3FX3A

Structure of a putative camp-binding regulatory protein from silicibacter pomeroyi dss-3
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
223
structure length
218
Chain Sequence
HEAQKAIARNSLLIRSLPEQHVDALLSQAVWRSYDRGETLFLQEEKAQAIHVVIDGWVKLFRMTPTGSEAVVSVFTRGESFGEAVALRNTPYPVSAEAVTPCEVMHIPSPVFVSLMRRDPEICISILATTFGHLHSLVAQLEQLKAQTGAQRVAEFLLELCDCEVTLPYDKMLIAGRLGMKPESLSRAFSRLKAAGVTVKRNHAEIEDIALLRDYAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a putative cAMP-binding regulatory protein from Silicibacter pomeroyi DSS-3
rcsb
source organism Ruegeria pomeroyi
molecule tags Camp-binding protein
molecule keywords Cyclic nucleotide-binding protein
total genus 65
structure length 218
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fx3A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3fx3A01
1R58A 2VQAA 1H0MA 1ZG3A 2VC1A 4MQ9F 1ZRFA 3TQNA 2QQAA 3SZTA 4AD9A 2P5VA 2GA2A 3KGZA 4PGGA 3ZPLA 4JVAA 1ZZ7A 1K78A 1TQMA 3ZN1A 2V09A 1O5UA 2H27A 2LF8A 4L9VA 1Q1HA 2FBHA 4JBAA 4GYGA 4G7ZF 3LOIA 3KLOA 2CSOA 3QAHA 4EM2A 4IHTA 4AVBA 4KMUX 2HKXA 3SQNA 4EJWA 3R6SA 2ZMEB 4IEUA 3LZZA 2MA3A 1YIOA 2DK5A 4TLFA 4CZZA 1B59A 2Q0OA 2KXLA 1ZVFA 1DP7P 3F22A 3LAGA 3ECHA 4DNCA 5DCMA 1J58A 4JK1X 2H0VA 2VC0A 2MLKA 1ZZ9A 1P6RA 4MUVA 3C1DA 4RB2C 2A5YB 3WTZA 5J8FA 2Z2SB 4IEYA 4KUMA 3F3XA 1EP0A 1MJ9A 4MEXF 3OF1A 4RGUA 3JSOA 1UHWA 5F1RA 2ADUA 3EHKA 4RS8A 5F6FA 4Z07A 4CICA 2CGPA 4MZUA 4Y13A 3WGHA 4BH9A 1UIJA 3EUHA 2HTJA 1SFXA 3SZPA 4GXOA 3RPUA 4RGRA 3M3IA 4IRGA 3RTRA 4Y15A 1D8JA 1G4DA 5EEGA 1U2WA 5E16A 4XFFA 3JAMK 4YFNF 3BB6A 1FBUA 2QVSB 3DXJF 4ZZLA 5AIQA 1WI9A 4HVOA 4HLYA 4XFCA 2EJRA 5L3GA 2PMUA 3HT1A 2N7GA 1TTYA 5A2QZ 1IAWA 1ZREA 3KE2A 2VECA 2O0YA 1FZPB 1RTVA 4FX0A 2Y0OA 2O1QA 1YLLA 1O3QA 4MH0E 4PZJA 4L0YB 5FLJA 2GH2A 3GF2A 1TQIA 3M9AA 5FO5A 4O3MA 4WBBA 2LKPA 3TGNA 2MC3A 1WA4A 1G3TA 3LWFA 1SD7A 1QNTA 3GVAA 3KP3A 4HV5A 1ODDA 2PBIA 2YX7A 4O9GA 4HSJA 4Q0UA 2NYXA 3WTYC 5BPIA 2MHFA 1LEAA 5H6QA 2P17A 5FGMA 2F5FA 1QO0D 4WCGA 3ZN0A 4KWJA 5CADA 3KEOA 5H20A 3CTAA 1Y3TA 5L3EA 5DCMB 3NVCA 1O7LA 2L01A 3NL1A 3I58A 1B9NA 2DPDA 5EZWA 2DAOA 3FHZA 4ESJA 1E2XA 3OGJA 4HW0A 3T0YA 5KK1A 1RIOH 2CAVA 4QGMA 4PIXA 3GEZA 1XMKA 1LQ1A 3D5LA 2XLFA 2A07F 3I59B 4EWDA 3BY6A 3I0TA 3TNPB 3C3VA 1YTYA 3HRMA 2OQRA 4XETA 1B6AA 1P4AA 2CYYA 3KGLA 1J1LA 5J8CA 1J0RA 3WG9A 1FXZA 2QNKA 2V1UA 2HFHA 1J59A 4KICA 3EO6A 3KP2A 1FYKA 4B09A 3GW2A 1LDJA 2FE3A 4ETSA 3ES1A 2IXIA 2BGCA 3M8EA 3GFJA 4TV7A 2PHLA 5E1WA 1ZLJA 3WU0A 4HLTA 3CLOA 2LSOA 5HDNA 2XAFA 2O03A 4Q4ZF 4YSFA 1ZGAA 1XB4A 3ZMTA 2EAAA 5CVIA 4LLNA 1P92A 3WTUC 3RI4A 3RYKA 5FLIA 4G7OF 1S8NA 3KP5A 1JE8A 3KLNA 1HW5A 4IERA 3OOPA 4U88A 3ROUA 3HUGA 4LK1F 4OIOF 2HJIA 2OBPA 2H6BA 1RL3A 3HOSA 4A12A 1NZCA 2MH9A 3VHRA 4A5NA 3GZ5A 4JV4A 1HKSA 2YX4A 2XRNA 1J3RA 1O5LA 5L3DA 1ZRRA 2IPQX 3H1MA 1O3TA 2F2EA 4OFGA 1Z6TA 1IXSB 5C6CA 3R0AA 3GFIA 2GC3A 1QY4A 3HRUA 4HYEA 3C18A 3SCHA 4A0ZA 4G9YA 2ZFWA 4RAZA 5FLXK 3P7NA 4IVNA 4IETA 3I5UA 2A69F 3L7WA 4EJUA 5BPDA 2HOEA 5JI6A 4KNYA 4ZYDA 1TNSA 3BPVA 1IN4A 1DPRA 3BWGA 2QWWA 3RYRA 1JUHA 4KL1A 3O2PE 3K2ZA 1HBXG 5FQ0A 4M73A 3ZMZA 3ZQ7A 3O3KA 3FF5A 4Q0SA 2PLYA 3M1EA 5DDGA 2J5OA 2G7HA 1U5TA 2B5HA 2X4HA 1HW1A 2BV6A 2GC0A 3NQOA 5J6XA 2BE5F 1XN7A 2ZMEA 3REOA 2FQPA 4KU7A 3R0JA 3SHFA 3MAJA 3GUDA 3G3ZA 4HBNA 1ZZBA 4GULA 4LG0A 1LB2A 4AIKA 4WXCA 2XHKA 3F72A 2QCSB 2GIVA 3H92A 2D93A 1X8MA 3DPTA 5I0TA 1U12A 4QGNA 1FOKA 4Q47A 2IVMA 4YG2F 4OOIA 2VN2A 3WGGA 2F5CA 4MHGA 1ZYRF 4OLLA 3H7YA 2B8MA 4QMAA 3K1PA 1DUXC 2MNGA 4AVCA 1QZYA 2D1HA 3JTHA 1K6OA 3U10A 2HKOA 3L2HA 2DTRA 4M9XA 3GO5A 3T1BA 1YW8A 1T0FA 4XLPF 1XGMA 2PYTA 1TW3A 1PP7U 1J3PA 2IXLA 1B9MA 2IRFG 2QBYB 1ONVA 2PJPA 3DPLC 4PCQA 4ZH4F 4ZYHA 2EA4A 2ZJ2A 3E6DA 2ATFA 5K5RA 2CAUA 3KP7A 3HHHA 4A0XA 4MTEA 2IP2A 3NJZA 5ICFA 1BC8C 2I45A 4I02A 1NHAA 5KHIA 5BUVA 1DGRA 2E1NA 1UD1A 3BCWA 2V6CA 4HN1A 5AONA 3OV8A 4META 2E7XA 2OPKA 3MQ0A 4MEYF 2FMYA 4KWKA 1GXPA 2HYGD 3D0JA 1FBSA 1FY7A 1SD5A 3MZYA 2RV8A 4L9JA 1O4TA 4L2NA 1MJAA 3MZHA 4BNCA 1C0WA 4YFXF 2Z9OA 3CJXA 4AVPA 1FYLA 3PLQA 1OYWA 3RKWA 2P6TA 3E5QA 1UPIA 1USTA 3BOQA 2VE8A 3WE3A 1SAXA 4PIYA 3EQLF 2PAEA 3HT2A 4KIFA 2D1VA 2DQLA 2GC2A 1UB9A 4MGZE 5BY5A 4KT5C 1HKTA 1QPMA 1CAUB 2XIGA 1DGWA 2XROA 2IC1A 1KQ8A 4IRIA 4X6RB 4P9GA 4WXDA 1FP1D 1H9TA 3DF8A 3D82A 5BMZA 2ESHA 3HSEA 4LJZF 4ZU7A 1WLTA 1R7JA 3SFZA 1OKRA 1IRFA 2G9WA 3L9FA 3F8CA 2WWYA 1QXRA 1FI2A 2FOKA 1XMAA 2FBKA 3VOEA 4NVPA 5D6EA 4FT8A 4EGZA 3FJSA 5ICCA 3H7JA 2L02A 5BS6A 4RAYA 4HDUA 3O14A 1CAUA 1OFNA 1HSTA 1KA8A 1YUDA 5TJJA 2QYOA 4KA4A 3U11A 2HDCA 5D5XB 5LLQA 2OQGA 4HBLA 3H1YA 3BPZA 4I2OA 2FXAA 3BZ6A 3CJNA 2EB7A 1ZRDA 3CLPA 5JFRA 4A2UA 4FAGA 1MZBA 1QWRA 3WW2A 2QLZA 4HX8A 4M6XA 2UYAA 3KFWX 3BJ6A 4E70A 2ZO4A 2LF7A 3RJPA 3FZVA 2Y75A 4MGYE 1G6NA 2COMA 3BROA 2ZKZA 4AIJA 1JXSA 5K5QA 1F5TA 1MDMA 2WFPA 2XKOA 2W57A 4BQAA 1A04A 2DPUA 2EA2A 3N97A 4AVAA 1BI3A 1E17A 2H94A 5DEQA 4OIPF 4XF9A 2FF4A 1LDDA 2FSWA 4ENMA 2A61A 4XSZF 2ZXJA 4HF1A 1X8EA 2VBYA 1XRUA 2PEXA 4BIFA 1IPKA 4FAHA 4YIIA 4UUVA 2VPVA 1BJAA 3OTFA 1RZ4A 4O5VA 3S7EA 4Z82A 1R5GA 1XGOA 2V9VA 4LMYA 3TOBA 4BHCA 2W84A 3QPHA 1S7AA 2IJLA 1R22A 1DZRA 2M87A 2DFIA 1GHCA 1J9IA 4U0YA 3ST7A 5D4RA 1VP6A 1EH6A 1RI7A 1OMIA 3E5XA 4CGZA 2UZKA 3TDZC 4YYOA 1CX4A 1MDMB 2ETEA 4N9HA 2EVXA 2EWNA 1KQ9A 1QZZA 4XF4A 1HKQA 1H1IA 4F8AA 2XAHA 1IN6A 1U8RA 5ED4A 3WODF 5HOOA 2NNNA 4KDPA 4KIBA 1XGSA 2C0ZA 4RB1A 1EH8A 1AWCA 3T8RA 2M45A 2KKOA 2FEZA 2QM3A 3FM5A 5K8SA 5DD4A 2OAZA 1PUEE 1X82A 2P5KA 2UWMA 4ON0A 2UXNA 2UXXA 4IRHA 4KN4X 5IT3A 3QP5A 1YHFA 4QX5A 3V8JA 3H8UA 5E8GA 1J5YA 1NE6A 3PVBB 5BXXA 2ISZA 4IF4A 4L0ZB 4I01A 2UY8A 4AQ6A 1UIKA 1YFWA 4M74A 1TQ5A 2NAZA 4OU0A 1XDUA 3ZMSA 1F9NA 2DO7A 2BYVE 2P7VB 4IESA 1U5TC 4QM9A 4UXAA 4IXAA 1I5ZA 3EYYA 2PI0A 1O57A 3SMHA 1UFMA 2ZKLA 5L3FA 1UW8A 4A6EA 2K4JA 4E2QA 2E7WA 2O8QA 2V1XA 5E18F 4FX4A 5EFUA 1KYZA 2NS0A 1CAVB 2B9UA 4IEZA 4M9ZA 1TBXA 3FMQA 1WGPA 1VJ2A 1T98A 3ML6A 1CAWB 3K9TA 3O6BB 3H50A 1U5TB 2RQPA 5KHGA 3MDPA 3HSFA 5BQTA 3E6BA 1J7KA 1HXDA 1STZA 1LVAA 1IF1A 2WTEA 2PN6A 1FNNA 1OYIA 4S05A 5HI0A 2K02A 4WWCA 5T3NA 1DZTA 3P9KA 4XBFA 2JRTA 1I1GA 5L3BA 5DV5A 1LJ9A 1R1VA 3IWZA 1JHHA 5BPXA 1R1TA 4UBGA 4LLOA 4A6DA 1XGNA 1GVJA 4L9NA 3NW4A 2W24A 4LLLA 1FSHA 5FB2A 2BBYA 1ULYA 4WZCA 3GYHX 1SQ4A 4I0BA 5C8WA 4R8HA 4D0PA 1ZAOA 3M70A 1I6XA 4X6QB 1FP2A 4Z2YA 2QQ9A 4HLXA 5LHGA 4G6QA 1I27A 2JPCA 2YPRA 3ZMDA 1ON2A 3C3WA 2IXHA 1T6SA 2PA7A 3VODA 2IXCA 2W85A 2HZTA 3LAJA 2VBZA 1FX7A 5K1YA 3RYPA 4EQQA 5JR3A 1U78A 2HWVA 3PNAA 5D8LB 4XF1A 2ELHA 2WC2A 2XAGA 2ZCWA 3F8NA 5LRSA 3NEUA 2ESNA 3R60A 3BU7A 3QPTA 3WTSC 4BXUA 2FNPA 2RC4A 2YU3A 1X3UA 4MV2A 1G3SA 5E1XA 3V4GA 1LNWA 2Q2EA 4D7SA 1DPUA 1HSJA 4HVQA 2M8EA 4L5IA 2QDRA 1R1UA 1YS7A 2Z33A 4MGIE 3JSPA 4ZU4A 2FQ3A 4EMSA 4HVRA 4LB5A 2XL7A 1X7NA 4IPAA 3IRRA 4N9IA 4K8FA 3KZZA 5HLGA 1CAWA 3GBFA 2E1CA 3SCFA 4YRDA 2Q30A 2ETHA 4K2EA 1K78B 1CGPA 2HYFA 3KETA 5JHUA 2VBWA 4L11A 2DQRA 2EV0A 4QGLA 4XLNF 5TRDA 1QGPA 1ZLKA 2V1DA 4LGWA 5E20A 3KP6A 2BNOA 5JSRA 5LBQA 3LFKA 2L4MA 1T38A 2OU2A 4IJAA 5IT9Z 1S3JA 1MJBA 3COAC 3ZDSA 4ORFA 2MH2A 3FM3A 2PFBA 2ISYA 4M9SA 1Z1DA 5ERIA 4AXOA 1XDSA 2P4WA 5DYMA 3WTVC 2XAJA 5D5VB 2UYBA 2A68F 3ELNA 1MKMA 3VEPA 2KRFA 1Z7UA 4R79A 3J80Z 1F4KA 4CDGA 4UXNA 5JSOA 5H6RA 1FYMA 2DBBA 5JR7B 4XSXF 2CFXA 1UHMA 5FD5A 3U9GA 2RNJA 1FSEA 2PTMA 1EY2A 4R1HA 3FE5A 1CAXB 3BALA 2H09A 3S0MA 3CUQB 4MGRA 2V79A 4PIZA 3F8MA 2EV6A 4KN7X 1Z91A 5FCCA 3H1WA 2IXJA 3QACA 1ON1A 3CO7C 5D6FA 2PG4A 3R4KA 5HDKA 4LB6B 5ICGA 3M7GA 3HSRA 3V8LA 4WK8F 3FXUA 2XLGA 3JZVA 4WVZA 4FHTA 3OCPA 4EM0B 2MD5A 3HTSB 2CWEA 2IT0A 3LA3A 4ASNA 3IIAA 3CDHA 4BHPA 1JHFA 2O3FA 4PJYA 4I7HA 1CAXA 3ECOA 3FZ3A 5CVVA 4AWXB 1EV7A 1S29A 4MQVA 4KMFA 3GFLA 2VE9A 2QJVA 3EYIA 1ZG5A 3DQVC 3TNQA 3B73A 2HGCA 5LEKA 3HTUA 1J3QA 2P8TA 1KU2A 4U0VA 4HX7A 4XEZA 3G7DA 3I71A 4RD7A 1KU9A 3TOAA 4EWAA 2Z69A 3NRVA 4XF0A 4MTDA 1L3JA 2R7FA 4HF0A 3TKYA 3IRQA 1HQCA 3KSCA 2RKHA 1D5VA 2NNYA 1WSUA 3JAMZ 3DFGA 2O8XA 1P2FA 2OZJA 2PMHA 4WX9A 3V8KA 6PAXA 2B0LA 3WU1B 4L5JA 4RB0A 1ZHFA 1LEBA 2XKPA 4Q0QA 3F8FA 5HS9A 2L4AA 2FBIA 3QOPA 2JPBA 3LWCA 1V70A 1Z6RA 2L3DA 1Q43A 3JW4A 4LEJA 3RIRA 2PAKA 3VB2A 5FLXZ 2H6CA 2K9ZA 4QXKA 3E6MA 3I59A 2VOPA 2CO5A 2VOOA 3BPXA 3KMHA 4M72A 1KU3A 1PP8F 4LLGF 3QRFF 4UVBA 3CEWA 3L2CA 5LGNA 1EYBA 3MFKA 1YLFA 3BJAA 3DL3A 1MGTA 3FXQA 5CVUA 2JSCA 3U1DA 2EA7A 4G94A 3RZZA 4OIQF 3B02A 2L54A 3ULQB 3P9CA 5LGTA 1YS6A 1XCVA 3GLXA 1OI6A 1SD6A 4I3PA 4KIGA 3FWEA 3IDCB 1UCRA 3IWFA 2FNAA 2Q8KA 2D45A 1BN5A 1OYYA 5D5UB 1QXJA 2HQRA 4CO8A 3ERED 3FMRA 1REPC 4LUKA 3IKTA 1H1MA 4RB3C 2A6HF 4G6DA 4HZFA 2PHDA 5I8TA 5A2QK 3IDBB 1ZH5A 3RKYA 4XFBA 3FFQA 3DKWA 3H3ZA 4XFGA 4M71A 1KGSA 4HA8A 4IEVA 4Q5SF 1WRJA 1OPCA 1BM9A 2EK5A 2M5WA 4NB5A 2GAUA 1TNTA 4AQ2A 2P6SA 2HS5A 2OZ6A 4J1WA 1KQ0A 1IZ1A 4B8XA 5E1ZB 2FU4A 4ONUA 1CF7A 1SFNA 3L09A 5FDBA 5FFXA 1PMIA 3JTGA 1VR3A 2D5FA 3FXRA 1FPQA 2A3SA 4KFCA 3DV8A 4LK0F 3MPBA 2Y48A 3MCZA 1P4WA 5CLSA 2YSRA 5D4SA 2XVCA 4OINF 4MNUA 2VXZA 5LHIA 3ELKA 1YO5C 5CVJA 1SD4A 3D0SA 4HV6A 4KWLA 5BV6A 1G3YA 1XSXA 2TDXA 4HX4A 2RDPA 5LHHA 4N0BA 3F21A 5I0SA 4H7LA 1ZN2A 3SXYA 3MEXA 3BP8A 3TO6A 1S7OA 5D5WB 1R23A 5DUIA 5J7MA 1V4RA 4RGXA 1ZNPA 3E6CC 4IEXA 1W7PA 4Y17A 2XGXA 3HOTA 3Q9VA 5HVQC 2STTA 2Q1ZB 5LEJA 4GYIA 5KVRA 2IA1A 1BIAA 1IN8A 2LDUA 2Z3YA 3KZYA 1BI1A 3I7DA 1XE7A 3NKTA 2VT3A 5E8IA 3GXOA 3WW1A 3CUOA 3CO2A 4CXFA 3KP4A 4JQFA 1BI2A 3BJOA 1RUNA 4KU8A 1JGSA 3F6OA 3S2WA 2AS5F 4FBFA 4GO1A 5DD8A 4UVCA 4A5MA 5I93A 4U7BA 5KBFA 2VBXA 3IC7A 3CUQA 2VONA 4EV0A 3W6KB 4Q0PA 3WW3A 3EDPA 4ENNA 2DU9A 1UCXA 4CYDA 3HRSA 5KHKA 1I1SA 2CQKA 4YFKF 1GXQA 3IKVA 4EGYA 3WW4A 2ACJA 5AVPA 1BOAA 2E9QA 4LULA 2EFQA 2M1BA 4ESBA 1ZRCA 2RVCA 1PM7A 1WKMA 1IUYA 4QLCU 3G73A 2R3SA 1Z05A 3F23A 1IN7A 2DCTA 4LFUA 2XAQA 4UBHA 3VFZA 4A0YA 1U3EM 2RGVA 3USSA 1AOYA 3EBRA 1CAVA 1P4XA 3HQXA 1D3YA 2D5HA 1YW9A 4YARA 4UV9A 1B1BA 4HOBA 3MYXA 4U0WA 4HN0A 2A6EF 3UKNA 1IRGA 3I53A 4EVIA 1LRHA 3U2RA 3I4PA 1S6LA 2F5EA 2KJCA 3HRTA 3GYDA 5HLHA 3CUQC 4HQMA 2GZWA 2HR3A 4HMZA 1USSA 1ZGJA 1FT9A 4P96A 4ESFA 4XRFA 1QQIA 3LA7A 2QENA 3EJKA 4EM1A 1NYWA 1EH7A 2IXKA 3M8FA 2Q4SA 5FQ0B 4WF2A 3TO7A 2K27A 3ES4A 3CF6E 4PDKA 2QVOA 2F4PA 5CJ9A 5BOXA 3SHRA 5I91A 4DQ2A 2GXBA 1FC3A 3T5XA 2ZBKA 2EFNA 1Z9CA 1LKNA 4PGHA 3AAFA 3NSTA 1ZARA 2M30A 1R36A 1O3RA 3K1NA 5CYVA 4P55A 5HS7A 3QU3A 3K69A 2O6GE 4UV8A 4LG0B 2KJBA 2OA4A 3GX4X 2BNMA 3RKXA 1O7FA 3DN7A 4R52A 3U0ZA 2PQ8A 5DUKA 3KCCA 4ENJA 2ET7A 4L18B 3WTTC 1V3FA 4EJTA 2GA1A 2VODA 1XSDA 3HHGA 4J1XA 3ISPA 3QU6A 4P9FA 1R00A 2XV4S 4F7ZA 3V7CA 1TW2A 2JT1A 2HTSA 3F8BA 2IA2A 1YFYA 2EFWA 2K86A 1PDNC 1HW2A 1MD0A 2JZYA 2OA2A 3J81Z 1XSVA 5HLIA 5J48A 4GCVA 3WGIA 3ABUA 2ZNZA 4LD5A 4H0EA 3WE2A 1YFUA 4NQWA 2R7DA 1KYWA 1TQPA 4IEWA 5EEHA 2BNNA 3E5UA 2STWA 4HQEA 3ABTA 4I98B 3GWZA 3H3UA 1GQGA 5FFZA 4WXHA 2LNBA 1YYVA 5I8YA 4OIRF 2OD5A 1ZZCA 3UKVA 4BYYA 3P9IA 2KIUA 5DCFA 2DW4A 3RDIA 5FLHA 2MLGA 4LTAA 3V7RA 5FD6A 2Z99A 1XCBA 1YWKA 4CHUA 5IT9K 4LUMA 1BI0A 1RNLA 4EJVA 3F6VA 3J7AO 3SCGA 1T2KA 1CF7B 3ACLA 4BHBA 5ILUA 1Y9QA 2K0GA 1IW7F 2IW5A 3OD0A 1Y0UA 3V7SA 4HF2A 4KYWA 4JTNA 3HIFA 2PQQA 1SMYF 1YFHA 4ZZDA 3ZMVA 4JTOA 1RGSA 5JSPA 4LA2A 2PFWA 2QUFA 5L3CA 2DI3A 3KEQA 2OZUA 2QZ8A 2HEOA 2P5LC 2EV5A 1EPZA 1TLHB 1D8KA 1J2XA 5D1IA 1XD7A 2GQQA 1K79A 4L9TA 4B29A 1L0OC 3MWMA 1IXCA 1BIBA 3SXWA 1SMTA 1FWZA 1R5HA 5ILVA 1Q5OA 5E1RA 2MBFA 2J5PA 1NE4A 2EFOA 1WWXA 4YIFA 3RNSA 1T39A 4IEQA 4HAMA 2QQBA 2KIMA 4S04A 1NXMA 2P7CB 3BDDA 3LQQA 4ZU5A 5F64A 5JVTA 1GQHA 1SEFA 2WV0A 1W7PD 3WTWC 1IN5A 3W6JB 2ZNYA 2KIFA 1YFXA 4G8XA 3C7JA 2O61A 2HQNA 2F5DA 3LSTA 5I0UA 1XE8A 3R61A 3ZP5A 1RC6A 4XF3A 5D8KB 1QBJA 4QWQA 3IHUA 2XLAA 4P5OA 5I0RA 5J3UA 5FPXA 2DK8A 4XFHA 5FPZA 3Q5FA 1KU7A 2AXLA 1OR7A 2D2WA 1L3LA 5KHHA 4Q29A 5HDGA 4MGKE 2VT2A 4AIHA 4XFIA 1SFEA 2NRAC 2UY9A 5E17F 3EQEA 1W5TA 3FMSA 3DP7A 2Z5UA 4I09A 1J75A 2D40A 2CG4A 4M6YA 5LRRA 4YNIA 1LR5A 1DDNA 1ZG1A 4HDVA 3ETQA 4I0AA 4ZYEA 1W7PB 4UNOA 2CV6A 4ZYGA 1SFUA 4QM8A 1LDKB 2FA5A 3E3VA 4O6JA 2QBYA 3QP6A 3EETA 2C6YA 3ZMUA 3I64A 3T8TA 3L00A 3H9AA 5ILSA 4OMYA 3GFMA 1K7AA 5I8SA 3PQKA 5LGUA 2K7LA 3LAPA 4MX3A 2MPFA 2FRHA 3TDUC 3CL1A 1BC7C 2GC1A 2GWRA 4Q48A 4D7TA 5HS8A 2G7UA 3N4MA 4XFAA 3RPQA 1W4MA 1WQ2A 4LA3A 3FHIB 3S7IA 5KHJA 1G3WA 2JTVA 1ZX5A 5ICEA 1OD5A 1IXRC 3HYIA 4IEPA 1YW7A 3K1MA 2GXGA 2Q0AA 1H9GA 4IHSA 2PAMA 4OMZA 4EWEA 3Q9SA 3J81K 3IBMA 4Q0VA 2YR2A 4EJOA 1FBQA 4BAYA 1Q3EA 2Y0MA 4E2GA 3PFIA 1YQAA 2ET1A 3GZ6A 1ZZ6A 4NHJA 2DLLA 2W25A 2X0LA 1YG2A 2OYZA 1B4AA 4G7HF 1U6GA 3K0LA 5JAXA 2BEOA 5AIPA 5CVRA 2CW0F 3DEUA 3J80K 4GGGA 1F1ZA 2EFPA 2XUBA 4P9UA 5JCTA 3WTXC 1FLIA 4HSLA 5CU1A 3CO6C 2IA0A 3UKTA 1RUOA 1O3SA 3PQJA 2DT5A 2RN7A 4UHTA 4UVAA 4ENKA 2XL9A 1W5SA 1BBYA 4IEOA 3IL2A 3E97A 3LQRA 3I54A 3FX3A 1VTNC 1IPJA 4EROA 4O9EA 4E2SA 3TO9A 2XASA 2FMLA 4RGSA 4U7DA 2GU9A 3LA2A 2K4BA 1ZZ8A 4DINB 5K5OA
chains in the Genus database with same CATH superfamily
1URXA 2VQAA 2CWMA 4RN5A 4MQ9F 1ZRFA 3VD5A 3U1XA 3HM5A 3AFKA 1JODA 5C3QA 3ITQA 1W2AX 4PGGA 1ZZ7A 3FMGA 1K78A 2H27A 1S9HA 4QPIB 4L9VA 4NE9A 3T0BA 3KLOA 3B7MA 2CSOA 3QAHA 4IHTA 5FK7A 3HPHA 4KMUX 3SQNA 2XB6C 1NLRA 2JSPA 3WZ1A 2RR12 2A05A 2GOMA 1DP7P 2C9KA 3TEZA 3VZMA 1UU4A 1TNFA 4NMIA 5D2AA 1PX4A 2R7TA 2H0VA 5GPCA 1RUI2 1X4PA 1SDDB 1MZEA 3RZDJ 3EB7A 2ZC2A 4K6BA 2MLKA 5M3MJ 4MUVA 1NZIA 4GWMA 5F0HA 2WAOA 2CMPA 3GHMA 2PN5A 5FY5A 1WBLA 4K40A 1EP0A 2WNUB 1HLVA 5L36A 3OF1A 2E2IJ 1UHWA 5F1RA 2KZGA 3N05A 1PVC1 1SFPA 2QQNA 4RS8A 4Z07A 4CICA 1Y7BA 1PVXA 2DXIA 1US3A 1GLHA 4COWA 3H5AA 1ERDA 1UIJA 2COBA 3M3IA 5JHFA 2EZLA 1JZ8A 1GU3A 5IVFA 3DWLE 1LE8A 3ECQA 1AL23 3ZFFA 4YFNF 1UY2A 4C2TA 2HVRA 1S0FA 4FFGA 4LHKA 5AIQA 1WI9A 1IS4A 4XFCA 1VBC2 2EJRA 1PO22 5FP7A 4RLFA 2PMUA 4PLMA 3ABKH 5T54A 3HT1A 2P5BA 3M1HA 3PVOA 3BGAA 1RTVA 2DT7B 1R081 4BQ1A 3N9NA 4YZ5A 3ATGA 4MH0E 4PZJA 3WF2A 4KT6A 1QDCA 3VBHB 4L0YB 3M9AA 4WBBA 2LKPA 2G9FA 1XX5A 2MC3A 1G3TA 3ZSJA 1NLSA 1SD7A 1TWFJ 1ODDA 4C9YA 4FOQA 2PBIA 4O9GA 4HSJA 1XXNA 4CP1A 3O1UA 2V26A 5BPIA 1W39A 2RMU2 3TAYA 5DQ0A 3DXUA 3BTCA 4UW3A 2CHHA 1HV0A 3ZN0A 5F3CA 4RA2A 2EIBA 3BU0A 1UMZA 5E89A 1YIJI 5HODA 3DYOA 5FYHA 3B69A 5FZDA 2ID3A 4FISA 3PJYA 2DPDA 4L8QA 4IV3A 3MI8A 4XN0A 4BPZA 3Q0UA 2ZJPF 4ITVA 4YZ4A 2XLFA 3MIEA 4I30A 3I59B 3BR3A 3I0TA 4OI0A 3HRMA 2OQRA 4XETA 2YB7A 1P4AA 1XJAA 5ABJA 2I2SA 2BWAA 3I2KA 1JYIA 3TW7A 3WG9A 1FXZA 1QJX2 3D3AA 5F3IA 3EO6A 1MMGA 3I2FA 1LDJA 3NNGA 1W36C 1G9AA 2Y9YA 3GFJA 5CBLA 1RUE2 1QHHD 5E1WA 4E6KG 4HLTA 3HC7A 4XW3A 2LSOA 2V4AA 2O03A 2JE8A 4YSFA 1WW7A 3OBTA 2EAAA 4LLNA 1P92A 3RI4A 5EZHA 3TL4X 4G7OF 4COYA 2GMPA 3CC4I 1D0GA 4ZXKA 1IC8A 4OIOF 5LATA 2WZEA 4Y1VA 1I3QJ 1VRBA 5F1JA 1UYPA 4QKBA 1VBE1 2MH9A 4A5NA 3FLTA 3OG2A 4LXLA 2HOSA 2JVGA 1J3RA 5L3DA 2IPQX 1O3TA 2F2EA 1X2NA 3GFIA 2E51A 2GC3A 4AI9A 1UZZA 5ISLA 1V5EA 1QH7A 5E3OA 4TN7A 2QQMA 5JOYA 3C18A 3SCHA 5JUVA 4DOUA 4DYCA 3AFGA 3G2BA 3O1SA 2ZGQA 3K4DA 5M5XJ 3H9QA 1GWMA 4CCCA 3SFIA 1NY72 4IV3C 1W8HA 2ICWG 3BWGA 4C2UA 2Y6LA 1WH7A 2K40A 1HBXG 2E26A 4NRPA 4AU7A 3ZFEA 3O3KA 1H8AC 3SYTA 2WYSA 3S6PA 2J5OA 3PIJA 2GC0A 3NQOA 1XN7A 3JB8A 1UY1A 1PVC2 5JZGB 2BW3B 3VZNA 3PIGA 4RGGA 5EYYA 3MIBA 3MAJA 2QEXI 3GUDA 3LSDA 1GWLA 4LG0A 3WY6A 4GD4A 1QXPA 4WZFA 4D7NA 1LHVA 1RUG2 3CMMA 2QCSB 4IHYA 1X8MA 2SLIA 3KB5A 3HDDA 4QGNA 2IVJA 4Q47A 2IVMA 4P1WA 4YG2F 2GM4A 2VOXA 2F5CA 1MS8A 2B8MA 4AVCA 5EDNA 3OSFA 4LBKA 2D1HA 1KS4A 4HOOA 5C9AC 5FUIA 5ACA1 2VQLA 2F4OB 4M9XA 1Z7S1 3GO5A 2VC9A 4IE0A 4CCOA 4XONA 2P4EA 1XGMA 2PYTA 4KJZA 3MUZ1 1LE8B 4XURA 1D1BA 1XS9A 2IRFG 2W4SA 2G9GA 1TMF3 2JEMA 3DPLC 3G71I 3IAPA 5FKMA 1UX7A 4UT5A 2EA4A 1CQ9A 5IFPA 1MBKA 2ZJ2A 2CAUA 3KP7A 2RMU1 3AVRA 3LEMA 1ZK8A 2ZJRF 4UUSB 4JX0A 2DVBA 1DYOA 2Q2EB 5BUVA 1UD1A 4CZCA 1DHKB 1QU0A 2V6CA 2UURA 4HN1A 4P5YA 4META 2E7XA 2QQKA 5BNNC 2FMYA 2PELA 1JKRC 4LE4A 2OQ6A 3OGSA 4DY5A 3MZYA 2QQOA 4GB31 3C2UA 3MZHA 4Y1UA 2FCUA 4QB1A 3HEIA 2Z9OA 4W8JA 1JXNA 4MFEA 3N9LA 1FYLA 1OYWA 3PDQA 1HB2A 3E5QA 2WNUA 1UPIA 4NHMA 1FMVA 3H0OA 4A7KA 3EUKL 1PO11 2E63A 1UHSA 4PIYA 1G59A 1W9WA 3VBOB 2RQQA 3HT2A 3ZN6B 4KIFA 1ZBE2 2QSGX 5BY5A 3FHNA 1PGW1 1UYZA 5F08A 4X6RB 3IPVB 4WXDA 2A75A 1FP1D 1H9TA 4A3DJ 3D82A 2E2HJ 3UESA 3MIGA 1W9TA 5LBBA 1J09A 3HSEA 1NQJA 2LREA 2CFOA 1WLTA 3NMBA 2G9WA 2D44A 3F8CA 2WWYA 1QXRA 2VCAA 3LIGA 3VOEA 2OF7A 1YC61 2QQJA 1D0ZA 3FKIJ 4RAYA 3VKOA 2WO3A 2L9LA 1ODNA 2KFDA 3DBHB 4Y1ZA 1OFNA 1KA8A 1XNKA 1YUDA 3Q8FA 3ZXJA 2QYOA 3UGGA 5JXGA 1TT0A 2B9SA 2XOMA 3BPZA 3RFRA 4D0QA 1MQTA 4XQWA 2EALA 1BEV2 2E19A 1WHUA 3ZXSA 2D43A 1E3PA 3AMHA 4CDUC 4BJTA 4A2UA 4FAGA 1BXHA 3T2QA 3BR6A 1U9OA 1AF9A 1J1TA 4C0HA 3Q8CA 2QLZA 4BBSJ 3BJ6A 2ZO4A 3GZAA 2LF7A 4P9XA 2B42B 4BBRJ 1OLME 1QVUA 2Y6HA 1G6NA 5K9YA 1MS4A 1JXSA 2ID6A 5K5QA 1SVMA 1VQMI 5IT6A 2Y31A 2W57A 5FY4A 1W9SA 4GXLA 4PHZA 4Y1XA 4AVAA 1F36A 5D8AB 3PTYA 2C4XA 2TRTA 4XF9A 4JCKA 3JUUA 3O0XA 1RETA 2VBYA 2XONA 5DMYA 4YM3A 1CWPA 2V9VA 4BHCA 3TOBA 1RXGA 2VBBA 1S7AA 3CDZB 1DZRA 1PIV3 3K3OA 1GHCA 4U0YA 1VP6A 4CGZA 2BVVA 3ZFEB 5HXVA 3ZQCA 1CX4A 4RLQA 4GMP0 2YS9A 3DLAA 3OL3A 4HEA2 1T33A 4XF4A 1D4M2 1PMHX 4JGZC 4OMDA 4F8AA 2XAHA 3NV2A 1OA3A 2AC1A 1OLTA 4IQ4A 3TP0A 1HF0A 3W2AA 1L7RA 2B39A 3BQYA 1IGNA 4RB1A 1EH8A 5A70A 1LHWA 4EN6B 4CCMA 3UYJA 2OAZA 2AACA 1X82A 2P5KA 1EUTA 4YW4A 4ON0A 1JKQC 1Z67A 1JHJA 4IRHA 4QX5A 4N4OB 1EJ9A 5E8GA 4CSWA 1NE6A 4P08A 3ZFGB 1ZM1A 4PSWA 4IF4A 2UY8A 3WR0A 3S32A 3WNLA 1C57A 3ILNA 1JT6A 2BYVE 4UW6A 2ZSIB 2R32A 4QM9A 1RINA 1I5ZA 4TWTA 5JWPA 3LF7A 3KT1A 4LKDA 3X29B 4CDXB 4A6EA 2K4JA 2XF6A 2X53S 4GWJA 5D8AC 3S5QA 2KLOA 2P6HA 2XBO3 2NS0A 4IEZA 5EG0B 1Y0NA 5C71A 1MBJA 4BXSV 2XRLA 1LNSA 3FXLA 1NLQA 3SH4A 2CJJA 4HSRA 1Y1VJ 5KHGA 2VO5A 4M01A 2W7NA 3E6BA 3LB9A 5C7GA 3MMYB 1KXGA 1TEIA 1FNNA 1OYIA 5C70A 4E9KA 1ETVA 4XBFA 4C3JJ 2J1VA 1I1GA 4NIAA 5DV5A 1LJ9A 1R1VA 3FUOA 5HV0A 3BTYA 4UBGA 1JYNA 2B7EA 2W39A 3VSKA 4LHSA 3NAUA 1ENQA 4DZPA 3JD72 3U37A 3QYEA 4PK4A 3IKWA 1SDWA 1FSHA 1U5YA 1A34A 4JX4A 3E0JB 2WZR1 4R8HA 2W1UA 1I6XA 4LK6A 1IJWC 1I39A 4Q4X3 1AUYA 1VBB3 1HJGA 1ON2A 2DCZA 3C3WA 2YBSA 4LBMA 3VODA 3WQBA 2W85A 2WB1N 3RYPA 4TXWA 5F8PA 3HNBM 1COV3 5H9PA 1ETKA 3PNAA 1AA7A 4XF1A 2NVXJ 2W68A 5GPAA 1QHDA 1ULOA 2A5ZA 1OCCH 3F8NA 2A70A 3CF2A 4P9IA 4UAPA 1X58A 1ZR2A 1X3UA 3WCSA 1GP5A 2M0MA 5E1XA 3ZIXA 4YW3A 1XSRA 3PL8A 3D4KA 1XNBA 3KT4A 1K4SA 1YS7A 4CDWC 1KDKA 2XL7A 3OYMA 1X7NA 4KG8A 2WWUA 2CSGA 3LSRA 3B94A 3JBG1 5JI7A 3DPRA 1XOYA 5EYRA 3KETA 1N3OA 4HKOA 4A7ZA 3ZR5A 3OR1C 2FZ1A 3K6GA 3VBRB 4Y22B 2DUQA 2VXJA 5C4WC 4KBZA 2HWE1 5IVYA 1VBC1 2BNOA 2A6WA 2HWE2 3LDRA 2VZOA 2L4MA 2VD7A 1TE1B 4IJAA 3RI9A 4ASKA 1Z1DA 5DYMA 2XAJA 2VBPA 5D5VB 2UYBA 1WLDA 1MKMA 3CJQB 1WCQA 3PU3A 4R79A 5T5PA 5T5LA 3LFMA 5FZIA 1O8PA 1F4KA 4XPVA 4PJMA 5JSOA 5JMOA 2PLV3 2CFXA 2VKHA 2QUOA 5FLMJ 3BOPA 5FZLA 1NCQC 3S3NA 5FOJB 4LPLA 3FE5A 3VZKA 3WDVA 4MGRA 2YXSA 5GLZA 4M3GA 4S2FA 2V79A 1COV2 5ACA3 1V6NA 4W6XA 1WW6A 5C8CA 3F95A 1C4RA 4AFAA 4QPIA 1POV0 1W9YA 3ILRA 3R4KA 3RSNA 3MLJA 1RHI2 5HDKA 2ZACA 3FXUA 5IY5H 2XLGA 1LGBA 3OCPA 1R4MB 1ACIA 2MD5A 1R092 1XBFA 1OCRH 1H0BA 3VZLA 1GV2A 4F3QA 3WX5A 3T0DA 4ASNA 4BHPA 2O3FA 3HOUJ 1PUFB 3FZ3A 4CEYA 3SDBA 3V64A 1QQP2 4NIGA 1EV7A 4MQVA 2I8DA 1UNBA 3IH4A 2WB1A 2GBYA 3N7MA 2YG0A 1XG1A 1C5HA 2HGCA 2YFZA 1UYXA 2ZXHA 5LEKA 2LKXA 2XQXA 3RZHA 4HX7A 2K5CA 2PHWA 2Z69A 4XF0A 4F91B 3I49A 2R7FA 5EGOA 2NNYA 2VM9A 4CDQC 4RS5B 3NKGA 6PAXA 3HUGB 4RB0A 1ZHFA 1IG0A 5FYBA 2YUSA 4A93J 5FBZA 3QOPA 1GWKA 3GTMJ 2L3DA 3VLBB 1WWYA 3S1QJ 2PAKA 1PO12 5KXCA 5FP3A 2GP3A 2K9ZA 2R061 4DYRA 2Y6GA 3JR9A 4HPKA 3UETA 3MF9A 4DRRA 4LLGF 1RUI1 2HEYF 3CEWA 3QRFF 5HXMA 1WD4A 1ZA7A 3L2CA 3LCPA 2P0WA 5FJKA 1LJ7A 1GDTA 3T08A 1EYBA 3MFKA 2YV8A 1B72B 1YLFA 3BJAA 4JGYB 2KQRA 3K4CA 3DL3A 1QJY2 1F5FA 1DQ4A 5CISA 4XJ8A 3U1DA 1YYNA 2WFF1 3RZZA 2IBDA 4WM7A 1AL22 3P9CA 5LGTA 2XPWA 4U87A 5CA6A 4MXWB 3OUIA 4LE3A 2BU9A 1OI6A 2FQ4A 4A3CJ 2W0XA 4KIGA 3CJIA 3IDCB 3MEPA 5FKLA 2VMEA 2TBVA 1REFA 2FNAA 3LL7A 3ZQQA 4XKWA 1W06A 2D45A 1VAVA 5J37A 4ZKTB 3U4XA 1A31A 1G9BA 3ZYBA 3POGA 5IP7J 2HQ5A 4DYQA 5IP6A 4BXFA 4RB3C 2A6HF 3WDXA 1X4OA 2PX9A 1AR73 2VJIA 2ZX3A 2J1RA 4IQPA 3RKYA 2Y30A 2LTPA 4XFBA 3DKWA 1TME2 4J01A 2BBVA 4IXLA 1VBD3 1WRJA 1W0NA 1OPCA 2M5WA 1TNTA 2EQRA 2DWRA 2P6SA 1BKZA 2HS5A 4AK3A 3CCUI 4J1WA 4B8XA 4ONUA 3KF5A 1AR63 1A6IA 1CF7A 1SFNA 4AYUA 2FDJA 1PMIA 3JTGA 2XJRA 3VBUA 2D5FA 1NCRB 3U75A 2A3SA 1G8WA 3AKQA 4ZDPA 1JYXA 5FP4A 3VYRB 2Y48A 2NVTJ 1P4WA 5CLSA 2YSRA 4OINF 5JIUA 4ZZ8A 1UF2C 3M7AA 5LHIA 3ELKA 4F93B 1UYYA 4HXCA 4HV6A 4B7EA 1RHI1 2JUGA 2VASA 1K5MA 1EAH1 2LR8A 1BOBA 3F21A 4UFKA 1ZN2A 1D4M3 3SXYA 3TO6A 1W8TA 2HNHA 4ZTFA 1MH4A 1IOAA 3WHCA 1N77A 1V4RA 4RGXA 1ZNPA 4IEXA 5CZKA 1ZRIA 2BFUS 2CUJA 2Q1ZB 2ZX4A 2WNUC 4LOCA 3K4MA 1IN8A 1BIAA 4YVSB 2LDUA 2Z3YA 4XJZA 4LT5A 1XE7A 3BZCA 2WT0A 3NKTA 2VT3A 2Y0SA 3B9IA 1VQLI 2R043 3CUOA 1MVQA 3CO2A 1MNDA 4IEJA 4HNUA 4JQFA 3HNYM 1RUC1 1BI2A 3BJOA 5KCMA 5LA0A 4NHKA 4WM8B 2AS5F 4FBFA 4GO1A 2HOAA 4QU2A 5I93A 3OWTA 3IC7A 3CUQA 4EV0A 4O61A 4Q0PA 3PJQA 4G4FA 2ORXA 3EDPA 2DU9A 3T3YA 1RVF1 1ZBE3 3O0VA 2ACJA 4S2GA 2WSVA 2E9QA 2EFQA 2RVCA 1PM7A 4ZZ5A 4CUCA 2R3SA 3KS7A 1OISA 2VG9A 2WIIB 4LFUA 1DQ1A 2L7MP 5J47A 3RMXA 3KV5A 2RGVA 2Y9ZA 3ILFA 3TB0A 1H6XA 1FNYA 4RM3A 5DZFA 1XPXA 4UV9A 3SEEA 2E6VA 5GJ6A 3UKNA 4MGTA 1IRGA 1G2HA 3U14A 3U2RA 3I4PA 2AO9A 3H35A 4ATFA 3CUQC 4HQMA 2E34A 2HR3A 4DO0A 4LBJA 1FT9A 4JQRA 1D7PM 5F5AA 4EM1A 3WNNA 5LA9A 2K27A 4Q4V3 2YU9J 4YWAA 3CF6E 3IH3A 3RZKA 5CJ9A 3SISA 2PJRA 1YO8A 1QJY3 2YPJA 2ARCA 3KHBA 2GXBA 1S4CA 2D3RA 2X5IB 1GQPA 2ZBKA 2EFNA 3LSGA 1Z9CA 5E3NA 5FMBA 5F7UA 3NSTA 1ZARA 4CU6A 3FK7A 5BNPA 5D21A 4P55A 1UJ8A 3K69A 3QU3A 3JD71 3LD8A 2P81A 1H9WA 2IGNA 2ARXA 3GX4X 2X05A 1S2BA 3CZ6A 2DDBA 1GNZA 1LESA 2EF6A 2K9NA 2PQ8A 1D4VB 4EN7B 3OEBA 4H4KC 4E7KA 1S0BA 3WG3A 1XNDA 1XSDA 2E31A 4JC1A 2OUMA 2DCKA 2LY2A 3JRCA 5FYCA 5LFAA 5AVAA 5GALA 1TW2A 2XUMA 4R9DA 2IA2A 4CCKA 4RHV2 1V00A 1SBDA 3A0NA 3PMSA 2EFWA 5DM7F 1H2KA 5HLIA 1FMD3 1JT0A 3WGIA 1BBT3 3IPVA 2NVYJ 4GRIA 1YFUA 1KYWA 3UL2A 5C4WB 2HWE3 5FKKA 4XOGA 2QQLA 2BY3A 4I98B 4YLZA 3GWZA 3H3UA 2JN6A 3VWBA 1UG2A 5FRMA 2YGMA 3N3HA 2LNBA 5I8YA 4OIRF 3VDCA 2W87A 5F2WA 4XABA 3MF6A 3GLLA 4Z1VA 5GLWA 5FKCA 1RUH3 1QIQA 1BBT2 2Z99A 1YX3A 1FMD2 1OHFA 3HL2A 1LULA 1HXS3 3SLIA 1WI3A 3C7GA 1QNWA 3IIIA 5IT9K 2WWSA 3CNAA 1BYHA 3DCFA 1N3QA 3ZXFA 1Z21A 3J7AO 3WP4A 1HDPA 2RAEA 1CF7B 3OL4A 2LFBA 3LSIA 1MEC3 3B6AA 3KZIC 1IW7F 1ETYA 3B3QE 4BQXA 5A7SA 1VAKA 2GOXB 1Y0UA 4BEHA 3RMYA 4MLOA 3ZMVA 1RGSA 4OI2A 2VKVA 4OHYA 4MGSA 3KEQA 2OZUA 3O0WA 2HEOA 3WF3A 1TLHB 1J2XA 2MFZA 4L9TA 3K70D 4B29A 4IE5A 1OQEA 3MWMA 1D0HA 1Y56A 1OQDA 4QPQA 1R5HA 3CESA 1TVGA 4BK5A 3ZR8X 1Q8VA 1OVPA 3USUB 3DPUA 3KV4A 1OLMA 4ZU5A 4Q4V2 4KMQA 2XUEA 4A3EJ 1SEFA 4BGDA 3WTWC 1W7PD 3CIHA 3OUJA 1BW6A 3AG1H 2W00A 5GZFA 2O61A 5FO9B 2HQNA 3LSTA 1W6PA 1XE8A 2XH6A 2D98A 4ZDLA 4XF3A 4YW5A 3WT3A 3WNPA 3IHUA 4A3MJ 4P14A 1MS3A 5J3UA 5FPXA 1UXXX 4Q4W3 1DGRM 1QJU2 3M1CA 3Q5FA 3QLQA 1JUIA 5GTIC 5EEAA 3WSOA 1KU7A 2D2WA 4M0NA 4PDWA 4YM0A 3T1LA 1F2NA 1GMMA 2P3JA 4CDWA 3BG3A 1VFCA 4FFIA 2D5VA 1ASJ1 4PFOA 1OJLA 3BR1A 1GOFA 2Z5UA 4YNIA 3WG2A 2RVAA 2EH3A 4HDVA 1ZG1A 2VNRA 1DGWX 2X10A 2J1AA 4UNOA 4ZYGA 4QQHA 5GM0A 4BQNA 3GCMA 1X9PA 4QM8A 2FA5A 5KNLA 4O6JA 3EETA 2R7OA 2F6CA 3I64A 2CNAA 3S14J 2Z79A 3L00A 1UY3A 1K7AA 4BJ6C 5I8SA 2KIQA 3NNFA 4MX3A 2FRHA 5JVGF 1UOFA 1BC7C 2GC1A 3OGVA 2GWRA 3J8F2 4JKMA 2CQ7A 1BJQA 5GLTA 4XORA 4AF9A 1WH5A 3FXJA 1LEDA 2P2KA 1UZ0A 3P5BA 1OLRA 3PL0A 2OC6A 1BVP1 2ZGSA 3S7IA 4CU9A 2V9KA 4FVVA 3CCEI 1OD5A 2WNVB 2GSYA 4AC0A 3HYIA 3K1MA 3ZN4A 2HDWA 1IS5A 4OMZA 1OH3A 2EICA 5FOBB 3I4MJ 2DF7A 3J81K 2WKKA 4Q4Y1 3M8LA 1R082 2G19A 4Q0VA 2K3FA 4EJOA 5FYZA 5BNPB 3S1RJ 2ET1A 3H0DA 3GZ6A 1W6MA 2FDKA 1YG2A 4RMNA 1QGLA 2VJ4A 3HD8B 1TZOA 1A5JA 2E7QA 4K21A 1S0CA 1VE0A 3AL5A 5FAXA 3CCVI 4FPLA 4KITB 1WCUA 2VGDA 1KJRA 3OJBA 3PO2J 3GZUC 5CU1A 3ZXGA 3NWTA 1NAEA 1O3SA 3PQJA 4UHTA 2YC4A 4CVUA 2PXJA 4KG0A 4E7JA 3LQRA 5FZOB 3I54A 5K0UC 3GHNA 1SLTA 5GLVA 3VBSA 2QKDA 1IV6A 3DBRB 1UY4A 2XHNA 2K4BA 4IHXA 2ZX1A 5K5OA 5JLXA 3TBDA 2E53A 4X6AJ 3IMNA 3APBA 1AXYA 5CEHA 1YI7A 2QFEA 2HOTA 3HBLA 3SZTA 4AD9A 2XGEA 3C2BA 5DG2A 2AR6A 1HKDA 3VYTB 2V09A 3JXSA 2RREA 1Q1HA 2FBHA 4GYGA 4XLHA 3LOIA 2W1SA 3VV1A 3QOEA 5CQEA 4XUOA 4EJWA 2ZMEB 1KEXA 4BEHB 1YIOA 2DK5A 4TLFA 2X1CA 2RR13 1VQ9I 3F22A 1R1A1 4NAOA 3LAGA 3ECHA 3NV1A 2QQIA 1AX2A 3V42A 3I8TA 3AXDA 3KYDB 2VC0A 3JRIA 1P6RA 5FZHA 4AGGA 1CZSA 1DYPA 3WTZA 2Z2SB 2AQEA 3S57A 2Q8EA 2LRDA 2A1XA 4DUXA 4MEXF 2LMDA 5IUQA 3K75B 1FV2A 5F6FA 4N8MA 5CKMA 5K4LA 4Y13A 1RUD2 4XMYA 1MACA 1N3PA 1QNYA 5F6LB 4GFBA 5HPOA 3H8OA 1TWAJ 4RGRA 4IRGA 3RTRA 1E57A 1W0OA 1G4DA 2H1KA 1U2WA 4XFFA 3JAMK 4XQDA 1XC6A 1Y9GA 2BERA 2R041 1FBUA 2RS11 4FPHA 1W6NA 3MUY1 4HLYA 4HVOA 4GJZA 2WV1A 3A01A 2LW8A 4XJWA 4DRVA 4OUEA 1TTYA 3KE2A 4AL9A 5A7NA 2VECA 2O0YA 3OD4A 5B1AH 4RR3A 1O3QA 1ND2C 3VBFB 2ZA9A 2ARBA 5FLJA 3H42B 3J8F1 5I0DA 4D7MA 2G9ZA 5IOZA 1QNTA 2Y34A 5LB6A 3GVAA 2NZ9A 2LY9A 4Q0UA 3VDBA 2RJKA 2XVKA 3VL8A 1W0TA 1ZR4A 2X6XA 5C5UA 4UFIA 1RUF3 5FGMA 3KEOA 5H20A 2ZKNA 1Y3TA 1NCQB 1L7LA 5DCMB 3NVCA 1W2UA 3I58A 4NNJA 2IEKA 1UOJA 1B9NA 2M9HA 2LALA 3FHQA 1YJNI 4R9BA 2G4IA 3CCYA 1CJPA 2H8RA 3OGJA 5C8CB 3T0YA 1RIOH 3VHNA 3GEZA 2NM1A 1IV8A 4FE7A 3QD6A 1LQ1A 1AR83 4EWDA 3BY6A 3ZFGC 3KQ4B 1YTYA 1F5JA 4RGKA 1YQ8A 2CYYA 3KGLA 1LOBA 2ZGUA 5J8CA 4A4AA 1J0RA 3CC2I 2QNKA 1KS5A 1J59A 4OULA 2XSJC 4E4DX 3SKVA 3GW2A 5A6QA 2WRAA 2FBEA 2W95A 1WCKA 3ES1A 4QT6A 4IO9F 3BG9A 3ZXEA 2OVUA 3M8EA 1W6MB 2BY1A 3PUBA 2PHLA 2OPWA 9ANTA 2P3YA 1ND3B 4AEDA 3CLOA 1SLCA 3TRSB 4ARXA 2V6EA 3GZNB 1UG0A 1SANA 4M6VA 3L2QA 5CVIA 3SDGA 4HANA 4Y5TA 1JE8A 1GVDA 4LKFA 2Y0IA 3OOPA 3RSJA 4LK1F 2OBPA 5FP9A 4ZHNA 3VKFC 3HOSA 4A12A 2VQCA 1NX9A 2DURA 5JVVA 4HKWA 3VHRA 4N53B 3FN9A 2YX4A 2XRNA 5GAGJ 1MZ6A 1HN1A 4R4XA 3T2TA 4DXZA 1IXSB 4CP9B 5FYIA 4R9CA 4Q1RA 2WNVC 3QPSA 1XYOA 4IE4A 2HBTA 1O8SA 4A0ZA 2ZFWA 4RAZA 3P7NA 2BOIA 2LROA 4IETA 2PMZA 2A69F 3ABLH 1B72A 1HLCA 1JYVA 4LITA 2K9QA 1MR5A 1YXWA 1RR7A 1IDYA 1WLWA 3BODA 1SLIA 4GH4C 3O2PE 5AFBA 4M73A 1NCRA 2XJTA 3ZN5A 3FF5A 2L5QA 3TEWA 4FOVA 3EUHC 1VLNA 2B5HA 2ZSHB 1LFBA 1HW1A 4PLOA 2ADDA 5J6XA 1BW5A 2ZMEA 4XLFA 2FQPA 2ARAA 4FQZA 3RZJA 5T5OA 2HVSA 4B4PA 4WVWA 1BCXA 2AXTC 1FMD1 1ZZBA 3ZO0B 2JA6J 4WXCA 2XHKA 2OPTA 5IYBJ 3HJEA 4QHOA 1LENA 2BOJA 4DNYA 3DKXA 1WFXA 4OOIA 2HI3A 1LHOA 3A03A 4INDA 4MHGA 4M3CE 1ZYRF 5B3SH 1B8IB 4S2DA 2XJQA 2HPMA 4XKCA 2LD5A 3K4AA 2MNGA 3DYMA 3JTHA 1K6OA 1ETXA 4CEWB 2OTJI 3FBNB 4HRIA 2OW4A 2DA5A 2ILMA 4XQ4A 3T1BA 1YW8A 4A3LJ 3DF0A 3VBOC 4V1PA 5E8AA 3MO4A 2XVLA 4AAXA 3VYUB 3H0GJ 4NRMA 3PNYA 5GKAC 2EXHA 2CQQA 2QBYB 1C8M3 1POQA 3VD4A 4XMIA 2ZJCA 4FFHA 4FSJA 1JUPA 1RESA 5FY0A 2G0EA 5IYCJ 2ATFA 3HHHA 4A0XA 4MTEA 2IP2A 3JRHA 3NJZA 1BC8C 3WG4A 4I02A 5A3NA 1YJ9I 3AVSA 3BCWA 3KWVA 5AONA 2Y6KA 5J09A 3MQ0A 3LSPA 4AI2A 3A0HC 3MZ8A 4KWKA 2R042 1FPN3 5KXDA 2HYGD 4COVA 5F3EA 3WCRA 3U1KA 1O4TA 3TP3A 1NKGA 1K83J 3WP5A 1RMU2 2YDEA 2QSHX 2P6TA 4UF0B 1OKOA 1QU3A 3N9MA 1JYWA 1USTA 4MADA 3BOQA 2VE8A 3WE3A 1ST8A 2GN3A 4AWDA 3FLPA 3JBG3 2PAEA 3I3EA 2OUJA 2GC2A 1QJX1 4MGZE 1G9FA 1HKTA 2Z1DA 1NCQA 1QPMA 1QRYA 1PMJX 1DGWA 1KQ8A 4P9GA 2LH9A 3NNJA 1GLNA 2J7MA 3DF8A 3LOBA 3ZQLA 5BMZA 3BTXA 3IB3A 3KIOA 3QBQA 5C9AA 3ZSMA 1JZ2A 3WD5A 1US2A 1R7JA 4BISA 3SFZA 5L7OB 1OKRA 3T4HB 2WQ4A 4JRAA 3ZYIB 2FOKA 4NC8A 4NVPA 1WMEA 1OH4A 5D6EA 4FT8A 2WAQN 3T1MA 2W82A 3L2UA 1BA5A 3H7JA 2NYYA 5BS6A 5CAZA 3O14A 4ES8A 2ME0A 1RUJ3 4X8NA 5GAEJ 3AMPA 5CG8A 3AKZA 2WDBA 3UJOA 3R4DB 1Z3XA 5LLQA 4HBLA 2EXKA 4UY8I 2X5IC 2ELKA 3CLPA 1OCZH 2J1SA 4XDPA 4QHZA 3EPZA 3RGBA 1QWRA 5L9RA 4HX8A 2ADEA 4M6XA 4YW7A 1GV5A 1R71A 1XB9A 5J1UA 1H8TC 2VMHA 3C2HA 2YPDA 4MGYE 2COMA 3CU7A 5DZEA 3BROA 1XYNA 1W5CC 4FPYA 4CP9A 1A35A 3OS0A 3CZJA 4CPBD 2WFPA 3TEDA 4AHZA 2DPUA 3MGUA 1KFUL 1PJRA 1E17A 1VBE2 2AHQA 1PK6B 4FETA 2FF4A 1DFQA 2ZXJA 2PEXA 4A41A 1C8M2 1IGOA 4UFLA 2VPVA 5A6ZA 5HNHA 3OTFA 3BG5A 4O5VA 3S7EA 1R5GA 3BLYA 2W84A 5C3RA 3NRUA 1R22A 1MS1A 1CIWA 2OJED 2RG4A 2UWCA 3ST7A 1OPMA 2VL4A 1OMIA 2ZXIA 3TBIA 3OYFA 1X50A 2NMOA 3WHTA 2ETEA 2EVXA 4NN0A 1QZZA 4NIIA 5J40A 1HKQA 1H1IA 4LBQD 2Y6JA 3PUSA 3C7EA 4KDPA 3S8PA 4XACA 2L0KA 4KIBA 4LKEA 1F43A 3KD4A 4A6SA 2KKOA 4E8CA 2QM3A 4ITCA 4FTSA 2IFRA 3MIDA 3SJMA 1FEXA 2A6TA 2UWMA 2UXXA 3WNXA 3KQRA 4G3YC 1YHFA 4UFMA 1XNAA 3H8UA 5BXXA 5F0FA 2ISZA 1DDLA 1YFWA 4M74A 2P37A 2ZXWH 3GMEA 4K3UA 5ABJB 4QXBA 4V2VA 3ZMSA 1F9NA 4IESA 4QQ2A 2BY2A 2OCCH 1PIV1 4IXAA 1RVF2 4HK8A 2BVBA 5IVCA 4UB6C 1O57A 1U5XA 3SMHA 4ASLA 3PIOF 4E2QA 2W46A 2WZ8A 3POWA 2E7WA 5F5CA 1LOFC 3BI3A 3EUAA 4FX4A 1CAVB 1VQNI 1WGPA 3OGRA 1VJ2A 4Y26A 4E4SA 4RGAA 4B4RA 1REEA 3NNLA 2IZWA 4GIQA 4IDZA 5FY1A 4YGBA 3OR2C 1YNAA 3MDPA 2V9PA 3AP9A 1LU2A 1LVAA 2J1TA 1IF1A 1FMWA 2WTEA 2XGDA 4B43A 1HJFA 2WA0A 3OYNA 1DZTA 3A7QA 2JG8C 1UXZA 5F32A 1I3AA 1JHHA 1QJU3 3SNMA 3OMYA 3PJRA 4LLOA 4KBBA 1XGNA 3FFZA 2JE9A 4J19A 3RWKX 5FB2A 1ULYA 4BS9A 1SQ4A 3C2GA 3M3QA 4JDNA 3M70A 2XGCA 3GM8A 1FP2A 4P5HA 4Z2YA 1AR81 2IAIA 1K5MB 3Q8EA 3ZOIA 3ZMNA 2CV2A 3LSJA 2FCVA 1S0GA 4L9BA 2IXCA 3SC7X 1W2OA 2VVEA 5K1YA 2XR4A 3OBZA 3MKLA 3ZOBA 3O1MA 5JR3A 2I10A 2HWVA 4CRQA 2BV4A 5KR7A 2XAGA 2RNGA 2XWBB 2HWB1 2ESNA 4ISRA 1AX1A 5C9AB 3BU7A 4XCBA 4AGVA 2WN2A 3TOJA 2LG4A 1BK0A 4FPOB 2ZHMA 4LBQA 3V4GA 1LNWA 5IVBA 4D7SA 2X85A 1DPUA 1HSJA 1VBA2 2NVQJ 1I1EA 1RUG3 4ZU4A 1V6KA 1GANA 3WG1A 4EMSA 4IPAA 3U4SA 4K8FA 4N9IA 3PNTA 3KZZA 1CAWA 3PUFA 4YRDA 1WKYA 2KISA 2A3XA 1VQ4I 1CGPA 5JHUA 5EJ1B 1BMV1 3O1TA 1LPQA 2DQRA 1TZLA 5TRDA 1QGPA 3KVAA 1ZLKA 1YIPA 1JZ3A 3BIWE 1PGW2 5JSRA 4ASMB 1T38A 3COAC 2EBIA 3QH6A 4XM3A 3V0AA 2MH2A 2JDMA 3SEZA 4AEMA 5ERIA 1T8IA 5JDBA 1XDSA 3VBSB 3LEGA 2R0HA 1DU3D 3ELNA 1GUUA 1G9DA 3VBRC 2DYRH 2JA2A 3J80Z 2JDHA 3RI8A 5FO8B 1TP4A 2DBBA 2Q8DA 4XSXF 2Y8KA 5E6HA 2ZGPA 1XTAA 1FSEA 1LOEA 1EY2A 4EQVA 4GKXA 1GKBA 1JJ6C 1W6OB 1MZFA 3S0MA 2RJLA 3MKWB 1D5YA 4DMIA 3UKGA 1DZQA 2E1MB 3OYLA 1AR82 1NT0A 2ID4A 3AJYA 4N7UA 3TWIA 5FCCA 4COUA 2HEWF 2WR9A 1SFKA 3H1WA 1E5RA 4BIOA 1ON1A 3RKQA 3GTGJ 1SACA 3M7GA 5H9QA 1QJY1 2CWEA 1F4AA 3HQUA 3PFYA 3IIAA 3CDHA 1JHFA 3IH2A 4PJYA 4I7HA 2JWPA 1LTEA 4AWXB 4D5FA 5GTHC 3C7FA 3VDXA 2VE9A 1X2MA 2ECBA 3TNQA 1NA1C 5CFCA 2VPLA 4Q5OA 1VBB1 3AMQA 1J3QA 3I2GA 4U0VA 2A6VA 5B4XA 2BJSA 4XEZA 5CQGA 3HNMA 4CCDA 1QOSA 2MG4A 3HB9A 2AUYA 3NRVA 1L3JA 3IRQA 3PIPF 1X1DA 5CKQA 2RKHA 3ZGKA 2A3WA 1VMHA 1GZ9A 5LA1A 2ZX0A 5CB7A 3WQ0A 3VSLA 2B0LA 3WU1B 4L5JA 3MLLA 3B01A 4Q0QA 2DFCA 1AR72 3MHZA 2L4AA 2FBIA 4BY7J 1DBNA 5KAFC 1V70A 2QKMB 1Z6RA 1Q43A 3JW4A 3LDKA 2PHTA 1S0JA 4LEJA 1YI9A 4QQPA 2ZB9A 1J84A 1WCSA 4FTHA 5FROA 4FCAA 2VOPA 3AP7A 2OKXA 3KMHA 5EJ3A 4I6ZA 3A02A 3V56A 4XK4A 4E27A 4PUSA 2WLQA 2WAEA 1UAAA 1KU3A 2GNTA 2R7QA 4UVBA 3ENRA 3U78A 3J7AY 1MMNA 3VZOA 3NV4A 2MW8A 4FPKA 3NJYA 1CONA 2HWD3 1MGTA 1YHQI 5BNPC 2VNVA 3TEYA 3BTAA 5CVUA 5J1XA 5FZ6A 4LORA 2RM21 1TWCJ 1ULPA 4CCJA 3FUQA 2DMTA 4M0HA 1JOPA 1NUKA 3B02A 2L54A 1MPXA 2WSUA 4ZTJA 1ZELA 1SD6A 2M8GX 2UWAA 5TISC 1QOOA 3FWEA 1BR2A 3WUCA 1CZVA 1FJLA 5DUUA 2FDFA 4XHXA 4NC7A 1S2KA 5EP9A 3CC7I 3IKTA 2JECA 3S1MJ 1H1MA 4II3A 4XIOA 3AKPA 3WP6A 1GV9A 1DP0A 2KR2A 2ZS6B 5A2QK 3F2ZA 3OYJA 2VLAA 3OIQA 1J83A 3UJQA 3USUA 1KGSA 1R64A 3JCIA 4IEVA 4Q5SF 4QPGB 2Q1MA 5LK7B 4HK9A 4NB5A 2GAUA 4AQ2A 4QHBA 1JW6A 2OZ6A 1KQ0A 2VY0A 2BTVC 1LODA 3Q0VA 4FTBA 2HPIA 2CDPA 3WINE 3N9PA 2VOWA 1VR3A 4LK0F 1UZWA 3QODA 2CWSA 3MCZA 4Q4W1 5JXIA 3WF0A 2CH0A 2XVCA 4EN9B 2VXZA 4D1QA 4CDUB 5CVJA 1SD4A 2R4GA 1GYKA 3W20A 2A3YA 3DEEA 4OHWA 1G3YA 1XSXA 3I56I 4D6QA 4HX4A 4N0BA 2R6QA 5I0SA 2E5ZA 2QA4I 1S7OA 1GBGA 2E2JJ 3OEAA 5J1YA 5BNGA 1R23A 4R4ZA 5DUIA 5J7MA 3CLQA 2BHZA 4NWVA 1Z77A 2K3PA 3KF3A 2XGXA 2DCEA 3CJTB 5HVQC 4GYIA 4XKVA 3KZYA 2L9NA 1BI1A 3I7DA 5AC91 3S17J 1H89C 5E8IA 1JKPC 2PLV2 1PNGA 4JGYC 3WW1A 4CXFA 3KP4A 4Q4W2 4IX7A 1PHMA 5KXBA 1MEC2 3F6OA 3S2WA 2W08A 4ET7A 4M3CB 1SZBA 5KHDA 2BRTA 2EIMH 3VB9A 4A5MA 1NY71 2WO7A 1GT0C 2A7AA 3GF6A 5KC5A 3W6KB 2MC4A 4FO9A 4PJ0C 5FP8A 1K45A 1UCXA 3KLSA 1NOVA 2CQKA 4GWNA 4EGYA 3WW4A 4XTMA 1ZRCA 2M1BA 2LVSA 1MS0A 3I4IA 3MICA 4FXGB 4QLCU 1S0DA 3G73A 4UB8C 2WA3A 1Z05A 2WBMA 1ZA4A 1IN7A 2XAQA 3VFZA 4KGQA 4WV8A 4A0YA 3H5NA 2JENA 1W36D 4FXKB 3BTJA 1PUFA 3HR9A 3HQXA 5LBCA 3OPWA 2D6LX 4M3CF 1YW9A 4YARA 3LE0A 2PJRB 2WS93 3HBKA 1B1BA 2DMUA 5FYUA 3GALA 5FTTC 4PJJA 1XSQA 1PO13 4DEQA 3H8RA 2DV9A 5FZ7A 4B48A 1LRHA 3WEZA 4QD2A 4I3GA 2XJPA 5LW9A 5EF6A 2VUMJ 1ZGJA 2WA4A 4ESFA 1QQIA 3GTQJ 3OS2A 2RDRA 1RB8G 3RS6A 1EH7A 3M8FA 3RVHA 4BDVB 2JDKA 3ES4A 4BOWA 4PDKA 2QVOA 5F0CA 4DQ2A 1FC3A 2JRMA 2E71A 3T5XA 4YM2A 1MW7A 1RIRA 2CW7A 1PGSA 2KPMA 5FPVA 1YJWI 3EMRA 4YZ1A 2DCJA 5DUXA 2YUEA 1R36A 1O3RA 3K1NA 1WBFA 5HS7A 1SAUA 1BMV2 3ZKYA 4UV8A 4LG0B 3JD73 2QZ2A 3THTA 1Y43B 2FOWA 3K2OA 3RKXA 4RSUA 1O7FA 1HQLA 4YGCA 3U0ZA 2WT1A 1Y9MA 2PHUA 3KCCA 4ENJA 2ET7A 1V3FA 4K7JA 2NOGA 2VODA 3PSFA 4XTPA 1SVLA 5JPMB 3WHUA 4URAA 2JA5J 2HWF3 5G04L 2XV4S 5DXDA 3P3NA 3Q8AA 4QX1A 2X09A 4XOPA 2JT1A 3PSIA 3F8BA 1QQP1 1OUXA 3AG2H 1JN2P 2JZYA 5K0UA 3J81Z 4GCVA 4A6OA 2RS51 1O6UA 2ZNZA 5FMOS 5GZDA 3WE2A 2BNNA 3O12A 1AJOA 4HQEA 3ABTA 3H5RA 3K2AA 2P3IA 5IPAA 4YIRX 5FFZA 1ZBA1 4OMCA 3R4UA 5FV3A 3VBSC 3URFA 3UKVA 1LVKA 5K7FA 2WZR2 1UZCA 1POV1 2DW4A 4AZZA 5ABJC 3RDIA 1EV13 5FLHA 3V7RA 5FIXA 4NAMA 4QPGA 4I0WB 1YWKA 3AL0B 1WMXA 1BQPA 2JJ7A 1O4ZA 1ZTRA 4IV3B 3ZYGA 5CPRB 3F6VA 1QH6A 2N8GA 3ZYRA 3ZSLA 4BHBA 2VZTA 5C3SA 2M4KA 2IW5A 1SEUA 3LFIA 1FOXA 1MIJA 1ZBE1 2HWB3 4JTNA 3HIFA 4Z2AA 2DBNA 1YFHA 3HVDA 5FR3A 5EGOB 3ZYFA 2HBUA 3C8XA 3SQOA 4RS5A 2KZVA 3W9AA 5L3CA 1O59A 1LKXA 2DI3A 2QZ8A 1C5IA 1IKPA 3W2WA 2EV5A 1EPZA 1D8KA 2WO2A 1CN1A 2K9SA 2BOLA 2GQQA 1ULEA 1DLCA 2R7XA 3T4VA 3SXWA 4NC6A 2LUWA 2JKXA 4CDXC 5E1RA 2MBFA 2JG9C 4YIFA 4HAMA 2KIMA 4S04A 2CDOA 3I3DA 2L7FP 2JB8A 2VMCA 5IK7A 1RJ7A 1CESA 2X51A 4AHWA 5JVTA 5A32B 2DFHA 4YRVA 1YCIA 1IN5A 2ZNYA 5EIYB 3WQ7A 1YFXA 4JGYA 4G8XA 4B1MA 3KCXA 2F5DA 2QCOA 1WJCA 2WABA 3R61A 5FZ8A 4W6WA 3INAA 5HCBA 1RC6A 5DUVA 1NG7A 2XLAA 3CF5F 2DK8A 4RFRB 3J9SA 4XFHA 2HWD2 1KFXL 3FXKA 4EN0A 2DFBA 4HSTA 1L3LA 3ASIA 1E3HA 5IFTA 4YVWA 3W6VA 1KRIA 3O1OA 2BDRA 4TLGA 1O4XA 1SFEA 2NRAC 1AJKA 1OOPC 1W5TA 4XICA 1J75A 2CG4A 4M6YA 5LRRA 1E5HA 2O8KA 2PMZN 1T95A 5HLTA 2VUDA 1SFUA 2BGPA 4OYUA 1UQXA 3TW6A 1FV3A 1JJ8C 1X1AA 3ZMUA 4Q27A 4M4PA 2Y0SN 5IWFA 3T8TA 1R9TJ 3J7YJ 2VH9A 4BUPA 1W8ZA 3CCMI 1IG7A 5LGUA 2VULA 2HU9A 3LAPA 1DGLA 2MPFA 2VOVA 3TDUC 1W6QA 3J8F3 2G7UA 3MW4A 4IV1C 3RPQA 1WQ2A 4WM7B 2XB0X 1G3WA 2JXAA 3C7OA 4HNVA 5ICEA 2QTWB 4IEPA 2GXGA 5IK4A 2AEYA 3LKJA 1H9GA 5L73A 4IHSA 5DDJ3 3SH5A 5AFEA 1RYYA 1NXD1 3IBMA 4XUTA 4LBNA 3U07A 1WPKA 4QB2A 1FBQA 4BAYA 5FJ8J 3K51A 2DOFA 2CV1A 5B66C 4MXVA 1ZZ6A 1APLC 1W6QB 2RS53 2DLLA 2IS6A 2W25A 4A3JJ 1UN1A 1OA2A 4HT1T 5JAXA 5FXZA 2BEOA 1AKHA 4H7MA 2IVIB 4JX6A 1OT5A 3LEKA 2VZ3A 5CIRA 2QKLB 1NG6A 2R063 4WVMA 1AYN2 1F31A 5FZ1A 1GUIA 4P9UA 3ACFA 1SBFA 1UU6A 4HSLA 4OHZA 1PGL1 5C44J 1W05A 1JZ5A 3UKTA 1RUOA 3LNQA 2RN7A 4QPIC 2EZKA 4UVAA 2VZPA 4W50A 4ENKA 1X33A 1BBYA 4IEOA 1LFPA 3IL2A 4QPGC 3OPZA 1WJFA 2YZ4A 2LP0A 4NBQA 1IPJA 4EROA 4O9EA 4E2SA 2XASA 4P9JA 4U7DA 2RR11 4PCRA 5FPUA 2F6BA 4DINB 2V5DA 2V7FA 4HKLA 3JQWA 1QVTA 2Q8OA 3O1VA 4NWWA 4LIVA 1R58A 2VTXJ 1H0MA 1N78A 4O65A 3BT9A 5EJZB 3HJRA 3OOXA 3AJZA 3TQNA 2QQAA 4QTRA 2DODA 3BN6A 3DEWA 1TL8A 4M3BA 2GA2A 4QU1A 5K7PA 3KGZA 3ZPLA 4Y33A 3WF4A 3L2RA 1O5UA 3DLLF 2HYJA 2XPVA 4JBAA 4G7ZF 4JRLA 3UT0A 4EM2A 4AVBA 3F9KA 4LIUA 3R6SA 4IEUA 3ZLIA 3LZZA 3AYCA 4N4NB 1JYTA 2NS7A 2ZHNA 4CZZA 4CYCB 2HWF2 2R16A 1ZVFA 2WJSA 1F8VA 5DAWA 5KWRA 4DNCA 5DCMA 1J58A 4JK1X 3OYWB 2LOOA 4MSVA 1JTZX 1VRH2 2AH2A 3GZEA 4DXTA 3RQIA 2HDDA 1Z0HA 4MHRA 1W0UA 2W3JA 2GALA 3BIEA 3ZYJB 3VGIA 2BXYA 2XJSA 1QJZA 4IEYA 4QXCA 4KUMA 2JDUA 3QYBA 1ETWA 1VBA1 4RGUA 2ADUA 3H3VK 3O5SA 5FZBA 2BUKA 2DBIA 2CGPA 3HKZN 3WGHA 1H8TA 4LR4A 2HTJA 4XBNA 1SFXA 1VRH3 1O4YA 4GXOA 2JUCA 3RPUA 1YRNA 4Y15A 1HN0A 1YEWA 2GNMA 4LBLA 4XZPA 5EEGA 4O7XA 3IUOA 3ACHA 5EHDA 4L0PA 5A80A 2VKDA 3OUHA 1MMDA 2UU8A 3BB6A 3DXJF 4A3XA 2LBFB 4ZZLA 2KRHA 3L1PA 5A2QZ 1H88C 1MSFC 1IAWA 2R5YA 1FZPB 1FIAA 4FX0A 2Y0OA 1Y8RB 1YLLA 5J98B 2BW8A 1W0PA 4FI9A 1TQIA 5FO5A 4O3MA 3VDDC 1KQRA 1OOPB 5EYXA 2VQHA 4X8PA 2NXNB 4HV5A 2X8KA 1JI6A 1AR92 1JTXA 5H2FC 2NYXA 3Q3SA 4X0GA 1NH3A 2MHFA 1LEAA 3POYA 4OHXA 2P17A 2VI6A 2F5FA 1QO0D 4QIWN 4WCGA 4KWJA 1XC5A 3AK0A 5EQUA 3CTAA 2YC2A 5APAA 1OCTC 1O7LA 4AGRA 3NL1A 1AVBA 4M3EA 5EZWA 4EYUA 4YELA 3FHZA 4GB32 2M2EA 4ESJA 1E2XA 2BZDA 4HW0A 5KK1A 2ZAAA 4QGMA 4PIXA 1XMKA 1YI2I 2A07F 3OYEA 2VMIA 2DVAA 2R7ZJ 1X3ZB 5FZ9A 2L7KA 4HFSA 1B6AA 4DXRA 2F4LA 3HWJA 4W6YA 1J1LA 2DMPA 3HOYJ 4AE2A 3T09A 4ZS2A 5E3MA 1DQ2A 2HFHA 4KICA 3U21A 1YJLA 4XC9A 4GH4B 5F37A 2FE3A 2H8WA 5C8CC 4B1LA 4UFJA 3IM0A 2IXIA 1JTYA 2BGCA 2EILH 4SLIA 4AHXA 4TV7A 3VL9A 1STMA 1JUMA 1ZLJA 2A71A 3WXPA 5EG0A 3ZXKA 5LZ6A 4GJYA 3JRDA 5J3LA 5HDNA 1OKQA 2WS92 5DAXA 4RL7A 1XB4A 3ZMTA 3JRGA 4HL0A 2IS2A 3RYKA 1S8NA 1DCSA 3KP5A 4IZZA 3KLNA 1C8NA 5HBAA 4IERA 3ROUA 1GOHA 3HUGA 3JRAA 2ZTNA 2WFF3 4B47A 1G86A 2H6BA 1VBE3 2ZJQF 4YW6A 3GZ5A 4XRSA 1HKSA 1SLBA 1O5LA 3HQRA 1W6PB 1ZRRA 3H1MA 5B5EC 1Z6TA 3BQZA 3QH7A 1PGL2 2BVMA 3R0AA 4MG2A 3HRUA 3G4SI 1X9TA 4JQTA 3I5UA 3L7WA 5DZGA 4JZRA 1Q8OA 4W97A 5JI6A 1OUSA 1VALA 4KNYA 4ZYDA 2TNFA 1TNSA 3BPVA 1IN4A 3E7LA 4YFWA 4KL1A 1K3IA 3K2ZA 2B4KA 3NAPA 1P8JA 2RS52 5H9SA 3CCJI 3W58A 3ZQ7A 4Q0SA 1OPOA 3FISA 1SLLA 3HKZA 3NJVA 5DDGA 2G7HA 3S2HJ 2X4HA 2BV6A 4H2AA 3HMYA 1MQTC 1I9RA 1UX6A 3SHFA 5FMDA 2FD5A 2VNGA 2E32A 3DBLB 1CQTA 1LB2A 4AIKA 2W1OA 3GDBA 4D5CA 3H92A 4XNFA 3W21A 2R7WA 5I0TA 3CCQI 1FOKA 3DPRB 4PBPA 3POFA 2JD9A 3IAM2 2FD8A 4OLLA 5ERLA 4Y22A 2K9MA 3NQHA 1DUXC 3MW2A 3AZYA 3K46A 3FDYA 1OVSA 1QZYA 1PM4A 1VB2A 2DTRA 1JZ4A 5FYMA 4XLPF 1VMFA 4Y1YA 5IYDJ 2ZGLA 1R083 1PP7U 4XRSG 3PUHA 2HH9A 3A23A 2ZGOA 4PCQA 4UW4A 4NIHA 3E6DA 5K5RA 3OBAA 1RUJ2 2I45A 3OPTA 4F3JA 5A3UA 2R5YB 1DGRA 2BP6A 1FOD1 3RZMA 5M3FJ 2B46X 3NO8A 1GP6A 4Q4V1 1NA1B 5DABA 2NOJB 3OYWA 3ERMA 3D0JA 2O9LA 3IZOA 1FY7A 2WL1A 5LA2A 1VBC3 1W90A 5LBFA 3AMMA 5J4VA 5A3OA 4BNCA 1C0WA 4YFXF 3FBYA 3MFAA 2VZRA 4MGQA 2YBPA 1VMJA 3JCUC 3E1F1 2X6OA 1SAXA 1N1YA 2DYCA 2TUNA 4RHV1 2DQLA 1VQOI 1UB9A 4M3CA 4Y5SA 4KT5C 4FFFA 3AG4H 1CD3G 2HXOA 1WJEA 2E60A 3GBGA 2E1MC 5EV7A 2IC1A 5FKBA 4IRIA 4TSVA 1KITA 1UL9A 4LJZF 4MO7A 4B4CA 1K5JA 3N9QA 1U5IA 3JREA 2RDSA 2LLKA 4IGQA 2RM22 3H9GA 4K1YA 1FI2A 3VN4A 2VKEA 3FJSA 2B45X 4GB33 4CXYA 5ICCA 4QX0A 2L02A 3CJIB 4QDRA 4AFBA 4AG4A 1APNA 1XQNA 4Y24A 4HDUA 1JZ7A 2KDOA 1W6OA 4EJRA 5FWEA 5TJJA 4KA4A 2JIJA 1T08B 3U11A 2HDCA 5D5XB 5KAIC 3H1YA 1AL0G 4I2OA 4Q4X1 1MBHA 3L9JT 3K77A 4E4ZA 2FXAA 3BZ6A 3CJNA 4G9SB 1AR93 2QF7A 4UUSA 1TMF1 4HPKB 2WZR3 3ZMOA 2FUG2 1ULCA 3SEPA 3G1MA 2R1DA 2X29A 1MZBA 1RJ8A 5ACA2 2ZGKA 1LEMA 1NTCA 3J7MA 3P5JA 2UYAA 1RKTA 3KFWX 4XLEA 4Q2FA 4E70A 4A3ZA 1RC9A 1QJU1 3RJPA 2OTLI 2DYSH 1OLQA 1YE9A 2CYFA 3N9OA 2ZKZA 3HGYA 1EAH3 1QEXA 1GICA 4Y4RA 3S30A 1MDMA 5H9RA 5CFDA 4WM7C 1A04A 1VF9A 2EA2A 4BE0A 3N97A 4GAZA 1BI3A 3ZXDA 2H94A 5FXWA 2ZGMA 3B9CA 1JH5A 1HV1A 2LKSA 4LJHA 1LDDA 1W2NA 2FSWA 2RS12 1X8EA 3KV9A 1XRUA 1IPKA 4DW6A 1H6YA 4FAHA 4YIIA 1TMF2 1HCRA 3MPPG 1RZ4A 3KEYA 1SPPA 1XGOA 2IJLA 3PVEA 5FY8A 5A7PA 2QSFX 3KX2A 2VMDA 2YU1A 5T55A 2M87A 2DFIA 1J9IA 1ZGWA 5D4RA 3E5XA 1HRI1 2UZKA 3BPSA 4D94A 3TDZC 4YYOA 2XF5A 1MDMB 5CFDB 5DM6F 2EWNA 1HRI2 3UNPA 4II2A 2DA2A 1RXFA 3ZPOA 4C1XA 2R7RA 1IN6A 1U8RA 2JG8A 5ED4A 1IUFA 3WODF 2WUHA 3DPRC 3J7HA 3HEFA 5HOOA 4IOCF 4BE2A 4NHYA 1AWCA 2KA3A 3H3LA 2GNDA 4GMP1 5C4XJ 3FM5A 1GR3A 5K8SA 3JQXA 4AEDC 4A3BJ 5DD4A 5C4WA 1GZWA 1PUEE 3I2HA 1UMHA 3M3EA 4B7KA 1UAIA 4W4ZA 2VVFA 5TGTA 5JI9A 5IT3A 3QP5A 2CU7A 5CFDC 3S16J 1J5YA 1XU1A 3I2IA 5JZGC 4ZYAA 4L0ZB 4AQ6A 1UIKA 2VW0A 1TQ5A 3VKLA 2NAZA 4OU0A 1XDUA 1W8FA 1RUD3 1PZ9A 1U5TC 2XDVA 5A32A 2VE1A 3EYYA 2PI0A 2DTWA 1UFMA 2LC2A 4A45A 3D5OA 1OQYA 1UW8A 2VQGA 1ITYA 2W47A 1E5IA 4MO3M 1S72I 1GZWB 2O8QA 5E18F 4LK7A 5EFUA 3NAPB 1MZ5A 4KQ7A 2B9UA 4NJ4A 2BXZA 3AL6A 1CZTA 1T98A 3ML6A 1CAWB 1C28A 3O6BB 3HBZA 4LO6B 3PTRB 1N1SA 4IHWA 2RQPA 3MIFA 5BQTA 2VTXA 1J7KA 2R072 1A78A 2VCBA 2PN6A 5HI0A 2K02A 4WWCA 1F9KA 4F83A 3P9KA 3AP4A 4XLCA 2RDQA 2JRTA 2VMGA 3GTLJ 1W8NA 4HNTA 4HG6B 4HG2A 5BPXA 4AFDA 3SZGA 2NPIA 4A6DA 5FZAA 1IRXA 4B1RA 2JKBA 1GVJA 1PYVA 2W48A 4L9NA 2LYCA 3NW4A 1V5FA 2W24A 4LLLA 2JA8J 5C8WA 4D0PA 5LHGA 4G6QA 1I27A 3E1SA 2AREA 2QQ8A 2XC7A 2WZPP 4TZDA 2IXHA 1PX3A 2PA7A 3QQAA 2L9SA 2K2SA 4DEVA 2V4JC 3HZJA 1H2LA 2HZTA 2VBZA 1CVNA 4BQYA 3VYSB 4EQQA 4BL0B 1U78A 3ZKUA 3M07A 1NG0A 2A6ZA 4OQ8A 2R5ZA 1RUE3 2ELHA 1HDDC 2CV0A 3BG6A 1AXZA 1A8DA 3R05A 5LRSA 5KXEA 2XAUA 1VBB2 3QPTA 3VPRA 2VW2A 3WTSC 4BXUA 2FNPA 3TYJA 2YU3A 1H9PA 1PO23 4N53C 4CU7A 2ZZJA 2IXSA 4YW1A 5BNNB 5JMCA 3K3NA 3POSA 2XSDC 4L5IA 3BR5A 1K61A 4A3GJ 4MGIE 4B44A 2VVDA 3JSPA 2VTFA 3I2OA 3VDDB 4QQLA 4DBRA 2EXIA 1RUH1 5FLVA 3AFHA 2E1CA 3GBFA 3SCFA 1ENRA 2Z16A 4CCLA 2Q30A 4K2EA 3KVBA 3WU2C 4OI1A 2VXDA 5IK5A 2VR4A 3ZQHA 1YQ6A 4L11A 4JGZA 1T6BX 1XU2A 4E4HA 5T52A 4ABZA 4Y7NJ 2V1DA 4AM3A