3FX4A

Porcine aldehyde reductase in ternary complex with inhibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
325
structure length
325
Chain Sequence
MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEPVLLEEPVVQALAEKYNRSPAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALNKNLRFIVPMLTVDGKRVPRDAGHPLYPFNDPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Aldehyde Reductase in Ternary Complex with a 5-Arylidene-2,4-thiazolidinedione Aldose Reductase Inhibitor
rcsb
molecule tags Oxidoreductase
molecule keywords Alcohol dehydrogenase [NADP+]
total genus 101
structure length 325
sequence length 325
ec nomenclature ec 1.1.1.19: Glucuronate reductase.
pdb deposition date 2009-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3fx4A00
4IJRA 4JQ4A 3WG6A 1EL3A 1IHIA 3UGRA 3G1RA 3LUTA 2A79A 2R24A 2DUZA 1T40A 3EB3A 1Z89A 4GCAA 3NTYA 4LB3A 4LB4A 5KETA 4XZLX 2BGQA 1Q13A 1ZSXA 4WGHA 1AH3A 4L1XA 2HDJA 3M4HA 2AGTA 2CLPA 4JTQA 1FRBA 1EXBA 2WZTA 2PDYA 1X97A 3LQGA 4IGSA 1M9HA 2INZA 3MB9A 4QXIA 1S1PA 1Z3NA 3FX4A 4XVEA 3O3RA 2HE5A 4WDTA 4EXAA 1RALA 4F40A 4PR4A 2IKHA 3N2TA 2QXWA 3LD5A 4IJCA 4GQGA 4FAMA 4DBSA 2PD9A 3GHSA 3H7RA 3P2VA 2R9RA 4XZHA 2C91A 3FJNA 3R58A 2FZDA 1ADSA 4ICCX 3RX4A 1XJBA 2PDLA 4HBKA 2WZMA 3WCZA 3COTA 4JQ1A 1A80A 4XZIA 1XF0A 4FZIA 4DZ5A 1Z8AA 4JTAA 1IEIA 2ACSA 2PZNA 2PDPA 1RY8A 3DOPA 2PDIA 1ZGDA 4WDUA 1QRQA 2INEA 2F38A 3Q67A 2NVCA 4I5XA 3UYIA 4XO6A 4GABA 1K8CA 4PMJA 1EF3A 3UZXA 3UZZA 1MZRA 4H8NA 2IPWA 4XO7A 3WBWA 4JTDA 3V0UA 3R94A 2PDBA 3RX3A 2J8TA 2HE8A 3EB4A 3T42A 4G5DA 5M2FX 4DBUA 2ISFA 2PDHA 4JIIX 1PZ0A 2HVOA 3QKZA 1VP5A 2BGSA 1QWKA 1MI3A 2FZ9A 4GA8A 2FVLA 4XVDA 4OTKA 5LIWX 4LBSA 1YNQA 2ACQA 1S1RA 5LIYX 5LIXX 4RPQA 1S2CA 3V36A 4GIEA 3LNMA 3ERPA 1AFSA 3GHUA 5AZ1A 2PDKA 3DN5A 2IQDA 5AZ0A 1X98A 4ZFCA 4PRTA 3U2CA 3GHRA 2F2KA 4ASTA 4EXBA 5JH2A 3UFYA 4H7CA 3LBOA 1PWLA 4YVPA 4PRRA 4WEVX 3R43A 3BUVA 2PDMA 4XZMX 2I16A 2PDJA 4WDXA 5HNUA 3Q65A 1PWMA 2PDFA 1MRQA 2ACUA 4GQ0A 1Z9AA 3CAQA 3S3GA 2PF8A 1ZUAX 5JH1A 3F7JA 1AH4A 3WBYA 3LZ3A 3BV7A 4YVXA 3LEPA 4LAZA 2PDUA 2DV0A 5HA7A 1R38A 4MHBA 1RY0A 3R8HA 1LQAA 1C9WA 2P5NA 1VBJA 4PUUA 2IS7A 2PDGA 3UP8A 2IKIA 3KRBA 3H7UA 3CV6A 2DUXA 2FZBA 3C3UA 3CAVA 1HQTA 1ZQ5A 4QX4A 2IQ0A 5C7HA 3R7MA 3CV7A 1PYFA 2PDWA 2IKGA 1YE6A 3BURA 1EKOA 3V35A 3BCJA 3GHTA 2NVDA 3LZ5A 2PDCA 1AH0A 3VXGA 3M64A 4YS1A 3ONCA 2FZ8A 4Q7BA 4QBXA 1XGDA 2ACRA 4JIRA 4FA3A 4JQ3A 1PZ1A 3GUGA 1YNPA 3G5EA 3M0IA 4WDWA 4GACA 5LIUX 1X96A 2I17A 4XZNX 3MC5A 2PD5A 3R6IA 4Q3MA 3CASA 5LIKX 4PUWA 4HMNA 2HV5A 2PDXA 4LBRA 3B3DA 1YE4A 3UZYA 3LQLA 1S2AA 3UZWA 5HNTA 4LAUA 3EAUA 2IPJA 1JEZA 3LN3A 1J96A 2IPFA 3WBXA 4FALA 1HW6A 2VDGA 4YU1A 4JTRA 4QR6A 2BP1A 4JQ2A 4L1WA 1UR3M 3V0TA 5DANA 4XK2A 4JIHA 1AZ2A 3R8GA 3LENA 3V0SA 2IPGA 1T41A 1OG6A 3CMFA 4AUBA 3UG8A 2PDNA 4JTCA 3H4GA 3D3FA 1Q5MA 2PFHA 3RX2A 2ALRA 2IKJA 4R9OA 1US0A 4NKCA 1GVEA 1LWIA 1AZ1A 3UWEA 1SM9A 2HVNA 4XAPA 2HEJA 4YVVA 2PDQA 2PEVA 2FGBA 3ONBA 4WRHA 3O0KA 4DBWA 4JQAA 3N6QA
chains in the Genus database with same CATH superfamily
2A21A 1TR1A 2CCRA 3AAMA 1UC5A 4DO7A 3WH9A 4A3HA 1UOKA 3HO8A 4A21A 2RGLA 3LMZA 2OOGA 3IANA 4OQVA 3DGRA 1GEHA 4MYXA 1VC4A 1TV7A 4GCAA 5AHNA 4N02A 3IEBA 4IIDA 1RQEA 3IK4A 3S8HA 3QQ1A 3OA5A 5I03A 3Q58A 2G3NA 1H7OA 5FJRA 4MLJA 1P0NA 1JPHA 4HHMA 3SUSA 2OO0A 4D1IA 3CIVA 1KW1A 1IEWA 2CITA 5DCEA 3S2MA 3H55A 4MJ2A 1T99A 3GUWA 3BLPX 2V8ZA 2BXZA 1Y5WA 3FGCA 4Z2IA 1O66A 2RGMA 4PYSA 3WQ6A 1QOQA 5BCAA 4RV8A 3FX4A 3PFRA 3MBDA 3O8AA 2WVSA 4PR4A 7CGTA 2BMBA 1VPYA 2REQB 1CB2A 3MKCA 4RNIA 5IFTA 4NRSA 3OLGA 4MZ1A 1ADSA 4A8RA 4BQ4A 3CIWA 3FVMA 3G3MA 3QY8A 3S42A 4R88A 3BMXA 1SZEA 3UVIA 4DZ5A 1JDCA 1XBXA 3B0XA 3HU7A 2A6NA 1IEIA 2Z25A 4C6PA 1UUMA 1QW7A 1JGMA 2CC0A 3FN9A 1NFPA 2ZE0A 4ICMA 2INEA 4CCDA 3U48A 3WQOA 3CYJA 3A3HA 4FOKA 1ZS2A 3SRHA 3ITGA 4JN8A 3H6OA 4B91A 3TTQA 2ZDRA 3THUA 4PZVA 1VF8A 1N8WA 2SFPA 2DZWA 1EGZA 1MZRA 3KLLA 2IPWA 2ZUNA 4TXEA 2ZOXA 1D8CA 2J7GA 3QEZA 3ZZ1A 3G1VA 1PKNA 3RO8A 2NV2A 4W8BA 3UF9A 2GUUA 4X0VA 2DH2A 2HCVA 4UTMA 5M5DA 2H3DA 1PCWA 3QKZA 1NELA 1E6RA 1OC6A 1WOBA 4W4QA 4XAFA 1ZPTA 2GZXA 4JXCA 3WDRA 5LIWX 2Y7DA 1TUXA 3CL6A 1S5TA 4ZSTA 4Z2LA 4GY1A 4ADUA 1RAKA 1XD1A 1HJVA 2GJRA 3VDHA 2ZVIA 3R5EA 3R0UA 4TO8A 1GG1A 4GUHA 4PSRA 2VZSA 4MAZA 1W9UA 3I6TA 3TSBA 5JH2A 3MJMA 4A3YA 3F03K 5FF2A 3E5PA 1KFWA 4CUCA 5DMLA 5D9NA 1I2RA 2E40A 1PHWA 2JF7A 4UQAA 2PDJA 5HNUA 1A3HA 3F2DA 1QW8A 2TPSA 3URQA 3S9YA 1XPGA 3NL6A 4DYJA 1XRFA 4A6GA 1O95A 2QCLA 1SQ7A 2PF8A 4PMUA 4J3WA 4YN5A 5LHEA 1DJQA 4IG2B 3PUDA 3H70A 5HA7A 4E3TA 2DW6A 1XCWA 1GOWA 3CUFA 1E5NA 2YXXA 3OOQA 3W28A 1VH7A 2XIIA 1HJSA 2OX4A 5HQLA 3BSGA 2V67A 4KETA 3ZSTA 5A2BA 4U5IA 1EEPA 5DBUA 3SGZA 3W1MA 2CERA 1F74A 4P7OA 1F61A 1MW2A 4UCGA 3NPXA 3SCNA 3AU6A 3VKJA 2FB2A 3CAVA 5A6LA 2WKLA 4I9TA 4NX0A 4G9PA 3GTNA 1RCQA 2I56A 4NNAA 4BI7A 1WKDA 2P50A 4F3HA 3W70A 4ATDA 4C5ZA 1RQBA 1CXKA 2YL6A 4EAYA 2OYLA 1A5OC 1JG9A 2IKGA 1AL7A 3VPLA 4I7WA 5EMKA 1WZKA 2R6OA 4PL2A 2BOFX 5DRCA 2DT3A 4U2ZA 1SUXA 3EWZA 3KM8A 2RDTA 4FA3A 1BXCA 1XI3A 1UZ4A 1PKMA 4BR1A 3E74A 3QTGA 1O94A 2PAJA 3E6EA 3V75A 3C2VA 2EPNA 3QR1A 5A69A 5JBFA 4GGBA 4F66A 3MT1A 3RU6A 2O9RA 5REQA 1V79A 3F4WA 3ORWA 4TX6A 2OGYA 3P61A 3CK5A 1UKQA 1AMKA 2J78A 5HQEA 1F7BA 5E6ZA 1H50A 2VEFA 2JBMA 4F8XA 3BZGA 4I9AA 3O1NA 5D2YA 1TRDA 4FF5A 2CBJA 2ZXDA 2GJXA 2J4GA 3DBNA 3NJ3A 5LZLA 1I75A 3HGJA 1WV2A 1TJ0A 2D2HA 3BV4A 3TW7A 4GO8A 1YKWA 3TYDA 4L1WA 4LQ1A 3W1UA 4QG9A 3OVQA 2I9UA 2UWFA 4GH3A 2QT3A 3IIZA 3CMFA 3G6LA 4W85A 5LNWA 4A8LA 4QROA 1KRCC 3VMPA 2YLAA 4UR9A 4PUNA 4KFNA 3OQEA 1AJZA 4IGMA 1YTEA 3VIJA 2PFHA 1UG6A 3RUBL 2HXTA 2CWXA 2W6RA 1US0A 4KPLA 3F2BA 1LWIA 1Z7AA 1ZNNA 3PPFA 3HG3A 1LQ0A 3W7OA 4XAPA 1VFOA 1X7IA 1O4UA 4DBWA 4AB4A 1YPXA 2YB1A 3BK0A 3WF3A 4L56A 3T7VA 1GTHA 2I9EA 4L4LA 3PB0A 4AVOA 4B3KA 3SRFA 1XWYA 2A7NA 3UGRA 4GVIA 5FEPA 2WZEA 3MUZ1 4H9VA 3QMRA 4LNCA 3L5AA 5FSEC 1H7RA 4JZ5A 2BY3A 4P8XA 1H7WA 4MNMA 4CD5A 4S2BA 5A6KA 2DZPA 4LYKA 4IZGA 1O5XA 1VIZA 2A3BA 4FP1A 1ZZMA 4Q7NA 2BOGX 4DUOA 5J5DA 1KFJA 3PBGA 4DVOA 1VJZA 2BY0A 4YYCA 2E4TA 1GHRA 2DFAA 2GGHA 3DG6A 4LVBA 4MB1A 1FWHC 1KWGA 3MCMA 3FXYA 8RUCA 2GVEA 3R4IA 5CSSA 3S1XA 2ZUTA 2EXOA 4IPIA 4WXYA 2Q3RA 5KINA 2Z1SA 1GQNA 1QI5A 4O16A 3MQTA 3BQ5A 5CPMA 4DI8A 1W5MA 4XAYA 3BG5A 2FZDA 1ITCA 3KHDA 5HBFA 2J8FA 1ICPA 3KX6A 4HOZA 2E67A 5DY2A 2E8YA 2EQDA 1X38A 4RUBA 1J0IA 2C14A 2W79A 3T78A 5EGRA 4DI9A 4MWAC 4GXMA 1QO5A 3T81A 1ZB5A 3SGGA 3F4CA 4F0LA 1GKPA 2ZUWA 4KEZA 4O28A 3GRIA 1J0YA 1TWIA 3WK0A 1A5AA 4C1LA 3CL8A 4F4RA 3NVTA 2NVCA 1X6LA 5J04A 1XUZA 3M16A 3NDOA 3OODA 4LY8A 3RO6A 3MYOA 1FP8A 3FS2A 4QRNA 1VLIA 1HNYA 3IGHX 3LLFA 5DX7A 2QDDA 3RX3A 4MFDA 2I57A 4BQ3A 2OQHA 4EIVA 1ITQA 2V5CA 4JOMA 2OWWA 4GNJA 4QNEA 5D8WA 3LHUA 4GYFA 1HT6A 3EX2A 4B5TA 1QXLA 1LJYA 4X2PA 1HJUA 3WD1A 5CC5A 5CZTA 1WUEA 2Z6IA 4NZ4A 1WQ5A 4O17A 4H6EA 3VUPA 1IWBA 3IIVA 4LAKA 2WW5A 3LGEA 4H00A 4E8GA 2J7FA 2A6LA 4LF2A 1F8IA 4A8NA 2X7VA 1E6NA 1CYGA 4ZEPA 2ZIDA 2WZIA 4L1GA 5CC3A 3IVSA 2NQZA 1LP6A 5K4XA 3BUVA 4W9TA 4B9ZA 1TE6A 4JIQA 3CQIA 3SECA 4MWAD 2Y4SA 4GZJA 2CLKA 5CZSA 2DZUA 3STEA 1FCBA 2GJLA 1IE7C 4DBEA 1TMHA 2ZXQA 1Z9AA 3TV8A 1PO9A 2WPBA 1ZUAX 4UTWA 1DVJA 4YVXA 1HG3A 4YIWA 4K68A 1EJRC 4YHGA 1I0BA 4RZ6A 3BJSA 3T4CA 4MHBA 1H51A 4PTMA 3N4AA 1RY0A 4ZXLA 2WANA 3C86A 5EA9A 4DXXA 1JUEA 2QV5A 4ACYA 1OX6A 3P62A 4H7VA 4GBDA 4KFOA 1VHCA 2Z28A 2E68A 3SY1A 3PZNA 1SU5A 3QTPA 2VGFA 5C7HA 2X16A 3TR9A 1GYMA 5GJNA 3C2FA 4D6EA 3RYSA 1YRRA 1R46A 3DC0A 2V6AA 4CCZA 3TSMA 4JTFA 4N9EA 9XIMA 3NDYA 3GNNA 3HPSA 2QLYA 4MB5A 5DO8A 5AC6A 1F6YA 5LGXA 4J3XA 3M0XA 3HOJA 1IIGA 1KBIA 5CSUA 1C29A 3NYDA 3AICA 3ITYA 3C0QA 1XBYA 3LHYA 1K03A 4RZ5A 4AYGA 4NHVA 1SZRA 3AIUA 2I5IA 5CLTA 1TREA 2Z2UA 3WIJA 3GVGA 3UY8A 1UA7A 3TP4A 4IIGA 5G4EA 4E5TA 2PLMA 4H41A 4QQ3A 2BHYA 3GO2A 1XIHA 1XLMA 3S6OA 4HNLA 3E0LA 3R6IA 2QYGA 4L6HA 2AQVA 4ZODA 5TIMA 1TPVA 4NAEA 1PTGA 3EMQA 4LV4A 4GMEA 5EBAA 2O55A 1J2BA 1R47A 5AVNA 5HNTA 3B9EA 4WSKA 4K1GA 4EAMA 1Z32X 1LROA 1WXYA 4PMZA 1HW6A 1KFKA 3U9IA 5A8MA 3POHA 4NI3A 4YU1A 1JCXA 1TZ9A 3P5YA 2FPYA 2PRLA 1GZGA 2UY3A 2ADAA 3TN6A 1ADOA 4JN7A 2G3IA 5BRBA 4QIUA 2PWHA 4JY9A 1DWJM 3RLHA 3WKZA 5CKSA 2X09A 2P76A 3I6RA 1EIXA 4OECA 2ZRXA 3RX2A 1XHGA 3YPIA 2ALRA 4JTLA 4AMAA 2FH8A 3E9AA 3G0UA 4V2XA 3MP4A 3R0DA 1OGGA 1Q6RA 1RJPA 3VFLA 4OFCA 5DN1A 2X7WA 3N2MA 4WRHA 3VM7A 4Q8UA 4G7EA 1E6SM 2CW6A 1FY6A 1ICQA 4O19A 1NQKA 4JNYA 1YYAA 3WG6A 4FOUA 4IFRA 3GW0A 3E0FA 4N2YA 3ZOAA 4NG3A 4KWVA 4S3AA 2A79A 5FJOA 1LOQA 3EXTA 2DUZA 1PS9A 3DDMA 4PCSA 3K1GA 3LSBA 3BOFA 1MQPA 1QI2A 3L9CA 3M0VA 4X61A 2DU2A 1YXDA 3C8NA 1G1YA 1XYCA 3SRKA 3BLFA 1W3IA 3RCMA 1YNYA 2XU2A 3AISA 4JTUA 4FNPA 5JBDA 1XLKA 3JS3A 4R7OA 3RM9A 2WJZA 1EXBA 2WZTA 3M7SA 1QNRA 1XSIA 2INZA 5A1AA 4QXIA 1SSDA 3PUOA 2C1IA 2GJNA 3U6WA 3S9ZA 2ASHA 4JNZA 3V1PA 4WDTA 3ARRA 3LCXA 2QDGA 5EMUA 3M0LA 4IQJA 3OZOA 3N2TA 1KGXA 2NV1A 2W62A 4JTHA 5HJYA 3V5FA 1LL6A 3VKDA 1XPYA 4HMDA 3DHPA 5A6BD 1BGAA 3I3EA 3CMJA 1IWAA 3FJNA 4NZ3A 1LG1A 1XG3A 4O1FA 3WEOA 4DBDA 4HBKA 3G1YA 2DZBA 5F7UA 3ZJ8A 2YBVA 1XGEA 3PK7A 3TN3A 1D3HA 1UWQA 2NX9A 1UWSA 4LALA 4L65A 5A95A 4C7DA 5HINA 1RY8A 3R89A 3UWWA 3ALFA 1SJDA 1MNZA 3WDQA 4FXJA 1CLVA 3VZZA 2G97A 4UR8A 3EKGA 1EDQA 2NV9A 3W7QA 4PTXA 2VZUA 4JNMA 3CUZA 4WKAA 4AY1A 4H8NA 3PBWA 1J5SA 2J74A 5HJXA 1L2QA 1Q8JA 3H2NA 1FWCC 5CG0A 4Q4RA 1PJ9A 1W1YA 1K77A 2OO6A 4RDZA 3EB4A 4CNUA 3Q94A 1XSJA 4W93A 3GDKA 1ME7A 3ES7A 5EMJA 3A6OA 1EO7A 3V5OA 1GORA 4Q8NA 4RE0A 1VEMA 2GSEA 2GYIA 3H2MA 4LUTA 4IXHA 1MI3A 1FWEC 3BLDA 4GX9A 4X60A 2VX7A 5CPNA 1E56A 2AL1A 2VMFA 5CJNA 4LVGA 5G2WA 5F2MA 1JAEA 4KS0A 4CQ9A 2R14A 2QCDB 4LH8A 1HKJA 3WLNA 4A3RA 4LBUA 1FCVA 1TO3A 3MI2A 2V68A 3E96A 3TAOA 4HOWA 4ILSA 5AZ0A 2NZLA 4GWEA 4Q8PA 1BQGA 2F2KA 1FWAC 2PCEA 1LCOA 1PV8A 2ZRWA 1IGWA 4MZ8A 1JXKA 4FNTA 1RD5A 4U31A 3AMLA 2DZVA 1E71M 2CZEA 3G1DA 1DWGM 3VC6A 5FEZA 4C90A 1S5WA 3E38A 1V3JA 1PWMA 4GUGA 3WF1A 3S46A 3FKKA 4W7WA 4GQ0A 3E49A 4CNTA 3KVKA 3ZIZA 5IRPA 2D24A 1E0XA 2VWSA 4MTVA 5A5WA 4AEOA 5LNRA 4WOQA 3R8HA 3VKKA 4EPEC 4HPNA 4S3BA 4REQB 3S1WA 1Q4WA 2FZMA 3MO7A 1K4HA 3RFAA 4E4UA 3W7HA 1CGYA 3KRBA 3PZOA 1CCWB 2V5LA 5C2GA 1D3GA 3M43A 3TLQA 2E5CA 3OQ8A 3KAOA 4UIOA 4H8HA 3ANUA 2AL2B 2CLLA 1ZQ5A 3BJTA 1XLLA 2XVNA 1UPMB 3WSUA 4ECLA 5A6BA 4IHCA 2RUSA 1U22A 2CKSA 4HN4A 4YL2A 1JR1A 3W71A 1PYMA 3WMSA 4B5VA 1OADA 2Y7FA 4Q33A 2QCFA 6ENLA 1F6KA 3DIPA 4ZXOA 2A7RA 1QNOA 4NZFA 1W0MA 7REQA 4ML9A 3W7LA 3ZR5A 2QUUA 4EWJA 1Q7MA 4K8GA 2BV9A 3VKAA 3W25A 3IAPA 2ZZ5A 3TLLA 4AZ5A 3SEPA 4QHRA 4PTVA 1BG4A 4OOZA 3NR0A 1E5JA 3TJIA 3CASA 3WN6A 1NTHA 4DF1A 5AYXA 2BB0A 5FOOA 5CXPA 1V3HA 3TE9A 4MPKA 5FESA 1QDSA 3AWOA 3QQWA 3TQ0A 1V6XA 4PFHA 2C8NA 1TKKA 1QR7A 5H91A 4URIA 1UW9A 2C18A 4US5D 3OG3A 3DKJA 4RW3A 3CUIA 3LB0A 5E93A 2R1PA 2O56A 4PEEA 4RE4A 6A3HA 1Z48A 5DY3A 4QLKA 3W81A 2V30A 1E3ZA 5I79A 3WEZA 1C8XA 1T41A 3HFYA 4MG4A 3T07A 1OG6A 3ZJ7A 2YL5A 3QZAA 1EDGA 5DMYA 3UG8A 3RR4A 4GYPC 1O5RA 1TB3A 3D3FA 1SFTA 5KEZA 4EF8A 4RDYA 3WO8A 5JU6A 2QVNA 4ZSUA 4CD6A 4R9OA 5A8QA 5B7YA 5D32A 4AVFA 3GH7A 3WDIA 1ALDA 1GEQA 2PC4A 3H2CA 3B40A 2A3EA 1S2TA 3VNLA 3EOSA 3ONBA 1OFPA 1DJIA 1NSJA 1DQXA 4KESA 2J7DA 4AC1X 4JAWA 3T05A 1PDYA 5AHIA 1IHIA 3P8JA 4DZHA 3IVUA 2YA1A 3AXHA 1RJRA 1GOQA 4HPGA 1TVLA 2R24A 3CUHA 3NXLA 3S5YA 2GVJA 2Z7GA 4E4PA 1KFEA 3S0CA 3ICJA 2QVHA 4EXQA 4CQDA 1E4IA 4AX7A 5BOEA 3VTRA 1M7PA 1BRLB 1I9CB 3CHCA 1QPKA 4GXWA 1CXIA 3W73A 4DF0A 3AO0A 4I6VA 3WLOA 2QUNA 2OTDA 3RMJA 3KOXA 3OBKA 5DBTA 4AH7A 3AIBA 3GNPA 3PWIA 5E09A 2HPMA 3LI1A 3E0IA 3EWDA 2C0HA 1AL8A 1W3TA 1EB3A 1OB0A 3WQ5A 5G4WA 4A8IA 5IHRA 1WNOA 2ZRUA 3AALA 4AD3A 4RXFA 3CNYA 1WP6A 4LCSA 2DT2A 3C0JA 1S2VA 3H4WA 3WQ4A 1S3TC 3GFYA 3OW1A 1V8EA 5FAJA 4CN6A 2ALDA 3WLIA 2F38A 2WAGA 4C6NA 1EO5A 3IIOA 1V4YA 5KZEA 2C79A 1WBJA 1HKMA 1GOIA 2G4JA 3ZQ9A 2DH3A 1XR2A 1WKFA 1V02A 5GNYA 5AHLA 4MM1A 4Y9PA 2VI0A 3WDPP 1DJNA 2GQ9A 4XO7A 4GLEA 1P6BA 2X1UA 4PMXA 1EHNA 2Q3OA 4ZL1A 2EEXA 1H7NA 1L6SA 5A2CA 3K1DA 1DJZA 2OXNA 3TTEA 4C7GA 2PDHA 1C91A 4J4KA 2BGSA 1E70M 2C6QA 2NLIA 2VQUA 1I45A 1KM3A 3GDTA 4H19A 1MXGA 4YMZA 2ACQA 1FHVA 3QFWA 4GIEA 4NSBA 5A8GA 1G69A 4AXNA 2QF7A 3QHMA 1ZLPA 3KP1A 4IIBA 5AZ1A 3DN5A 2IQDA 2ZKMX 4RR4A 2WKJA 1V6YA 2GDUA 6CGTA 1Q66A 3DKLA 2GGJA 2DVUA 4N7QA 3PHAA 3TTSA 1J2WA 2VX5A 2PLJA 1XUUA 1XLIA 3IJDA 4FHAA 4E6MA 2RH9A 1PWLA 4A4AA 1TPDA 2Y62A 1SO3A 4LC8A 4K38A 3RM4A 2VGBA 3SZ8A 1H5VA 3KTCA 4CD4A 3GYCA 6REQB 3CS2A 4D8ZA 5D9PA 4WVXA 1AVAA 2YGYA 3EOEA 3QVQA 4Y9NA 4FX8A 1YW1A 1ESWA 1FXQA 4HK6A 2JE8A 3UBPC 3S3GA 4UC5A 3VGGA 3UXAA 1N8IA 2CESA 3UYCA 3L65A 2OG9A 3WENA 2NUXA 1JCMP 5D9MA 1XFCA 3J7HA 3WLQA 4Q8WA 5K9CA 5DT5A 4X9SA 5CBBA 1LQAA 4D8AA 2R82A 5TNVA 4PMDA 4DJEA 2OYKA 2CHRA 1RPXA 3UP8A 4AD1A 3MY9A 2FKPA 2QS8A 4BZYA 4GZ7A 1WDPA 3MCNA 3A22A 1HX0A 1H5YA 1BVZA 2FZBA 4O8AA 1BVNP 4QX4A 1JAKA 5A6AA 3CH0A 1A3WA 2DSUA 3FCPA 3T40A 4BQ5A 3HPXA 2YYUA 1JCNA 2RFGA 1D9EA 3VZXA 1JQXA 4XBSA 2CZFA 5C6MA 5D4YA 2X42A 3B9NA 3THAA 2WSPA 2YLLA 3BCFA 4TIMA 2QV4A 1Q85A 4Z1CA 1P0KA 1WZMA 3KS5A 1IR2A 2IUZA 3THQA 4OUIA 4R27A 4AAJA 1KTCA 4Q4MA 3WQDA 3L12A 2Y1HA 3N25A 5C9XA 1XRSA 4AD2A 1QPOA 2VEIA 2PTXA 1W1VA 3LM7A 3KE0A 1XLCA 4DJFD 4B15A 4C1NA 2VC9A 4KW2A 1TVPA 1V93A 3B8IA 4PCFA 1A4LA 3U2ZA 2WKGA 3W1XA 1HP4A 3TTYA 4WSHA 5LIKX 4ZQOA 1BD0A 2Z1VA 1NFBA 5AYBA 4PUJA 3G8RA 7PTDA 4AF0A 1JPKA 1RA5A 3L5LA 3LLDA 1CW2A 3WL0A 3UJRA 3M0JA 4H01A 1JEZA 1Q45A 3QFEA 2OQYA 3GVWA 3UWZA 3M0KA 1DJWA 2H8ZA 1XIGA 4HU3A 4M5PA 1GT8A 1KM0A 3F2CA 3NWRA 2PWVA 4G8TA 3OLIA 4GI4A 2XGBA 1XGZA 4JTGA 1RK5A 3O6CA 5C8BB 3VGHA 1GNXA 1PB0A 3LENA 1A4MA 3EDDA 4GY0A 4UFMA 1GJWA 2DEPA 4CN4A 4N4PA 4WY0A 5I24A 2BG5A 4GH1A 4LU0A 2TODA 3W37A 1TUFA 2IKJA 3HG2A 2W92A 4KCTA 1LBFA 4BK9A 3TU9A 3B05A 2HS6A 4UQCA 1EGMA 3TW9A 4E0CA 2WBGA 1FXPA 3NSNA 4YVVA 2PDQA 1A5KC 4JN6A 5HMSA 4D6FA 2FMOA 4AISA 2XFWA 2QJJA 1J6OA 1W1A1 1VRDA 5C70A 4M29A 3GNDA 3VIOA 3N4FA 3H21A 1MW0A 3FVDA 1NQ6A 3NQFA 3CT2A 2C15A 2WHMA 1EYWA 1UP2A 4C6QA 3G1RA 3MI3A 4HA4A 4GYPA 2ZUMA 3NVDA 1ZBWA 1OT1A 2O0TA 4A3QA 4QP0A 3M46A 4PSPA 2VC5A 1V5XA 1Q13A 4WGHA 4Q32A 3CZGA 2HTMA 5HNRA 3N19B 4IP7A 4KMQA 4NILA 4XAGA 3VZYA 2VFGA 3VIPA 3PZVA 3H2EA 1X97A 3LQGA 1F3WA 1UMLA 1ZAHA 3B9AA 3FNDA 4O12A 2P88A 1B3ZA 3FSTA 1W54A 3WELA 1NOUA 1R2RA 2RAGA 1EJ7L 4L4MA 4MUZA 1VLWA 1RP9A 1UP3A 5E9XA 4C6CA 4F40A 2YCIX 1L6GA 2BVDA 3GC2A 2QXWA 3A4AA 3BH4A 3LD5A 3BOLA 2YCLA 4D8LA 2CU0A 4XD4A 2YL9A 2CBIA 1DJHA 4XUGA 1E3XA 5ABFA 4IUOA 4B16A 5I07A 1CB7B 4O14A 2R1LA 5I23A 1KLZA 2FTPA 1C9DA 3UXLA 1LWJA 5M1TA 1W3NA 2V81A 1QO2A 1EF2A 1POKA 4UQEA 1MW1A 5ECUA 3ENLA 3FHAA 2QZRA 2VT0A 4QDWA 3PJWA 2VCAA 3GDBA 3PULA 5U7SA 4PUEA 3W7RA 3SQLA 1JZ2A 2YCKX 2PDPA 2GQ8A 2OOFA 4TX8A 4DJED 3W6LA 3CAKA 4V1XA 2NXIA 1TPEA 3W7IA 5FEXA 4H1ZA 1UZDA 3K46A 1GUVA 4IISA 3ZT5A 3GWQA 4HSOA 1Q6QA 7ENLA 1L8PA 3DUGA 3NUKA 2GSHA 3DESA 3EWWA 2X2GA 2GL5A 4PODA 4QTGA 3TMLA 2PDBA 8A3HA 1KFBA 1QNQA 2ANUA 5C0QA 1X8CA 4W88A 3QMTA 1KCZA 3G1HA 4EVZA 2DT0A 1NF7A 1VBHA 2JK2A 2AQWA 4NXSA 3G0XA 1PHQA 1N82A 2CIPA 2XSAA 4ZQMA 4KEMA 3N3TA 4W8LA 3HQPA 2NQLA 4NZ5A 4AEFA 3KP0A 4KCVA 2W0UA 3MKKA 4BA0A 4TU1A 1NARA 2MANA 4KKXA 1S38A 2ZA2A 1JZ4A 3PTDA 3BLEA 3EXSA 4H4IA 3FW6A 5CGQA 3U7BA 3VD4A 3WJYA 1QBBA 3W7MA 2PDKA 4JTKA 3K4WA 8TIMA 4ASTA 4QLJA 3KBWA 1WX0A 4ZOBA 1FWDC 3LBOA 3WZ0E 3N18A 1KBJA 3EOOA 3FEQA 1DTUA 4HTYA 1FWWA 4C6DA 4FNRA 3C2EA 3AHVA 1DV7A 1QHOA 4FOJA 1ZJIA 1R3VA 5K3VA 2E3ZA 1SSGA 3ARTA 1TELA 2C0AA 2TMDA 4Z1BA 1AQFA 1LM1A 1K3UA 3V1HA 3R79A 5AYYA 4BY3A 2PTDA 1AW1A 1J0JA 3M44A 1KB3A 3LEPA 2JALA 3QBUA 2DJLA 1N7KA 4HCDA 2POZA 1FFQA 4EP8C 5LNUA 1IXQA 1FQ0A 2V5BA 3ANYA 1C92A 1IEVA 1Y7VA 3WD3A 1S46A 4IGNA 4ZTXA 1R7OA 1CXEA 1FWFC 4CQCA 1XS2A 1AUSL 2FGLA 3GH5A 1JDEA 3DGBA 1HFBA 1L2UA 1E55A 2TSYA 3UG5A 1UR0A 2Y61A 3VI2A 2ZUVA 2YBTA 5E70A 1XYAA 3H8AA 4FSAA 3STFA 4QCFA 4P61A 4ZGYA 5CEWA 2V2HA 4EPKA 1WDDA 3FAXA 3HG5A 4XX6A 1MVYA 3TEVA 5BRQA 3PJUA 2FDMA 4BWLC 1EXPA 2YJQA 3CPRA 1TVNA 1FX6A 1ZJHA 4GIRA 1XX1A 2PCQA 5L6UA 3P82A 3HG4A 2CZ5A 3DAQA 2CLFA 1DP0A 4GNVA 4IFKB 3G5EA 4Z2KA 5C54A 5KSWA 2XM1A 4D71A 4ENLA 1CXHA 2D3NA 4J5NA 1S39A 4LEQA 1MQQA 4ZB5A 1FWTA 4X9YA 3LPGA 3NEVA 1M7JA 1OYAA 4PL1A 5CG7A 5I09A 3EA2A 5M17A 4LYRA 3ZLFA 4H2HA 4V27A 2E5DA 1K8XA 2VEGA 2PZ0A 2DSWA 3N14A 4NX5A 2BGNE 3GAKA 4UFJA 2B81A 3K4DA 2VEKA 4IIFA 5HPCA 2IPJA 5G2HA 4IMDA 1H41A 3HURA 2DT1A 1OX4B 2ISSA 2VCCA 1V0MA 3B04A 4LC6A 3BAYA 1MXSA 4QR6A 2BP1A 5JIPA 1JZ7A 2E5BA 2ZRYA 2Z26A 4DAIA 2E77A 5I3JA 3DFYA 4QJ4B 2J79A 1T7LA 4DNMA 5HULA 1TCMA 2KX9A 5FAGA 5GPRA 1LYXA 2VP8A 4KCUA 1V7YA 3VGBA 2PDNA 4JTCA 2E6AA 3E3HA 4GGHA 3ABZA 4HU4A 4NXKA 1EC8A 1EDTA 1VBRA 3M0HA 1GVQA 5K2ZA 4OHQA 4PEKA 3EDFA 2OCZA 4ZFMA 4J3SA 2FJKA 3BWWA 1K7EA 3T08A 5EMMA 1GHSA 2W91A 4H9TA 3VFCA 3S9IA 3E02A 4IMFA 3ABOA 3MWCA 7TAAA 4N42A 3GDLA 4O15A 4IJRA 3PPCA 1EL3A 3AYTA 1P48A 3GG7A 4P2VA 3MMTA 2D23A 3CZKA 1GCYA 1TYGA 4EX4A 3P3BA 1BLIA 4XAZA 4DPPA 3R25A 5D04C 1EJTC 3EB3A 2XZ7A 3WNKA 1J6PA 2CPUA 5U4NA 2VENA 4HSNA 4GI6A 2HNEA 2I1OA 1B3YA 3UCDA 3AU2A 3USBA 4HOXA 2J6VA 4YTQA 2BTMA 4N6FA 3OB8A 3H7VA 2C1GA 3BJFA 2PTZA 4C65A 2AGTA 3TYAA 2AAAA 2XDFA 2WO5A 2HMCA 3P14A 4G7FA 4HMCA 1VAHA 2GVLA 1ENUA 2ISVA 1QPRA 2MUCA 2E9BA 2VVNA 4PMNA 1NIUA 2J9YA 3N11A 4HMEA 1GVOA 1QI3A 1UBPC 5DCDA 2HK1A 3TOYA 1O6IA 3RLVA 2YFNA 1RBAA 2WSKA 3U4AA 4INFA 2FPTA 1HJQA 1DHKA 1VFFA 4GQGA 4YCOA 5JMUA 1VHNA 1L9WA 3EX1A 3P2VA 2R9RA 1JULA 4ERGA 2J88A 4XZHA 3BW4A 5FKYA 2C91A 3W22A 1XIBA 1C7TA 1XJBA 2ISWA 5JIWA 2WZMA 3QPZA 1UZ1A 3WCZA 4C6MA 3BLIA 5BZAA 3M0ZA 1WDSA 2QUVA 1Q6OA 1TZ7A 4PUMA 1XQLA 2GGEA 3HQNA 5AYIA 2V3EA 3E2VA 1IR1A 4AZ6A 1BSIA 3W3OA 3N2BA 3WLTA 4RL3A 1SGJA 9CGTA 4JEQA 1K8CA 4B92A 2ZRVA 3VGEA 5GJMA 2XJ7A 1B4KA 2TYSA 2BFGA 4O18A 4IM4A 3APYA 4F0HA 5AB3A 1W9VA 2GLKA 3SR7A 3NGFA 5DFAA 5CJMA 1Q6LA 1GVFA 2MNRA 2AMXA 3NQDA 1V6UA 4GFIA 5E5CA 1FCQA 1CNVA 3SN4A 2G3MA 1DJXA 4P8VA 4WJXA 4AX6A 3HTWA 4FXFA 1IXNA 3WJZA 1G6CA 2XISA 1P0BA 3CWNA 2HISA 1FCUA 3OLDA 3OHMB 3WY1A 3C2OA 4K7YA 3KOZA 3S6DA 3PR2A 1XISA 3VNYA 5E1QA 1FWJC 2EPHA 1UD4A 3UU0A 5T8GA 4HPXA 4FX7A 3NCOA 5K9DA 4HN8A 3T4WA 1PKLA 1EP3A 4ZFCA 1ZRQA 3GHRA 1LDCA 2UY2A 4BCEA 3ARWA 3TSDA 4DYKA 1WA3A 1L8NA 1WKEA 4JY8A 5MHBA 3BGAA 4MFEA 3GIPA 1GZJA 4JGDA 3MO4A 2WJEA 1R6WA 2X05A 4B3ZA 1J0KA 5D03A 2NSOA 2ON3A 2NXHA 1VD6A 2XVKA 3M47A 4S3KA 2BNJA 4QFUA 4Z1AA 3AYSA 4WHBA 2ACUA 5D05A 4UOZA 3V7PA 1Z69A 2FZNA 1W5NA 3QV6A 3K8LA 3GXDA 3LZ3A 3W1AA 2B4GA 4R85A 1B90A 1NDZA 4GZEA 4UTLA 4M82A 2ZC1A 1E4NA 4DF2A 4UTJA 4C5YA 3WDHA 1Q6FA 1US2A 4HYWA 5DMMA 3W72A 4S3JA 1TMLA 5HMFA 1W1TA 4HVXA 4J28A 3LPOA 4PH6A 1GPFA 1S2WA 2Y8VA 3NQCA 3HA1A 1T8QA 4HK7A 5AN7A 4H9XA 1QJWA 3QPYA 3TCSA 2E25A 4KCWA 1E0WA 3VD9A 1OJXA 1BQCA 5C2XA 1YBQB 3VKBA 4JIEA 2E0PA 3K8MA 4P7RA 2BASA 3W7JA 3CJPA 3S83A 1SFJA 7TIMA 3BCJA 4KEVA 3IIXA 1E43A 1J01A 3NQEA 4OE7A 4WGXA 2ISDA 4PTDA 1AH0A 1KM1A 3W7NA 1I2NA 4DXVA 2GQAA 1CGVA 3PUEA 3MU7A 5HMDA 2ZXBA 2A0NA 5LYRA 2AKMA 2PP1A 4YWSA 3EWUA 1TCDA 3S1GA 4GACA 1AK5A 4OWGA 4L9ZA 3UEQA 2QCDA 4V1YA 2WVUA 4J40A 2O7QA 4A22A 1Z6KA 4DWSC 3UJFA 4K39A 3E5BA 3LCIA 5LSMA 2ATMA 4NNCA 3JZEA 1OG0A 2EKGA 4WJ8A 4H9MA 3NA8A 1F07A 2XWDA 1QATA 3L4XA 3SB0A 3AYRA 2JQXA 1U30A 2RDWA 3HPFA 4LAUA 3H2OA 1KCXA 2WXDM 1J79A 3SJNA 1TWWA 1PE1A 1H1NA 4NRRA 1MW3A 1ISVA 1XW8A 2YX0A 2XVGA 2F84A 1THFD 3E2SA 4JTRA 3BPWA 3BARA 5LA1A 3Q4DA 1CXFA 4JQ2A 4LS2A 3V0TA 1LLWA 3TH6A 2BLEA 2W67A 1FBAA 3T2QA 4KRUA 3TXVA 4NUWA 3I4KA 3GNRA 3DI1A 2P3ZA 1MUCA 3GR7A 3D47A 3T0DA 4RV3A 1FDZA 3UXIA 1YBQA 1MMFA 3QHOA 3T6CA 1MDRA 3HV9A 4A35A 2QGYA 3AHZA 1N2VA 1B3XA 3BGGA 1I2QA 1HIZA 4MYAA 1DQWA 3SCOA 4BHYA 4JTEA 1GKQA 4OU1A 5BMWA 3IV3A 3L23A 4K2SA 1A47A 5HAOA 2PGEA 3KUMA 4JFVA 1H49A 5JBEA 3ME3A 4LANA 5BXRA 3N6QA 4BEUA 4UB9A 4HNUA 2Q8XA 4LOCA 4DNHA 3VDGA 3WLRA 1PSCA 4Z42C 1PXGA 1A3XA 2HWGA 3U2OA 4DWSA 1EIBA 3EOLA 4MB3A 3SI9A 3MTWA 5BWAA 3T0BA 2XVPA 2ZZ3A 1T40A 1NY1A 2QHAA 3BG3A 2YBUA 4S2CA 3DC8A 4UFKA 1R3RA 3N9RA 3BLLA 5BRPA 2X1TA 1GOOA 1U1HA 3O6AA 3MDUA 5G1YA 1JZ5A 1QK2A 2XH2A 5CC6A 2DP3A 3IUIA 5A6MA 4ATLA 1MO0A 3FA4A 4MMWA 1HZYA 3BTNA 1UR8A 5D02A 3AZTA 1SJBA 2J27A 2XGZA 4XVEA 1R8LA 1TPH1 3MSRA 2V69A 2JKEA 1VJIA 4H7ZA 5KZMA 2X0SA 5GQBA 3G1XA 4LW7A 3GHSA 3H7RA 3VX1A 5IBXC 3M5XA 1P0EA 3A24A 3ARUA 3VCRA 4PCNA 3N4EA 3R58A 1O1HA 4FNUA 1CEOA 4QDMA 2CNCA 4FO4A 1XIIA 4OZOA 4IX2A 3LTSA 1QBAA 3COTA 4JQ1A 3WNOA 4XZIA 4KGJA 3S2LA 3FYYA 1UD3A 1KBBA 4MLRA 3R10A 4JYDA 4H9ZA 3WQFA 3EZ4A 2YXOA 2GK1B 3W9ZA 3T1GA 4Q6XA 3B9DA 3WLMA 1XKJA 4HNTA 2RJGA 1F8MA 4NJJA 3GTHA 2D2JA 4GVHA 1R86A 2OFJA 2WCGA 4DM1A 3VABA 2CZVA 2FJUB 4AZCB 5M2FX 2HPIA 4MNLA 1LLOA 2OSWA 1ML1A 2H9AA 4LVFA 2R8WA 2VR2A 1K8YA 1PPIA 2X1SA 4XVDA 2CETA 4L7ZA 3GAYA 1UKOA 4UNIA 2EBNA 1ONEA 1UKTA 5FJPA 2NT1A 2YA0A 3PBYA 3CB8A 4JTSA 1LORA 4JL1A 5EKYA 3ZMRA 1CT5A 3RPDA 3V3WA 2CLEA 2EKCA 4HA3A 1X98A 3QY6A 1J12A 2ONEA 1V6WA 4B4FA 1CPUA 4H7CA 2X40A 4Y9OA 2J62A 4WQ6A 4JICA 1RCOB 1TFVA 4UNLA 3VIFA 3NPWA 3G1SA 1E6QM 5IOBA 4GKTA 1XRTA 3K8KA 3TROA 3U2EA 4YTTA 3BZJA 1EFZA 3W29A 2WMKA 5IM51 1YTDA 1XG4A 3F7JA 1OIFA 3SO7A 3GNXA 3BV7A 3SCQA 5KTLA 3PC0A 1F05A 1IIHA 4TTGA 2XFRA 5HUOA 3VA8A 4IG2A 4V33A 2OELA 1V3KA 2WSRA 2NWSA 4IJBA 5BNKA 3BL3A 2EPKX 4EKJA 1K02A 4MY1A 4CEXC 3M6DA 4X2RA 4UOQA 1MEHA 1V02E 3G8EA 1J0HA 4FPSA 4H6RA 2DIEA 3A9IA 2ZX8A 2VCBA 2YSWA 2PLCA 3TXZA 1Q3NA 4GJ1A 1VEOA 3NQMA 2FLIA 5FJJA 5BXTA 1LBMA 1PYFA 2ZZ6A 3MANA 4DN1A 1PTAA 4D6JA 3LPFA 3T9PA 1VEPA 1W17A 3QYSA 4BI6A 4Y7EA 2NVDA 2AAMA 3LZ5A 2CFFA 1IT8A 3TN5A 1MQRA 3VOCA 1XDLA 2DJXA 2G5WA 3G24A 3IUHA 4EE9A 3L0GA 4N0RA 2B7PA 3LA4A 1XQKA 4O1DA 3OYXA 4O1AA 3RPMA 4BEQA 3K2GA 3LCLA 4IICA 3D6NA 4A2RA 3WFLA 3UWUA 1B30A 4S1FA 4S3CA 1GQLA 1X6UA 2V0TA 3MBFA 3ZLHA 4JFTA 4ICNA 3AFBA 3FJ6A 2F8QA 4I3GA 5CBJA 4C6FA 1NDYA 1TV2A 1W9DM 1DWFM 3FYOA 4J3VA 3ZJ6A 4DJFC 3KBVA 3W6MA 4FB7A 1YE4A 3LQLA 3QSTA 1S2AA 3KEHA 4BF9A 4DEFA 3AWNA 4RK8A 3W02A 1SZFA 4M1BA 1M03A 2VELA 1QFEA 1C8YA 3PNUA 1UR3M 4W7VA 1U5VA 5HATA 3D3AA 1AZ2A 4I8DA 4LUTB 3WMBA 1FKXA 2E28A 3PZQA 4QJ5B 1EPVA 2HNHA 1OC7A 2YCLB 4AZBA 1RQHA 3QKEA 4O0ZA 3EEZA 5AHMA 3PWGA 5FD0A 5IBXA 5FI8A 1FH8A 2V82A 2E8ZA 4J2MA 3UWEA 1E1CB 3MVTA 3LGGA 5F4SA 3ARYA 1GVRA 1QK0A 3M6YA 3O0KA 1M7OA 4UMBA 3GQYA 4Z2HA 1PCKA 3WF2A 4JQ4A 4AEEA 4RPPA 2WV8A 3OZYA 4CQ8A 2CXGA 4WF7A 4O52A 1MSSA 2QCHA 3ISIX 5BU9A 2VUNA 2X30A 2VM8A 1R9YA 1SW7A 5KETA 4ZOAA 2BGQA 3FHQA 3KTSA 2PODA 2OKOA 4LEFA 1UBSA 3LRMA 1WDQA 5KITA 4NZ1A 1LZOA 5AY7A 3WUBA 4I7VA 1VYSX 1V51A 1ECEA 5CZKA 1UB3A 2VDHA 3VIHA 3RNDA 4POCA 5A3HA 3MB9A 1UUQA 3UR7A 4P7LA 1EP2A 3TIMA 4MY9A 4GCXA 4QSHA 4IP5A 1WBHA 2BOEX 1WKYA 3G3DA 3WUEA 2R1MA 3UR2A 4IJCA 4YNGA 2ZE3A 4U3CA 3UWVA 4DBSA 4X0NA 4P7QA 1VYRA 2POTA 4PB5A 1WO2A 1GTEA 1UA3A 3FYPA 3FA5A 4RXGA 4J3ZA 5ENLA 4K7VA 3IJ6A 5D33A 2XN0A 1MEIA 3IGUA 1CZ1A 4HSHA 1PZ3A 4Y9AA 1E1CA 4CGTA 4M51A 3SRDA 1G0CA 1Z8AA 4PMYA 3RXZA 2VXNA 4JTAA 4XKYA 2VR5A 1DBTA 1UR4A 5F4WA 1UJPA 3PPHA 5D2TA 1G7UA 1RK6A 1H3GA 3FEMA 1UQYA 4U33A 4H3DA 2X41A 1JD9A 5H1WA 2FDSA 2TAAA 3V4BA 1SMAA 2EGZA 3TA6A 1EA0A 1P0DA 2D2GA 3W2UA 4EPBC 1XIJA 2CLHA 1R85A 3WQ8A 2CBUA 1BYDA 2JFEX 3R94A 4GXPA 4KEUA 4PB3A 2VWTA 2CBVA 1MDLA 3T42A 4G5DA 2Y5JA 1IXOA 4DBUA 1F9CA 3BCDA 3FJLA 5XIAA 3ATZA 1IZKA 2Y7EA 1VJSA 2HVOA 3VNKA 3HGRA 1TPB1 3NO3A 3DYOA 1Q6EA 4WOZA 4ROQA 3TQKA 1T6MA 3TAKA 1U2YA 4CD7A 5CAKA 5ABEA 3FKRA 5LIYX 5D9OA 5G2IA 2Y24A 1PIIA 3CH9A 2RHGA 3LNMA 3ERPA 1AA1B 3TJLA 2CZDA 2A5HA 2G50A 5DMNA 3IGXA 4HU0A 3NQAA 4GI8A 3W27A 3GKAA 3PS7A 1V7AA 4FR6A 4TR9A 3PB2A 1FDYA 4LS1A 4A29A 3IGSA 5I2UA 2QNEA 3P93A 2ZDSA 4KH2A 2I16A 2WMIA 4ZENA 4TVUA 2J75A 4MAVA 4MWAE 2YFOA 1XIMA 2BSLA 4ZMGA 3GD6A 1MRQA 2ZZ2A 3KRZA 1JYXA 5CPQA 1EUAA 3CQHA 1FWBC 1ZAJA 2XUCA 4O1CA 3TYCA 3LX9A 1R38A 5HWNA 5C9RA 3B9OA 4Y8FA 3KBNA 1U1UA 3L66A 4ORMA 2VKZG 1MFUA 2W5FA 1BRLA 4DZAA 2DVXA 1V77A 1F73A 4YXGA 2CLIA 2J24A 3L4YA 3GXFA 4LRTA 3AHYA 4IPJA 3CV6A 3PAJA 4CU7A 1LOLA 4O11A 3O7UA 3N3MA 3IRDA 1EEXA 1UP0A 4CVWA 2YW4A 4UTTA 3AXMA 1ICSA 3DI0A 3PZUA 1TX2A 3AXIA 4UTKA 1OCQA 2ZQ0A 1DXEA 1Q2RA 1U5HA 4UCFA 2DUAA 1UWAA 4IMGA 1JZ6A 3DCPA 2D2OA 3ELFA 2XSXA 3AROA 3W75A 4ADTA 3WQEA 2NQ5A 4YS1A 1NF0A 4OGZA 2YIHA 3U0HA 5CSYA 3VC5A 1XGDA 4L61A 4ONVA 4PFMA 1NJJA 3GTXA 1LUCB 2ACRA 4JIRA 4J35A 3FJ4A 1S5NA 2VX6A 2Q09A 4AWSA 3CPGA 3OLEA 1KRBC 1I1XA 2I17A 4ACZA 3CL7A 2WHJA 1QT1A 2P8CA 1XYFA 2UBPC 3GYEA 3N6HA 1ME8A 3DHFA 1QCWA 1XC4A 2Y5EA 1WAWA 1PIGA 1CENA 3DECA 3QOMA 1EQCA 4GI9A 3BICA 2Y0FA 3G1AA 4E2VA 2WVTA 4CNNA 2VTFA 1XYLA 4I90A 3BMVA 4RNJA 3VO0A 1R3QA 3HZ3A 3RR1A 4P8WA 1Q4NX 4O53A 1HKKA 1MNSA 3GKFA 3CUXA 4LAMA 1DORA 1ZCCA 1K6AA 4J9JA 5A94A 1G9HA 3MPGA 3HV8A 2DIKA 3UY7A 1JNDA 4O1BA 3ARVA 4V28A 4K3ZA 3WDJA 1XCFA 1VGAA 2C71A 2ZWYA 3C2RA 4F0SA 3SSJA 3WNNA 4RCXA 1PTDA 3DEQA 4ROPA 3PZIA 1ZHAA 4DAFA 3C4UA 4CLMA 2QEZA 3DG7A 2Z29A 3I68A 2DZXA 1JRBA 1UZHA 3N15A 2FHBA 3ZR4A 1H7XA 5SWUA 5DEZA 3VINA 3GG8A 2PEVA 2GWNA 3UCQA 3M5VA 3LU2A 8XIMA 1VPXA 3QY7A 3PWAA 3CHVA 3NZPA 4X63A 3ABSA 3R13A 4ZCWA 2QMKA 4HCHA 4DY1A 3QHNA 1ONRA 1XDMA 4C6KA 3UCCA 4KERA 2NSXA 3O15A 1GW9A 4Y2WA 5GNXA 4EPDC 4JX6A 1V3LA 4AZHA 5A8NA 4XZLX 4O4WA 1OBAA 1KNWA 4DWDA 1AH3A 3GU1A 1TJPA 3LDVA 3CV2A 3VCCA 4C1KA 3W6YA 2IXUA 3ARZA 4FEZA 2ZRZA 3WLHA 2VL4A 1FRBA 2O4QA 1OCJA 2PDYA 1W31A 2WCSA 7REQB 4GIYA 3I7QA 2OPJA 5J8LA 5LNSA 4QG6A 2CKRA 1Y0EA 2J6XA 3DG3A 3VOIA 4FMVA 3LMYA 1XLEA 3A9BA 2IKHA 1OT2A 1QVBA 2ODOA 2E7FA 2EJ1A 5C7VA 2ZTKA 4FAMA 4XWUA 3L0NA 3L4WA 3AIEA 2QDHA 4HHHA 1UQZA 3SJ3A 4AHOA 3BMWA 4LVDA 3P67A 3TK7A 4YJ5A 1UPPA 3MCOA 3MMDA 3WBEA 2EPMX 2VEMA 2PZNA 1OF6A 3JUGA 4ZB0A 2V63A 1Y5XA 2IQTA 5ABHA 4X22A 2EHHA 3DFPA 1EP1A 3P80A 3TR2A 3W1PA 2REQA 3QOKA 1I0DA 1TMQA 4DO6A 4QAIA 4LNYA 3N29A 5AOUA 5FIPA 5FL1A 3PP7A 5AVHA 1F4HA 4N9CA 3AOFA 2OEKA 2OEMA 4RX0A 4Q4KA 4UZSA 1PZ0A 2ATSA 6PTDA 1QWKA 5FACA 5CSRA 3AS3A 3DFTA 1R9ZA 2WMIB 1ZY9A 2ZUSA 1QPNA 1ITXA 1HP5A 3BLOA 3AMDA 4HNVA 1S1RA 2NUYA 2PS2A 4CNPA 2QPSA 1ZFJA 4G6CA 3AUJA 5ECVA 4GC4A 4NZJA 1OD0A 3UG4A 5I3KA 2XN2A 3W74A 4Y96A 5EFDA 4LJ3A 3W7KA 3TWAA 3LXCA 2QR6A 4IFOA 5D38A 2QCEA 4ZOCA 1YMYA 5EMYA 5I06A 4H9UA 5BXPA 1XD0A 1OFOA 4MUPA 2V3GA 3CAQA 3PM6A 4JFWA 2O9PA 4O0QA 1TA3A 4DZIA 4TV6A 3P74A 1K6WA 1AH4A 3WBYA 2BXVA 4S3DA 1NP0A 4HYVA 3IPWA 3L7RA 3C56A 4CQAA 3WK2A 2QUMA 1XBVA 3OBEA 5HQMA 3H4XA 4JD4A 1V0KA 2PDGA 3M9YA 3IAQA 3LHTA 4IIEA 1H1YA 5I00A 1MWOA 3KFTA 3G0SA 1LUCA 4L4OA 4QAWA 2OLHA 5BOOA 3QLDA 4UMCA 1HQTA 1ZP4A 3B0VC 3TQPA 5D2VA 1TV5A 5F2GA 4M0XA 2FFIA 1KXTA 1REQB 4FNSA 5F4XA 4GUFA 2WMHA 2WMGA 4M6VA 3CV7A 4RKAA 3AIRA 1KCKA 3ZM8A 3OJGA 1YE6A 3EDKA 3POCA 4IPLA 3PG9A 2PDCA 4MNJA 3VDBA 1J93A 3VXGA 1WOAA 3K5XA 4XG1A 3TJXA 3KVLA 1BXNA 3W76A 3P6LA 3UXKA 3VIMA 1J5TA 5EBUA 3INPA 4IIHA 2DORA 1QU4A 1CIUA 1EA9C 4GFSA 2H9AB 1LOSA 4R7WA 3LTYA 2JIWA 2JKPA 1X96A 3GBEA 1O68A 2VFHA 1AG1O 2E1WA 3NSXA 5D09A 3EWXA 2WQPA 4TMBA 4LSBA 1H2JA 1FUYA 4DO4A 2Z00A 1I60A 1KV5A 1P7TA 1BYAA 1W37A 4AVNA 4F79A 3UWYA 3ZWSA 1GONA 1PX3A 3N73A 5F2LA 3BSHA 2ZICA 1TJ2A 1JI1A 2BXYA 1SW3A 3CV1A 3LGDA 3EAUA 4FXSA 3NL5A 5G5IA 3NZRA 3AJXA 3PTQA 1EJSC 1E1FA 4GHRA 2OZTA 1VFLA 2DDXA 3CMGA 4IX0A 4C6OA 3E1F1 4LUYA 3W1QA 3MV01 3P0XA 2OB3A 3KCJA 2FGZA 3UNDA 9XIAA 3HFTA 1JUBA 5XIMA 1DJYA 4U2YA 3P60A 3WH7A 4U3AA 4MOZA 2Z1BA 2XYLA 5JQ9A 3LLXA 4C60A 4LAOA 1GVEA 1FWNA 4UR7A 1PX4A 3P5ZA 3MDWA 4M6QA 3TA9A 4A2SA 1H0GA 2J66A 1R3TA 1M41A 1XSKA 4LY4A 3VNDA 3GXTA 4QDPA 2GK1A 4NJHA 4ACZB 5H8UA 1VR6A 4D6GA 1D3CA 3O16A 1XLJA 2D0HA 1Y5VA 3DX5A 3E2QA 4LB4A 3WK3A 4QSFA 2QQ6A 1KFLA 3VM5A 1FHLA 1P43A 3GU9A 2P3EA 2XINA 3N04A 3NFUA 2WLYA 3GXIA 1O5KA 4LGXA 1TPUA 4ZZ9A 4JTQA 1V6TA 3W2LA 3NZ1A 3AMGA 1HO4A 3FV9A 1B54A 1GYLA 3B0UX 2HXUA 1IT7A 4Q22A 4UQDA 3UXDA 4S3EA 1TTIA 4ALDA 2HSAA 3EPMA 3DENA 1B2YA 3DERA 2PC8A 4Z1DA 2XFYA 2HE5A 1XINA 4ERAA 4GJJA 3EWYA 1XYBA 3BAIA 4DQWA 4AU0A 2VO5A 7XIMA 1IV8A 4ZBCA 4DX3A 3VNJA 5HK4A 1O60A 3GVVA 4JDBA 4N6EA 4LUIA 1JJKA 2DPEA 2NWRA 4ICCX 1T96A 1XLAA 2C3ZA 4Y6GA 3P8IA 5HNNA 3HMCA 3TYUA 3MHGA 1BKSA 2H8XA 2ACSA 1KTNA 4KWSA 4GBUA 1I2PA 1ZGDA 4I9JA 4IFKA 5XINA 3UZJA 4LUSA 5JXQA 3CLWA 1V3IA 1MEWA 3AMKA 3S5NA 4YTRA 1K7FA 3O6YX 1KRAC 1DIKA 3WQWA 2OSYA 4WCJA 4HNOA 3AIVA 1XRVA 3QC0A 1NP2A 1H09A 3RN6A 3LCGA 3Q45A 3NQGA 4DJDA 1NVMA 3G6MA 3UR5A 3RLUA 5AYZA 3GZAA 4KQNA 1Z42A 1GYNA 3NQ7A 4F9DA 3SFWA 3CXOA 1M65A 3MUY1 4NAFB 2J13A 2KZHA 3CUJA 1VP5A 2OWCA 1RLDA 1QUMA 1OC5A 1WE5A 3MHUA 1EQPA 3VNIA 1DTNA 2NXGA 1V0NA 1O1ZA 4KIEA 5F2IA 5C9WA 1AJ2A 3L4VA 3C0LA 3AS2A 1O5QA 5C71A 4XQ6A 4XUYA 2WNNA 2PP0A 2P53A 4PBEA 1LRTA 4XIAA 2XSBA 5B80A 5IFPA 2OODA 4ZQCA 2W61A 4Z1YA 1KXHA 5D37A 3WLKX 4KFPA 4DM2A 3W1LA 4L6DA 3S2JA 1WXZA 1KM5A 2AMGA 1OVDA 2OU4A 1X1NA 1XDJA 2WHKA 1ONXA 2G8ZA 1TV3A 3BOXA 3ANVA 4RLIA 3IS4A 3L2IA 4TOQA 4XZMX 1ISYA 2DSZA 2WWCA 1B9BA 1DIDA 1V6VA 2AGKA 1KA9F 2YPIA 4CCCA 2D73A 1XKYA 4R33A 3ECQA 3KRSA 4QCEA 1SJAA 3ITTA 1YDYA 3MYPA 3RCYA 2Z27A 4Z0JA 1US3A 1A0EA 3UA4A 5C9ZA 3LM3A 4QG8A 1A5NC 4IL0A 4FS9A 2ZX7A 3NOEA 2Z24A 3EB2A 4PULA 5CAHA 1YDVA 4C7FA 3JVAA 3DZ1A 3U5YA 1HVXA 5BXSA 3L4TA 1B1YA 1OIMA 4PUUA 1E72M 3ITOA 1GOKA 1VENA 3K30A 3O63A 3L4ZA 2XM2A 1SFSA 3VAVA 3G2GA 4QE1A 1BG9A 3SCUA 4AW7A 3SUWA 4BFAA 2XH4A 3PNZA 2DUXA 1EZ2A 4YPJA 3W4RA 4O0KA 1KFCA 1BWKA 2PTYA 3C52A 3Q37A 1GQIA 1KGWA 1T8XA 3HF3A 2JGYA 3WYZA 4GNKB 4EACA 1LG2A 3AHTA 3WD2A 2VYOA 3HPAA 4HU8A 2VZOA 1AD4A 1KGUA 3EX3A 4J3TA 1JCYA 3W87A 4BWLA 1OM0A 1ONWA 2DW7A 1DL3A 2FIQA 2W4XA 3VX0A 4QEHA 1HKVA 1R2TA 4GUJA 1K9FA 4JYFA 1OINA 2A3AA 4UXDA 3WH8A 2OX1A 4JKMA 2P10A 4QLLA 5ABTA 4PE8A 4E8CA 2PWFA 4CCEA 4XIMA 2R91A 4JHMA 2PD5A 1RPKA 3T09A 4DUXA 1F4AA 5PTDA 5LKYA 2PSNA 4ZE4A 2HV5A 1EWDA 3S5OA 5A6SA 1VB9A 2XHYA 2F9RA 4K36A 4JX4A 3WNPA 5LNVA 5HANA 1EYEA 2R1KA 3KVJA 1TRIA 3T55A 2W63A 1QAPA 3MUIA 3B8TA 3M41A 3NGJA 4J1OA 5CGMA 3SY5A 3DHUA 5I77A 3NSMA 4LF1A 4NI8A 4PMVA 4QE4A 4ZR8A 3B8UA 2NVAA 3N9KA 4GKLA 2VX4A 4RJEA 1TTJA 2V38A 1B3VA 4OT7A 3OBAA 3QGAC 3TNBA 3CB3A 1UIPA 2FVMA 5HUPA 3LV5A 2YR1A 1CWYA 1FKWA 2DZTA 1SM9A 2W9MA 5LHFA 1BXBA 3KBSA 5F1UA 1JYVA 1D2KA 3HQ1A 1SMDA 4ORIA 4E2DA 1IXPA 2CLMA 4JQAA 3AZSA 3QGKC 3MI6A 2PWDA 3TQVA 1XIEA 4LYQA 2F61A 4US5A 3OU8A 5DF0A 3QW4B 1S2UA 1JIBA 3IACA 1WB0A 3ABRA 2FHFA 4IMEA 3VGFA 1RV8A 2DZSA 1TJRA 3RCNA 3V18A 3MWAA 3H2FA 1P7TB 4ES4A 2FH6A 2E6YA 3N13A 1D7KA 3AHXA 5FF3A 2JKAA 2L5HA 1RH9A 3PAOA 4M19A 3BGJA 4Z17A 3M4HA 3SFKA 3OIXA 2EO7A 4HIBA 3B0YA 3CUGA 4ZO9A 3SGUA 3AYVA 3C8FA 4LCRA 1NFGA 3ARSA 3FGCB 4NF7A 3H54A 4F2TA 2GOKA 4IGSA 1VBGA 1F76A 1M9HA 1P6CA 4C1NB 3KCOA 2YB4A 1BYBA 1B31A 4YYFA 1FH9A 3LI0A 2Y5SA 4DB7A 1GOXA 5HPOA 9RUBA 2QJIA 5A2AA 2XH7A 4LUSB 2VFIA 3BDKA 1ZP3A 1F6PA 5C5YA 2UY5A 3WH6A 5FSDC 1K9TA 3DBPA 4K8EA 3QC3A 5FL0A 1DWHM 4OBSA 1VBUA 1E6XM 1Q7ZA 5E0KA 3AXKA 3OHIA 2XIOA 3PZTA 3T2OA 4CVUA 2YXGA 4MNKA 1JL8A 2ZX5A 3GIYA 2AKZA 4HZ8A 1WDWA 1IEQA 4M8UA 1A5LC 1MXDA 3CIXA 4D72A 4HNNA 1D7FA 1DOSA 4A05A 4MJ4A 1VFTA 4B5XA 1QRQA 1JF5A 4AY8A 4EF9A 4A3UA 4AIOA 4M6UA 1XIDA 4WUIA 3UJEA 4I5XA 3H22A 3CYVA 6ALDA 1EF3A 1E0UA 1UJQA 1UHVA 3BO9A 2WVVB 1AODA 2O9TA 2KAUC 2WC3A 2WHLA 4UTFA 2YDRA 3GDRA 3LNPA 3WD0A 2W27A 1A5UA 1X7FA 4R3UA 1RR2A 4G1KA 4RZBA 2ZC8A 5M3WA 4M56A 1PAMA 1QI4A 1WZAA 4NP7A 3GM8A 3ZS4A 3CQ0A 2PA6A 3SW6A 4MDPA 4KRZA 2DGAA 1JPIA 2E1DA 1XH0A 3UD6A 1GVYA 4XB3A 4QJ3B 1UD6A 2FMNA 5H8MA 2XGIA 1HJWA 4UTUA 1HL9A 4IF2A 4ZTYA 5AHFA 4S3GA 3GHUA 3B06A 3PBUA 2Q8ZA 5FF0A 3E0VA 3S1VA 1BGGA 4PRTA 2R1NA 3OA3A 3VD7A 5CQ1A 5BYWA 4Z08A 4JL2A 2XPKA 2D3LA 3STGA 1P6WA 3TYBA 4GZIA 3I3DA 1Q63A 4PRRA 1E1EA 2Z0IA 1B9ZA 2VFDA 3CEPA 4H04A 2CYGA 3MUXA 3FXGA 1P4CA 1WDRA 3NEHA 3EMCA 4FLQA 4L80A 5AC7A 3ZXWA 2PDFA 1HUVA 3QXBA 1H62A 4PN2A 4XD6A 3V5CA 4JR5A 4XBKA 2Q8LA 1EUNA 1VCFA 5FEWA 4JTTA 1UROA 4JHZA 1IWPA 1T0OA 2GGIA 1WUFA 2VJXA 3KDNA 4WZHA 2VR4A 2A1YA 4ZB2A 4UWMA 1XC6A 3C5QA 1H63A 1W8GA 1G4EA 4MB4A 2BWGA 3PUGA 1FP9A 3BAWA 1NWTA 3BQ6A 1TG7A 3AMCA 4JHOA 1E9LA 4O1EA 3UJ2A 1E0TA 4LPCA 5KMYA 4CD8A 3H2AA 4QEEA 1RVGA 1R2SA 1EJUC 1DQUA 2GSJA 2BHZA 4JCLA 4UFIA 1H60A 3B4UA 1TR9A 5K7JA 4TUFA 2WLZA 4I7UA 3QV9A 3V16A 1XM3A 3RLGA 1YEYA 3CZLA 1XFBA 3URAA 1TZZA 3W86A 4QJ1A 3R2GA 3VMOA 3D46A 2JEQA 3BXWA 3PZ9A 4AQLA 4DYEA 3AXXA 5F1VA 1CGXA 2PB1A 5MKGB 2IMRA 4D6DA 2EJAA 4PUDA 2J47A 4AIBA 1S3HA 2OQLA 4M7TA 3II1A 1F3TA 2EG8A 4E3VA 1XL9A 1EC9A 3UQNA 1ZJAA 2J77A 3VDAA 3DH7A 3ZWTA 4M7SA 4NQ1A 5JVLA 1R5YA 2D0FA 3MC5A 3UR8A 1IF2A 1FOBA 4AZGA 3HJEA 5H6HA 3AIWA 4UBPC 4MZYA 3GNOA 6XIAA 1FDJA 4ERIA 3D5HA 3UZWA 4JX5A 4AZIA 3LN3A 3OG2A 2OSXA 2GPTA 5HR7A 3M7WA 2DIJA 2VDGA 1JCTA 4GQBA 1SZGA 3CZEA 3SADA 1OX4A 4E38A 5HDRA 3NIYA 1KR1A 5DANA 4XK2A 1R9XA 1OFAA 3T8QA 1ECQA 4U10A 4HB7A 4S23A 3UZ5A 5CCZA 1RHCA 1K4GA 2QF8A 4E4FA 3N6JA 2O4MA 3EDEA 4UTWC 3CC1A 3ITVA 2WB5A 2VZVA 4PTWA 2ZA1A 4TQTA 4J7RA 1SW0A 3MP3A 4LRSA 4RNFA 2UZ9A 3MSYA 1C8VA 4Q4QA 2PPGA 2Q6ZA 4HYRA 1LT7A 2P0OA 1FA2A 4GQQA 2GJPA 2HVNA 1GVIA 2P1FA 2VUYA 1XYZA 1IYXA 1YIXA 2FGBA 1GQJA 1Y8BA 2VVSA 3EWBX 1E6ZA 3O07A 4QQUA 2PTWA 3QMSA 3S5ZA 2B7OA 3W88A 5I3FA 3QM3A 4G1NA 1TJ1A 3N2XA 4IQLA 4MJZA 2XIMA 3VOHA 4AFYA 3TVAA 1W9XA 4FLRA 1Q2SA 4P8UA 5CZ0A 5I3IA 3I10A 5CPOA 1ISXA 3VOJA 3SUVA 4L1XA 3ZVHA 3UPWA 3W0KA 3HMJG 3QW3A 2Z1KA 1J0ZA 1N55A 4I6KA 3NQ6A 1W5QA 1D8WA 1VFHA 4AD4A 4MVAA 4MADA 3MZNA 1QHPA 2NW0A 1GKRA 2WQDA 4O54A 3L68A 4GC3A 3I6EA 1W5PA 2G3FA 3UPBA 5AHEA 1EGVA 5FA5A 2OZ0A 1JYNA 4CU6A 3KL0A 1WPCA 2PGFA 3ZT6A 2C7FA 2Y63A 1R3SA 3TN4A 4DO5A 4GISA 1TQXA 4P7NA 3W24A 4DUWA 2GUYA 5IDZA 2X8RA 3VYLA 3T0AA 4NT0A 1GOMA 2OLSA 2BY2A 1DPMA 3SCPA 2PWGA 1DYSA 2UY4A 4KRTA 1SFLA 3WQPA 1K1DA 1LTDA 1XF0A 2CHOA 2Y85A 3F4DA 4WLCA 3F4NA 2BODX 2Q71A 3R11A 1HF6A 2PDIA 1EOMA 5BROA 3GK0A 2PURA 3FSUA 3BSMA 1FWRA 4B90A 1H0IA 4W89A 5RUBA 3CHEA 1F5ZA 3UZZA 1ZALA 1E9ZB 4KBXA 3WJSA 1G01A 3MHFA 3WBWA 1IZCA 1TV8A 4GIAA 3CAWA 3WL1A 2HE8A 2VOMA 3REQB 1VRXA 3PF3A 4OUEA 3P84A 2Y6ZA 3EYPA 1UH2A 3WFZA 3I3BA 3CTLA 1VFUA 4N4QA 4PMQA 2FQIA 2QDEA 2QCGA 1WYIA 2VZTA 3CHDA 1REQA 4GA8A 2O92A 1EBGA 5C9UA 1YHTA 4QGCA 4GD0A 1DE6A 4RE2A 4B5SA 4UZUA 3O2LA 3TDFA 3OVRA 3DFHA 5C55A 3PANA 1S2CA 3GVQA 3TJ4A 4LTSA 2G96A 4PMOA 5E9AA 1B5TA 5BMXA 2WC7A 4FI4A 1KXVA 3GXNA 4ZVJA 2OGJA 3CU2A 4L9YA 4DPQA 4Q8QA 3U2CA 4M81A 3NQVA 2A4AA 4NAEB 1VFSA 2O9OA 3L4UA 2FB3A 5BWFA 2PWEA 4XSLA 3UFYA 4JKLA 5HOSA 2QIWA 4YVPA 1C93A 2ZADA 3A5VA 3I7RA 3W7GA 3U57A 4WXZA 4ZA0A 3CGTA 5GNZA 2I7GA 4KGLA 3AS1A 3KZPA 1L0PA 3EEGA 1V03A 1KQZA 4BKNA 4Q4SA 4HHPA 5T91A 2PLKA 4KIRA 2DY3A 4LAZA 4NL1A 3DHDA 1KXQA 1Q65A 4B5NA 3ALGA 4ATWA 4F0KA 2OT0A 3I4EA 2Y2WA 4NZCA 3A4JA 3F5KA 2V3FA 3IK2A 1VBJA 1X39A 1DEDA 2IS7A 3HGOA 1JXJA 1F3EA 1OK4A 4LCQA 3TYZA 3QV7A 3QH2A 1EZWA 1ME9A 3O0FA 3REQA 2IKIA 1J9YA 5CZJA 2ZYFA 1EJVC 3UETA 1G67A 3VOGA 1AQ0A 3CWOX 5CLWA 1CX9A 4G7EB 5TF0A 1GJPA 3APGA 4IPNB 4GE8A 1B3WA 4J3UA 3S4TA 3CHFA 2XFFA 3OZMA 4CNOA 1QNPA 4U28A 3H26A 2YZ5A 3OGSA 4AD0A 1HL2A 1R7AA 1XLFA 5D2WA 3WQVA 5I5RA 4UTHA 2J25A 4MKVA 2PBOA 3ARQA 5A8OA 4FLSA 4FNQA 4WY0F 1DJGA 3UGVA 1W3KA 2XIQA 1CGUA 1SR9A 4NAFA 1PL9A 1BWVA 4ADSA 1VZWA 4DRSA 3B8SA 3M0IA 1XICA 4TX9A 4WDWA 2RJHA 1XH1A 3L0KA 1GG0A 3H24A 3WD4A 3WMLA 3SCSA 4XZNX 4LXFA 2PE4A 2ZX6A 3NPVA 3KOFA 1G5AA 3RMEA 4XV0A 1U33A 4EANA 3AI0A 2H6RA 5D30A 1M5WA 2W3ZA 2PUZA 1P1MA 2V2DA 3RRAA 2V3DA 3B3DA 1QWGA 2ICSA 1OFDA 4ZE5A 2YDAA 2H3BA 3LG3A 2PU0A 3WBXA 1J4EA 3W2KA 4TVDA 3IJQA 4KF1A 3H23A 3RG6A 3VIKA 1CI1A 2OR2A 3URNA 4LWWA 2VQTA 3M0YA 4B5WA 4GYJA 1QI0A 2D20A 1DXIA 4IL2A 5A6JA 3DFQA 2G4FA 3HB9A 3N12A 1JUKA 5EFFA 4M80A 3GC5A 2WMJA 3AQUA 3WLSA 5DXYA 1Q5MA 3LRLA 1FFRA 1DWAM 1OF8A 2WJDA 2JF6A 2B0MA 2YYTA 1GPWA 1SO4A 3LOTA 4NY2A 1M6JA 4ZQPA 4B5UA 5T9CE 1EJWC 4J2PA 3UG3A 3AZRA 3GTFA 1VFMA 3D0CA 3U7VA 3TOPA 3W7PA 4C6BA 2B31A 4UMAA 1XV8A 3FDGA 5B7ZA 5G4HC 2WBKA 1Q6DA 1AW2A 1YTKA 4IT1A 3PVFA 1UKPA 3QSRA 1Y65A 3NO1A 3HM7A 4NJGA 3RF9A 3ZJKA 5BW6A 4IH3A 4DWSB 2J7HA 1Z89A 3GSMA 3LCWA 3EXRA 5DCBA 3GW3A 3VK5A 5IDIA 1RA0A 1YXYA 5EB8A 3R1ZA 1RVKA 2GOUA 2HDJA 3SBFA 1VYPX 4NYYA 4O8RA 3G1FA 1W3LA 1KTBA 1A5SA 1ZAIA 2CLPA 4HT3A 3TTOA 3BAKA 2DQWA 4HA0A 1BAGA 1JD7A 2BVTA 1TWSA 3I7SA 3TKFA 4PBGA 1CGTA 2F7FA 3WLJA 4E8DA 4DJDD 2YL8A 3SQSA 1OK6A 2WM0A 3MMUA 4EXAA 4B4HA 2WSYA 2EAWA 4HD5A 2G95A 4WK9A 2VHLA 2PD9A 3GE7A 2CHNA 3ZR6A 4XBJA 1K9DA 3BW3A 4AY7A 3UVAA 2QCNA 4OOUA 3FDKA 3RX4A 2Z1WA 4L5ZA 4Z2GA 3ABXA 3SN0A 2E6DA 4LVAA 3NG3A 1UWTA 4HZMA 3VDCA 1G4TA 4RDVA 2NQHA 2WNWA 4FZIA 1QNSA 4FLOA 4PCTA 5CJ5A 2GFTA 3PJXA 3OIHA 5FJIA 4MIMA 5E6YA 3CBWA 3A5FA 3WH5A 4WDUA 2WCAA 2FHCA 4D2JA 3W01A 3T2PA 1AMYA 4PMJA 1EX1A 3OZPA 3QYQA 1B0IA 3IRSA 4JPGA 4JTDA 3V0UA 3N1AA 3L21A 3SCRA 1BYCA 1UC4A 4G56A 4H2CA 1YDOA 4K6AA 1HKIA 3KLKA 5TAOA 2WYSA 4AZCA 4MY8A 5HR6A 4IP4A 3KDOA 3PZMA 2XVLA 1BSLA 1JDFA 4L4PA 4LUJA 1DIEA 3F5LA 4FIQA 3GB6A 2FZ9A 1XIFA 1BTMA 2XG9A 4LBSA 1LL4A 1X8FA 2G3JA 3IARA 5LIXX 1ZJBA 4M24A 3S5SA 2VEPA 4HJFA 4CEUC 1OHLA 1KC7A 5D8ZA 1AFSA 4D6HA 1NWRA 2PBGA 2BVWA 3W1RA 2P0IA 4O50A 1W2PA 1UH3A 2WOQA 3W38A 1UIOA 3STCA 3C6CA 4EXBA 3KRUA 8XIAA 4IMAA 3NZQA 5KZ6A 1SYTA 3OVPA 2J9XA 4WJEA 1L6WA 4AIEA 4WEVX 1FHUA 3R43A 3B0PA 3ZSSA 3BAJA 4L64A 3L2MA 5I02A 1YPFA 1JYWA 5I78A 5G1TA 1LBLA 2BBFA 1DKWA 3B8DA 5D2XA 1Q6CA 3TFXA 2A85A 4EK7A 4XISA 5AC4A 1OFEA 2ABBA 2QAPA 2PDUA 1E9IA 1K8ZA 4YHEA 4NIRA 4L9XA 1A49A 4W86A 3ARXA 4H6QA 3DYMA 1E51A 4IUGA 2VRQA 1KM6A 3QF0A 1I6NA 2JIEA 5G1MA 2DSKA 4HQVA 4QISA 4Q8MA 3RIKA 4HZ7A 1HO1A 3MA8A 3KS6A 2PRHA 3PN8A 3A64A 1FWIC 1CGWA 5TBOA 3LSCA 1YQ2A 1NDWA 2A3HA 6TIMA 1BKHA 2QUTA 3H7UA 3MUCA 2I5GA 3IVTA 3OGVA 2AL2A 3UPMA 3L2LA 3C3UA 2G37A 3GXMA 1SO5A 1GZ1A 3KW3A 4AWEA 2EPOA 3CO4A 2VDIA 1ELSA 3CPUA 1EKOA 3TCEA 1QNVA 2WNQA 1TWZA 1OZMA 3WNMA 2F6KA 3KL3A 3PTMA 4UFLA 2ZWZA 3IWPA 1PIFA 3ONCA 1V0LA 1FWGC 3MKVA 4DLFA 3G18A 4H6KA 4B9YA 4JQ3A 3R8RA 3PFMA 3WLPA 1DE5A 1KR0A 3ABQA 1DXFA 3M5ZA 3TZFA 3GFZA 4XD5A 1JZ8A 4K8HA 2FVKA 1UYQA 3W7CA 1SZNA 5LIUX 1HN1A 3VCNA 1BHGA 3OTRA 4QE5A 3NNTA 4MSSA 5AC8A 4HMNA 3U3HA 3UESA 2OLAA 3P7YA 3BC9A 8CGTA 1RCXB 3Q2DA 3M1ZA 1UD8A 3W2MA 3NAVA 3ITXA 4AWTA 4UQBA 1TIMA 1HXJA 1H4PA 3BLKA 4H8UA 1BVWA 3USZA 1EPXA 1QOPA 2QJNA 2OJPA 4JIHA 3SDOA 3R8GA 2ZFAA 1TSIA 3V0SA 3T0CA 2JGQA 3SUUA 3THCA 4PGLA 4AUBA 3U8GA 3N9SA 3RDKA 5AFDA 1E4MM 3T44A 1YX1A 5LA2A 4DJDC 4PRWA 1H7PA 4LFYA 1QMLA 3QGVA 2WM1A 1C90A 3KWXA 2PU1A 4LV9A 2EPLX 4LT9A 3OP2A 4V15A 4W7UA 1ZBCA 3NO5A 1O12A 1OFRA 4I5RA 1YDNA 4GJIA 1UD5A 3VNMA 4C91A 2ZZ4A 3CQKA 4JBRA 3A21A 2YOCA 2HBXA 2AOSA 3A3WA 4OVXA 5H2ZA 1S5MA 2Z2AA 1JCJA 3LUTA 2QPXA 3W26A 1ZENA 2ESCA 1R87A 3LHWA 5EMLA 2NQJA 1ZSXA 3SIZA 1UR2A 3ZT7A 3EOUA 4QM1A 3ATYA 4GINA 4WX2A 4RW5A 1E40A 1ODZA 1EH9A 4F9JA 1OEPA 1CBGA 4Q4PA 1Q6GA 4PCPA 2VFEA 2XWEA 1KV8A 4DJFA 4HPHA 3QQ0A 3TC6A 3WNLA 2F6UA 1OSEA 2I14A 3NOYA 1OD8A 5AKQA 4YTUA 1S1PA 1M7XA 1PUDA 2VC6A 1TTQA 3EX6A 2YKKA 1U5JA 3KHJA 4YLWA 2OKTA 1L6YA 2ZUUA 3B03A 5EY5A 1ODUA 1W1PA 1XYMA 1PZ2A 3IJLA 1XXXA 3WX7A 4RE3A 4UNKA 1MFVA 4BI5A 4FR1A 3MMWA 3IUDA 3FFSA 3LXAA 2PDLA 2Z7KA 3OYZA 2TRSA 3WUFA 3A4WA 3B8VA 2A2IA 2INFA 2BDQA 3PBVA 2FTYA 5C2CA 3R0KA 2GDVA 1JVNA 1RSCA 4TVCA 4XSMA 1R30A 1C3FA 3RU8X 4DELA 3DOPA 3W82A 3Q67A 1GQKA 1M04A 3UYIA 4AG0A 5LXEA 2BHUA 4AWUA 4GABA 4GY7A 1JZ3A 3UZXA 1KRMA 1A53A 3DFNA 3LBMA 2Z4GA 3RK8A 1OX5A 1GK8A 3WF4A 1U83A 5FF4A 4Z2JA 3M5YA 1HGWA 1M01A 2YDSA 2HROA 3NM3A 1FH7A 3S2CA 1RZMA 3TC3A 1KKRA 5ABGA 1IQ8A 3GTIA 5EPDA 4I9MA 2Y88A 2FVLA 2EG6A 3KBMA 2HK0A 3DFOA 2GVYA 4QITA 3TNOA 2QIIA 2QCMA 3ZFHA 3WK1A 3PPGA 2F6XA 3SURA 2D1ZA 1WAUA 1LF1A 4TV5A 3MP5A 4H9YA 3LERA 4G2DA 5A6TC 3UNTA 1G4PA 2E6FA 3JR2A 3RM8A 5MKGA 3B8WA 4JS3A 1NAL1 4NASA 1OCNA 1NWUA 3BAXA 3RGTA 1PX8A 1ZBKA 1QPQA 4Y9MA 3O06A 1KKOA 1V3MA 3NQBA 4AYSA 2OZ3A 3VU2A 2FPVA 6REQA 2XZ9A 1RD6A 3Q65A 1NOFA 2BZNA 1UASA 4OJYA 5J5RA 3DFSA 3SCWA 3W00A 1RBOB 2VRKA 1R3YA 1XLGA 4PBFA 3M0MA 4RZ4A 4JEJA 4M1RA 5DELA 2Y8UA 1UMYA 3APTA 4PTNA 4JIPA 3LV6A 3RITA 3SN1A 1W91A 3QV8A 4O57A 2EF9A 3IIPA 3HBLA 1EC7A 1QTWA 1ZCOA 3UT0A 1OGBA 2QJGA 3LTPA 2ABAA 1OGSA 1K70A 3MUAA 4PMRA 3TW6A 1OABA 2PWUA 4HKPA 4QNWA 3GH4A 4GX8A 3S47A 3NM1A 3ES8A 1PBGA 2J7BA 1W5OA 1W3HA 3TYEA 4NU7A 3FY1A 5LXXA 4PB4A 3VD5A 2VD9A 2C19A 3MS8A 3KXQA 3HJZA 3WQCA 3GIQA 1CLKA 4IMCA 1J10A 4W87A 1A5BA 1SVDA 4IOTA 3BURA 3KZSA 3SCVA 4K1WA 2J9ZA 3ARPA 3LY0A 3W2JA 3IJ8A 1J11A 3M64A 3KTXA 1I1WA 2FZ8A 4WKFA 1LT8A 3EPOA 3MW7A 4ZQRA 6XIMA 2NLYA 4GG9A 2GUBA 3GUGA 4GRSA 3LK6A 1J8VA 2XN1A 1UD2A 1EJXC 2HZGA 3ZLGA 3MSGA 1KO0A 4XZWA 2ZBTA 5I3DA 3HGSA 1R0MA 3GY1A 1RBLA 3RJXA 1YPIA 4WSJA 4HPJA 4DLMA 2YZRA 4Q3MA 4JCMA 4PUWA 3KL5A 2WZHA 2LLEA 1TIWA 5I6SA 4E2BA 1OY0A 2PDXA 1HVQA 2ZX9A 4LBRA 2XTKA 3UZYA 5ABFB 3KWSA 4GOAA 4KWOA 4F0RA 1MUMA 4R53A 2IPFA 3A3XA 1E73M 4OBRA 2YW3A 2EG7A 3GS6A 1OYCA 1E0VA 1S5VA 3QLLA 1UUOA 2Y8KA 5GJPA 1JPDX 4FIRA 3KOWA 1PEZA 3JW7A 3OO2A 2GVGA 4IGHA 4FF7A 3FIGA 4JTIA 4Q8OA 3E0WA 1JDAA 5TD4A 4H8VA 2HVMA 5KZDA 4LX4A 1HL8A 4GPNA 3LHVA 5HWJA 1F2JA 2FFCA 3B4YA 1JFHA 4I8YA 4QS6A 3OVGA 3ZO9A 4F2UA 1YADA 3L5MA 3QR3A 1AZ1A 1YXCA 3GFXA 2QJHA 4W5ZA 2HEJA 3OPSA 3EKZA 3XISA 5CGTA 4WD0A 3S2NA 1KLYA 1KM2A 2F2HA 3PG8A 1IT0A 4MJMA 4F48A 4W8AA 3UW6A 4HA1<