3FX4A

Porcine aldehyde reductase in ternary complex with inhibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
325
structure length
325
Chain Sequence
MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEPVLLEEPVVQALAEKYNRSPAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALNKNLRFIVPMLTVDGKRVPRDAGHPLYPFNDPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase [NADP+]
publication title Structure of Aldehyde Reductase in Ternary Complex with a 5-Arylidene-2,4-thiazolidinedione Aldose Reductase Inhibitor
rcsb
molecule tags Oxidoreductase
total genus 101
structure length 325
sequence length 325
ec nomenclature ec 1.1.1.19: Glucuronate reductase.
pdb deposition date 2009-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3fx4A00
2PDQA 3R43A 4WDUA 3LNMA 2PFHA 3LZ5A 3ONBA 1IEIA 1XF0A 1YE6A 3P2VA 3GHTA 4HMNA 1T40A 3WBYA 2IPFA 3WBXA 3QKZA 4WDWA 4XZHA 2PDJA 2NVCA 2HDJA 1YNQA 2PDNA 2R24A 4AUBA 2PDWA 1GVEA 2NVDA 1J96A 1Z8AA 3LEPA 4XZMX 4FA3A 1EKOA 3RX2A 3H7UA 4YS1A 3F7JA 4QX4A 3CV7A 3CAVA 5AZ0A 2I17A 2IKHA 2WZMA 4JTAA 3O0KA 1PWMA 4YVPA 1RY0A 2IPGA 1LQAA 3UG8A 4L1XA 4WEVX 1Q13A 1HQTA 4JQ4A 2FGBA 3BCJA 2PDMA 3V0TA 5C7HA 4PUWA 4XVEA 1ZSXA 1RY8A 2IQDA 1RALA 2PDXA 4DBWA 4HBKA 3M0IA 3ERPA 1T41A 2HVNA 4IGSA 4XAPA 5JH2A 2IKJA 2ACSA 1YNPA 3O3RA 2FZDA 5HNUA 3UYIA 4XO7A 4ASTA 5LIXX 5LIYX 3V36A 1XGDA 2IKIA 3KRBA 3LENA 5LIUX 4WDTA 4JTCA 3UZWA 3UWEA 5LIKX 4H8NA 1ADSA 4PR4A 1Z3NA 3N6QA 1X97A 2HE5A 4LBRA 1US0A 1YE4A 2IKGA 3R8GA 2A79A 4DZ5A 5DANA 1S2CA 5JH1A 2CLPA 4LAZA 4QBXA 1Z89A 3WBWA 4LB3A 4Q3MA 2C91A 4JQAA 3H4GA 1ZQ5A 2HV5A 4I5XA 1EL3A 1FRBA 3RX4A 4R9OA 3GHRA 3UP8A 1S1PA 4GACA 1QWKA 2DUZA 4ICCX 1JEZA 3ONCA 4RPQA 2PDBA 3M4HA 4XVDA 4JIIX 3GHUA 2PDHA 3LQLA 3R94A 4ZFCA 1PYFA 3M64A 4WGHA 1QRQA 3LZ3A 2FZBA 3WG6A 3CMFA 4JTQA 3R8HA 4FALA 4XZIA 4GABA 1Z9AA 1A80A 3CASA 4PMJA 2ACUA 2PF8A 3V35A 4IJCA 3T42A 2IPWA 2PDLA 4JIRA 4DBSA 3BUVA 4PRRA 3S3GA 3LQGA 3VXGA 2INEA 3R6IA 1S1RA 4FAMA 2PDKA 3RX3A 3FX4A 2BGSA 3B3DA 2PD5A 2FZ9A 4GQ0A 2ISFA 3MB9A 3C3UA 2PDPA 1AH4A 2R9RA 4GCAA 1ZUAX 1S2AA 1PWLA 1R38A 1SM9A 1M9HA 3UGRA 3COTA 3EB3A 4PUUA 4LB4A 3CV6A 2IPJA 4WRHA 1MRQA 1C9WA 3DN5A 5HA7A 2J8TA 2I16A 2DV0A 2PEVA 2INZA 3DOPA 4JIHA 1X96A 3UZXA 4H7CA 3EB4A 3G5EA 4YU1A 4Q7BA 4XO6A 4L1WA 4EXBA 1XJBA 2FZ8A 3R7MA 3CAQA 2PDUA 3NTYA 4LAUA 2PDYA 4JTDA 4DBUA 2PD9A 3MC5A 4NKCA 4JQ1A 2PDIA 1HW6A 4YVXA 2HE8A 1LWIA 4JQ3A 3Q65A 2BGQA 3FJNA 2PDFA 1X98A 1Q5MA 3U2CA 2DUXA 4JQ2A 3GUGA 4OTKA 4IJRA 2FVLA 3EAUA 4JTRA 2P5NA 2PDCA 1AFSA 2ACQA 4QXIA 3GHSA 2AGTA 1OG6A 2F2KA 2ACRA 3R58A 1VP5A 1VBJA 3LBOA 5AZ1A 4GIEA 4FZIA 5KETA 1PZ0A 3UZYA 4EXAA 4XZNX 1UR3M 1EXBA 2IQ0A 4LBSA 2IS7A 4G5DA 3N2TA 3UZZA 3V0SA 1MI3A 3Q67A 4F40A 2HVOA 1AZ1A 2VDGA 4QR6A 2ALRA 5LIWX 1K8CA 3LN3A 1AH3A 3UFYA 4GQGA 1AH0A 2PDGA 2WZTA 3G1RA 3LUTA 4WDXA 4MHBA 5HNTA 1IHIA 3H7RA 3D3FA 1EF3A 3BURA 2QXWA 3BV7A 4YVVA 4PRTA 1AZ2A 2PZNA 3LD5A 5M2FX 4XK2A 4XZLX 1MZRA 2HEJA 2BP1A 3V0UA 1PZ1A 3WCZA 1ZGDA 2F38A 4GA8A
chains in the Genus database with same CATH superfamily
1OIMA 4WDUA 4DO4A 2WC4A 4DJFD 2VUYA 2DSWA 4U2ZA 4H6QA 1RQBA 4LU0A 5MF5A 3SCTA 2ZZ2A 2OEJA 3UPWA 5F2MA 3VM7A 1QPKA 4DF0A 4O16A 1KTCA 1H7NA 4MNJA 3BZJA 1TV5A 2A7NA 4AG0A 5CZTA 3VO0A 4S3DA 1BWLA 3BW3A 1IEXA 4E4FA 3VIFA 1M03A 1ZB5A 3G1AA 1R3TA 1BRLB 5EMJA 1TG7A 1TFVA 3SGGA 5A69A 3ZJ8A 3TLQA 1L0PA 1ME8A 1B9BA 2TMDA 4M0XA 3WQWA 2CLIA 2DZPA 1XIMA 1M7OA 4O52A 1I6NA 3WSUA 3KFTA 2DVXA 4GI9A 5DEZA 2IPGA 2WLYA 2P3ZA 1XIHA 3WQCA 2RH9A 2RUSA 1A5CA 1J0YA 1OCJA 1Q13A 2QCDB 3LCGA 2QJJA 1EH9A 5C7HA 3PJTA 1PCWA 4YCPA 1E51A 5JXQA 3WMBA 1Q3NA 1GG0A 3DXIA 1J11A 1MYRA 1XWYA 2V3EA 3LLDA 3AS3A 3PNZA 1NOWA 3XISA 1MW1A 5AC7A 3GH5A 3LI0A 1T0OA 2QPXA 3WLOA 1K8XA 1S2UA 5KZMA 3RMEA 4E2OA 2EG6A 4UQBA 1S5NA 1SUXA 1Z3NA 4MDPA 3RJXA 4J2PA 2ZQ0A 4LY8A 2Z0IA 1XHGA 1EJSC 3GYEA 3LGEA 1WOAA 2X42A 6ENLA 1A5KC 1Q6OA 1ZNNA 3MDWA 3ALFA 4W86A 2AAMA 2B7QA 3LRKA 4QG6A 5DT7A 2WNZA 1RK6A 3FKKA 1KBBA 4HU8A 1L6FA 3GDKA 2GVGA 4JQAA 2VGIA 2VR5A 3AUOA 2HNEA 8TIMA 5CZKA 3RX4A 3U5YA 2VXNA 4PODA 3H2CA 4O0ZA 1JEZA 5FAGA 1R3QA 2XGIA 2NX1A 5H1WA 3MHUA 3APGA 1MUCA 4K39A 1EDGA 4ERAA 3MSDA 1TRIA 1LYXA 1UIPA 3R94A 2F9RA 1GCYA 3E2QA 1XM3A 1KQZA 4L6HA 3T0DA 1AA1B 3UR5A 1C7SA 4XQ6A 1G6CA 4HZ6A 3UWZA 4UTMA 4UMAA 3W7MA 3TJ4A 7REQA 3ZLFA 4UTIA 1Y5VA 4GBUA 1QI4A 2WSPA 5L9FA 3NL2A 5M1TA 4UFHA 4NIRA 4XWUA 1NSJA 3N15A 1FUYA 3N3MA 1IXPA 4RZ5A 2PDLA 4GIRA 4KFPA 1NARA 2QIIA 4IQDA 2VD9A 2FGZA 4MJ2A 1O95A 4R53A 1J0IA 3GNNA 3ZJKA 1XLAA 2WKLA 5I2UA 1CGTA 3TNOA 1W9XA 4GQ0A 2PTWA 1US3A 2XH2A 3C3UA 4S3GA 4A8RA 4ROPA 2CZDA 3SQSA 1PWLA 3WFAA 4NAEA 5I3FA 2CFFA 4EPDC 1BLIA 3L0KA 1WOBA 3VILA 3EPMA 4LYKA 4B4HA 1FWHC 3OVRA 4PFMA 4GZIA 3SADA 1TV3A 2Y24A 3GXDA 4KEUA 1ZPTA 5JBFA 3G0XA 4UUIA 3HO8A 3JS3A 3BQ5A 5BU9A 2RJGA 2YDAA 2BFGA 2BXYA 5U4NA 3UZXA 1OX6A 5AYXA 2YL6A 1B1YA 2XSBA 3ITLA 1OK4A 3UVAA 3RLHA 3KZSA 2X0HA 5BWFA 4S3AA 2VFHA 4JIEA 1FBAA 2B7OA 1QK2A 1FCQA 1ITQA 3USZA 2XDFA 6REQA 4AD1A 3GQYA 3W85A 3URNA 3VPLA 2X1UA 4AX7A 1HP5A 2YDSA 4HNTA 3MBFA 4PTXA 4N6FA 4IMEA 3OZOA 3PBGA 3GUGA 3U0HA 4IG2A 4OV9A 1U1HA 3WBAA 1NOFA 4GO8A 4W7WA 3SIZA 2BASA 1AFSA 4REQB 4HCDA 4DRSA 4CCZA 2GUUA 1ZJBA 1JYNA 2QCCA 3AYSA 5D30A 3GFYA 7PTDA 1VBJA 3M16A 2GFTA 3GNOA 3I6EA 4EAYA 1LBMA 4C7GA 4G9PA 2NQ9A 4RZ4A 4EAMA 2ZXBA 1Y5WA 3VC5A 4C1LA 4PMYA 4DJEA 4Q8VA 3OBEA 2CW6A 1EXBA 1GKRA 4AX6A 4MPKA 1EYWA 2EPOA 2WKJA 4G1KA 2AAAA 3CHCA 1SSDA 1KFEA 2V30A 2Y6ZA 3S5NA 3OB8A 3WN6A 5BU6A 3T1GA 5KSWA 1KFJA 2DZTA 4N9BA 2OYKA 4C6EA 3WD2A 2BX7A 1YDVA 4JTKA 5DXXA 2RJHA 1M7PA 3KOWA 4M80A 3LTSA 3G1RA 4E8CA 2W62A 3B8DA 3I7SA 4Z1DA 4NYYA 1EOMA 5C9ZA 1GHRA 3OA5A 4D6GA 4FF7A 4TUFA 4DUVA 1S5WA 3EB2A 2YW3A 4PRTA 5LA2A 2ZVIA 3KM8A 5ECVA 1LLOA 2A85A 2VHLA 4O1AA 1E6QM 2F6XA 3PB0A 5CPSA 3H2EA 2WHLA 3ZLHA 4OWGA 1JYWA 3VNYA 3O8AA 1VFTA 1HJUA 3TV8A 5E0CA 1K7FA 1T8QA 2NT1A 3QFEA 1WB0A 1XICA 3P2VA 5DCEA 3GHTA 1T40A 4AWEA 4NQ1A 3TZNA 4KWOA 2XTKA 2VFEA 3SCUA 3QQWA 2DT1A 1H1YA 2ZUMA 1CXKA 2PRHA 3WNPA 2OELA 4P8VA 2P1FA 4ZFMA 1BSLA 3T6CA 3KTXA 3OJGA 3NQVA 3R79A 2OB3A 4KRZA 3AUJA 2IKHA 4AD0A 4DZAA 4S3EA 3WQFA 4W88A 3FVMA 1FFRA 3KTCA 3BAKA 5D02A 1BXBA 1VF8A 1VIWA 3KDOA 3KRUA 5BCAA 5SWUA 3TSMA 1QI5A 1CPUA 3BTNA 3P3BA 1WKDA 2GUYA 6TAAA 3LCFA 2VRQA 1UZ1A 5BOFA 3L9CA 3AI0A 3NQMA 3W74A 4QS6A 4A2RA 3E0IA 4I9TA 4X60A 1LTDA 3HG3A 4AC1X 3W7OA 3EX1A 1VB9A 4H9ZA 1OGGA 3AIWA 1H2JA 3LHTA 4BA0A 3CPGA 1H0IA 1TV8A 2J8FA 3G3MA 5I77A 1OYCA 4NZ1A 1PE1A 2L5HA 1HJSA 1VPQA 1W37A 3CUJA 5AN7A 4AWTA 1HJXA 1GVYA 4DHGA 3H6OA 4OGZA 4EKJA 2G95A 4HGXA 4X3ZA 5EMMA 3VIIA 3VTRA 2WAGA 3PPGA 4P8XA 4QDMA 1KM4A 1EQCA 3KHDA 1C8YA 2ZTKA 4W8LA 1V7AA 1QHOA 2WMGA 1JCLA 3TFXA 1DJWA 3VIHA 3WNKA 5HUOA 2AL2A 2G3FA 1WXJA 2Z2UA 4IWWA 1WA3A 4IGMA 3L0NA 5G1MA 2ICSA 1D3HA 4HD5A 1EWDA 2WMKA 3DHDA 5EMYA 1E4LA 3SJ3A 1XKJA 1G4SA 5A8GA 4MFDA 1JZ4A 3CPRA 3U2OA 4Q4PA 5K4ZA 3M5VA 1KRCC 2NX3A 1N8WA 3R89A 5B7YA 3KBWA 4RPQA 4NRSA 4DJDA 4LUJA 2Q02A 4QE4A 1A5OC 2X05A 3PZ9A 4JHOA 5EYWA 3LLXA 4R27A 3W1QA 3II1A 5G2IA 1JYVA 2D23A 3EKLA 4KRTA 1K9EA 4DPPA 3BMXA 2EF9A 3OHMB 4WGHA 3HQPA 4NNAA 5FAJA 1A4LA 4OIFA 4JTQA 4NJJA 2DQXA 4IFRA 1XINA 2E4TA 4XZIA 5KZDA 4GABA 4MPQA 1WAUA 1RH9A 1K6WA 4WSHA 1F5ZA 3O16A 4IMGA 3ANUA 3TW7A 4BQ4A 4GNVA 2E9BA 4BK9A 1U33A 1GOWA 1FWRA 3BC9A 4WK9A 4MF4A 4F79A 4MSSA 4PRRA 3HG2A 2E09A 2VCBA 4P7OA 1EJUC 3ARWA 4JL2A 4UQDA 3QR1A 1S1RA 5I3DA 1YW1A 2ZIDA 2ZX8A 3SN0A 1FWAC 1EX1A 3W1UA 5CSRA 1JPIA 3CZGA 4CNUA 3MB9A 1UKSA 3OGSA 3RLVA 4DB7A 1H7PA 4MKVA 2DH2A 4PZVA 2WM0A 4PTVA 3VUPA 1SM9A 1EUNA 3STFA 3EWXA 3Q94A 2H3BA 4HB7A 3WJXA 1J6OA 1LLWA 4PCTA 3VM5A 4PB4A 2ZUWA 1UD2A 5TD4A 4ATDA 3E0LA 4RE3A 4RNFA 2NV1A 4UTWC 3CU2A 5REQB 1MDLA 1MSSA 1XRTA 2YL8A 4RE4A 5CC5A 4B15A 4LEQA 3QEZA 2VC7A 1GORA 3K4DA 2E28A 1FCVA 4S3FA 4NNBA 4GZJA 2CCRA 2RFGA 1U2YA 4I3GA 2DV0A 3GXFA 1SZRA 2FJKA 1ZTVA 2WZEA 1NDWA 4XBKA 1A5BA 3VCNA 1XJBA 3KCLA 4DWSC 4IPLA 3C8NA 1BYDA 2D2JA 3WH5A 1R30A 4KMQA 5D03A 5HR7A 3IUDA 2OLAA 3CUXA 3FCPA 4P7NA 1P0KA 1GQJA 3BLOA 2G3NA 1IEQA 3WD0A 4BF7A 1P6WA 2FH6A 1PYMA 3STGA 4J7RA 2OYLA 4J9JA 5IXEA 4AVNA 1RXOB 3A5VA 4D71A 2OSXA 3H21A 5FOOA 2EJAA 2AGTA 1XLMA 5KITA 4JBRA 3NZPA 5DO8A 1VP5A 3H7VA 1XLDA 1WV2A 3GS6A 3N2CA 4JICA 4UTUA 4GZEA 4WSJA 3P62A 1FWFC 1KXVA 1B3WA 1QR7A 3W1NA 1JXKA 1REQA 2GJLA 2P3EA 3AXHA 1JGIA 3M44A 4KEMA 4UNKA 2VWSA 3UYCA 2CZVA 2GSJA 4FEZA 2WOQA 2D0FA 1F8IA 4L1GA 3TUUA 1Z69A 3MHGA 3O05A 4DAFA 3DBPA 4Q8TA 2PWUA 2PDGA 4HP5A 1DJZA 3HG5A 5A6MA 2OG9A 2W27A 5C9WA 3DHPA 4AY1A 2VYOA 3D3FA 3S8HA 2ALDA 2QXWA 3QF0A 1EJVC 4L80A 1GONA 3V7PA 4E4PA 3FYOA 3WLNA 5EPDA 3VU2A 2WHKA 4GI4A 2PZNA 3GG8A 4NASA 3N9KA 1MZRA 1ZBVA 4Y8EA 3P0WA 5CBIA 4MB5A 3RR1A 1W3LA 4GA8A 2ZA3A 1DJIA 4DI9A 1EO7A 2OO6A 3R43A 4J3SA 4P2VA 4K36A 4O4WA 4DYKA 3KEHA 4BWLC 4ZR8A 4PBFA 4QJ4B 3OYXA 2ON3A 1ZJIA 3H4WA 4GNKB 3L2LA 3LDVA 3IVSA 5HQEA 4U2YA 3F2CA 3PBUA 2V38A 2PAJA 3PN8A 3AWNA 1XH1A 4L4LA 3TMQA 1JQVA 1R3YA 1V4YA 4AXNA 3QV7A 5BROA 1VFSA 3KOXA 2QPUA 3WYZA 1Q63A 5H6HA 3GLCA 1FCUA 1CDGA 3HM7A 3LBMA 2ZX5A 5HPCA 1IT8A 2QDDA 5A2AA 3A3XA 3HFTA 3W29A 1WKYA 4H19A 1W5MA 1PIFA 1NU5A 5DLCA 2YSWA 4X63A 5HQMA 4IIBA 4C1KA 4RV3A 4GE8A 3BCJA 2HK0A 2NQLA 2PTXA 3NR0A 2FHFA 1WDDA 5EL1A 4AZCB 3QY8A 4DUXA 4W7UA 4I7VA 4LS1A 3ITGA 2Y2WA 1WDRA 3W01A 4KIRA 3MWCA 3CPUA 4AXKA 3TQ0A 5JH2A 3CT7A 1FWSA 5TNVA 1YNPA 1ISYA 1V6WA 5I6SA 2E25A 2FHBA 3KRBA 2JQXA 3G77A 4HZMA 2ISVA 1VJIA 3UWEA 4G2DA 4PR4A 4TVUA 1X97A 3W83A 1FHDA 1OQFA 1E15A 1EEXA 1GOOA 1A50A 3N14A 4J2MA 3WX7A 2V5KA 4MGGA 3W86A 1U30A 3TN6A 3C86A 1S2CA 4KRUA 1CI1A 3K13A 3TOYA 1ZL1A 2FIQA 4ATLA 3T07A 1IWAA 2OODA 4LWWA 5LHEA 2WVVA 2J4GA 4UQAA 3TYDA 2EKCA 3IUIA 4CQ9A 2PGEA 1AQ0A 2XVKA 3CV1A 4IXHA 2ZE3A 1BYCA 2GL5A 5F4WA 1O68A 3GZAA 1EJRC 1UD3A 4LT9A 4Z2IA 1FH9A 1WDPA 4DM2A 4UBPC 3M4HA 3TIMA 4AIOA 3UWYA 2KAUC 3G1SA 4LV9A 4LF2A 1QOQA 2E9MA 3WQ4A 4ZFCA 3NQEA 1JPHA 4MY8A 3TX9A 1JPMA 4CEUC 3LZ3A 3H70A 4IP5A 3L23A 4UR7A 1UJPA 1MWOA 3E1F1 4GVGA 1FWNA 3W25A 4Z2GA 1ONEA 3L0GA 1VEOA 1B9ZA 1K3UA 3LXCA 3FJ4A 1PKNA 1DWJM 1MUWA 4PUNA 1W3TA 2PP1A 5CXPA 3KWSA 1J10A 1IYXA 1J18A 1H7RA 4W8AA 2WNWA 4FIRA 4WCJA 2IW0A 1HL9A 3R6IA 4TX8A 1O5XA 1SVDA 4GY0A 3KW3A 3VD4A 3J7HA 2PDKA 3BGGA 3DBNA 3KBJA 1OD0A 4QNEA 2XU2A 3EEZA 1CGXA 2ISFA 1KBJA 1TPDA 4DEFA 3C0QA 1R38A 1W8GA 1LJYA 4J28A 3L4ZA 2OKTA 1JYXA 1TMLA 1A5LC 3C52A 5EMKA 2ODOA 1P4CA 4Q8WA 2ZA2A 5G2HA 1A3XA 5CG7A 3B9AA 4NT0A 2WO5A 5M3WA 2Y4SA 1UHVA 1PKLA 2CLEA 1RP8A 2FTWA 5DN1A 1EYEA 5A5WA 2IQTA 5HOSA 1E73M 4PEEA 1BRLA 4JTDA 3GBDA 1BXNA 1U22A 2UY4A 1YXCA 3UESA 5ABFB 1NDVA 1UWQA 2QJMA 3EX4A 1VZWA 3E38A 1PTDA 2WMFA 2AQWA 1ISWA 2OCZA 3TMLA 4JQ2A 5A6BA 3KBMA 1G4EA 1R8LA 1CZ1A 1LT8A 1TMHA 1KTNA 3N9SA 3TK7A 3RF9A 3NZGA 1UA3A 3KL3A 3TTOA 4GUHA 3RU6A 2NV9A 1VHNA 3ARYA 3MJMA 2DFAA 4N0RA 1PZ3A 3M5YA 1MMFA 3SO7A 5I7GA 4AD4A 4KESA 1ZP3A 3QQ1A 3DG3A 2HJPA 1PCKA 1E0XA 1LCOA 1V3IA 3PTKA 1KLZA 3IRDA 1JNEA 1C93A 4A22A 1EPVA 4GUIA 2QMJA 1J2WA 1AZ1A 2PP3A 2BBFA 2EEXA 4C6OA 3NG3A 4DNHA 2Z4GA 1G69A 2WZHA 2XINA 1JDAA 4H8HA 2XVPA 1MQRA 3PZNA 3U6WA 3PFMA 4NRRA 3A9BA 4LQ1A 1EDTA 1ISXA 1IHIA 3NYZA 2PWFA 4WUIA 2XN0A 2XFFA 1W1PA 1TR1A 1BTCA 1OYBA 1A5MC 5F1UA 4H7VA 2F2HA 3M0XA 3M43A 4Y7EA 4XK2A 3LPGA 1J8VA 1PXGA 5XIAA 1PZ1A 3A12A 1RA0A 3WNLA 2UY2A 1N8IA 2YGYA 2GUBA 1W3KA 4W4QA 4O13A 1QI2A 1HTIA 1V51A 3M7SA 4C5YA 2P88A 1P0NA 3CXOA 1NFPA 1KWGA 1E6ZA 2INFA 3P8JA 4GHRA 2VGFA 2YXGA 2ZRXA 3I4EA 3L2MA 4GIYA 4IPJA 3THAA 1UOZA 1CGYA 5D2WA 4FX8A 5C55A 3ZQ9A 1TSIA 3BMWA 5FJOA 2BV9A 3QH2A 2AOSA 3OO2A 4QLJA 4JTTA 1Z8AA 3TN5A 4PTWA 1VH7A 2GSEA 8CGTA 2RGMA 3H7UA 4HOZA 4YS1A 2ZYFA 3LM3A 3CV7A 3G6LA 1WP6A 1TPC1 4ADUA 4AHPA 5A6TC 1NWUA 2BVDA 3ALGA 3DFQA 1US2A 4LSBA 1LDCA 3BSMA 2YA0A 4BQ2A 1TCDA 2Y61A 5J8LA 1O6IA 3V1HA 5E1QA 4H9MA 3BLPX 3S83A 2Q3RA 1M1BA 1W1ZA 2YL5A 3KVJA 3QR0A 3AMDA 5AHEA 3MZ2A 1MEWA 5PTDA 1VPYA 2C14A 4QG9A 3CZ8A 2POTA 5C8BB 3CQIA 4MMWA 4Z08A 4D6IA 1XIDA 4RDVA 2CLFA 2PODA 2QJGA 2WMHA 4I6KA 4M24A 1ZBKA 5D33A 2PWHA 3APYA 1XGDA 3NOEA 5C71A 3SAZA 2BY3A 3AHYA 1EJ7L 1A5NC 2X1RA 1TTIA 4AMCA 4H9UA 4XKMA 3MUY1 5J5RA 3TOPA 1IQ8A 4HN8A 3AMLA 2FJUB 1VLWA 1H0GA 4PCPA 2O9TA 3OP2A 3SUUA 3VGEA 4GCXA 2XH7A 1C8VA 3BSGA 4O14A 3RPTA 3LTYA 1A4MA 3NQGA 1YPFA 3MP5A 1ZFJA 4DXVA 4N7QA 3W7NA 4DYEA 3IGUA 5FD0A 4YTQA 1QW7A 3FIGA 4R88A 4IUOA 4RNHA 1BQGA 1J0JA 2BVYA 4I5XA 3LGDA 1I2NA 4REQA 1YPIA 2MNRA 1I0DA 4IL0A 2X0SA 3HQNA 3LTPA 1NTHA 3F5LA 5XINA 2E67A 3GTHA 3VC6A 5FSDC 1NDYA 2BODX 2QCFA 3VNDA 2PDHA 4GI8A 3LQLA 1XIBA 3TAKA 3NOYA 3EXRA 4IIHA 2TYSA 4Q33A 2GJXB 5HATA 3UW6A 2A1YA 1O12A 1VGAA 1PX3A 3NWRA 2I14A 2JK2A 3FEQA 3QN3A 4S2CA 4O10A 2DZXA 1O66A 3CASA 1QAPA 1WPCA 3TW9A 1LT7A 4IQLA 3N73A 3F2BA 5AB3A 3P67A 3MMDA 3GM8A 1YYAA 3CTTA 4UIOA 1M04A 2J9XA 5GJPA 3KX6A 5G4WA 3LMYA 4NXKA 3E12A 3WLPA 3VKCA 1A47A 3EKGA 4GQRA 4QCEA 5K7JA 5BWAA 3UXLA 3CMGA 4UWMA 1BYAA 4HTYA 3CJPA 1AMKA 1VBUA 3Q4DA 1P5BA 1P43A 5ECUA 3ARQA 2DVTA 1BF6A 5CPTA 4HSOA 4RR4A 4DVOA 3NL3A 5E9AA 1ISVA 2R1MA 1E1FA 3RR4A 1BXCA 1PVNA 3JUGA 1QDSA 4RV8A 3P80A 4AIBA 3CT2A 3GWQA 6CGTA 2IPJA 2ZZ6A 4ZSUA 2OZTA 3VIOA 3C2EA 5CC7A 3GVGA 1R7AA 4AW7A 4EK7A 2H3DA 1QPQA 4GC3A 1RJPA 3JZEA 3AIRA 3EWUA 2W67A 1UBSA 1UCWA 2V5LA 4J3TA 3HPFA 4TX6A 2QUMA 3IGXA 3PAOA 4GH1A 3G24A 3HMJG 4JQ1A 3TTSA 1TQXA 2Z1BA 3TSDA 4JQ3A 3Q65A 2P10A 2EBNA 2Z26A 3BV4A 1O5KA 2OGYA 5DRCA 4H6RA 2X2GA 1AD4A 5F2LA 3DECA 3FKRA 2WJFA 5KMYA 4US5A 4IJRA 1KCZA 4JX4A 4WJEA 2FPTA 4DZHA 1FH7A 4B5UA 3BAJA 3GSMA 3USBA 3LHVA 4MFEA 3SCNA 1AQMA 1QNQA 3GXPA 2J74A 2FKPA 1OCQA 4ACZB 3BOXA 3M46A 5FF2A 4DJED 5D32A 2DUAA 3NM3A 2B31A 3OGVA 4MWAB 1NDZA 4FPSA 1QO2A 3MCMA 3V0SA 3D0CA 1XLIA 4L4PA 2PCQA 4W84A 4L56A 4ZXLA 5F4SA 4KFNA 2VUNA 2OR2A 3QV8A 4HNLA 4DO7A 1E9IA 1SPQA 1QVBA 4HNVA 3EA1A 5GNYA 2NUYA 1W8SA 3NSXA 4PN2A 4OKDA 5IBXC 3N29A 4AEEA 3E02A 3IIOA 1E6RA 4F8XA 3H7RA 4PSPA 3M6YA 1CYGA 4TTUA 2G3JA 1OVDA 4HKPA 1PIIA 1VYRA 4UTKA 4P7QA 3S5OA 2WWCA 5BMXA 3AALA 1RAKA 5D8ZA 3ZXWA 2PPGA 3AS1A 4O1FA 1TPB1 3XINA 3OG3A 2QNEA 5ENLA 2E8ZA 2HEJA 3DFSA 3SRFA 1L6YA 3WDJA 3VX0A 3I10A 2OEKA 4CQ8A 4ZO8A 4L6DA 1IT7A 1E6SM 1DIKA 1YPXA 1C7TA 3MMTA 4WOQA 3B40A 1HGWA 3VAVA 1N2VA 3NVTA 3PZMA 1UPPA 3F5KA 1AUSL 1UWRA 3WBXA 4ES4A 1F61A 2D24A 3R1ZA 1VRXA 1SQ7A 5I00A 2WVSA 3EXTA 4E3TA 3AJ7A 2ZXDA 1TTQA 2J78A 1TJ0A 5T26A 3BOFA 4V15A 1C8XA 1FDZA 3URQA 1PTAA 3S46A 2A21A 4QJ1A 2I57A 3WF1A 2PDWA 2ZVRA 2J7FA 4Z42C 3PG8A 4FNQA 4TVDA 1EKOA 1VCGA 2DZWA 4UTFA 4JYEA 3DZ1A 1NVMA 2OSWA 5J04A 1XBVA 2V2HA 3G8EA 3GY1A 4Q4RA 3GO2A 1H7XA 1BVWA 1E9LA 2QUTA 2Z6JA 3U9IA 3QR3A 3LM7A 5IM51 4ERGA 1CT5A 1TRDA 3FV9A 2PDMA 4HU4A 5HWNA 5BYWA 2H8XA 1RY8A 4U5KA 5AYBA 3W2JA 1JUEA 5GPRA 4A05A 4GISA 1CENA 2WC3A 2OOGA 4HBKA 5KZ6A 3ECQA 3T55A 1ELSA 5I23A 1V77A 1U1UA 6TIMA 3WJSA 1J5SA 3UYIA 2JKAA 1SR0A 1VRDA 5KEZA 5I3KA 1OY0A 2W3ZA 4K37A 3GYCA 3G1DA 3TFCA 5F7UA 3GBEA 4MB3A 4JTCA 3M0VA 3IANA 1N8FA 3TWAA 1VFUA 1QW9A 1XLGA 3MYPA 2W61A 4LBRA 5D04C 4PE8A 5RUBA 2FZMA 4HK6A 3MDUA 4I90A 4C6FA 3T0TA 5EB8A 1QNRA 5DANA 2EPKX 4FX6M 4WOZA 3HOJA 1VCVA 1DV7A 1R6WA 3A4XA 2VELA 2QGHA 4GUGA 1XR2A 3C8FA 2Y8KA 5MHBA 4QE5A 4PMQA 1NJJA 4M3PA 3L4VA 4Q3MA 4X9YA 4W87A 4D1IA 2YFOA 3GKFA 1MW2A 1DQUA 3CHEA 3MMWA 2I1OA 1MXGA 3GNXA 1Y8BA 3ZMRA 2QVHA 1EJTC 1H61A 3I4KA 4V1XA 5FESA 4DJDD 1W1A1 4I5UA 2I5QA 2Z28A 2BY1A 4MDOA 3WF0A 3ABXA 3ZIZA 3IRSA 2CBUA 1PYFA 2F8QA 2WNNA 3M64A 2PA6A 1VIZA 3TYZA 1XC4A 2XN2A 2PE4A 1S46A 1JRCA 1XYFA 2OSYA 5CZJA 4IMCA 5BZAA 3AFBA 4QP0A 2PS2A 4EE9A 1IIGA 1OC5A 1FWGC 2CXEA 3VNKA 3K1GA 1HJVA 3MP3A 3CNYA 3A23A 1FX6A 1T96A 1KRMA 2BGNE 3DHUA 4HJFA 3UZ5A 8A3HA 1XSIA 1V6VA 2G3MA 2R94A 2DU2A 5TF0A 2FTPA 5C54A 1XV8A 5G4EA 1XD0A 4FOUA 4GYPC 4DBSA 3SJNA 4CN4A 1OC6A 4XD4A 2A3AA 1B3OA 2IMRA 2C0AA 3PTQA 3MKCA 3W02A 3ITYA 4X2RA 5LNWA 1R2RA 1DWIM 3Q2DA 1NM9A 3PANA 4HA3A 3O1NA 3W2UA 1Y7VA 2HVMA 3S2LA 4ORIA 3CH9A 3MVTA 3S9IA 2NSXA 3EWYA 1XRVA 4WSKA 3WUEA 3T4CA 1Q6DA 1H62A 2CETA 4C6MA 2HSAA 1OK6A 3LPFA 4G7FA 1Z32X 2E6DA 3B0PA 1CGVA 4CQAA 1KTBA 2CZ5A 4LC8A 1YLVA 2BNJA 1F05A 4Y9AA 2GQAA 2J7BA 3KUMA 4Q8OA 3AMKA 3W23A 1DBTA 1TA3B 3AIUA 2VFFA 4NZ3A 2YLLA 2HPMA 1L6SA 4LYPA 1UZ4A 1DWFM 1H1ZA 3VGHA 3TSBA 3QHOA 1F6KA 4JL1A 3T2QA 2OZ3A 2CYGA 4GINA 1HW6A 1Q6RA 1O4UA 3L4TA 4HU3A 4IFOA 1Q5MA 3VGBA 4NAFA 3HURA 3TAOA 1MXDA 2DJXA 3N2XA 3TEVA 2YFNA 2QT3A 1GTHA 3H24A 7TIMA 4OE7A 3KP1A 2Q3OA 3EWZA 1TPH1 1BSIA 3MT1A 1KXHA 4V2XA 4AZCA 2J6VA 1KQYA 3CIVA 1EGMA 4Q4KA 5E93A 5AZ1A 1ICPA 1EJXC 3HGRA 1RCQA 3UJ2A 4K8HA 1I75A 2XSXA 3SB0A 4E2BA 2YDQA 2XIQA 1UR3M 4UR9A 1LBLA 4HT3A 2IQ0A 1RPKA 3UA3A 4GMEA 1GVQA 5T91A 1ITCA 3TYCA 3WLSA 3Q67A 1UC5A 4P8WA 4PFHA 2NXGA 4A35A 4ZQCA 5K2ZA 3PS7A 3LHWA 2X16A 5LIWX 1XPGA 3UFYA 3MJYA 1SMAA 3PUEA 4CCDA 1LQ0A 4FR6A 1HGYA 1TJ1A 3WK3A 5HNTA 3EA2A 1XIGA 1JF5A 3HMCA 4MY1A 3E2SA 3VIPA 2RGLA 4WD0A 1AG1O 4JZ5A 4FLQA 4OBSA 3LD5A 4PMZA 2E68A 3SM0A 4XZLX 3OVQA 2XVNA 3JW7A 5FF7A 1KGWA 1JNDA 2O4QA 1LQ2A 1H49A 3POCA 3UT0A 4B16A 1VFOA 1WZAA 4BF5A 1XQLA 5AHLA 3RILA 3OZPA 5FJJA 1F6PA 3BARA 3QKZA 5IHRA 4IPPA 5DX7A 3M0MA 3WUBA 2J7HA 1FA2A 4YN5A 3W28A 3W7QA 4JFSA 4BF9A 4K8GA 3AJXA 4PBGA 1VENA 2XN1A 1TYGA 1RVGA 3BO9A 5GJNA 4FF5A 2DH3A 2HRWA 5CKSA 2D3LA 2WZMA 1EPXA 5D2TA 1DIEA 1ICSA 3ZOAA 3ZVHB 1VJZA 4E2VA 4ML9A 3H53A 3V1PA 3DYPA 1TUXA 1UP0A 2HXTA 5DXYA 3NO1A 4PEKA 1QHPA 1ZS2A 3FJLA 4CEXC 2HPIA 3V0TA 1XLLA 1LF1A 3NQ2A 1TR9A 1NF7A 1KWKA 4GVHA 1RBOB 4RDZA 4YTTA 3SCRA 3IJLA 1B3ZA 3GIQA 3WFZA 4JGDA 3IJ7A 2NQZA 1WBHA 3PZGA 4GLEA 1V3JA 1XFBA 2FZDA 5HNUA 1NF0A 3I3BA 1NFBA 3NCOA 1AQHA 3ES7A 4G8TA 2VC6A 1ALDA 1BTMA 1DJGA 3EGJA 1FHVA 1CCWB 3GW0A 1GW1A 1E6PA 4IH3A 3U3HA 1ML1A 3O15A 2DVUA 2Y5EA 1XDJA 5ABFA 2WSRA 3O9NA 3WLQA 4E5TA 4M29A 5AYYA 1W5QA 1ICQA 1QW8A 2CESA 5I03A 1EZ2A 3QJAA 3RFAA 1ITUA 3GNPA 4Z1BA 2EHHA 4IX2A 1B57A 3VDHA 3PG9A 2CLHA 4H01A 1TIWA 2D3NA 3MANA 3N6JA 3VI2A 2P0OA 4XUYA 3POHA 2FH8A 1Z48A 4ICCX 4ZSTA 3WDHA 3NA8A 1JQXA 1JCMP 3CK5A 2PDBA 2AL2B 3ABZA 3BAXA 1MNSA 3FDGA 3FXYA 1FWIC 3VCRA 3AC0A 1RQEA 1KC7A 3ZYZA 4LAOA 4HNUA 3IEBA 2X7VA 1LL4A 1L8NA 3GXMA 4GBDA 1JR1A 2I7GA 3M41A 3WZ0E 2VEKA 1PBGA 4M6UA 4FR1A 5DBTA 5HJLA 4CD5A 1A5UA 3WK0A 4HK7A 3CBWA 2JKPA 4ICMA 4GQQA 4B9ZA 2GGIA 1TWSA 5LSMA 2Y85A 3NFUA 4M6QA 1V0LA 3GC5A 3LI1A 4AZ6A 2HNHA 1UR0A 3OTRA 3WLMA 2O92A 4DBEA 3VDCA 1VFMA 4H9TA 1XH2A 2Z1VA 4XIMA 1E40A 1QNPA 1R86A 2XIJA 2VDIA 3H2OA 1EA9C 4CNPA 4WVXA 2WWDA 2G96A 4INFA 3SCVA 2E1DA 5BOEA 5CC6A 2R9RA 1CXEA 2G0WA 1S2AA 1SW7A 1LROA 3NSMA 5LNVA 1M9HA 3PHAA 2X09A 3INPA 3M9YA 3NQ8A 4IFKB 1V0NA 1PS9A 3THUA 2BWGA 1A0CA 2HQAA 1JZ6A 3HV9A 3WQVA 4RX0A 1S5MA 1XKYA 4D6JA 1CW2A 3OHIA 1IIHA 5H91A 5AC8A 4ALDA 4O8AA 4LRSA 1XDMA 4LRTA 1V3MA 3F5JA 2Y63A 1KLYA 3OA3A 3M0LA 3OIHA 3QKEA 2C71A 2QCGA 3VMPA 1IE7C 2FZ8A 1HXJA 1EX5A 4M1BA 4IUGA 2HTMA 3LS9A 1YHTA 4S3KA 4XSLA 1XCXA 4WKFA 1WXZA 2Q01A 5G4HC 5BRQA 2IXVA 5FIPA 2XFRA 3G18A 3LSCA 3HGJA 4EANA 4LF1A 5A6BD 4LS0A 4LUTB 3NO3A 2VNCA 1N82A 2D22A 1A3HA 2CNCA 4JTRA 4JN6A 2Y88A 1YTKA 2R6OA 4B5VA 4PA8A 3G3DA 2AQOA 2ANUA 5CPLA 1E0TA 2DZSA 4C6LA 4M81A 4X0VA 3QZ6A 4PUJA 4LANA 1KXTA 2VM8A 4XZNX 3WLLA 4ADSA 3LXAA 2OGJA 2NWRA 1NIUA 3CZEA 3KAOA 7A3HA 2HCVA 2W0UA 3DFYA 3EWBX 2IS7A 3SFKA 3SRDA 3WENA 4P7LA 3BLFA 4NSBA 3N11A 4QFUA 4G5DA 4W5ZA 4A2SA 5HNRA 2VRJA 4FMVA 1MI3A 3DHFA 3ABQA 1GWJA 3PPFA 1RVKA 4F40A 4U31A 4YXGA 1P1XA 3W1XA 3C4UA 3T44A 2YB1A 1Q7MA 3LN3A 4LPCA 3FLUA 3PJXA 1UC4A 1OF6A 4WDXA 5I07A 3SURA 1REQB 2OZ0A 4E8DA 2VEMA 4AFYA 4JFTA 4IIFA 4XAZA 1OFRA 1PKYA 3NGJA 3FOKA 4GD0A 4BQ5A 3H26A 4AVFA 1VCFA 2RDUA 1KGXA 3DG6A 3QMRA 3BGJA 3WF3A 4FNPA 1UR9A 3BOLA 3AIEA 2Z29A 1TJRA 4R5EA 4JS3A 3T08A 4RZBA 1RSCA 1DORA 4KBXA 2F38A 4AY7A 1CGUA 4QEHA 4CUCA 4KGLA 4I6VA 5T9BG 5LNUA 2AL1A 4GK8A 3OLDA 2F7FA 4NX5A 2RHGA 1K1DA 4JHZA 2IPFA 2J8GA 4K8EA 4F9DA 1AVAA 3RPMA 4DJFC 3S6OA 3GG7A 1QUMA 5HBFA 2ATMA 1P0BA 5M03A 4CN6A 3VMNA 2ZCGA 5XIMA 3TVAA 4DWSB 1NEYA 4TXEA 2R1NA 1SO3A 3H2FA 1V6XA 3RU8X 5FEXA 1X8CA 1V0KA 3QTGA 4Q8PA 4FA3A 2CC0A 2XIIA 1QMLA 2X7WA 3BLEA 1CXHA 2UV8G 3CQKA 5C70A 1B2YA 4I7WA 1T5AA 2VKZG 3D5HA 4ZO6A 4PULA 1YDOA 3EMQA 1G67A 3UA4A 3DFTA 3VOFA 1P6BA 1ONWA 2J13A 3DKJA 1GQLA 1W17A 2OX1A 1O1HA 1XRSA 3AHZA 1JDDA 4C6PA 1ZSXA 1B90A 3S2JA 3HTWA 3VGDA 3U4AA 1PDYA 1DWAM 4JDBA 1W1B1 1XIIA 4YIWA 2AMXA 3VD3A 3ARZA 4IGSA 4XAPA 1TPUA 1W3HA 3FYYA 2E0PA 4QCFA 1VJSA 3V36A 6A3HA 1NY1A 4JYFA 3QY7A 1V08A 4P8UA 1H60A 2OKOA 1AL8A 3KOZA 4KKXA 1QCWA 2PTZA 4N4QA 1PHQA 1HKVA 4IIEA 2NV2A 4EP8C 3SBFA 5EBUA 3RJYA 4GJJA 3KVMA 4J3ZA 1MW0A 4URIA 3K5XA 3VNMA 2G41A 1E6NA 1HKMA 1IXOA 3DG7A 4WQ6A 3UCDA 2V6AA 4NU7A 4NZCA 4UMBA 3S5SA 2YCKX 3APTA 3SRHA 3W7JA 4PB3A 2WHMA 3EX3A 3WQ8A 2E40A 1LOLA 2OOFA 3MWAA 4JKMA 3W2KA 4HNNA 3W7HA 2W66A 3IV3A 1QHZA 3SY5A 3KP0A 1H7WA 4BI7A 1JPDX 3ONCA 2AQVA 3OVGA 5HJXA 3REQB 4B92A 4TU1A 4HJWA 1UH2A 3EDJA 4N42A 1XLFA 2QYGA 3RIKA 4ACZA 4U5IA 1G7UA 4DAIA 4K38A 4MWAA 1XUZA 4M6PA 1OFEA 2Q8LA 4YTUA 3W84A 1JGMA 4JFWA 4DYJA 3VE9A 3ZVIA 1WZMA 3FVDA 4LXFA 2AKZA 5CZSA 2G3IA 4O1BA 3AXKA 1UUMA 4HNCA 1R3VA 5LNRA 3ZWSA 1PZ2A 5HNNA 4PGLA 1ZBWA 4NI8A 3B8IA 4ICNA 5AFDA 4FAMA 2D73A 3YPIA 2BGSA 4JIQA 4YMZA 3VMOA 3AZSA 5CQ1A 1F7BA 3LA4A 1UWIA 3F1QA 1E3XA 3CS2A 2CXGA 3MKVA 3O6YX 4TTGA 1F4AA 1XI3A 1Q45A 2OT1A 3H2AA 2D20A 3G0UA 1FWWA 3W73A 1E6XM 3BSHA 1D9EA 5HQLA 2VZTA 1LWHA 2YCLB 1DJYA 1J79A 2E8YA 2OJPA 1KNWA 4IGHA 4WRHA 3SY1A 4IHCA 1RJRA 4RL3A 2QCNA 1A0DA 3R12A 4TO8A 5MKGB 1G5AA 4IQJA 4XUGA 3E0WA 1O5RA 1ONRA 1X96A 4OECA 4H7CA 1JUKA 3V4BA 1LRNA 3C0LA 3DGRA 3NDYA 5LYRA 2PDUA 2J79A 5C2CA 2V5JA 2F61A 2X2YA 1AJ2A 3OIXA 5BXSA 2WCSA 3EX6A 3ZJ7A 2BY2A 3FHAA 3G1YA 4QLKA 2X1IA 3AROA 4E2DA 2BGQA 1X98A 2V3GA 3WKZA 4UB9A 2V5DA 1UMLA 2DSKA 4B2DA 3DENA 1LG2A 2HWGA 4US5D 1K4GA 2QHAA 5I09A 3NEVA 3B8SA 1OG6A 4QJ5B 1QBBA 2VEPA 4GFSA 1JPKA 4TV6A 1DPMA 2QPSA 1CX9A 4QNWA 4H9YA 2XZ9A 1HKJA 5D37A 4HSHA 4LUIA 1Q4WA 2WQPA 4FP1A 3P5ZA 4IPIA 8XIAA 1E5NA 5CGTA 4HHLA 1EF2A 2UY5A 4X22A 3TXVA 3ZLGA 1H4PA 1LM1A 1TVLA 4Q6JA 3ICJA 3MI2A 3L66A 1FQ0A 4Q8QA 5HWMA 1XCWA 1MO0A 3H8AA 4BZYA 1WUFA 2D0HA 4YLWA 1F07A 2HBXA 4MHBA 1IEWA 3AIQA 2QULA 5BRBA 4HYVA 4TOQA 3I6RA 1ZHAA 1PSCA 2VCAA 4FXJA 1M6JA 1UKQA 2E1WA 3H54A 2YXXA 3ANVA 3CUIA 5F2IA 3OG2A 3R0DA 4KWUA 3ZZ1A 1S3HA 2ASHA 4OZOA 1XBYA 4GG9A 5AHFA 2ESCA 5JBDA 3OW1A 5D9OA 2XSAA 3BMVA 4R3UA 4CU6A 4XZ9A 1DXFA 5FEZA 5M5DA 3NVDA 4UQEA 4FOJA 4ZZ9A 5EMUA 5HMSA 4XV0A 1K8YA 3W26A 2ZOXA 3PPHA 3WL0A 5CSUA 3VA8A 2HDJA 4O0QA 3VFCA 2R24A 3FHQA 1DHKA 3NPUA 3OLIA 4LBUA 1HT6A 4AEOA 3TZFA 3UJFA 3WD3A 2UBPC 3E2VA 4PUDA 2EG7A 4WGXA 1XPYA 1KM2A 6XIAA 1GG1A 4GYFA 1DTUA 1E0UA 3N4EA 3CH0A 3VIJA 3O0KA 3N2MA 2Y7DA 1OYAA 4AMAA 1GOKA 1I4NA 1XQKA 3C3NA 2O0TA 4QDPA 2XVGA 1TZ9A 3MYOA 3NPXA 3S4TA 1RZMA 1DIDA 1S2VA 1JDFA 4GVFA 4UXDA 4Y90A 3VOHA 3A4AA 2PSNA 2XWEA 1EP2A 2Y0FA 2PDXA 4NXSA 1S3TC 4J40A 1P1MA 2PU1A 4B5WA 1G4TA 3IJQA 1FXQA 2GZXA 1VYPX 2CHOA 1X1OA 4QROA 1G7VA 3OLGA 4RKAA 4Q32A 5C2GA 3VZYA 4AHQA 3BJSA 4YCOA 3CL6A 3P14A 3QPYA 2CZFA 4KFOA 3IJ8A 3LCLA 3CHVA 2WC7A 4PH6A 2Y7GA 1AW1A 1SFTA 2AMGA 4KWSA 1TA3A 3BAIA 1EOKA 4JCMA 4FLSA 5A8PA 2YIHA 4HPHA 3THCA 5F4XA 1M5WA 3MTWA 1KFWA 4C6KA 2W91A 5LA0A 5K4XA 3CEUA 2CBJA 2Y70A 3JZUA 2WSYA 2FDSA 4HPJA 3HQOA 1J9YA 1U1JA 1FWCC 1UQYA 3M0KA 3KS6A 4BKNA 3PTMA 3VE7A 1OABA 1R9YA 2C91A 1HL2A 2Z2BA 1ENUA 3SCPA 3UCCA 1FRBA 1TJ2A 3MV01 1EC8A 5DMLA 1DQXA 3GXIA 3FK4A 1EP1A 4RJEA 3EPOA 4PCNA 4NJIA 3A5FA 3W6LA 4JKLA 3LLFA 3FS2A 3GR7A 3TTYA 5C7VA 5D05A 2X40A 2ZWYA 1V6YA 3TQVA 1R87A 1YTEA 3LX9A 4PMJA 2A6LA 2GGHA 3V35A 2P8BA 1V6TA 3GVVA 4MJMA 1XYBA 2RDTA 3UZJA 3MVIA 1OADA 4XSMA 3U4FA 4JKKA 3CUHA 1JD9A 1Y65A 3GNDA 2J7GA 5CAHA 2I5IA 3F03K 4N4PA 1OFPA 3VXGA 2INEA 4HN4A 1YDYA 1UWUA 3DAQA 1OFOA 1WKFA 2H6RA 4Y9OA 1UR8A 5EY5A 3CUFA 3BLKA 2HS8A 4M56A 4XD6A 1DL3A 4Q4OA 1B54A 2WB5A 5EFFA 4S3CA 3B0UX 5EBAA 1H7OA 2V8ZA 1IR1A 1ZENA 1SO5A 1JCJA 3BW2A 1JZ2A 1VBRA 2I56A 5JU6A 1J01A 3WD4A 3WNNA 1K9DA 3VCCA 3QPZA 4GKLA 3U57A 2WPGA 3CV6A 5I79A 5FKYA 5G5IA 1KM0A 3HV8A 4JAWA 5TIMA 4X61A 4JR5A 2GWGA 2ZUNA 4TR9A 1CEOA 5JQ9A 2INZA 2ZUTA 3TJXA 1Y0EA 2DSZA 3U7VA 3LNPA 3TLLA 1QNSA 2WPBA 2V67A 1V3LA 4AH7A 1XG4A 4ROQA 4K1WA 2EXOA 4WKAA 4LAUA 4Y2WA 1HF6A 3MPGA 4MG4A 4FS9A 5BXTA 4EWND 3MC5A 3M7WA 2CEQA 3P61A 1W2PA 4G7EB 4Q4SA 4UC5A 3HU7A 3ZVHA 1ZLPA 3HG4A 3QOKA 1XG3A 4Y8FA 4PL2A 3PJWA 3L67A 3DIPA 3B4UA 4LUYA 1PTGA 3WK1A 3GDRA 5AVNA 4CNSA 2OWCA 3AHVA 1V3HA 3IGHX 3MUXA 3VKBA 3BCFA 1W32A 1AMYA 1F3WA 4RW3A 1EP3A 4EWJA 5A8OA 2FYMA 5D38A 1Z42A 3OQ8A 1PZ0A 2F84A 5DY2A 2VENA 3VOJA 1GVFA 4PMDA 3W88A 2QMKA 4E6MA 1W0MA 5I5RA 5E5CA 4HK5A 5D9NA 2BHZA 3N2TA 4OHQA 1DJXA 1UH3A 1C90A 3MZNA 1Q65A 1XH0A 4DUOA 1D3GA 3QZEA 4AD2A 3RO6A 1LL7A 4MNLA 2GYIA 2C6QA 4H4IA 1PDZA 3L4YA 4RDWA 1QASA 1L8PA 3KHJA 1LORA 4CD6A 4YHEA 2GLKA 3TA9A 2XIBA 4LFYA 2ABAA 4YYFA 1EQPA 4PUEA 1G1YA 3TJIA 3I3EA 5AHNA 3P82A 2OLHA 2PCEA 1AODA 3LNMA 1JCTA 1IT0A 2BOEX 1YE6A 2I9UA 2NVAA 4FB7A 3KDNA 3W82A 4HMNA 3OLEA 2VL4A 4DXXA 4FSAA 1W3NA 2FVMA 2V81A 2PLJA 4HYRA 1ZZMA 3RCYA 2FTYA 1UJQA 4V28A 4ZB2A 3EMZA 4MUPA 1R9XA 4CKQA 1H1NA 5AHIA 3GD6A 2F6KA 5G1TA 1GVEA 2QAPA 3U8GA 4UQCA 2JEPA 3GDTA 2EG8A 4AWUA 4XZMX 2JKEA 1P48A 2GJPA 3MA8A 1PX4A 4M82A 4AZBA 1Q6GA 2HMCA 4WX2A 2Z00A 1WDWA 2I17A 1E4MM 2C7FA 3LV6A 4IXXA 4TX9A 4ERIA 3ZS4A 4F0SA 4IF2A 5FJPA 1L6WA 3KS5A 4GYKA 2CKSA 2QZRA 4D6FA 3G8RA 2BXZA 3E5PA 4JY9A 4LCSA 5GVJA 2GVEA 3GRIA 3OODA 2QKFA 3SEPA 3CO8A 3ARTA 2QDGA 3UERA 1KKRA 3LRLA 2D2GA 3M5XA 2VP8A 1KXQA 1UUQA 4IFKA 1WO2A 3VKJA 2DT0A 3KZPA 1EC7A 4X0NA 4DM1A 5ABHA 2HVNA 3BG3A 2ACSA 3O3RA 1D2KA 1GJUA 4XO7A 3VGGA 1N7KA 3ABSA 3O6DA 4KQNA 3T0CA 4O8RA 1JD7A 4D2JA 1CGWA 2ZUSA 3M0JA 1JUBA 1ADSA 4IGNA 4I8DA 3ELFA 3WNOA 3EOEA 3ITTA 1KA9F 3C2YA 1XYMA 4ZO7A 3SGZA 1GKQA 4M5PA 4XAYA 1FWDC 3IIPA 4WHBA 3EOSA 3VOIA 4MAZA 3C56A 4PTNA 2YPIA 3GDLA 1KCKA 5CPOA 3GR8A 4HPXA 3ZJ6A 4EF8A 4Z0JA 3N04A 4IICA 2O9RA 2DZAA 2E5DA 1SU5A 3GE7A 2XPKA 4JFUA 5IHSA 4LUTA 3JU2A 2FHCA 2TPSA 2W4XA 1XLBA 1ZAIA 4GACA 5DELA 4C1NB 3W22A 3GVWA 2Y5SA 5D9PA 4DUWA 1M01A 4IIDA 2W9MA 3ID7A 1EHAA 1UKOA 3K2GA 1YADA 4ZOAA 4Q7NA 4C6NA 4GJ1A 8RUCA 4F9JA 3WG6A 1D7KA 3CWNA 4H83A 4HZ7A 4U3AA 2OPJA 1UBPC 3R0KA 1FCBA 3RO8A 5IFTA 1A80A 2BVTA 4HHPA 5DRIA 1OGSA 5LHFA 2G4FA 7CGTA 3MSGA 3H23A 3KE0A 4JNYA 4QAIA 1F9CA 1TPWA 1OFBA 5ABGA 2ZZ4A 3W7PA 4QSFA 3T0AA 3W7IA 2CLLA 2Z1SA 2A6NA 4C65A 3OVPA 3PTDA 4CQBA 3B9EA 1EDQA 3E0VA 1LG1A 2OVLA 4YYCA 2ADAA 3UGRA 4F48A 3G1HA 4O1CA 2C19A 4ZXOA 4UTWA 4O57A 9XIAA 3EB3A 3HJEA 2C0HA 3CTLA 1JL8A 3VKDA 4JN7A 3ZT7A 3WLRA 3CIWA 2FMNA 1DJQA 1MUMA 4LS2A 4L5ZA 5HA7A 1CLVA 1W5PA 3P60A 2GGJA 1J2BA 2JBMA 4DWSA 3Q37A 2WVUA 4JEQA 3NQBA 3BH4A 4UFIA 1UASA 4MNMA 4MADA 1H41A 4WLCA 3SZ8A 3NZRA 2ZZ1A 1WXYA 1TVPA 4AZ5A 4H9XA 3SW6A 3JVAA 3K46A 1M7XA 1CXLA 1XYZA 3W87A 1M68A 1VFLA 4Z2HA 3SI9A 1K6AA 1FDYA 4M8UA 4W89A 4BQ3A 2QAFA 1ZJAA 4UQ9A 1GQNA 3CUGA 3CL8A 1W9BM 1DJNA 3I3DA 3GDBA 9CGTA 2ACRA 3UNTA 3TA6A 3N2OA 1LRQA 2J77A 3GTXA 2QCEA 4GIEA 4LAKA 1XGZA 4NAFB 1TE6A 2GDVA 4ZL1A 3LK6A 1IXNA 4EXAA 3IUHA 1LZOA 3VNIA 3WUGA 2DPEA 1W3IA 1ZJHA 2WXDM 4YWSA 2OWWA 3WF4A 1M53A 5B80A 4LNCA 1Q6LA 3BGAA 4AHOA 4Q4MA 4MZYA 3VK5A 2WBKA 3QC3A 1AW2A 3P74A 4H8VA 5A1AA 3NQDA 3AU2A 1K8CA 2CBVA 3ITVA 3QTPA 2H8ZA 3LB0A 1FTXA 1S38A 3UJRA 4H00A 4J3XA 1KM3A 4IZGA 2YBUA 5HMFA 1LL6A 3ARVA 2C3ZA 5AYZA 3UY8A 2VEGA 1JZ8A 3D3AA 3V0UA 2ZUUA 3CAKA 4CD7A 2YZ5A 4HU0A 3U2EA 3T05A 3FDKA 1YX1A 4BWLA 1ZRQA 3NAVA 3R4IA 2GDQA 2PI6A 3BJFA 1GYLA 3REQA 1J0KA 4IISA 1RD6A 2ZXQA 1JI2A 2PF0A 2QF8A 1YQ2A 3A21A 3EDKA 5I3IA 1H5VA 1WZKA 3CQJA 2CHNA 4WDWA 1CTNA 3QW3A 3B8VA 3TWBA 3VOGA 4B91A 2QV5A 2VZSA 3QM3A 3T78A 2NVCA 4HA1A 4C5ZA 3L68A 4TQTA 3E3HA 4KCVA 1R85A 5IOBA 5FJUA 3W53A 3GU9A 1EC9A 4JNZA 4FLOA 2VX5A 2CIPA 1LBFA 3VNLA 2VFIA 2OLSA 1OINA 3PWGA 2YW4A 1ZY9A 6XIMA 3AXMA 3UG5A 4WIWA 4DIAA 4WY0B 1D3CA 1IWPA 2D2OA 4KW2A 3UR2A 3N3TA 1PHWA 1XSJA 2J25A 4L1XA 3MSYA 1UWSA 3ARSA 3GK0A 4JD4A 3S6TA 4UTJA 1R5YA 1TIMA 3K4WA 2YXOA 3CV2A 2UY3A 2GWNA 1YXDA 3S5ZA 4MNKA 2TODA 4O53A 4ZBCA 2PB1A 1TX2A 3RN6A 4AVOA 1XBZA 3RHGA 1SW0A 2OXNA 2D2HA 2YCLA 1TJPA 4MJZA 4BJHA 3PBYA 2JGQA 7ENLA 4NJKA 3AICA 2XYLA 1QATA 5LIYX 4GYJA 3EWWA 5MKGA 3BL3A 3VDGA 1IWBA 3AS2A 1F4HA 4S39A 3IACA 3VABA 1F76A 4UZSA 3NXFA 4A6GA 3PP7A 1L2UA 1YE4A 3O07A 3MUIA 1UIOA 3GXTA 2D69A 1E0VA 3R8GA 4DZ5A 1EIXA 2G37A 1PL9A 3H4XA 3V3WA 2DZUA 1WBJA 4EPBC 4LAZA 1Q8JA 2ABBA 2DT2A 3KCOA 1TWZA 1WCGA 1ZCOA 4D6HA 4AZHA 1ZQ5A 2CLMA 2G50A 3EYPA 4LJ3A 1YTDA 2YB4A 3V5FA 1JDCA 1SGJA 1UD6A 1MFVA 1XYAA 1XLJA 3WO8A 2VC9A 2FPVA 5E09A 1ADDA 4GOAA 1BF2A 2NQ5A 4OQVA 5AKQA 1TWWA 4IQEA 3TP4A 3TNBA 3SUTA 3CEPA 4ZQOA 1Q7QA 4O28A 3CIXA 4JX5A 1BFNA 4K3ZA 3F4CA 2DIEA 2ZFAA 1I8JA 4MWAD 4MJ4A 1Z9AA 4ZE4A 2C1GA 2C8NA 3FA3A 4O1DA 2ACUA 2PF8A 2Y5JA 2Z25A 3MI6A 2VQTA 3EOUA 1V6UA 1MQPA 2NLYA 4PC8A 3TCSA 3LXBA 4H6EA 2PMQA 3BG5A 4XKYB 4RE0A 4CQDA 4FXSA 5CPMA 2GPTA 3ME3A 1ISZA 4S38A 3B05A 1FHLA 3B3DA 3UXIA 4DY1A 2FZ9A 1ITXA 3F4DA 3OZYA 3WEOA 1JF6A 3P93A 2PDPA 4GGHA 1AH4A 3QV6A 4LW7A 3E5BA 5CZ0A 1KFLA 4KERA 2VX4A 3LGGA 4IJBA 3DFNA 2PWVA 3COTA 4HIBA 4B90A 3BJTA 2XISA 3A3WA 4KGJA 1GQKA 4FXRA 4U3CA 3N12A 3AHTA 3SRKA 2RDXA 2YBTA 1FP9A 3IPWA 2BOGX 4L61A 1B3YA 3LHZA 4AU0A 1HFBA 3GDMA 5DQPA 4I7UA 2A5HA 2ISSA 4H3DA 1TZ7A 3GNRA 5H8UA 2W79A 3VD7A 3R7MA 1E4IA 4B9YA 2XVLA 1GZGA 4AIUA 3W4RA 1OJXA 3NTYA 1IZCA 4DQWA 4F0HA 2VX7A 3WQPA 2V2DA 4L4MA 1GT8A 3ZR4A 2B7NA 3OBAA 4UTLA 4Z1YA 2PZ0A 1UP3A 1BAGA 3DFPA 3LBCA 3F4WA 3WLHA 3STEA 1IV8A 1TTJA 1J4EA 2QCLA 3U2CA 4O50A 2Z1XA 4B2DD 5G2WA 4GXWA 4BCEA 5CEWA 2NQHA 1BKHA 3QC0A 3VX1A 1ODUA 3NEHA 2A0NA 2FVLA 4KT2A 5I0DA 4KEZA 5LKYA 4L9XA 2BG5A 1Q6FA 1QPOA 1Y5XA 2EJ1A 2QIWA 3KOYA 1OFAA 4PSRA 1IF2A 1SZEA 3C5QA 4JY8A 3R58A 5DBUA 3LY0A 3GH4A 3LBOA 3AISA 5HXMA 1Q7ZA 3MP4A 1HKIA 4UZUA 4QTGA 4NJGA 1XLCA 2REQB 3DCPA 3PZUA 3T81A 3QPEA 3IVUA 1MEHA 3UG4A 1VD6A 3G1XA 4Q7IA 1EGVA 4DJEC 1UQZA 4KS0A 5T9CE 4C7FA 3MSRA 1K9TA 3M47A 1Q6QA 3LMZA 1M7JA 3O6CA 1W3JA 3WH9A 1SMDA 4JYDA 4K6AA 2DJLA 1AL7A 4QE1A 1AW5A 2VOTA 3WDQA 2O7QA 3VFLA 2ZDSA 1PAMA 4O12A 4F2UA 3S9YA 4QJ3B 2OU4A 2VCCA 3R2GA 3WLJA 2PLCA 4ZENA 4C6QA 4D6DA 3UXAA 1Z6KA 5IDZA 4W93A 5LXEA 5LZLA 4LUSB 3LPOA 5K3VA 1OIFA 3KTSA 2GJRA 4O17A 1ZGDA 1US0A 2J7CA 3WD1A 4NL1A 2D0GA 3PWAA 3V5CA 3TE9A 5CAKA 3ABRA 3SY8A 1XF0A 2UZ9A 5F1VA 1WE5A 3H2MA 4CQCA 3GH7A 2FVKA 5HJYA 5GNXA 4XZHA 2XJ7A 4OBTA 3NQ6A 4NUWA 4E0CA 1YNQA 3QMTA 4B3KA 3BLDA 1ME9A 3MQTA 4DLMA 4UCGA 4WZHA 2BLEA 2WK2A 4G1NA 4ZB5A 1OD8A 2YKKA 4QX4A 4ADTA 2XFWA 5AZ0A 1GEQA 2WCAA 2ZZ3A 1QXLA 3QVQA 3CLWA 4LOCA 2W6RA 2Q71A 1EBGA 1PWMA 1Q66A 2FLIA 3LG3A 3MUZ1 1Q6CA 4XBJA 4QRNA 4EACA 1DXIA 3KLKA 3SR7A 1XISA 3NZQA 3EEGA 3BAWA 1LUCB 4JEJA 3WEMA 2E7FA 3WLIA 2V5BA 3HPZA 4ECLA 1FWJC 4EX4A 1DE6A 1R7OA 4GX8A 5CGQA 2P53A 5FJRA 2YCEA 1U5JA 4NF7A 3M0IA 3W7KA 1GGOA 1DKWA 1DE5A 3WQ6A 1B4EA 3PSVA 4XX6A 2ZC8A 4GGBA 3N9RA 4IMFA 3HA1A 4ASTA 1B0IA 2Y7FA 1PKMA 4WDTA 4KETA 1EIBA 4KH2A 3QRHA 1KGUA 3W81A 5HR6A 3FJ6A 3N6QA 1TX0A 1XXXA 4MB4A 4EVZA 3TYUA 2FMOA 1HUVA 3UXKA 4FLRA 1F6YA 5IRPA 3GVQA 2IKGA 3QQ0A 2XUCA 3DEQA 3VNZA 1E72M 1NP2A 2NUXA 3M07A 2QJHA 2R82A 4G7EA 1RA5A 1E9YB 2E6AA 5LNSA 2E6YA 1YBQB 4QSHA 3W2NA 2NSOA 5A6AA 3STPA 1OZQA 3PPCA 1BEUA 1A0EA 4AAJA 4J3UA 1XC6A 2Y8UA 3GHRA 3UP8A 2JF6A 1YRRA 2CERA 2DUZA 1QOPA 3DX5A 1JAKA 3A4JA 3QYQA 4XVDA 1ECQA 1OSEA 3U5UA 1KBIA 1MXSA 4DJDC 2HISA 2JEQA 2NX9A 4N9DA 5FEWA 3TC3A 3NO5A 1QPRA 1QRQA 3N25A 4YHGA 3W27A 3H12A 4YL2A 4FALA 2YL9A 3MMUA 5FSEC 3U2ZA 2X0YA 5JIPA 4HOWA 2GK1B 1VQTA 4S3JA 4QQUA 3W6MA 4IJCA 4L4OA 3PZVA 5JVLA 3ATZA 2YR1A 5D09A 2VJXA 4UCFA 2O9OA 1MZHA 4ZCWA 4OUIA 1G9HA 4FX7A 1TV4A 1G4PA 7ODCA 4LVGA 1H11A 1WDSA 3SN1A 1XBXA 2V3FA 3U7BA 3WEZA 2DW7A 3KL5A 1P0EA 1UZDA 3HGOA 4H2HA 4Y9PA 5AC6A 4A3QA 2J24A 2ZRVA 4H9VA 2VEIA 2JIWA 3BWWA 5GJMA 4H41A 4GCAA 4ACYA 3GAKA 3KBVA 3V16A 4AIEA 3FYPA 1TVNA 3QGAC 1GHSA 4G6CA 5C0QA 4M51A 3UF9A 1DVJA 2OZ8A 4JPGA 5A2BA 4PCSA 6ALDA 1TZZA 3QV9A 4MM1A 5AECA 3UY7A 2WCGA 1S2WA 2PLMA 5M17A 9XIMA 3TYEA 4EPKA 3MUCA 2PEVA 2YLAA 5H8MA 3G5EA 1SYTA 3CYJA 4Q7BA 1E1CA 3VKAA 3PBWA 1C8QA 1ECEA 2V69A 3HB9A 2WZIA 1KM5A 1XSKA 3NQAA 4M1RA 1NH6A 2ZRWA 5T8GA 1G01A 1FWEC 1JCYA 1SW3A 3ANYA 3WJZA 5CSSA 5B7ZA 3W75A 2PGWA 4L9YA 4XD5A 1LWIA 1POKA 4WJ8A 3URBA 3FJNA 2PDFA 3PY2A 5HINA 3PBMA 1PIGA 3ZM8A 2DUXA 4WXZA 4DBDA 3DI1A 3L12A 4S1FA 1KV5A 2PDCA 2A3BA 4PMXA 1GJPA 1WX0A 1GOMA 1JZ7A 2O7SA 2ZZ7A 1E0WA 3TJLA 2I9EA 2VGBA 3GTIA 1YXYA 3EOLA 5LGXA 1EB3A 1UD5A 2OYMA 1N55A 3M1ZA 3E6EA 1HVXA 3OQEA 4K2SA 2E9LA 1W9PA 1W9VA 1O7AA 3VIGA 1A53A 3K8MA 3R25A 3BLIA 3IS4A 2ZRYA 2CKRA 3CC1A 4MKNA 1E70M 1JULA 2QDEA 2VEFA 1Q8AA 5K9DA 1RK5A 3E74A 2QDHA 5IBXA 3IK4A 4GQGA 3HBLA 3SCOA 4BEQA 2GOKA 5I02A 2YZRA 1ZU8A 4X2PA 1IEVA 2DDXA 5DY3A 4YJ5A 2DSVA 3BURA 3IWPA 1JI1A 3KOFA 2A7RA 5C9XA 1AZ2A 2WMIB 1KBLA 2X1SA 3P7YA 1WQ5A 3S1VA 1CWYA 1W54A 3EOOA 3G1FA 3THDA 4H8UA 4HCHA 3WCZA 3OYZA 3TTEA 3V18A 1V93A 1RQHA 4C1NA 3O0FA 3PWIA 3QSRA 2PGRA 3N19B 5CG0A 4YWIA 1GYMA 1A5AA 4HZ8A 3THQA 1IXQA 1PX8A 1XIJA 5CC3A 1UMYA 1H3GA 3AIBA 3E49A 3L5AA 3ARXA 1E71M 4HYWA 3K1DA 1R0MA 1OFQA 2NVDA 4GPNA 4XAGA 3EBVA 4QGCA 1OFDA 3W76A 5E0FA 3CWHA 4AQLA 5HPOA 5CGMA 3F7JA 2QW5A 4ILSA 4R85A 3JR2A 1T8XA 1OCBA 2OO0A 4GY1A 2YCJA 1K7EA 4GZ7A 3CAVA 3WK2A 3L5LA 4IT1A 2R91A 3I65A 1KBKA 3GVRA 1RY0A 4E38A 3DH7A 1X6LA 3MCNA 1J6PA 3DUGA 1EO5A 2Z2AA 2CWXA 1W31A 5AHMA 2MUCA 2TSYA 5JUVA 1GTEA 2CWNA 3DESA 2PBOA 1VLIA 3CHDA 3S42A 4BY3A 3S0CA 4ZE5A 4P5UA 1RHCA 4L9ZA 3BVJA 4ZQNA 3UWQA 2WVTA 1HNYA 3RGTA 4ZTXA 3PSWA 2GGEA 4LAMA 4LCQA 4ZQRA 3O7UA 3B9OA 2GDUA 4HNOA 3DI0A 3GFXA 3VIKA 1P7TA 1E55A 5D2YA 4I9AA 3UR7A 3CB8A 3FGCA 1G94A 5LIKX 3QLLA 4PMVA 4D8ZA 1AJ0A 3CGTA 3RCNA 3IJ6A 4G56A 3FNDA 4UFKA 1H09A 1FFQA 2A79A 1L2QA 3RPDA 1EBHA 2VFGA 4IM4A 1VAHA 5A6JA 2YJQA 1T6MA 1KR0A 4HMEA 3HN3A 3TXZA 3W1PA 3AO0A 2ISDA 3DDMA 2DEPA 3SQLA 3CQHA 1SR9A 4R7JA 1B31A 2YA1A 3I7RA 3N4FA 1E3ZA 2B81A 3B8UA 4H2CA 2YA2A 4DWDA 1S1PA 2ZRZA 4AZ7A 1R2SA 4GXPA 4JIIX 4ZEPA 3B8TA 3EXSA 3KWXA 1D8CA 1L9WA 5A6SA 4CN1A 2VTFA 2VI0A 3CMFA 1PEZA 3AWOA 1VPXA 2PWEA 4H04A 5K9XA 4HA4A 1M65A 3WBEA 4LVAA 4C6BA 1F73A 1LOQA 2YOCA 4MTVA 1W6TA 4GYPA 4LY4A 5FF0A 2Z1KA 1F8MA 2CU0A 2ZX7A 4B3LA 3FAWA 5JIWA 3QGVA 3CYVA 1GOIA 4XTDA 3S3GA 4TV5A 1R47A 2GSHA 2WMJA 5BMWA 2WANA 3ZT5A 1KKOA 1BGGA 3G0SA 1X7IA 3MS8A 3O6AA 1UR2A 4HCLA 4Z2JA 2X8RA 3KBNA 5BRPA 2X41A 3QGKC 3MY9A 3VIMA 1MNZA 4Q8MA 3WQEA 3LHYA 5HULA 4C6JA 4EF9A 2O4MA 4PUUA 4ONVA 2G4JA 4HA0A 3G6MA 1W1TA 1I0BA 4DN1A 4P7RA 3VKKA 2B0MA 1C9WA 4ZO9A 4C91A 3S1XA 2JGYA 2VT0A 2J8TA 2I16A 4HHMA 1J5TA 1KW1A 2NXIA 4F4RA 1KRBC 3ATYA 1EGZA 1KR1A 1SO4A 4DWSD 3NIYA 3UPMA 1X1ZA 1JIBA 3PF3A 1FY6A 1UWAA 3TQKA 5DMYA 3BQ6A 4PMNA 1AJZA 4KCWA 2XH4A 4LV4A 3RNDA 3W70A 5CJMA 4DBUA 1DWGM 3SQMA 3RMJA 5AOUA 3WJYA 5H8PA 2VC5A 2QLYA 2HE8A 3UG3A 5A2CA 4NG3A 1CLKA 4WY0A 1XYLA 3EDEA 4E3VA 3B06A 4WF7A 4IIGA 3GKAA 4XISA 1DP0A 4MY9A 1UROA 3RRXA 3HIJA 2BS9A 4OTKA 1VFFA 1TPVA 4QHRA 5HWJA 3E2RA 3LYEA 3CWOX 3WJWA 3TONA 1SO6A 1SZGA 3T8LA 2F2KA 2DIKA 4MAVA 5FF4A 3VD9A 3WMLA 1RR2A 1PB0A 1W1VA 5KINA 5TBOA 1CB7B 2XWDA 3BZGA 5KETA 4RLIA 4S23A 1EEPA 3I68A 3C6CA 3T09A 4BHYA 3AMCA 3ISIX 2QCHA 1ZAHA 3L5MA 1UA7A 3CAWA 3F4NA 2WW5A 1QNOA 3MO7A 4KPLA 1JFXA 1UYQA 3W1RA 1VR6A 2BY0A 2EKGA 1ODZA 2ZTJA 4NZJA 1BPLB 1DHPA 2ALRA 2W63A 4K7YA 2WJZA 4HMDA 4TMBA 3ZO9A 9RUBA 1OZMA 3UD6A 2OQHA 1RCXB 1DXEA 3LUTA 2FB3A 4QM1A 1I2QA 2FFCA 3A9IA 1P6CA 4A3YA 4KEVA 3WH8A 1QU4A 3IAPA 3VNJA 5M2FX 4FNRA 1Z44A 5D8WA 4DELA 2WJEA 2VO5A 3L7RA 1XD1A 4J5NA 3ES8A 2QEZA 3KRZA 3LZ5A 3VDBA 3ONBA 1OM0A 1IEIA 1D7FA 3T7VA 5I3JA 4B5NA 4IPNB 1SFJA 2QUNA 4D9PA 4FNUA 3SSZA 3B97A 4UOJA 4JTFA 3HQ1A 3TR9A 4Y9MA 1GEHA 3GIYA 3LPPA 3T2PA 3A13A 3NDOA 1SJDA 2GVLA 1SFSA 1HVQA 4GWEA 3ARPA 3NQCA 2QCDA 1J96A 5AYIA 1KFBA 3NL5A 3GC2A 1UD4A 2DW6A 1HX0A 4XD3A 2WJDA 4FXFA 3NURA 4GH3A 3CUZA 1TV2A 2Y62A 3JRKA 4OU1A 4IX0A 4XKYA 4JTAA 1UKTA 1QI3A 3XIMA 3AZRA 3T4WA 1VS1A 4DI8A 3UG8A 3RXZA 4H6KA 2DT3A 4ZOEA 1BG9A 2PRMA 1V79A 3UWWA 3QMSA 3T9PA 1XIFA 2A2IA 3AOFA 4V1YA 3U48A 5KZEA 2PTYA 1HO4A 2I5GA 4ZODA 2QUVA 4FI4A 5CPQA 2ZC1A 1I45A 4GX9A 4LALA 4HQVA 3ZT6A 4D6EA 3EDDA 5EU9A 4AF0B 1C3FA 4AYGA 3L2IA 4C60A 3FSTA 3VINA 4JCLA 3LENA 3WNMA 2GOUA 5LIUX 1K9FA 1KO0A 1K7XA 2XFYA 3QOMA 1S39A 1OX4B 1KFCA 1TCMA 3SFWA 3ZSSA 3VZXA 4LX4A 5GQBA 3T0BA 4NZFA 2GQ3A 3W38A 5DFAA 2DZVA 2P0IA 2H9AB 3H55A 3GB6A 4LVFA 5C9UA 1K02A 4HMCA 5FI8A 3CL7A 1YEYA 2CLKA 3HJZA 4MLJA 3SCQA 2B4GA 4KCUA 4LTSA 5HUPA 4F0RA 4C6CA 1E1EA 4NI3A 1HN1A 4R9OA 3M0YA 2HXUA 1W1IE 1A5SA 4EPEC 3NYDA 3LCHA 3PVFA 3QYSA 1K70A 3C61A 4LYRA 4RNJA 4I5RA 3BXWA 2REQA 2NWSA 4Z1AA 4IP4A 4MZ8A 1XGEA 3L4XA 2R1PA 1XLKA 4W7VA 4EIVA 4NVTA 3W7RA 1XFCA 1RUSA 1GVIA 2ZE0A 3HFYA 2J7EA 1BD0A 1F3TA 3SN4A 2BHUA 2IPWA 3A47A 4PMRA 1EHNA 5CJNA 2FGLA 1UP2A 1TQJA 2Y7EA 4JIRA 1B3XA 4FO4A 4UTHA 5FL0A 1V8EA 1FHUA 1UB3A 3DGBA 4Y9NA 1KM1A 4GVIA 4JHMA 4NX0A 4MKSA 1U5VA 2VMFA 3DFOA 1S2TA 3IIZA 2ZUVA 5CLWA 4LUSA 3RUBL 2MANA 4OVXA 3E0FA 3TW6A 3MHFA 2Q8ZA 1PPIA 2AKMA 3KCJA 3QHNA 4ZB0A 1ADOA 3B03A 1QFEA 3BANA 4LB4A 4N2YA 1TREA 2DORA 3TYBA 1CIUA 4J4KA 1OEPA 3N1AA 5LA1A 2JFEX 3AIVA 2EPLX 3KRSA 1EFZA 3P81A 3BE7A 1WDQA 3S6DA 4JIHA 2PRLA 3F4VA 3EB4A 3GG1A 3SUSA 3GFZA 3NPVA 5JBEA 1M3UA 2J9ZA 4DF2A 7XIMA 3WDIA 3DYOA 2PD9A 4JTIA 5DCBA 4UTTC 4NZ4A 2C1HA 3AXXA 2X30A 1UZHA 3ZWTA 3GU2A 3H22A 1GPFA 3B4YA 2BOFX 2WV8A 3PUDA 1VHCA 1RJQA 1Q85A 2O56A 1XYCA 1IGWA 1YNYA 3C2OA 4Q22A 1LUCA 1F74A 3MU7A 2BB0A 1VEMA 3QSTA 3A3HA 1SZNA 1C29A 1WKEA 3CHFA 3AYTA 4P61A 3DFHA 1RBLA 5EKYA 3DKLA 3TN3A 1U5HA 4RK8A 1H5YA 3BDKA 3N6HA 1B3VA 1BGAA 1W9UA 4Q8NA 3EKZA 3MV11 3RM8A 5A8QA 2Y89A 5C5YA 3O2LA 2OWXA 5HK4A 4ENLA 4QIUA 1GYNA 4BEUA 1HG3A 4AISA 4EOUA 1K4HA 1MQQA 2DP3A 2EPMX 3UZZA 2Z6IA 4IP7A 1BWVA 4Z17A 3BPWA 1LRTA 3LCXA 4M7TA 4QR6A 3S1WA 3BLLA 3ARUA 2YDRA 5CBJA 4FNSA 2ZA1A 2QCMA 3KVLA 3QW4B 4F2BA 1W2VA 3DU0A 3FN9A 4UFMA 2JIEA 3BV7A 3TYAA 4LCRA 1YBQA 3M5ZA 1J12A 3SCSA 4L6OA 4HSNA 4A3HA 4O15A 1C91A 4O1EA 3GG0A 3WDRA 1VBHA 3HZ3A 3M0HA 1KV8A 1BVNP 4DJFA 4UTTA 3IGSA 3RLUA 4A8LA 1PJ9A 4X9SA 5DMMA 3LU2A 4ATWA 3URAA 2V3DA 5I3HA 2VVSA 1EUAA 3ZR6A 2UWFA 4CCCA 2ZX9A 3PUGA 2PDNA 4OBRA 3KLLA 5E0KA 1OCNA 4OOZA 1FVPA 2GK1A 3IJDA 4NJHA 4AC7C 3VOCA 1R3SA 1RLCL 2A4AA 3UR8A 3E96A 4IL2A 4N9EA 2RAGA 3OPSA 3UEQA 1UPMB 4GXMA 4YPJA 3PZIA 4KIEA 4DXKA 2V0TA 4JTUA 4YVPA 1E43A 3GAYA 1LQAA 4WEVX 1EA0A 3TC6A 4JQ4A 3NJ3A 3GXNA 2PP0A 2FGBA 5C2XA 4UMCA 1L6GA 3D47A 4CLMA 2RDWA 4XVEA 2IQDA 3FXGA 1RALA 3B9NA 1FWTA 4NHVA 2C16A 5FCZA 4JTLA 2QGYA 1FKXA 3AS0A 1QTWA 3SUVA 3STCA 1S5VA 3ENLA 4UNIA 3OBKA 5LIXX 5AC5A 1HL8A 2ZRUA 1Z41A 4OOUA 4TIMA 4B5SA 4RUBA 3CZKA 1Q6EA 2VZVA 3CLMA 1GK8A 3BICA 3HPAA 1W91A 4ZMGA 2E5CA 2VRKA 1OB0A 4BFAA 3FFSA 3ZR5A 1OGBA 2VDHA 1AK5A 1RV8A 1TPEA 2QQ6A 3PNUA 1G0CA 5BXRA 4YTSA 2YBVA 4D6CA 3AU6A 1CXFA 3WQ5A 3W37A 5IDIA 2Y1HA 3AHXA 4ZVJA 3S1GA 1JVNA 2FDMA 1QT1A 3NNTA 1OG0A 3W00A 4LNYA 2EPHA 1Z89A 1CXIA 3GTNA 1GVRA 4LVBA 2TAAA 2V5CA 2R1KA 1H50A 4U4MA 3EWCA 4CVUA 1ZBCA 3R0UA 1JG9A 1CECA 4BI6A 3UXDA 5FEPA 3KVKA 4PYSA 3IK2A 4N9CA 2YYUA 3ZSTA 2Z1WA 4RCXA 3R11A 5D9MA 2DQWA 1MRAA 1RD5A 1W1YA 5JMUA 3PZQA 4S3BA 2VR4A 3Q58A 4NNCA 4IOTA 2JF7A 1R3RA 1O5QA 4CD4A 1W9DM 1EZWA 3R8HA 1FOBA 1JCNA 2R14A 4NILA 4JTEA 4HTBA 1WAWA 5FA5A 2PGFA 2E3ZA 1OC7A 2AGKA 3R10A 3PJUA 4R9XA 4UNLA 3FA4A 4HPGA 1X39A 1R9ZA 1X6UA 3RG6A 2CPUA 4OUEA 1PUDA 1GOQA 4XBSA 3S2MA 1TWDA 2EQDA 1VC4A 3BUVA 2J7DA 3LQGA 3PC0A 1EWEA 1X7FA 1T7LA 2HBVA 4W85A 5REQA 1MVYA 4NP7A 3RX3A 1LLZA 3NDZA 1F3EA 5E9XA 3W3OA 2PD5A 4E8GA 2QJIA 2YCIX 3S1UA 1XDLA 2WMIA 3WQGA 3V75A 1C92A 4ZOCA 1ZP4A 4UFLA 2VZOA 2ZDRA 4YNGA 3LSBA 4YTRA 3DC8A 3GTFA 4Z2LA 3UWVA 2PU0A 3CM4A 4A3RA 1DOSA 1HKKA 5E6ZA 2A3EA 1MRQA 2QF7A 4GY7A 2EO7A 5BOOA 1KRAC 2XGBA 4JNMA 1WYIA 3PZTA 1TPFA 3CO4A 3ABOA 3OEXA 1SZFA 1TTPA 3FY1A 3HF3A 5CLTA 1P0DA 3SUWA 5ABTA 4DLFA 1Z7AA 3P8IA 1FH8A 3TDFA 3UJEA 3FSUA 3CQ0A 1IGSA 3CMJA 1FKWA 4K68A 5DT5A 1V5XA 2GGGA 1TV7A 4PUKA 3RM9A 1GJWA 3NM1A 4YVXA 3VD5A 1K77A 3B0XA 2VX6A 4QLLA 2C15A 3NPWA 1K03A 3WQDA 2HK1A 3BG9A 4D72A 1ZCCA 4M6VA 2LLEA 3KBSA 1KD0A 2P5NA 2OMAA 2ACQA 4QXIA 3GHSA 3W7CA 2V68A 1E5JA 2WKGA 3LHUA 1IZJA 1AD1A 3P6LA 3EDFA 2EAWA 5E6YA 4FHAA 3A22A 1JZ5A 3RAOA 2FQIA 3W9ZA 2BSLA 3ZFHA 3L4UA 4C90A 1RLDA 4FZIA 2SFPA 2Z7GA 3B0YA 4AYSA 3PM6A 2WNQA 3QY6A 3GW3A 3E9AA 4AD5A 3S2CA 3DYMA 4EXQA 3AAMA 4LBSA 2J27A 2VGGA 4H7ZA 2HROA 3T40A 3C0SA 2ZX6A 7REQB 3MUAA 4QAWA 4AB4A 5EA9A 4PMOA 1GOXA 3ITCA 4GQBA 2CBIA 2ZBTA 3LRMA 5HDRA 2PUZA 5LXXA 5HMEA 2OTDA 3OOQA 2R1LA 2D1ZA 4B3ZA 3B0VC 2FFIA 3MCOA 4MUZA 3UJSA 3D46A 1RBAA 4CVWA 2VR2A 3LERA 1D8WA 3KXQA 1GVOA 4F3HA 1ONXA 4QQ3A 2P8CA 3W71A 4GI6A 3L65A 1QPNA 4A8IA 4UOZA 1XLEA 3W2MA 3UGVA 1GNXA 3ITXA 4K7VA 3VZZA 3C2RA 4NAEB 5BNKA 4A21A 5D4YA 4PUMA 2BDQA 2YYTA 2VZUA 3W6YA 1JRBA 3TCEA 2XH0A 3EA3A 3A4WA 1O94A 3N2BA 3DC0A 1XLHA 3TKFA 1TELA 1V02E 4D8AA 3R13A 5CSYA 4QITA 5GNZA 4KWWA 3AYRA 4XZWA 5CBBA 2VURA 3TC7A 2PDJA 2E5BA 3O63A 4POCA 5HMDA 4AZIA 3SIMA 1XCFA 4AUBA 1YKWA 5H2ZA 3WH6A 5ABEA 3SGUA 3I7QA