3FX3A

Structure of a putative camp-binding regulatory protein from silicibacter pomeroyi dss-3
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
223
structure length
218
Chain Sequence
HEAQKAIARNSLLIRSLPEQHVDALLSQAVWRSYDRGETLFLQEEKAQAIHVVIDGWVKLFRMTPTGSEAVVSVFTRGESFGEAVALRNTPYPVSAEAVTPCEVMHIPSPVFVSLMRRDPEICISILATTFGHLHSLVAQLEQLKAQTGAQRVAEFLLELCDCEVTLPYDKMLIAGRLGMKPESLSRAFSRLKAAGVTVKRNHAEIEDIALLRDYAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclic nucleotide-binding protein
publication title Structure of a putative cAMP-binding regulatory protein from Silicibacter pomeroyi DSS-3
rcsb
source organism Ruegeria pomeroyi
molecule tags Camp-binding protein
total genus 65
structure length 218
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fx3A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3fx3A01
3EUHA 3LQQA 3GW2A 4Q29A 4WF2A 2IVMA 3ZMTA 4OIOF 3NKTA 3E6BA 5JSPA 1XE7A 3E6CC 3OCPA 2EFQA 1G3WA 4ENNA 3F22A 3FMRA 2IXKA 4PJYA 4M6YA 4MV2A 2IPQX 4XF0A 2MNGA 4CDGA 4XEZA 4YSFA 5BMZA 4LG0A 4A12A 1Q3EA 3F3XA 2EFOA 1ZG5A 1J2XA 2FQ3A 1FI2A 2VC1A 3J80Z 2V09A 1Z1DA 1LNWA 2OYZA 5JSOA 4KWLA 3OD0A 3TGNA 3LWFA 1ZARA 2M1BA 4ZZDA 4OIPF 1J3QA 2KIFA 3BU7A 1H1IA 2Y0OA 3K0LA 5CYVA 2NRAC 1RIOH 1ZRDA 4R79A 3RI4A 3IWZA 3CUQB 1EV7A 3CJXA 4Q0VA 5F1RA 4HF1A 3D0JA 2D40A 2QDRA 4I7HA 1O5LA 1UCRA 1TQ5A 4KFCA 4LLGF 3OTFA 4KU8A 3WW2A 2YX4A 5LHIA 1VJ2A 3BWGA 2HQRA 1ZYRF 2HOEA 1XN7A 1YFYA 1FXZA 5JHUA 1D5VA 1ZAOA 1BI1A 2RKHA 2K02A 2Z3YA 4UXAA 1XGOA 5CVRA 2Q8KA 3D5LA 1ZG1A 4XF4A 3BPZA 4KN4X 3FZVA 5EEHA 5D8KB 2QQBA 4I09A 1R1TA 5DDGA 1CF7A 3JAMZ 3ROUA 5IT3A 5CVVA 1FWZA 3V4GA 2GC1A 3NL1A 1B9MA 2UXNA 3WTXC 1B4AA 2GH2A 3R4KA 3HSFA 3RTRA 3KP2A 2VBYA 5D4SA 5CLSA 2OA2A 2ETEA 2MA3A 5K5OA 4O6JA 3T1BA 4X6QB 3FMQA 1W7PD 2WWYA 4GYGA 2RQPA 1UIJA 3IBMA 1UIKA 4L2NA 4X6RB 2DK8A 3I53A 1RC6A 2MHFA 1UPIA 1KQ8A 3PFIA 3REOA 1QBJA 3ZP5A 5H6QA 4U0VA 5L3FA 2P17A 3TDUC 2Q2EA 2XRNA 3ZQ7A 5EFUA 1FC3A 5HLHA 4BNCA 4FAHA 3VB2A 4AVAA 4M73A 4YIIA 1QNTA 1S3JA 2MH2A 2V9VA 3ZMSA 5FLHA 4UNOA 3ZMUA 1DPRA 1Z6TA 4D0PA 3QAHA 5D5VB 3CO2A 3NEUA 5E18F 2FSWA 1CAXB 2CWEA 3KP5A 2VQAA 1PM7A 4A0XA 4EJUA 2QJVA 2D1VA 1SFUA 3KSCA 2GWRA 5D5UB 2HKOA 5KHKA 2IXJA 3M3IA 1FX7A 2DT5A 1KU9A 3Q5FA 1RI7A 1ON2A 5FGMA 1C0WA 3BZ6A 4Q47A 4FT8A 1MJAA 4HLYA 4CZZA 1AOYA 3UKNA 4MEYF 3T8TA 4WCGA 4XFBA 2HZTA 4IHSA 2AS5F 3QP6A 2G7UA 2QCSB 2O03A 4ZYHA 1MDMB 2BEOA 1D8KA 2Y48A 2DQLA 4MTEA 1OMIA 5BPDA 4M72A 4AVPA 1XSVA 2ZKZA 3IKVA 5KBFA 1ZH5A 2YSRA 3T8RA 3L2CA 2EFWA 4MGYE 3WTVC 2XLAA 5E17F 2STWA 1X8MA 3WW3A 1LVAA 1MKMA 1J0RA 4ESJA 4HVQA 1DGWA 3O3KA 1SFNA 4A5MA 4NVPA 3ECHA 3FE5A 2P5VA 3ZMDA 1I1GA 4ORFA 3SXWA 2FA5A 2JPBA 1IF1A 1BI0A 1FP2A 5BV6A 4E2GA 1U78A 2ESHA 3RKXA 4ZU4A 1KGSA 4E2SA 1RUOA 2PHDA 2QNKA 3TQNA 1IN4A 3I64A 2XGXA 1JGSA 5ILUA 4O9EA 2FXAA 3DPLC 1ZNPA 5FD6A 2VPVA 2D5HA 4BAYA 2K9ZA 3HT1A 2JPCA 5KHGA 2M5WA 1LQ1A 1L3LA 2OQGA 4NHJA 3SCHA 2KJCA 3MZHA 3DL3A 5I8YA 3G73A 2LSOA 4ESFA 4KICA 5D6FA 4JBAA 2IA2A 4LB6B 4EM0B 2DLLA 4A6DA 2NYXA 3V7CA 2ACJA 3JTHA 1YTYA 1X82A 4XFGA 4BXUA 4R8HA 1IN8A 3M8EA 1W5TA 2XKOA 1CAVA 3BPXA 5KHIA 5DCFA 3H7JA 2EV0A 4LEJA 3PQJA 1W7PA 3W6KB 2OZ6A 5FQ0A 1X3UA 1J75A 5ICGA 1ZREA 1LRHA 4ASNA 4IJAA 4LJZF 3GZ6A 3GF2A 2FNAA 3KLNA 1T39A 3HHGA 3ST7A 2BNOA 5E20A 5DEQA 6PAXA 4LA3A 4CYDA 3NSTA 1YS7A 5H6RA 3R0JA 1WKMA 2HFHA 1FBSA 2Q1ZB 3CL1A 2OQRA 3BOQA 4IEQA 4HF0A 4KYWA 3SFZA 1S7OA 3ULQB 5ED4A 3BCWA 2GU9A 5C8WA 2QVOA 3HIFA 1T38A 1FOKA 4EWEA 1W4MA 3DF8A 1YFHA 2YX7A 3ZMZA 5TRDA 3TOAA 1CAWA 2DPUA 4UBGA 2YPRA 5LRSA 3SCFA 2A61A 1OYIA 4TLFA 3PLQA 1L0OC 1D3YA 2A5YB 3TOBA 2XUBA 4IRGA 4YFXF 2GIVA 4MUVA 4XLNF 2O8XA 3E5QA 1FP1D 2YR2A 2ZO4A 1G3YA 1R5HA 3Q9SA 3KE2A 3FX3A 1FT9A 2CQKA 4KL1A 1U3EM 3H8UA 2X4HA 3WODF 1BIAA 4EWDA 2JTVA 1GXQA 2IC1A 4S05A 1BJAA 3GZ5A 1EP0A 2ZXJA 3I7DA 5E16A 1HQCA 2IJLA 2QQ9A 2PYTA 4B29A 3JSPA 4UHTA 3MPBA 4K8FA 5IT9K 3RPUA 1SFXA 4EVIA 3EQLF 3W6JB 2EVXA 4GGGA 2F5FA 2PMHA 1OYWA 1LB2A 2GA2A 2K7LA 3DPTA 3F21A 3RYKA 2KJBA 3BB6A 3P9KA 4IF4A 5I0RA 5HS7A 2XKPA 1FBUA 3KP6A 2IXHA 1JHFA 1DZRA 3UKTA 3LFKA 3V8JA 2GAUA 1HW1A 2PG4A 4IESA 2CFXA 2ZNZA 4IHTA 1P6RA 5HOOA 2PAKA 3MAJA 3ERED 5KK1A 3IRQA 2VE8A 3GUDA 4HX8A 1REPC 1HBXG 5D8LB 1XB4A 4CXFA 3EYYA 1GXPA 2OPKA 4WK8F 3F8MA 1AWCA 3IIAA 2W85A 3TO6A 3IKTA 1DDNA 2E7WA 4UV8A 3HSRA 1BI3A 1K7AA 3NRVA 3T5XA 4R1HA 4G94A 4AIHA 5LBQA 4L18B 4I01A 3E97A 4IXAA 1LEBA 5AIPA 1X7NA 4A5NA 3FM3A 3EQEA 2O0YA 2MPFA 3SQNA 4ZYGA 1ODDA 5FFZA 1ZLKA 2A6EF 1K78B 3CUQC 3HRTA 2AXLA 2PMUA 3I59B 2BNMA 2QLZA 4UVCA 4KWJA 3S7EA 1OKRA 1H9GA 1P2FA 4FX0A 1YFUA 2F5CA 4XF3A 1O5UA 1ZGAA 1Q43A 3I0TA 4GCVA 4CICA 4XF9A 1XRUA 4KIFA 4O9GA 5ILVA 2P6SA 3DKWA 2CO5A 2HS5A 3IRRA 2PN6A 4ZU5A 2L54A 4S04A 4XBFA 4LB5A 4WVZA 4XFHA 1P4XA 3J81K 3LOIA 5LEJA 3OF1A 2W24A 5L3DA 3HT2A 2ZMEB 3FWEA 4IERA 2HQNA 1ZZ6A 2E9QA 2R3SA 3GXOA 1NE4A 3OGJA 2QUFA 3KP4A 3WE3A 1XDSA 3NQOA 4P5OA 4HV6A 1U2WA 3U10A 3F8FA 3LA2A 2OBPA 2A69F 3CF6E 4MTDA 3E5UA 2FEZA 4KIGA 2F5DA 1QO0D 4HDUA 5FLIA 2VXZA 1BC7C 2MLGA 4EJOA 2LNBA 2NNNA 3FHIB 2VONA 1J9IA 3C1DA 5BY5A 2XIGA 2PQQA 2MC3A 4HLTA 5FB2A 4Z07A 2DAOA 1WSUA 3WU1B 5JI6A 1LKNA 4O3MA 3U2RA 5I8SA 1FPQA 2FBKA 5DCMB 4G6DA 3QRFF 4I2OA 4A0YA 2XAJA 1K6OA 4M9SA 2JZYA 4M9ZA 3EO6A 1ZN2A 4YYOA 1SEFA 2QYOA 1XSDA 4BHBA 1O3RA 1R00A 3SZTA 2PLYA 3ZN1A 1FYKA 3F72A 5CJ9A 2K27A 2K0GA 4CO8A 1ZRCA 1YLFA 1J3RA 2EA4A 2ADUA 2XL9A 2PAMA 5ERIA 4L11A 2PFWA 4AXOA 3F8CA 3BJAA 5HS9A 5CVIA 2M45A 2OAZA 2FE3A 2NAZA 2MD5A 1IXCA 2C0ZA 3WTYC 4RGUA 4JVAA 2RDPA 1X8EA 2PI0A 1WA4A 3FXUA 5DV5A 1JXSA 1KYZA 3MQ0A 1QXRA 1KQ0A 2WV0A 4CGZA 2WC2A 4XSXF 3MYXA 3NVCA 4IVNA 1YG2A 3DV8A 3LA7A 5HVQC 5BS6A 1OI6A 2DQRA 3QU3A 1PP7U 4I0BA 4B09A 2QBYB 2GXGA 2VE9A 1J59A 1BIBA 2GC0A 2XAFA 3GFJA 4E2QA 4LUMA 2D5FA 5FLXZ 3CEWA 4A2UA 3ELNA 2M30A 1NE6A 1DZTA 3SXYA 2IT0A 3B02A 2K4BA 4ZYDA 3GBFA 4J1XA 4PCQA 1U5TC 3TNPB 3EYIA 1RL3A 3C3VA 4IEUA 5J48A 2R7DA 5D5XB 4O5VA 3QU6A 5FFXA 2WFPA 2GC2A 1XGSA 5L3BA 4F7ZA 1YW7A 1NHAA 4A0ZA 2FQPA 2IXLA 3R0AA 4MX3A 1P4WA 1SQ4A 4RAYA 4D7TA 3JZVA 1BC8C 4Q0QA 2Q0OA 1YW8A 2LKPA 3IDBB 2VODA 1HKSA 4EGZA 3LWCA 3PQKA 1LDKB 5I93A 1B6AA 2NS0A 2CAVA 3KGZA 4XLPF 3OV8A 4A6EA 2QM3A 2H27A 5J8FA 4QLCU 2STTA 3IC7A 2F4PA 2FBIA 4EJTA 2P7CB 4L9TA 3KLOA 1V3FA 4Q5SF 4Z82A 3U11A 1TQPA 3C7JA 3MDPA 1WQ2A 3HTUA 1Y3TA 2XV4S 1TQIA 2ZNYA 3CO6C 1QQIA 4LLOA 4Q0UA 5E1ZB 2RNJA 1G3TA 4OMZA 5LGUA 3BJ6A 1T6SA 2O1QA 1GQHA 3VODA 1U12A 2JSCA 1GHCA 4HX4A 1KU7A 4KA4A 2BNNA 1KA8A 2PQ8A 2EFNA 2K86A 2IXCA 4QM9A 2K4JA 1U5TB 5F64A 4HQEA 5AVPA 1PDNC 4L9JA 2FU4A 2EV5A 5AONA 1CF7B 3WG9A 4HZFA 4BHCA 4EV0A 2FBHA 4G6QA 4MEXF 1G4DA 3ES4A 2KXLA 1YS6A 1WGPA 4OU0A 3J7AO 1LJ9A 2J5PA 1R7JA 5BQTA 3UKVA 2RN7A 4KWKA 3S0MA 4OOIA 5LEKA 2OZJA 4YRDA 5IT9Z 1LEAA 1WLTA 4AVCA 2XAGA 2HTJA 2H09A 5FLXK 1BOAA 4GULA 2GQQA 2KIUA 4UBHA 2KIMA 4Q0PA 4WXDA 4YNIA 1I27A 2FNPA 5HDKA 1QWRA 3HUGA 1S6LA 4IETA 1GVJA 4Q48A 2HR3A 4ONUA 2VT2A 1E2XA 4M74A 2EB7A 3JTGA 4MGIE 4U0WA 3WTWC 5J3UA 2KKOA 4ZU7A 4UUVA 1UFMA 4RAZA 1L3JA 3V8KA 4XFAA 1XD7A 3RYRA 2XASA 4I02A 2IA0A 1EH8A 3H50A 4BH9A 3FXRA 3FM5A 2QZ8A 2VOPA 2N7GA 2BYVE 4XFCA 2RC4A 2B5HA 3R6SA 1ZZCA 1JE8A 3S7IA 2ZJ2A 2H6BA 1QPMA 4LK1F 1H1MA 1ZLJA 4ZH4F 2EJRA 5CVUA 1O57A 1FY7A 4LA2A 1J7KA 3T0YA 2H0VA 2XL7A 1STZA 1QZYA 4HYEA 1SMYF 2GC3A 4XFFA 4Y17A 2P5LC 4LLNA 1J58A 5A2QK 1TLHB 2EFPA 4ENKA 5JCTA 3ZN0A 3ACLA 3O6BB 3H9AA 2QVSB 1OFNA 4KIBA 4LULA 2P5KA 5D4RA 4XFIA 3VOEA 1SFEA 1YYVA 1RNLA 3QP5A 1KYWA 4YFNF 5BXXA 2TDXA 1R23A 2BGCA 1Z9CA 4MHGA 2PHLA 4G9YA 2V1XA 2FF4A 3GFMA 2HKXA 2Z33A 1TQMA 4E70A 3DN7A 1WWXA 4MGKE 2XHKA 3K1MA 4UXNA 2DBBA 3LAPA 4GYIA 1R1VA 2XLFA 5I91A 1ZGJA 1BI2A 2CV6A 2QQAA 4JTNA 3J81Z 4WX9A 1IPKA 4ENMA 1XMAA 3MZYA 3FJSA 1H0MA 2KRFA 3ETQA 1XDUA 3L00A 1RZ4A 2HYGD 4HBLA 1OR7A 1S7AA 4LMYA 1JUHA 1RTVA 1S29A 3H1YA 1MZBA 3K69A 4HMZA 3WTUC 2H94A 3EETA 4UV9A 4WXCA 5DD4A 3RIRA 5LGNA 1F4KA 2D93A 3F8NA 3V7RA 2HJIA 4ZYEA 3VHRA 5CU1A 4L5IA 5D5WB 4QGMA 1IN5A 4DINB 1P4AA 4PIZA 3CUQA 2ETHA 4R52A 1FYMA 2DFIA 3BP8A 4QX5A 2R7FA 5BPIA 4QWQA 3DEUA 3I54A 2E1CA 3BROA 4L9NA 2W84A 1EH6A 4QM8A 1IPJA 3KZZA 3KMHA 5JAXA 2LF8A 3HSEA 2DI3A 2ELHA 2G7HA 5ILSA 5JR3A 1CAVB 3SHRA 2XVCA 3DFGA 2ZBKA 2CGPA 5I0SA 1U8RA 1W7PB 4HN1A 2EAAA 2QENA 3IL2A 5FQ0B 1O4TA 5KVRA 4MH0E 3DXJF 1UHWA 4LTAA 1Z7UA 2UY9A 2UY8A 3N4MA 3H92A 2COMA 4MQVA 4HSLA 3COAC 1ZZ7A 1I1SA 1ZRFA 1IRFA 1UCXA 1LDJA 3M7GA 4XSZF 1ZX5A 3CDHA 1SD7A 2J5OA 3RKYA 4KMFA 4G7OF 4MNUA 5LRRA 5E1XA 3TO9A 3JW4A 4XF1A 4EQQA 3LQRA 5K1YA 2FMYA 4MGZE 1Z6RA 3NJZA 4B8XA 2VOOA 3GEZA 1EH7A 3FZ3A 2M87A 3GFIA 1MGTA 2BV6A 1FLIA 2Z69A 1HKQA 2XAQA 4JTOA 4EM2A 4PGGA 2UXXA 4L0ZB 1G3SA 2O8QA 1IXSB 3DQVC 5BOXA 2EA7A 2Z2SB 3G3ZA 4AWXB 2EV6A 4RGXA 2X0LA 2V6CA 3H3UA 4KNYA 1BN5A 4YFKF 3LAJA 2CYYA 4IRHA 3RYPA 4ETSA 3RZZA 2O3FA 4XETA 2VBZA 1FNNA 4BHPA 3V7SA 5E8GA 2Z5UA 3CO7C 2Q30A 3TKYA 1UD1A 3FHZA 1CAXA 3LZZA 4OIRF 3H1MA 2VC0A 2HTSA 3L7WA 1Z05A 3U0ZA 4AD9A 3HRMA 1I5ZA 1IAWA 1XSXA 1PP8F 1O3TA 1V4RA 5DUKA 2DU9A 1R22A 1HSTA 2A3SA 1MJBA 3O14A 4LK0F 3ML6A 4I3PA 3ECOA 1HKTA 4U88A 5K5QA 1HW2A 4H7LA 1V70A 5CADA 3O2PE 4IEYA 3JSOA 2IP2A 5KHHA 3FMSA 1USSA 2CG4A 1MDMA 3R60A 1SMTA 4HV5A 2PBIA 4ENJA 2CSOA 1FSHA 3GYDA 4META 5JFRA 4Q4ZF 2V79A 3WE2A 2ZCWA 2VBXA 2ZKLA 5FLJA 1DPUA 5J7MA 2EA2A 4HVRA 2DW4A 3K9TA 1YFWA 2Y0MA 1ZRRA 1F1ZA 3CJNA 4HSJA 4GO1A 1VP6A 4QGNA 2V1UA 5K8SA 1KQ9A 1LDDA 1ONVA 5E8IA 3WGIA 4IRIA 3GFLA 1QY4A 4BYYA 1QGPA 1SD6A 3I5UA 2A07F 1XCBA 1F5TA 5LHHA 3G7DA 2RVCA 3EBRA 4LUKA 4QXKA 1ZVFA 3S2WA 2OU2A 2CW0F 1R1UA 4NB5A 1U5TA 2IRFG 4HW0A 2E7XA 3USSA 3U1DA 5LHGA 4RS8A 2IW5A 2PJPA 2PAEA 5JSRA 1CAUB 3WTSC 4WXHA 2DTRA 2GXBA 1SAXA 4Y15A 3E6DA 2DK5A 3GX4X 4NQWA 3L9FA 2HYFA 1OYYA 2GZWA 5D6EA 4PDKA 3RNSA 1KU3A 1YLLA 3EHKA 5FPZA 2QWWA 3BDDA 1F9NA 5BPXA 1NYWA 4M71A 3ISPA 4LGWA 4TV7A 3WGGA 2L01A 1BBYA 1W5SA 2MBFA 4I98B 2W57A 4IEZA 3BALA 4FX4A 1FSEA 3CLOA 1HW5A 1IUYA 1O7LA 1ON1A 5DUIA 4IEPA 4KMUX 5LGTA 2HDCA 1K79A 3RPQA 4IPAA 3GVAA 3OOPA 5KHJA 2ET1A 1TW2A 3VFZA 3EDPA 4LG0B 2I45A 5FO5A 1ZZ8A 4OLLA 3J80K 1EYBA 3ZDSA 4UVBA 1XGMA 4LD5A 1LR5A 2DCTA 2OD5A 1GQGA 2CAUA 2RV8A 2LF7A 5F6FA 1IRGA 4RB1A 4HX7A 2B0LA 3C18A 4HQMA 1Y0UA 5C6CA 2E1NA 1E17A 1QZZA 3KEOA 1A04A 4YARA 4QGLA 3ABUA 5E1RA 2BBYA 1Q1HA 2Z9OA 3M70A 3P9CA 3BJOA 1EPZA 1UB9A 3KEQA 4G7ZF 3H1WA 2M8EA 1ULYA 5A2QZ 3QOPA 4HAMA 4PIYA 4PZJA 1VR3A 3ELKA 3L09A 5EZWA 2JT1A 3FF5A 3KP3A 4Y13A 2PFBA 3F23A 1G6NA 1YQAA 4WWCA 1NXMA 4WZCA 2L4MA 2UZKA 5HI0A 3D82A 4IEWA 1O3SA 3IDCB 4GXOA 3KP7A 1T2KA 1USTA 2PTMA 3JAMK 4RGRA 4HVOA 4RD7A 2P7VB 3WTTC 3FXQA 1IN7A 4OFGA 1S8NA 4HOBA 1IZ1A 2RGVA 3N97A 5D1IA 1ZZBA 2XROA 1OD5A 3LA3A 4IEXA 2V1DA 3FFQA 1CX4A 3SZPA 3WW1A 2ZFWA 2B9UA 5DD8A 1H9TA 3TO7A 3M1EA 3K2ZA 1IN6A 5H20A 1RGSA 4RB0A 1UHMA 3AAFA 2D45A 1DGRA 1ZZ9A 4DQ2A 4U7DA 1TBXA 2UYBA 3C3WA 1R36A 2P8TA 3U9GA 1T98A 5I8TA 3IWFA 4RB3C 4EGYA 1VTNC 2IA1A 4LFUA 4P9GA 4KDPA 4Z2YA 2DO7A 1HSJA 3KCCA 5I0UA 5FD5A 1FYLA 3E3VA 2JRTA 4EM1A 3VEPA 2F2EA 4YG2F 3HYIA 2HGCA 4M6XA 1FBQA 3V8LA 5T3NA 3KGLA 2FRHA 4UVAA 1J5YA 3HRUA 4HLXA 2NNYA 1YW9A 5EEGA 4OIQF 3HQXA 4FAGA 2A68F 2O61A 2ISYA 4HN0A 3HOSA 4Q0SA 4WBBA 3MFKA 1SD4A 3GO5A 4JV4A 2IXIA 2ATFA 4LLLA 1MJ9A 4G8XA 4JK1X 5CVJA 2Q4SA 3LAGA 4HF2A 3I71A 1OPCA 1K78A 3E6MA 3GYHX 3PNAA 3KZYA 4L9VA 5HLGA 3SCGA 1DP7P 3I59A 4M9XA 3E5XA 3I4PA 4ESBA 3HTSB 3D0SA 4N0BA 2W25A 2MH9A 4L0YB 1PUEE 4MGRA 2P6TA 2C6YA 1DUXC 4RB2C 4KT5C 4F8AA 3GWZA 4HA8A 2L3DA 2Q0AA 3PVBB 1CGPA 3MWMA 1O7FA 2EWNA 3WU0A 2ESNA 4ON0A 1WRJA 4FHTA 3ZMVA 2ET7A 1HXDA 1ZHFA 2PEXA 2B8MA 5ICEA 4OMYA 1YWKA 2F5EA 4AIJA 2GA1A 3RJPA 5HLIA 2ZMEA 4KU7A 4N9HA 1O3QA 3GLXA 1ZG3A 3RDIA 4MZUA 1Q5OA 3ES1A 4P96A 3TDZC 5E1WA 4J1WA 3BY6A 3CUOA 1XMKA 4AQ2A 1Z91A 3HRSA 4BQAA 5HDGA 1U6GA 1B1BA 3CLPA 1I6XA 3EJKA 2D2WA 5BUVA 4K2EA 5L3CA 4DNCA 1FZPB 4N9IA 2XAHA 3F6OA 5LLQA 2FMLA 3I58A 5ICCA 5TJJA 3WGHA 4QMAA 5FCCA 1TW3A 2VECA 4L5JA 2MLKA 5HS8A 1TNSA 2VT3A 1TNTA 3SHFA 2UWMA 3QACA 1IW7F 1EY2A 2L4AA 5I0TA 3KETA 3R61A 1YHFA 4RGSA 4EROA 2G9WA 1T0FA 1NZCA 2HWVA 3B73A 4XRFA 4KN7X 3WW4A 2LDUA 4YIFA 2OA4A 5DCMA 4U0YA 5ICFA 1XE8A 1R5GA 2BE5F 4IEVA 3NW4A 5JVTA 3P7NA 1YUDA 4MQ9F 4ZZLA 1YFXA 1R58A 2EK5A 2D1HA 5JR7B 1SD5A 1QXJA 4P9UA 5FPXA 1Y9QA 3ABTA 2WTEA 5HDNA 1B9NA 3SMHA 3F8BA 4OINF 2L02A 3L2HA 5L3GA 3Q9VA 3WTZA 3HOTA 2UYAA 4IEOA 1KU2A 1TTYA 2VN2A 2Z99A 5J6XA 1WI9A 4CHUA 1UW8A 2P4WA 3LSTA 3H7YA 5DYMA 1J1LA 4EMSA 1YO5C 3RKWA 3QPHA 5L3EA 2Y75A 4HDVA 2OZUA 2DPDA 3H3ZA 4AVBA 4FBFA 3MCZA 2A6HF 3TNQA 4EJVA 4H0EA 2HEOA 1D8JA 2O6GE 1XGNA 2H6CA 1YIOA 4P55A 1RUNA 1J3PA 4D7SA 2FOKA 5AIQA 3BPVA 3CTAA 4AQ6A 4EWAA 1CAWB 1IXRC 4JQFA 4KUMA 3K1PA 3KFWX 1CAUA 2PA7A 1B59A 3M8FA 4PIXA 2QBYA 3HHHA 5J8CA 4AIKA 1P92A 5FDBA 3DP7A 1JHHA 4EJWA 2YU3A 2ISZA 3IHUA 3ZPLA 3F6VA 1MD0A 3MEXA 1XCVA 1PMIA 4I0AA 5K5RA 4PGHA 4HBNA 4G7HF 1BM9A 4U7BA 3QPTA 4P9FA 2VBWA 3M9AA 4BIFA 3P9IA 3K1NA 2XLGA
chains in the Genus database with same CATH superfamily
3LQQA 4IL7A 2IVMA 2CDPA 1JUIA 5JSPA 2IS6A 5CFCA 2EPFA 2EFQA 1G3WA 4YRVA 2IXKA 1IHMA 1YX5A 2M9HA 4LORA 1BVVA 4B43A 1Q3EA 3WNNA 1C4RA 5C4WC 2EFOA 1ZG5A 3ZFGB 2RS31 4JQRA 4AOCA 1Z1DA 1E5HA 4YVSB 3DLAA 2YC2A 2LBFA 1QMJA 1SACA 5JSOA 3OD0A 1HB3A 3NV2A 3OG2A 2M1BA 4IZZA 3RG0A 3C2GA 1H1IA 3O0WA 5CYVA 1RIOH 1ZRDA 1OLMA 4YW6A 1YJ9I 1SLAA 2Q1MA 3C2HA 2D40A 2QDRA 5LBBA 4KFCA 1SFYA 1W39A 2X53S 3KVBA 2YX4A 4ISQA 3BR6A 5LHIA 1URXA 3HBKA 2HQRA 1DGRN 1MZ5A 3O1UA 4WVMB 3FLTA 5CG8A 4HG2A 1N78A 1A3KA 1D0GA 4XAAA 4DUVA 4BACA 1ETXA 1Y0NA 1FTZA 1KFXL 1S0GA 1OBNA 4E4DX 4KGGA 3ZFFC 5FY5A 4Q8KA 3AG2H 3ROUA 4I6ZA 2RS32 1J09A 4E7IA 3DUIA 3SDBA 4W97A 3V4GA 5FP8A 1U0JA 3OPWA 4XIKA 2GH2A 3HSFA 2RDQA 4AQSA 5JIUA 1I5PA 2OA2A 1BZWA 5GALA 2MA3A 4X6QB 4KQ7A 1MMSA 4JKLA 1QJFA 4ZDPA 5J98B 5HXMA 1OURA 1OXCA 2NMOA 4G3YC 2WNVB 3K51A 3S3OA 4LKDA 5LK5A 2WNUB 4QX7A 1YOVB 2MHFA 5F0FA 3MUZ1 5J4VA 2FDIA 1FIAA 1QBJA 1GNYA 2MSYA 2X09A 3BTIA 5H6QA 4GH4A 4U0VA 2P17A 1AU7A 2XRNA 4ZPIA 1V6KA 5GLTA 5EFUA 4QQ2A 4M3EA 2X6XA 5FZFA 2F4IA 4M73A 2E1MC 3IAQA 1QNTA 2CGOA 4YG6A 1KQRA 3EUAA 3ZYRA 3UETA 5DDJ1 1UMZA 3NEUA 2FSWA 4ZC3A 2O5RA 4BOWA 2J1UA 4GWJA 4M6VA 2CUJA 1LODA 4Q4X1 3M3IA 2TBVA 5C33A 1G9CA 2OPTA 3A02A 1RI7A 5LZ6A 2R93J 2Y6KA 4Q47A 1GYKA 4FFHA 1GKBA 4HLYA 2W87A 3LPFA 3R05A 5IPAA 1NG6A 4COYA 2HZTA 2BJSA 3QP6A 3ZQHA 3BUCA 4AYUA 2BEOA 1Q8OA 1D8KA 3FKJA 2KDOA 4M72A 1PGW1 3IKVA 1WW4A 1IKQA 3A0KA 4FOWA 2V4JC 2EFWA 4MGYE 1GLHA 2BTVC 2BHYA 3D8CA 1PGSA 3WW3A 5EQUA 1J0RA 1HXS2 4AC0A 4A5MA 3ZVXA 4M4RA 4LOCA 4AEMA 4CE8A 3ZMDA 1I1GA 4DUXA 1N1VA 5DDJ2 4OHXA 3H5NA 2R32A 2DT7B 1PO11 1I6HJ 3E7LA 2KHMA 1ZTRA 1MMGA 3JRIA 4Q4X2 2DVBA 1VALA 4M3GA 1U78A 4DZJA 1RUOA 1UZCA 2PHDA 1V6NA 5BNNA 3TQNA 5TSWA 2LY2A 4EZHA 2XGXA 1ND2A 5F3GA 2BVLA 1ZNPA 2RMU3 4MGQA 2D5HA 2Y0SA 2N8GA 4AFBA 1GDTA 5GZFA 4UUTA 5CFDA 2OQGA 4CP1A 4JZRA 1PGW2 3P1IA 2LSOA 4ESFA 1VFCA 1SEUA 1COV3 5FIXA 2DLLA 2BY0A 1AXKA 4LBKA 4SLIA 1MACA 2CWSA 3MF6A 4EYUA 4BXUA 4UW5A 3G71I 1LOAA 5F27A 1IN8A 2Y6JA 1W5TA 3BPXA 2IUWA 1QJX1 2KR2A 2A73B 1BOBA 4BY1J 3MW2A 3RRDA 2XUEA 4XABA 1RUH1 4XDOA 5FQ0A 1GZTA 3ABZA 1J75A 5ICGA 1LRHA 4IJAA 3GZ6A 1FV3A 4W1UA 2A3WA 4AZZA 1W6MB 5JOYA 2BNOA 5E20A 2YUEA 2B4KA 1OCTC 1C57A 1EV11 3NSTA 3ZN4A 5H6RA 3CCJI 1FBSA 4MADA 4YELA 1ZYBA 5JXJA 2OQRA 4QDSA 3BOQA 1JYIA 2RR13 2JIGA 1W9WA 4KYWA 2MYSA 2HWB3 2I74A 5ED4A 2HPMA 2GU9A 5C8WA 4JDMA 3LDBA 1T38A 1YI7A 5FPVA 1REDA 5LK7B 3ZMZA 5K7HA 1PM4A 2JUGA 3TOAA 1WWYA 2YPRA 2QF7A 3JQXA 1OYIA 1L0OC 5FUIA 1PHMA 2FD5A 4RBOA 4C1XA 4PJNA 4MXVA 4CDXA 2ILMA 5ABJC 3J8F2 3S32A 1QJX2 3ZQGA 2RM21 2W94A 2UUZA 3WDYA 2VUJA 1BIAA 1RUH2 1PK6B 3HNYM 1GP4A 2EF6A 1BJAA 2XQRA 3I7DA 4LBLA 4Y26A 4RR3C 2QQ9A 4MOAA 1EAH3 4MXWB 5T52A 3W6JB 4AHXA 4GGGA 1KS4A 2PMHA 1OYWA 1LB2A 2K7LA 3F21A 3RYKA 4A41A 2FD8A 5HS7A 1SVMA 4S2HA 4COVA 1JHFA 1MS4A 5CYYA 5DUWA 1HRI1 5K0UA 2DOAA 1HW1A 3NQHA 4INDA 3A01A 5CKNA 1MEC3 2OV7A 4ES8A 1YI2I 3A23A 3ILNA 3RCOA 5LW9A 4ATEA 5HOOA 3WQBA 2WO3A 2ZGNA 1FNZA 5FLMJ 3GUDA 3FN9A 2HYXA 2R0QC 3DKXA 4BGDA 1GXPA 1OR7C 3CZJA 1AWCA 2IBDA 4IE6A 3N7JA 4H3WA 4NRMA 1DDNA 3POJA 1KRIA 3N9OA 2DV9A 3NRVA 2P3YA 1H2NA 1OOPC 3ZFGC 4XORA 1CWPA 5FO9B 4L18B 2WFF1 1I50J 1X7NA 3VZOA 2A3YA 3PUIA 4YVSC 2X1DA 2VZ3A 1ACIA 1B35C 4G12A 2RDSA 1KD7A 2V26A 2A6EF 1D0YA 2WRAA 3ATGA 3HRTA 3KPHA 5GTIC 2PMUA 4JKKA 1HRI2 3I59B 4HK9A 4LPLA 1SLLA 5C9AA 1O59A 2W1QA 3OSGA 3S7EA 4IQ4A 1H9GA 4AK3A 4FX0A 4B7KA 2F5CA 2CY6A 1O5UA 1ZGAA 5FAXA 4LT5A 2DMTA 4P9XA 3T09A 4GCVA 3J7ZI 5IOYA 3SC7X 3AMPA 4AEDB 4BQ3A 3BZCA 2VE1A 4XZPA 5ILVA 3MICA 2ZJQF 2NZ9A 4CUGA 5GZEA 2CO5A 2HS5A 1LCLA 2P3IA 2PN6A 4S04A 2VNVA 4WVZA 5FYCA 1VQMI 3BG9A 1P4XA 4P9LA 1REFA 3SEEA 4CXYA 5LEJA 3OF1A 5C3RA 5L3DA 2ZMEB 2E9QA 3L1PA 4IOAF 5F6KA 3N35A 3IT8A 2QUFA 3KP4A 2XBO2 2OUJA 4RGKA 3WE3A 3NQOA 4HV6A 2XOMA 3OB8A 1B72B 2A69F 3CF6E 4MTDA 1W05A 3E5UA 5A3UA 4KIGA 4HDUA 1BC7C 4AYBN 4DRVA 1NA1B 3JD73 2CQNA 2NNNA 3I55I 2MC4A 3T08A 3NV4A 3VDAA 5KNLA 5BY5A 3AX4A 2F4OB 1WJ5A 3OIPA 1BHGA 4J25A 3P3PA 4M00A 1IG3A 3VBFC 1TWFJ 3MIEA 3A4UA 3SISA 5M5YJ 2ME6A 1E5IA 1FPQA 4JGYA 5EYYA 4E6KG 1POV3 5DCMB 3QRFF 3UGHA 1HN0A 4M9SA 4M9ZA 3ILRA 2I5UA 4PUSA 2V4AA 1SEFA 2DCYA 4BHBA 4M0NA 3SZTA 2ZGRA 4XIDA 3ZN1A 3F72A 2XDVA 3IP4B 2R041 5G05L 3OGSA 1ZRCA 4DXTA 2EA4A 2ADUA 4L11A 1MS1A 4AXOA 4P9WA 2ZXIA 1PVXA 2M45A 2NAZA 5FZHA 5FFOC 1A5JA 2C0ZA 3PDQA 2PI0A 1F43A 1JXSA 5FUNA 1HLCA 2WV0A 3RWNA 1Z0XA 1HJGA 5FXVA 1ULPA 2DQRA 2MD0A 4MGSA 2W82A 3TMOA 2JG9C 4KG0A 1XYPA 5JUVA 2VE9A 2WINB 3PSIA 1ZGWA 2WB1N 5GPCA 1BIBA 1TL8A 2GC0A 1RUC3 2VOWA 3K4NA 5E8AA 3MUY1 4LUMA 2D5FA 5FLXZ 1R081 1CIWA 3ELNA 2HWF3 3SXYA 3B02A 2K4BA 3RMYA 3OYNA 4J1XA 1C8M2 3JB4C 3TNPB 3EYIA 3C3VA 4KJZA 4FP2A 1I9RA 2CW8A 4CEWA 3I3BA 3FHAA 4MSVA 5CFCB 4K7JA 4OVEA 3O12A 4QX8A 4B4RA 2IXLA 2PJRA 4E7SA 5GAHJ 4UFMA 4RAYA 3JZVA 1D0HA 4QKBA 4I76A 4Q0QA 1FMVA 2V9KA 2EQRA 1YW8A 1OHFA 3IUOA 2LKPA 2LBFB 3KIOA 1HKSA 3X2QH 3KQ4B 4NHKA 2F5VA 3PQKA 5I93A 1B6AA 1UZYA 1NT0A 3NAUA 2XGDA 5GADJ 1WJFA 1ZBE3 3ZSEA 2BP6A 1R082 4Q5SF 1PVEA 3BIEA 4LLFA 1WD4A 5FBZA 2BVVA 1WQ2A 3TEYA 4XKBA 3VDXA 1EA3A 2ZNYA 1QQIA 2HVRA 2M34A 2RNJA 2Q8EA 1G3TA 4FXGB 1LJ7A 1VI0A 2O1QA 1X1PA 1D4M3 3QD6A 4RSUA 4XR6A 3D4KA 2JQ7A 3DECA 5CAZA 2BNNA 1ZQ3P 2K86A 3UJQA 3WUDA 2HWC3 1Z7S2 4L9JA 3WG9A 4MEXF 3MIDA 3N05A 4AL9A 4OU0A 4CUBA 4RQPC 4D8MA 5BQTA 2JENA 4KWKA 4LO7A 3S0MA 1IOAA 2O14A 5LEKA 2OZJA 1RKWA 4YRDA 2Y26A 1OT5A 1WLTA 2H09A 4GULA 1LVKA 2X8KA 4XQDA 2KIMA 4Q0PA 3BG5A 4LNVA 4YNIA 2FNPA 4XUQA 5HDKA 4Q4W3 1AJKA 4LG3A 4UWDA 2Y31A 3WV6A 2VTFA 2ZGMA 5GZCA 1TWCJ 1UHSA 3VBSA 4GH4B 4ONUA 3PFYA 4CUAA 4M74A 3JTGA 4MGIE 3LFUA 4U0WA 2M4KA 2ZX4A 1WJAA 3V0BA 1LOGA 1UFMA 1FATA 4BQ4A 1ODNA 4UAPA 2AACA 5FZIA 3RYRA 1EH8A 3H50A 4BH9A 1NTCA 3FXRA 5A3MA 4YFZA 2QZ8A 4DBRA 5J36A 4XFCA 4FFFA 4KBZA 4YGDA 2V6EA 3S7IA 2LRDA 4Z92B 2ZJ2A 1S9HA 4XOTA 2H6BA 1AL21 3OBAA 2MEV3 1E0EA 5FZOA 4LA2A 4XRSA 5FXWA 2QKLB 2XL7A 2O8KA 4N90A 2W00A 2GN7A 2DMNA 4HYEA 1SMYF 4XFFA 4Y17A 4LLNA 2R7RA 2CV0A 5JCTA 3ZN0A 1RVF3 4AAPA 3H9AA 2FCTA 2P5KA 5D4RA 4E27A 5DAVA 3VOEA 4JGZC 2UWAA 2ZAAA 2YPDA 4E7HA 3TAYA 2PN5A 3D5OA 2WY8Q 3POIA 1DGWY 4XOPA 2YGMA 3IB3A 4RGAA 2WWJA 1WW6A 2C6SA 2DBBA 1R6RA 4K3UA 5I91A 2OF7A 4PJLA 2QQAA 2BVBA 3J81Z 1QHHD 3A0HC 4C3JJ 1OLTA 4WX9A 3MZYA 3UR3C 1UF2C 1WLWA 3ETQA 1ETYA 3VBRA 1CN1A 1PO23 1RZ4A 1AL22 3CF2A 2HYGD 5J4YA 3A22A 3M8LA 5BNNB 2FCVA 3AC0A 1RTVA 1S29A 3T2TA 4WM8C 1IRZA 5A1FA 1MZBA 1VPHA 3K2AA 3K69A 2JICA 3USUB 5IJRA 1FMWA 1QA6A 1WJDA 3J7AY 2GP3A 4UV9A 5FREA 1GWMA 4YPJA 5F37A 3N9NA 5FYMA 3S17J 1XMXA 3J4UH 4ZYEA 5FYHA 1X1DA 2W91A 4LBQA 4DINB 3AZYA 4OZXA 3M8JA 4PIZA 3CUQA 1MBFA 3ZLIA 4BQQA 4UYBA 3S2DJ 2WAQA 3I54A 2DUQA 4QM8A 3KZZA 2E34A 2XQXA 4PLNA 2A5WA 2LF8A 2G1MA 1BK1A 3WU2C 2KFDA 2ELHA 3ZQFA 2OW4A 5JR3A 3CCUI 3C7GA 2QE3A 3DFGA 3MKLA 1NA1C 4HN1A 2QENA 3IL2A 1VQKI 1UO9A 3LDRA 5FQ0B 1VBB2 4MH0E 2V9PA 3UL2A 4RS5C 3OGGA 1RINA 4LTAA 4GQ7A 1Z7UA 3H92A 2COMA 4AI9A 4TXWA 3NJYA 2HWD1 3IDAA 4LMFA 1ZX5A 3CDHA 2J5OA 2Z16A 3RKYA 4KMFA 3TRSB 4G7OF 4RL7A 1AX0A 1W2NA 4ZJZA 4XF1A 2WY7Q 5DQ0A 4L92A 2YPJA 3I2DA 4MGZE 3I49A 3CMEI 5DAPA 1GV5A 4B8XA 2VOOA 2VZQA 5K7FA 3GFIA 3LOBA 1BEV3 4JTOA 4PFPA 4EM2A 2PQSA 3TN93 2UXXA 1TG7A 4CDXB 3DYMA 1UYXA 1G3SA 1JXNA 4WVVA 3FFZA 1DIWA 1AF9A 5FYBA 3DQVC 5BOXA 3OGVA 2R7EB 4RGXA 1DU6A 1G2HA 1AXZA 3DPRA 3A0NA 4C30A 3RZGA 4RMNA 4KNYA 1BN5A 2PX9A 3LAJA 2CYYA 3QCWA 4ETSA 3JXSA 1S0IA 1PVC2 4P1WA 3RZZA 4IE4A 1VF9A 1IO2A 3VBHA 1QJU3 2Z5UA 2HWD2 3CO7C 4DGWB 1UD1A 1YIPA 2KP6A 4GDFA 1CAXA 4OIRF 3GJAA 3L7WA 2VXJA 1Z05A 1N1TA 4UFLA 1IDZA 1I5ZA 1IAWA 3TWIA 2GNMA 1MBJA 1RRJA 3C2BA 1O3TA 5DUKA 2DU9A 1UMQA 3S16J 1STMA 5M5WJ 5K0UB 1MJBA 3ML6A 3A01B 1JH5A 3ECOA 3OS1A 2ZXWH 1HW2A 1V70A 2W92A 2IP2A 1JN2P 3HBZA 2E7QA 2DDAA 2YFUA 1AVBA 1GU3A 1PIV3 1G86A 4ZXEA 3PO2J 3KB5A 4Y52J 3QYBA 1FSHA 4Y1VA 5JFRA 4XVHA 2GSYA 4CP9A 2VBXA 4JYKA 3GALA 4GALA 4DIQA 2NOGA 3GTOJ 3DU6A 1AHSA 4HSJA 4GO1A 3W3CA 3SDGA 2J1SA 1KQ9A 4D6QA 2K9MA 1CQTA 1ONVA 5E8IA 5HODA 2HDDA 4QHZA 3RVHA 3CCRI 1OC1A 3LFMA 1XNKA 4BYYA 1QGPA 2M2EA 5LB6A 3G6JB 1SD6A 1H9WA 5CNAA 4YG3A 3THPA 2BOJA 1FNYA 3PTYA 5FP4A 3EBRA 1JKPC 5D8AA 2JRMA 3T30A 1R1UA 1U5TA 4X8PA 3LB9A 1AR73 3AZWA 3VL8A 4LBNA 1S2EA 5LHGA 4BBRJ 4IHYA 5FYSA 4FTEA 4RS8A 2IW5A 2PJPA 5C9AB 5F39A 2PAEA 1CZTA 2DA5A 1HDDC 2IWGB 3IMMA 1JTYA 4BEHA 4Y15A 4C0BA 4Y3OA 1W8NA 2M4GA 3L9FA 2HYFA 3H3LA 4QSHA 4FPJA 3PUAA 4E7JA 1H6YA 4PDKA 4QB1A 4EN8B 1YLLA 2VKEA 2DMPA 2QWWA 3BDDA 2W46A 3AVRA 4XLEA 1HJFA 5EJCA 1BBYA 1S0CA 1W5SA 2MBFA 4I98B 2W57A 4DS0A 4LHLA 5TGTA 1O7LA 1ON1A 5LGTA 3JRFA 3JBG3 3M7AA 5KHJA 3VFZA 4LG0B 1LHNA 5FO5A 1ZZ8A 1LGCA 3JRBA 1QNWA 3T1LA 5T54A 4UVBA 3ZDSA 5FV3A 2OS2A 2ZHMA 2CWMA 2P81A 2NM1A 3AZVA 2Y2ZA 1IRGA 4GWMA 3WDVA 4CCCA 4HQMA 3BC8A 3AZXA 1AHDP 1W2UA 3OYMA 1QZZA 1BKZA 1GICA 2WADA 1VB2A 5FPUA 3OWTA 4U36A 4JGYB 3P9CA 3BJOA 3FXLA 1V00A 3EXUA 4WM7B 4QPGC 2DVAA 4PIYA 3M1HA 5IVYA 3ELKA 3HJEA 1Z3YA 4DZPA 3POBA 1TMF2 2CQ7A 5F32A 1G6NA 3VHPA 5JPNB 2EINH 4GRIA 4D7MA 5FWJA 1QU0A 2E33A 3RZKA 3HD8B 4ASLA 1OFSA 3KP7A 1T2KA 4ITCA 2NVTJ 4F83A 4LQRA 2VZTA 2BZTA 1IN7A 2CQXA 1SG3A 3JRCA 3IN9A 2B42B 1IZ1A 3N97A 1ZZBA 2XROA 1ENSA 1W6PA 2V1DA 3FFQA 5IY5H 2VUMJ 4Y33A 2QQWA 1LFBA 4OHZA 5DD8A 4A7KA 3M1EA 3K2ZA 1IN6A 4RB0A 2D45A 3S5AA 1S0DA 2OT7A 2WDBA 4AGRA 2V73A 4W65A 3LF7A 2X6OA 1T98A 3IWFA 2RVAA 1UQXA 3AKZA 4A45A 2IA1A 3O0XA 2JB4A 4UY8I 5LASA 4C8DA 3ONQA 2TUNA 4RYDA 2DDUA 2JRTA 4EM1A 2X85A 2F2EA 1L7LA 3ESWB 3V65A 4HLXA 2NNYA 4CEWB 1YW9A 1YYNA 2E5ZA 1UZWA 1WUVA 2QTWB 2WN3A 2H1LA 1ND2C 3HOSA 5FRMA 3I3EA 2WQZC 5C5TA 1HX6A 1MPXA 1JOPA 2QGUA 4OZOA 3LFIA 3CLQA 4JV4A 1FEXA 5CFDC 4D7NA 2V72A 1GFF2 4EN7B 2L7MP 3W2AA 1K78A 4AF9A 3PNAA 4MHRA 4I3GA 3SCGA 2XSDC 4FPYA 3E5XA 3I4PA 2WYSA 3RSJA 2LUWA 1HXS3 1Y7BA 2A6WA 5HV4A 3K4LA 2P6TA 1DUXC 3CESA 3BU0A 4F8AA 4HA8A 1VMJA 1CGPA 2W9XA 4UFIA 3KF5A 3ZPOA 1UPSA 4YW7A 3WXPA 3TL4X 4FHTA 1TEIA 3LE0A 3OBRA 1PYVA 4M0HA 1B8IA 4OMDA 3L2WA 1UU6A 4N53C 3C8XA 3WCRA 4XRMA 1XS9A 5C71A 1O3QA 1IUFA 4QXBA 4MZUA 3TP0A 4P96A 4C3IJ 3TDZC 4J1WA 5B2GB 1XMKA 1OSGA 2YFZA 1UU4A 2E2HJ 4L99A 5HDGA 1U6GA 1UX7A 3ZFEC 5BUVA 2D6NA 5L3CA 3VD9A 1XC6A 1VQ5I 2DXIA 2W08A 2LY9A 2FMLA 4LKFA 2XVLA 5A1AA 2VQ0A 5CIRA 4L5JA 3MIFA 2VT3A 4CDXC 1TNTA 5M0TA 1XNDA 2L4AA 5JXGA 1IS3A 4CYCA 1NZCA 1XSRA 5DG2A 4KN7X 3WW4A 4F3JA 4YIFA 2AZ5A 3LKJA 2OA4A 3CCQI 4U0YA 5ICFA 2K9SA 1R5GA 2WQ4A 5JVTA 3IH4A 1H30A 4LO5B 5SV5A 4ZZLA 4V19K 3S93A 4B4QA 1G9AA 5FKMA 4Q8LA 3Q8FA 5E6HA 4B48A 2ID6A 3V0BB 2R6QA 2BBAA 4RFT0 5FZAA 4DEVA 1QXJA 3FISA 4P9UA 3LSMA 3ABTA 2WTEA 3WF2A 3LL7A 1B9NA 5DAQA 4X6AJ 3ZSKA 5B3SH 4AEJA 5L3GA 1KU2A 5HNHA 5C8CC 4CHUA 2JDUA 3CQOA 3VYUB 2DFHA 4HDVA 2BV4A 4AVBA 4BJ5C 4FBFA 4CDUA 5FZOB 2A6HF 4OI0A 3DCFA 3VSKA 4JX0A 2VW2A 4H0EA 2HEOA 2UU8A 4QX2A 1XGNA 3NAPA 3J8F3 4COZA 1RUNA 1J3PA 1LU1A 1N25A 1Y9MA 2VMEA 4P02B 4BKXA 1MMAA 5AIQA 3BPVA 5CPRB 4AQ6A 1D2QA 1IXRC 1VBC3 3OY9A 3K1PA 1NUKA 3I2OA 1TT0A 3SJMA 2R7XA 4QPIA 1T95A 1W5CC 4AIKA 5FDBA 1JHHA 5BNOA 2TEPA 3VLBB 3HPHA 1QGLA 1MD0A 3MEXA 3X29B 5CB7A 4HNTA 2ARBA 3NNLA 3BODA 1CZSA 4I0AA 5K5RA 1PMIA 2CGNA 2E71A 1ZKGA 2V1NA 3QPTA 4FI9A 3VBOA 3K1NA 3KM5A 1Z78A 3OS0A 3NNGA 1EJ9A 4GWNA 3WLUA 1A6CA 4WF2A 3CCYA 3VBRB 3MLKA 1LPQA 1XSQA 1KONA 4NIIA 3OEAA 5DUUA 3FMRA 2ZJPF 1D4VB 4PJYA 4XRSG 4MV2A 4XF0A 4DJAA 4XEZA 1DLCA 3LIHA 4A12A 3F3XA 3A1YA 1J2XA 2FQ3A 3JRDA 3ZOBA 1LNWA 4XONA 1AA7A 4AVZA 1RUD2 4KWLA 2UWCA 3TGNA 4DOUA 1ZARA 4FASD 4ZZDA 1J3QA 3BU7A 1C1LA 2VOKA 4R79A 3H36A 2LYCA 3AL0B 3V64A 3CUQB 2Y6GA 2VQCA 2VQTA 5F1RA 1V5GA 1KZHA 3HOUJ 3OYHA 1PZ9A 1JJ8C 4I7HA 3TBIA 1TQ5A 2EXJA 4LLGF 3OTFA 3OSFA 4BUPA 2ZPXA 1ZYRF 1XN7A 5J1XA 1O4XA 1ZAOA 3WVJA 3CJTB 3VSLA 2RKHA 2K02A 2RMU1 3AP9A 3AYEA 3MV01 3OPTA 3C7HA 2J1RA 4UXAA 2LH9A 1XGOA 2Q8KA 4QU1A 2DBIA 4XF4A 3BPZA 3BLYA 3CCMI 3FZVA 5D8KB 4A3IJ 2FDJA 1YCIA 1TME3 3ACGA 5DDGA 1COV1 1JYXA 1VAKA 1QXPA 5F5IA 4GA9A 5CVVA 3NL1A 2GC1A 1B9MA 2UXNA 1VBA3 2DVGA 3KP2A 1PMJX 5D4SA 3B00A 3FMQA 3DLLF 3H3VK 1VMFA 2BRTA 2VZOA 4LBJA 3U1KA 4YIRX 3IBMA 1UIKA 2XBO3 1RC6A 3HG9A 2G19A 3LCPA 1RUF3 4NWWA 2ZMKA 3KHCA 5JI7A 3PFIA 1OFCX 2Q2EA 4E7LA 3JRHA 3DPRB 4BNCA 2RMU2 2P5BA 3VB2A 4AVAA 2L0KA 4IE7A 3RZJA 1MS0A 3AKSA 2RR11 2DTWA 2IS1A 2HWB1 2HVQA 1XNCA 2FZ2A 1UJ8A 2V9VA 3ZMSA 4ZTJA 3KVAA 4UNOA 5E3MA 3GCXA 1X58A 3ZMUA 3LEMA 3POGA 4D0PA 2VCAA 1COV2 3CO2A 1AR83 1CAXB 4MO3M 2CWEA 3KP5A 1YEWA 4A0XA 2D1VA 1SFUA 2VY0A 4CU9A 5KHKA 1A6QA 1FX7A 1NH3A 2BU9A 3Q5FA 5GTHC 1X1BA 4FPGA 2V4VA 4FT8A 4CZZA 4ZYAA 1Q8QA 1E3OC 3UKNA 5FZMA 4XBQA 5M3FJ 1V6IA 1O4YA 2VUAA 5EYXA 1K4TA 1YJKA 4MTEA 5BPDA 3NRUA 2BW3A 4HKWA 5DMYA 4CP9B 2YSRA 3T8RA 3L2CA 4DB5A 1EAH1 3DEEA 1WBFA 2VOVA 3WTVC 3PUSA 2XLAA 3VYTB 4IE5A 2NOJB 2V5YA 3ZXKA 1U5ZA 1X3ZB 4NVPA 3FE5A 2P5VA 1F15A 1T8IA 2NS8A 3LMMA 3UGFA 2FA5A 1IF1A 1BI0A 2Y8KA 1MEC1 3B94A 2L5QA 3WP4A 5GAGJ 5D8AB 1MZFA 2DYRH 3AFGA 2Y34A 3I64A 5ILUA 1HIXA 5A7WA 3DPLC 2R1DA 5FD6A 3MKWB 2RHPA 3OEBA 4RA0A 3I4IA 2VPVA 4BEHB 4Q27A 4BAYA 3G4SI 5KHGA 1C8M3 1LQ1A 1L3LA 1GOFA 5IVBA 5IK8A 4DYRA 3SCHA 4Y1XA 2ZC2A 3DL3A 5JHFA 3WUCA 4ATFA 5I8YA 1YQCA 3B9CA 3WNOA 4KICA 4FPFA 5A7PA 4Y24A 1ULGA 1EAH2 4A6DA 2ZGOA 3NV1A 2NYXA 2K3PA 1K5MA 2ACJA 3JTHA 4YM0A 4XFGA 3K4CA 3OR1C 1Q56A 1YJLA 2XKOA 1CAVA 5H9QA 1TP4A 4LEJA 3PQJA 2VUDA 5DUXA 1X3UA 1NCRC 2MW8A 1UOFA 2DFFA 4LJZF 3GF2A 2FNAA 4JDNA 3ST7A 2OC6A 1YS7A 3R0JA 3BTZA 1WKMA 1GMMA 2XVGA 2HFHA 2OPWA 1RR7A 4MVTA 1QH6A 2WZEA 2WNEA 1JKQC 3DKQA 4HF0A 3J7YJ 3VBSC 3SFZA 5B66C 3EB7A 3QPSA 2A70A 4IV1A 2E1OA 3HIFA 1FOKA 2XWBB 4BQ1A 1W4MA 3DF8A 1YFHA 3WQ0A 4EWEA 4CZCA 1IV6A 2DPUA 4H7MA 5LA2A 5LRSA 5HLTA 3SCFA 2X5IA 4DY5A 2A61A 4P08A 4NBQA 3PMEA 2LFBA 4L97A 1D3YA 1Z7S3 2HH9A 1MS5A 3TOBA 3DPUA 2GIVA 4MUVA 4XLNF 3JD71 5SV8A 5FBJA 2I07B 1ZA4A 5HXVA 4XAEA 1R5HA 3Q9SA 3FX3A 4KL1A 2EXKA 4BY7J 2X4HA 3BR3A 3WODF 1H8TA 2X1CA 2BFUL 2IC1A 1DQ5A 4BZ4A 5LA9A 4CH7A 1RUJ2 1POV1 3ZXDA 5ISLA 4FCYA 1SFXA 3EQLF 4EVIA 1XU2A 4X1EA 1A6IA 2X9DA 2BUKA 3BB6A 3P9KA 3CF5F 1SZBA 3HNBM 2XGCA 2QQMA 2G9FA 3WG4A 2IXHA 2E2JJ 3LFKA 2GAUA 4XLCA 3J7NA 4IESA 2VJ5A 1GANA 2GALA 2ZNZA 2BZDA 4FP3A 3OYGA 3ERED 3IRQA 2VE8A 4RHV3 1REPC 2R7QA 2VVEA 3W21A 1XB4A 2E5NA 3EYYA 2OPKA 1IJWC 1Z0HA 4CPBD 1W0UA 1AKHA 2W85A 2E7WA 4L5EA 3HSRA 1K7AA 4M3BA 3T5XA 4R1HA 3ZGKA 4B47A 4AIHA 5LBQA 1SVLA 4IXAA 2WO7A 4Q4V3 1J83A 2MPFA 2KISA 4ZYGA 4ZDOA 2VR4A 4LIUA 4H55A 5HNFA 3CUQC 1K78B 2AXLA 2J1EA 1FOD3 2QKMB 3BTYA 2QUOA 2OX0A 5CBLA 2HWF1 5L9RA 4CCJA 1DHKB 3DYOA 3IDEA 1OKRA 1W0OA 5F1JA 2XJUA 4LK7A 2ADDA 5EYRA 2OKXA 4Y5TA 3QYEA 1XRUA 3OGRA 1HV1A 2P6SA 1BR1A 1A34A 2A6TA 2L54A 4FSJA 4XLHA 2RJLA 4XFHA 2K9LA 3J81K 3LOIA 5FZEA 3W2WA 1W90A 1B8IB 4AFDA 3CD6I 4IERA 2HQNA 1ZZ6A 2R3SA 3WDUA 3GXOA 4XJAA 3OGJA 4DYCA 2JXAA 4BQOA 4P5OA 3U10A 2RJ2A 3F8FA 5LBFA 2RE9A 4TTGA 2L9VA 3G1MA 3GTPJ 3QH6A 1H6XA 1RUC2 3BGAA 1ZBE1 2M3AA 2Y64A 2MLGA 2LNBA 3FHIB 1J9IA 3ZXLA 4OYUA 2YMZA 4N4NB 4N4OB 2XJSA 3PIPF 2MC3A 3ZCOA 2DU1A 3LPGA 2D6PA 1JGGA 2RS13 4FPKA 4O3MA 4CYCB 4P9YA 4DPNA 2UWBA 2ERFA 1D4M1 4DXRA 4A3EJ 2XB5A 4G6DA 1SFOJ 1VBB3 4I2OA 3BTAA 2XAJA 1MR5A 4IGQA 2HWC1 3LSEA 4CSWA 1LAJA 5EDNA 1G8WA 3VBHC 1GZ9A 5FP9A 5F3CA 4IGPA 4YYOA 3ZXSA 5DAXA 1XSDA 3H9QA 4GMP0 3HAGA 2K27A 1YLFA 3GTJJ 2K3FA 1LULA 3DBHB 2CS3A 2PAMA 2CW7A 4RFRB 3F8CA 3BJAA 5CVIA 1QHGA 4Q4W1 2VNRA 4QXCA 4I0WB 3UESA 2OAZA 1Y9GA 4CDUB 2P6CA 2XGEA 4FFGA 5DV5A 3CQZJ 3IAPA 4OHWA 4RLQA 1KQ0A 4CGZA 4K1YA 2R7SA 3NAPB 3I56I 3PVEA 4CPBA 4M3DA 4IE0A 1OQEA 3U78A 3DV8A 3LA7A 1OI6A 1YX3A 3QU3A 2GOMA 4DYQA 4QPIB 1AX2A 2VZPA 2HWC2 1IS6A 3VWBA 1KJLA 4LOSA 1J59A 1PVC3 3ZPYA 2VO5A 1W03A 2XAFA 5FOBB 4JX4A 5JLVA 2V5DA 1R093 1L7RA 3QLQA 3CEWA 3LSGA 4CCOA 1NE6A 1OA4A 1V6LA 1DZTA 2IT0A 3BPSA 2A6YA 3L2RA 4DQAA 3GBFA 5JWPA 2FUG2 1U5TC 3VBOB 3IKWA 1RL3A 4IEUA 5DZGA 2AH2A 4EN6B 4Q4W2 3I2GA 3EUKL 3WCSA 5L3BA 2HQ5A 4F7ZA 2VCBA 4XE9A 1RVF1 4ABZA 1WCUA 2ZS6B 2A6VA 1P4WA 2WJSA 4D7TA 1BC8C 2VUCA 2JDZA 5KWRA 1F31A 4HPKA 2Q0OA 4AUXA 2C1FA 1K45A 3VD3A 3IDBB 2JDKA 1WLDA 4EGZA 3ACHA 3VDBA 3MV11 5FY9A 5CQEA 2CAVA 3KGZA 1YXWA 3O7OA 5J8FA 4XL9A 2QQKA 3FXMA 3K4MA 2IS4A 3U14A 1W9FA 2STTA 5AVAA 4BIOA 2GBYA 3SEZA 1OKOA 5JPMB 3FK7A 1MVQA 4Z82A 1PO21 4XXPA 1TQPA 2MEV2 4AHYA 4XOGA 2R7UA 3C7JA 3Q8CA 2ZHNA 4ZXKA 2XV4S 3CO6C 1GV9A 4LLOA 4Q0UA 5E1ZB 5LGUA 2BY2A 2R7WA 1GQHA 4O61A 1ND3A 1RUI2 3CCVI 5A6XA 3PVNA 3SH4A 1RVF2 2EFNA 2IXCA 5F64A 4HQEA 4DXZA 3NNFA 2FU4A 2EV5A 5IAXA 5BNGA 4EV0A 2H0BA 1YS6A 2A7AA 4P9JA 4V1PA 1LJ9A 2J5PA 1R7JA 2VKDA 4MXWA 4OOIA 2W95A 1XG1A 2ZGPA 2RNGA 5FZ8A 4Y22B 2XAGA 3BQZA 2GQQA 2KIUA 2VBPA 2IEKA 1JTXA 3FMGA 4XNFA 2W1OA 1RUE2 4A4AA 2WWSA 4RAGA 4XUTA 1MH3A 3OYBA 3UYJA 2L7FP 2JD4A 2M7BA 3I4NJ 1GVDA 1GVJA 5IVEA 1AUYA 4BE0A 4BK5A 4Y1YA 3N7MA 1H2KA 5J3UA 3URFA 1ORKA 1US2A 2KKOA 4ZU7A 2B39A 4RDUA 1D2SA 2XASA 3NWSA 1WLCA 2EIGA 1X1AA 4U2AA 2GNDA 2XF5A 5APAA 2WV1A 3F2ZA 2B5HA 2VMDA 1SLBA 4ZTFA 3B9IA 2HYJA 1BEV1 5BNPA 4LK1F 3VHOA 3TN91 1O57A 1FY7A 1I3AA 1AZDA 2AR6A 4A7YA 1J7KA 4BXSV 2EZKA 2JVHA 1TMF3 2LK2A 5LCWL 2VTXA 5IFTA 1FOXA 3SKVA 5EIYB 3BN6A 2EFPA 1U0AA 3JRGA 5FYUA 4F55A 1POGA 3ACLA 2QVSB 4KIBA 5FK8A 4FETA 4XFIA 2BW3B 4N43A 1SFEA 1YYVA 1RNLA 1QJU1 2Z42A 3KCXA 4MHGA 4MGTA 4G9YA 2V1XA 1TVGA 2HKXA 2Z33A 2GMPA 4LO4B 3DN7A 4XMAA 3WDWA 1ASJ3 3GZEA 4IW3A 1V9U2 1W06A 3LAPA 2CFOA 4AI2A 4GYIA 4LE4A 1ZGJA 4PI0A 1A36A 1XE0A 2ORZA 4JTNA 4NN0A 3KV9A 2M8GX 4Q5OA 4ENMA 1LGNA 4QT6A 2KRFA 5JZGB 1IGNA 1XDUA 3L00A 1BEV2 1PIV1 2WA3A 1JYNA 4HBLA 1VBD3 3TN92 3H1YA 2JG8C 2ZGQA 2YROA 5A7WB 1K6YA 4CXXA 5F6LB 3WTUC 5DD4A 4N7IA 3VBUC 2C9KA 5LGNA 2KMUA 1F4KA 2JMWA 2HJIA 2ZACA 3MLLA 1AYM3 3GTQJ 1O91A 3VHRA 2LKSA 4L5IA 2FOWA 3K7AJ 3QWLA 1QJU2 2E60A 2KRCA 4J01A 1FYMA 2DFIA 4QX5A 5HPOA 2R7FA 4QWQA 2E1CA 2Y0IA 1RHI3 1Y43B 1AR71 1I1EA 2G7HA 1CAVB 2ZB9A 5GAEJ 3I2IA 3PJQA 2BDRA 1ULFA 5B1BH 5I0SA 1XNAA 2KLOA 4C2MJ 1YJNI 2BGOA 4YW1A 1O4TA 5KVRA 2CYFA 3HOBA 4AI3A 2UY9A 2UY8A 1FIPA 3ASIA 4HSLA 5FZLA 1I1SA 1IRFA 3UV9A 2VBDA 2DT6A 1LDJA 2OXBA 3AKTA 5EHDA 1JU3A 4MFDA 5LRRA 1LHWA 2VOTA 2X6WA 3TO9A 3NMBA 4URAA 3SZGA 4IV1B 2VCMA 1XYOA 3G2BA 1Z6RA 5A70A 5KXEA 3GEZA 3S3MA 3JBG1 4PJJA 1KFUL 3BR1A 2X5IB 2F4LA 2Z69A 3BTJA 4W4ZA 4PGGA 1Q8PA 1F9KA 2C4XA 1AR72 3S6PA 4OAZA 4YZ1A 2EA7A 1JBCA 3ZN5A 3HKZA 3G3ZA 3O8HA 3H42B 1H8TB 4CDUC 4G6TB 4XIOA 2GN3A 1XNTA 3QBQA 2QQVA 2CDOA 2O3FA 2VBZA 3D1NI 1T33A 2VGDA 4M3FA 3QQAA 2XRLA 3GTLJ 5A3NA 4XLAA 5IP9J 2P6HA 3LZZA 1VRH2 2HTSA 5FLVA 3HPNA 3LGRA 2ZOEB 1SBEA 2ZXQA 3OY8A 3KT7A 4A3KJ 1PP8F 1V4RA 5BNOC 5FZ9A 2A3SA 2KZGA 2NS7A 2ELJA 4KI5M 3PVOA 3JBG2 2FMDA 3GZUC 3SYTA 4IEYA 3JSOA 5KHHA 3JCIA 1FAYA 3FMSA 1X3WB 4NUBA 1MDMA 3VBOC 2W0XA 1I39A 2HWE3 2DN0A 4RM2A 3WX5A 1JZ7A 3LD8A 2ZCWA 2ZKLA 2WAAA 5HCAA 3ERMA 3MKZA 4HVRA 1WZ2A 3K9TA 1SPPA 1AKHB 2VJIA 1TT5B 1ZRRA 3CJNA 1D0XA 4QGNA 1HDKA 4XBLA 1O8SA 1NCQC 3VL9A 4IRIA 3GFLA 3AZZA 1CONA 3K6GA 4JOMA 1OQYA 1XCBA 5LWBA 1EPWA 4LUKA 2ZEXA 3GZAA 2ZGSA 1HLVA 3PUQA 3IIIA 1JHNA 2CUFA 4CCKA 1ALYA 3K4DA 4LBOA 2LC2A 5JSRA 1CAUB 1YITI 5T50A 2DTRA 3O5SA 2F4MB 3QOEA 4K1ZA 2JE7A 2DK5A 5D6EA 5A1LA 3BVCA 4DBQA 1W8TA 3LEGA 4X8NA 5BPXA 4LHSA 2W4SA 5AC93 3OYEA 1S2BA 1ST8A 1BYHA 3AP6A 3BALA 4FX4A 3M07A 1QEXA 5DUIA 4IEPA 2R0FA 3W9AA 4QQPA 3VZKA 3RPQA 3AMNA 4IPAA 4YZ5A 1WCKA 1RUD3 3GMEA 3PJRA 1H2LA 3LSHA 5FKLA 1HXS1 3OS2A 1AR93 3EDPA 1JOBA 2KA3A 2DCJA 2JDYA 3KV6A 1BMV1 1XGMA 1QHDA 4B8EA 2BW8A 3POEA 3CKHA 3FKIJ 2DCTA 2OD5A 2LF7A 3GXUA 2B0LA 2JUCA 3L2QA 1FMD2 2E1NA 4EATA 1PGL1 1A04A 4QGLA 3ABUA 5E1RA 2JA6J 2Z9OA 3LSRA 1PUFA 5EG0A 4BA6A 1JUPA 2W7NA 1UB9A 3KEQA 2JDHA 3AFHA 3H1WA 4DEQA 2M8EA 5A2QZ 2OUMA 3SH3A 1VR3A 1Q1VA 1AJOA 5C44J 2VQHA 4LOTA 5IK5A 1UYPA 3RKQA 4J00A 5EZGA 1US3A 1UAAA 3F23A 3PIGA 1IQAA 4WWCA 4WZCA 4M3CE 3KZ4C 5HI0A 3CIHA 5JMCA 4LR4A 1NKGA 1V6JA 4A42A 3OOXA 2JJ6A 3WTTC 1Y4WA 1ODMA 4OFGA 1S8NA 4AQTA 3CCEI 2B63J 5D1IA 4DUWA 1BMV2 1OD5A 4IEXA 2XH6A 1CX4A 2GIZA 3WW1A 2B9UA 1H9TA 2VXDA 5FKNA 2DA6A 5H20A 1UHMA 3AAFA 2PMZA 3K70C 1PGL2 5A80A 2ZEWA 1DGRA 3USUA 5DN2A 4AW7A 2JKBA 5FZ4A 1TZOA 2P8TA 4XUOA 4W6WA 4BLIA 5I8TA 3FC0A 2QQ8A 4RB3C 4EGYA 1VTNC 3WHTA 4II3A 3JREA 4M3CB 3VV1A 1WFXA 4Z2YA 1ETWA 3KCCA 4QPWA 5I0UA 4XQFA 2BPA2 3VEPA 1JYCA 4N8MA 4GZ9A 3KGLA 3NNMA 4UUSA 3J8F1 5EEGA 4OIQF 2A68F 3G6EI 2ZGKA 5ABJA 4HN0A 5EJ1B 2LS6A 2OIIA 4V2WA 1VBC1 2Q1FA 1DQUA 3DEWA 1CR7A 3H8XA 2Y6HA 4ET7A 2IXIA 2ARCA 3UKGA 2E53A 1MJ9A 1LHUA 2FQ4A 3HJRA 3VZNA 5CVJA 4FPCA 4YW4A 1B09A 3LAGA 4HPKB 4NIGA 5GJ6A 2JEMA 3BZKA 3UJOA 4RR3A 3GYHX 2ZXHA 4L9VA 1SBFA 1VB4A 1K5MC 1DP7P 4M9XA 2HOTA 2VZUA 3U21A 1HC8A 3VDDC 4BMEA 4N0BA 4AI8A 4YM3A 2MH9A 4MGRA 3VN4A 4RB2C 2SBAA 3GWZA 2B7EA 4QDQA 1R4NB 3HOWJ 2ZKNA 5E89A 3PHMA 3RGBA 3H5RA 4BBSJ 1H88C 2E31A 1HXDA 3H9GA 2VD7A 4OMYA 5M3MJ 2VC9A 2F5EA 1LOFC 1CZVA 1ND3B 4KU7A 3N9QA 1VBC2 5J1RA 4N9HA 5ANQA 2JDNA 5DXDA 5FJKA 3VUOA 4DOZA 4UW3A 3BY6A 3VYSB 3CUOA 3U4XA 1XYNA 3O1VA 3HRSA 4CDWC 4IV1C 1UNBA 3H0OA 5DTDA 2ZGTA 3CLPA 1I6XA 5E3NA 3ZIWA 4K2EA 1ZR2A 1OOPA 2VL4A 4G4FA 4DNCA 1XQNA 1BBT2 1UMIA 2XUMA 3F6OA 3I58A 1OISA 4OMCA 2X5IC 4JDOA 2VECA 1B35A 1DU0A 2AXTC 1IQDC 3L2YA 1XOYA 5FOJB 1RUG2 1IW7F 4EJRA 4NC6A 3KETA 3R61A 2G9WA 2GXAA 1J1TA 3B73A 2D6KA 3PM1A 2EIKH 2LDUA 1H8TC 3ZN6A 2E63A 2DU0A 1OQDA 1XE8A 5IP6A 1SC7A 4IEVA 1TWAJ 3SEPA 3VPRA 3HC7A 4YLZA 4MQ9F 2MG4A 1TME1 3FIWA 2F6BA 3BR0A 1N47A 1R58A 2EK5A 2D1HA 5IYDJ 1VQ9I 1SD5A 5GM0A 1WPKA 2WZ8A 2HOSA 1Y9QA 4ZONA 4COWA 1VBA1 3S2HJ 3SMHA 5FY8A 3F8BA 2ZX2A 1DDLA 2L02A 3L2HA 3FDYA 3Q9VA 3WTZA 2RQQA 2VMHA 2WA4A 4D5CA 4AWDA 3LSKA 2P4WA 3VD5A 1J1LA 4EMSA 1YO5C 1IZ3A 5FYVA 1YQ8A 5L3EA 2AO9A 5BNPB 2XBO1 1UXZA 4A69C 1YQ6A 1RUF1 2VZ1A 4K8RB 4EE2A 3RZLA 1ULCA 1MZEA 2HXOA 2H6CA 3ZSLA 2FOKA 1C1FA 1DGWX 2CV1A 1SLTA 3MN2A 4EWAA 2DURA 1CAWB 1KGYA 4K20A 4B3XA 1B59A 3M8FA 2QBYA 3FXJA 3HHHA 5J8CA 4N43B 3PJYA 3VBFA 1TME2 4EJWA 3SITA 1AR81 2ISZA 4EEFG 2Y30A 5FY7A 3BOWA 1RUJ3 2DUPA 3D3AA 1VBA2 4PGHA 1RESA 1A8MA 3G1LA 4P9FA 3M9AA 3WF0A 4BIFA 1VAMA 2C26A 2W2IA 1N3PA 1DCSA 1QH7A 5FTTC 3GW2A 4Q29A 2ICWG 3ZMTA 3ZXAC 3NKTA 3WEZA 1RB8G 4ENNA 4R4ZA 2XSJC 3F9KA 2JJ7A 1RUF2 4M6YA 2FDGA 2DFCA 2IPQX 4CDGA 4YSFA 2ZEYA 4LG0A 4E4ZA 3MIHA 5JR2A 5IW0A 3MIGA 4JX5A 2WNVC 5JOXA 1SVOA 2IS2A 1RETA 1UKRA 1G7YA 3GCMA 2WNUC 2JN6A 3LWFA 4XKVA 1R5ID 1OUXA 2XPVA 3HEIA 4OIPF 2ZX3A 3AJYA 2Y0OA 2ZX0A 3K0LA 2NRAC 1IPSA 5FRAA 3RI4A 4XJWA 2RDRA 4IDZA 4Q0VA 1AR82 5EZHA 2HQAA 4JRAA 3MBWA 3D0JA 3T1MA 1O5LA 3ZSJA 1VZ0A 2ZBJA 3SEQA 5DZFA 4KU8A 5FY0A 1Y1WJ 4WM7A 1ZELA 1OF4A 5LBCA 2RDNA 3CC4I 2QQLA 5EF6A 4PCRA 1YFYA 3U75A 2XJRA 5JHUA 2DDBA 1JI6A 1D5VA 2J1TA 1BI1A 1QJEA 5GZGA 3GDBA 2Z3YA 2OVUA 4E7KA 5T5OA 1PJRA 4TWTA 2PHXA 4K21A 5CVRA 1C8M1 3D5LA 4KN4X 4KBBA 5IYBJ 4ES9A 4A3FJ 5EEHA 2QQBA 3M4FA 4NIDA 1R1TA 3AYDA 5C3PA 2R4GA 4R9DA 1CF7A 1ULEA 5IT3A 3KV5A 2WR9A 5LY1A 3GHNA 1ETQA 2AC1A 3HB9A 3RSNA 3OUIA 3A7QA 3WG1A 3KS7A 1EUUA 2JVGA 4ZZ8A 3T1BA 4DFSA 1JMUB 4OUMA 4HANA 4NPMA 2WWYA 1YE9A 4GYGA 2LG4A 3LSDA 4BDVB 1XU1A 5EXOA 4QKDA 3Q3SA 1UIJA 1RJ7A 2DK8A 2P3JA 3I53A 2KPMA 4CTEA 4CZSA 1SHWB 1KQ8A 5A3LA 3REOA 3ZP5A 4NPRA 4W8JA 5F9TA 1WCSA 1SDDB 1ENQA 1FC3A 5HLHA 4R9BA 4N7UA 4FAHA 5IUQA 1VRBA 1YQ2A 3ZYBA 4UI9L 1BW6A 2L9SA 2VOXA 1CJPA 5FROA 4BJ0A 2VKHA 2BFUS 1S3JA 2MH2A 5FLHA 1AR63 2BERA 4NE9A 1DPRA 3M3EA 1Z6TA 4XCAA 5E18F 5EEAA 2VQAA 1PM7A 1MVEA 2D5VA 4EJUA 2QJVA 1OPMA 3ILFA 2VJ4A 1AL0G 3OY8B 2A05A 1Z7S1 4CEYA 4FCAA 5FGMA 1C0WA 3BZ6A 2FCUA 3T8TA 4WCGA 2VW1A 2EILH 4XFBA 4IHSA 2QCSB 2G7UA 1O4ZA 2O03A 1E3PA 1MDMB 2P1BA 2DQLA 2RS53 2CSGA 1XSVA 2ZKZA 5KBFA 2YYOA 5A3OA 4AYBA 2EBIA 1FYUA 1SPPB 5E17F 4R9AA 1LVAA 1MKMA 3RWKX 4HVQA 1MS3A 1SFNA 3ECHA 3BTCA 4QX3A 2JECA 2LW8A 4AGVA 4GD4A 3PU3A 2JPBA 3R0RA 1FP2A 4BDYA 2K46A 2E1MB 2CNAA 1QIQA 1V6MA 3RKXA 4GMP3 1KGSA 2W39A 2BWAA 4RHV1 3K46A 2VZVA 4O9EA 3I9V2 2FXAA 3I2HA 2QDNA 4XHBA 3O1PA 3NNJA 2PHUA 4F52A 5FKOA 4XM3A 3KQRA 2FJ1A 1WJBA 2M5WA 1WCMJ 4NHJA 1NQDA 1R1A3 2DJIA 2KJCA 5FO7B 1WH7A 3G73A 5DM7F 1OVSA 5D6FA 4Q4V1 2IA2A 4LB6B 4EM0B 2YC0A 4NAOA 3V7CA 2XHNA 4Z1VA 4AVVA 1PK6C 1D5YA 5JI9A 1U9OA 4LHKA 4R8HA 2BVMA 3ZR5A 3M8EA 2XXZA 1FOD1 4JGZA 3VKLA 2EV0A 3W5MA 4TSVA 3QYFA 4HXCA 2OZ6A 1JTZX 3OYLA 4ASNA 4YGEA 3KX2A 3KLNA 4YZ3A 2K2SA 2WB1A 3POFA 1UMHA 5DEQA 4RHV2 1UN1A 3GF6A 4LA3A 4CYDA 5HCFA 1WW7A 5IHRA 3VHNA 1VNDA 3CL1A 1VLNA 4BQWA 4HFSA 4LKEA 1S7OA 1KEXA 4A3JJ 3DTEA 4WM8A 3K4JA 1PUFB 5EG0B 2QVOA 3GNEA 2X51A 1IRXA 2QSFX 2YX7A 4Q4V2 1RUI3 5TRDA 2C5DA 1OLRA 2DVFA 5FZKA 2DJNA 4TLFA 2JD9A 3MI8A 1UZZA 3ALQA 1D1BA 4JP0A 2XUBA 4IRGA 4XXAA 4YFXF 3LIGA 2O8XA 1FOD2 4BJ6C 3E5QA 3W58A 2YR2A 1A31A 5IK4A 1FT9A 2CQKA 4IV3A 1U3EM 5BNPC 2L9LA 4NRQA 1QU3A 3O8GA 3ZXFA 4PF1A 1VQ4I 5FY1A 3MVPA 2JTVA 2WBMA 1NX9A 2RS11 4S05A 3TOJA 2ZX1A 1LUJB 1R1ZA 3CMMA 1EP0A 3CDZB 5E16A 4B1MA 1K4SA 1HQCA 2IJLA 1RUE3 3MW3A 1OA3A 1VBB1 1WVRA 3JSPA 4UHTA 2ES3A 5HBAA 4K8FA 3AM2A 3WHBA 4GB33 2F6CA 4RS5A 2GA2A 4N43C 4AEKA 2KJBA 5I0RA 2XKPA 1FBUA 3KP6A 5L9VA 1H0BA 4QB2A 4PQ9A 1S0EA 4AEDC 2BOIA 1WMFA 3E1SA 2CFXA 3MFAA 1U5XA 1BJZA 5ACA3 3AKPA 3HVDA 5BYNA 2VNOA 4IHTA 3TW6A 3OYKA 2PAKA 1ETVA 3MAJA 5KK1A 1I3QJ 2L9RA 4COUA 1W8HA 5F3EA 2ZMEC 4HX8A 2GMMA 5D8LB 1ULOA 1LHOA 1HN1A 5FP7A 4CXFA 1R9TJ 3CMAI 4WK8F 2L2OA 1FOYA 4UUSB 5IYYA 1W04A 2RS12 4XJUA 1GZWB 4UV8A 3LDKA 1NK3P 3TBDA 5ABJB 2OCEA 5DPNA 2WAFA 2JB8A 2YU9J 4D1QA 3E97A 3WNXA 1LEBA 5AIPA 4PFOA 3AYAA 3FM3A 1QJY2 3ABKH 3T2OA 1AYN2 2O0YA 1PVC1 4FO9A 2XVKA 1ODDA 4B4CA 5GLVA 1IV8A 1LENA 1T0FC 1R091 5FXZA 1NLRA 4D6SA 3BG7A 2ZMNA 4RR3B 2Y69H 4MIMA 1AX1A 2JDMA 4LKSA 2KZVA 2BNMA 1WMDA 2ZHLA 2R0HA 1V9U3 1F4HA 4HOOA 2FHRA 3OSDA 1YC61 3R4DB 1OKQA 4A3XA 2DWRA 1W0PA 2DFEA 4PLMA 4O9GA 3JCUC 3Q9OA 3DKWA 4ZU5A 4AM3A 2XB0X 3F95A 2C24A 3HOYJ 4HRIA 4UW4A 2W24A 4LBMA 3HT2A 3JU9A 1MS9A 3FWEA 3T0BA 4XYXA 5GZDA 2F17A 2ZABA 3WF3A 1H4GA 4BQ2A 5FMCA 3KYLA 3BQYA 3LQCA 3C7OA 3KT4A 2FEZA 1GLNA 3OIOA 2F5DA 2QSHX 3W5NA 1QO0D 2VXZA 1OOPB 1Q8VA 4LO8A 1R092 1FX5A 5I0DA 2VONA 1V6OA 1NXD1 2OUHA 4AI0A 1UYZA 1B35B 4HLTA 5FKCA 5FB2A 4Z07A 3M3YJ 1X9TA 2QQNA 3POYA 3WU1B 4D7YA 5JI6A 4XJ9A 4QPOA 2DA4A 4D9JA 1ONAA 2YZ4A 3U2RA 1X2MA 2JA5J 1W36D 2FBKA 3ZN6B 2YU2A 4HL0A 1P9QC 3KZIC 1W0TA 2VVDA 1GBGA 3WZ1A 2R7ZJ 3DEMA 3CHXA 1K12A 2JZYA 2E6VA 4RGGA 2PMZN 3FL7A 4AGGA 2VCCA 5A32A 1G59A 5C3QA 4ANJA 1C28A 1ZM1A 3ON7A 2QA4I 2Y0SN 5CFCC 1R00A 2DYCA 2PLYA 3AMMA 5CJ9A 4ISRA 4CO8A 1GZCA 3NV3A 2Q8CA 4CCEA 1QPIA 4B3NA 4Y7NJ 5ERIA 5AFEA 5G04L 2ORXA 2Y33A 5DS9A 2GP5A 2FE3A 2LVSA 4BDZA 4W50A 1IXCA 2RDPA 1FV2A 1WA4A 1F5FA 1Y56A 1V54H 4AAXA 1QXRA 4XSXF 4B4PA 3MYXA 2EH3A 3GBGA 4Z2AA 5FY4A 5HVQC 1XPWA 3RJRA 5ERLA 1N1SA 3WNPA 1OJLA 4B09A 1LTEA 3PMSA 4IHVA 2QBYB 3ENRA 2GXGA 5B1AH 2E2IJ 1RITA 3VBFB 4ZY9A 1Z67A 4UW6A 4ITVA 2DA1A 3GFJA 4E2QA 1Z7LA 2D3SA 1JJ6C 3FLPA 2WN2A 3JB8A 5B4XA 5KC6A 2M30A 1VRH3 1MSEC 2CMPA 4NHYA 4RM3A 1MBKA 4Y1UA 4PCQA 4QPGA 1KXGA 1T2XA 1X33A 2YDEA 1TMF1 1SLCA 3BTXA 1F36A 1C5HA 2R7DA 2K85A 5D5XB 4O5VA 5FFXA 2TCTA 1QDCA 2GC2A 3E1F1 1XGSA 2CU7A 2WYFA 2FQPA 4HK8A 3L2UA 2LRPA 1XC5A 2EZLA 4B7EA 3R0AA 3HGYA 4Y20A 4A93J 2K9NA 1SLIA 2QQPA 3N7KA 3HDDA 3DXTA 2WO1A 3UNGC 2ME0A 1NOVA 1GSLA 1MBEA 1WD3A 1RXFA 3CJRB 1ASJ1 2ADEA 2ZA9A 1H89C 1LDKB 4OULA 4QIWN 2NS0A 1POQA 2M0CA 3UK9A 3OV8A 3FHQA 2H27A 4GH4C 4URTA 1YIFA 2BXZA 2FBIA 2JA8J 4EJTA 5CQGA 2P7CB 2VIXA 3WG3A 3CZ6A 2JG9B 4NIAA 4Q1RA 1VBD1 3K2OA 3MDPA 4A6OA 4NOTA 1TQIA 3J26N 3AG3H 3BJ6A 5IYCJ 1T6SA 2VMGA 4IXLA 3DU5A 3ZMNA 3VODA 1RIRA 1U12A 3V0AA 3S57A 1GHCA 1KU7A 1MSFC 4KA4A 2PQ8A 5CA6A 1AYM1 3MFCA 2BWCA 5AVPA 2QQOA 1DP0A 2HDWA 1DYPA 2JE8A 3RI8A 1CF7B 4OI1A 4HZFA 4BHCA 3L9JT 3ES4A 1WGPA 1L7QA 2P34A 3WHCA 2WT0A 1QJZA 3UKVA 1RHI1 1ASJ2 4XILA 1TNFA 4AVSA 3K3NA 2WT1A 1V0AA 5IT9Z 4QD2A 1LEAA 2HEWF 1BOAA 1APLC 3OJBA 1MMDA 4UBHA 5HV0A 3M3CA 1JS9A 5FYIA 2SLIA 2HBUA 1BVP1 3HUGA 1X36A 1FOWA 1EF4A 3HOZJ 1VBD2 1NLQA 1U8BA 1A35A 1UY1A 2G9ZA 3INAA 2VT2A 1E2XA 2EB7A 2W1WA 2NN8A 5A6ZA 2K9QA 3WT3A 4UUVA 2FBEA 3ZXEA 1PO12 1APNA 5FYTA 2IA0A 5FZBA 3GCWA 4NHXA 3VDCA 1AYM2 5BNNC 1R64A 1FMD3 3FM5A 4FPLA 2ZEZA 3EPZA 4BQ5A 3GBWA 2BYVE 3MD2A 4DRRA 3R6SA 3OR2C 1ZZC