YVWC 3ZSMA 4CXWA 2QQLA 1USSA 3ES4A 3VKFC 5HODA 3TEZA 3UNGC 4TV7A 3IDAA 4FP3A 4AOCA 3WSOA 4QMAA 3I4NJ 4ZJZA 1D8JA 4ISQA 1FSHA 5LEKA 2WYFA 3DEUA 4ENNA 2EIBA 5ABJB 4S2GA 4XQDA 3HG9A 3ZMOA 4Z8BA 5JXGA 4Q0PA 5EGOA 1EUTA 4I02A 1E5RA 4CCNA 4ANJA 2ELHA 5HDNA 1WGPA 1YQ5A 2AR6A 1Y9GA 4EN6B 4AVBA 1XGOA 4U88A 3FZVA 4URAA 3HOZJ 4YZ4A 1GVDA 2VNOA 1BMV1 4BXUA 3C2GA 5J4YA 3L2VA 4OHZA 4NHJA 3T2QA 4CXFA 3PNTA 4ZTFA 3WF2A 2CAVA 3KF3A 3BROA 1JU3A 3W20A 3DKQA 5CKTA 2JXAA 1YI2I 4JGZA 4XL9A 3ZMVA 1US2A 3TP0A 1BR4A 1UMIA 1KRIA 4QLCU 1U8BA 3LKJA 2E71A 1N1YA 2WN3A 2FBHA 3VZMA 2PHDA 1QJY3 5FKLA 1JTXA 2WT0A 3M8JA 3HPGA 1U5TB 4XILA 3RKYA 1S0GA 1J84A 1MJAA 2BNOA 4K8RB 1X1PA 1N1VA 5C9AC 5D6FA 4JGYB 5KC5A 4YGBA 3DPTA 3HKZA 2CS3A 1PO13 3DPUA 5F3GA 1ETYA 2PHXA 4XDOA 3T1MA 3HQRA 1REDA 2HYGD 2L0KA 2RNJA 3POEA 2H8RA 5EQUA 3BY6A 2ZGRA 2A6XA 2X29A 3VYRB 1VBA1 3UESA 4J00A 2HWF3 1UPIA 2JIGA 2ZEZA 1REFA 1SQ4A 4JK1X 2FEZA 2NYYA 3FK7A 1G9CA 2BHYA 1NCRA 3CO6C 2XH6A 1GT0C 2CY6A 3CZUA 3WTYC 1H9PA 2DYRH 3OIQA 1R1TA 2NVUB 5EG0B 1QPMA 3GEZA 5D21A 4XFIA 3F9KA 4S2DA 1HRV3 2DCZA 2X5IA 4JCKA 2FA5A 2RREA 2VXRA 1R36A 4GKYA 4WM8C 1NE6A 5F37A 4GWJA 1BZWA 2Q8EA 1YQ8A 1GICA 4EQVA 3H8OA 3G4SI 3DECA 1J83A 2ZPXA 3AL5A 1G9DA 1BJQA 4QXBA 4AVTA 4EJWA 1Z1DA 2ARBA 4CU7A 2Y6HA 3H36A 1HLVA 1RMU3 1R58A 4XDQA 1NLQA 3KD4A 3AMHA 3S57A 3LA2A 1KITA 4ZY9A 1WJBA 1OQYA 1V5FA 5FP8A 2E51A 4JHZA 2HEVF 5T5JA 5FLXK 2JX9A 4KBBA 2LRPA 5DM6F 5FZ3A 2IUWA 2XBO1 4MG2A 4OUEA 3FISA 2DPDA 2ZXQA 4E6KG 2DMUA 2LKPA 1AZDA 1DG6A 1X33A 4ZONA 3FBNB 3G6JB 3WGGA 3CKHA 1NKGA 2QCSB 5J1RA 3L9FA 1ZBE2 5T52A 3O5SA 4UWDA 5LBEA 4INDA 2QQAA 3Q0VA 4QDQA 4Y15A 2ZMNA 3AG1H 1X50A 1Z91A 2XUBA 1WD3A 2DK5A 3C7HA 5D8AA 4W4ZA 2XPUA 2A5ZA 2K4BA 2E2HJ 3DU5A 4XLFA 1ASJ3 2RS51 1E17A 3A1YA 4GWNA 1MKMA 2E7AA 4B8XA 2WDBA 5DDJ2 2IGOA 3EYIA 4AAXA 1U5ZA 4EWEA 2W47A 1BK1A 2JTVA 5E88A 2CG4A 2PLV1 1RUJ3 3BPXA 1JN2P 5AC91 2GC0A 1URXA 3OTFA 2EFPA 4R9AA 4G4FA 4C0BA 4WM7A 2X85A 3B94A 5A3MA 3I8TA 1VMFA 4LKFA 3E6DA 4BQYA 4YW1A 5DUKA 2GNBA 5FYUA 2QZ8A 1CAWA 2GSYA 1X36A 3IAPA 1WH7A 4PBOA 4BLIA 1MACA 4KIFA 1OSGA 1WVRA 2K5CA 1JI8A 2YGMA 2ZJQF 3ROUA 1MQTC 2HVRA 2V6CA 3AAFA 3IPVB 4QQLA 4I0WB 3H3VK 3GXOA 1ZRRA 3NRUA 2ZFWA 1PDNC 1SFXA 2PHRA 2ECBA 4IE5A 4LE4A 5FYHA 2Z99A 1V6IA 5LGTA 2R7EB 2W82A 3ZPYA 1BBYA 2NMOA 5EFUA 4XW3A 2CV2A 2XG3A 2BU9A 5EYYA 1H8TB 1VRBA 5CNAA 3HOWJ 3ZQQA 5GLZA 3E1SA 3FMSA 1FPQA 3BJ6A 2VC1A 4PIYA 3SQOA 4MEYF 5LA2A 1XYPA 2ZGSA 1GQPA 3RPQA 2WA4A 1ZA7A 5A6XA 5F27A 3URFA 2NMNA 3DWLE 1FV2A 3LMMA 3J8F1 3Q3SA 3EPZA 4XUTA 5BNGA 4IF4A 4ASLA 4KI5M 2GNMA 2XHNA 5CYVA 5K8SA 5FZFA 3ALQA 3M3OA 5M3MJ 3WF4A 2JEMA 3HOYJ 3L2WA 2EBIA 3GZ6A 3V0AB 3LFIA 4FBFA 5HDGA 2JPBA 1U5YA 1UZCA