3FXGA

Crystal structure of rhamnonate dehydratase from gibberella zeae complexed with mg
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
407
structure length
407
Chain Sequence
b'LSSVKDFPKIKAIRSFIIGGVGSGGDYHNVKGGHWLIDSDISTPASKWEQYKKSRTSWGINVLGSFLVEIEATDGTVGFATGFGGPPACWLVHQHFERFLIGADPRNTNLLFEQMYRASMFYGRKGLPIAVISVIDLALWDLLGKVRNEPVYRLIGGATKERLDFYCTGPEPTAAKAMGFWGGKVPLPFCPDDGHEGLRKNVEFLRKHREAVGPDFPIMVDCYMSLNVSYTIELVKACLDLNINWWEECLSPDDTDGFALIKRAHPTVKFTTGEHEYSRYGFRKLVEGRNLDIIQPDVMWLGGLTELLKVAALAAAYDVPVVPHASGPYSYHFQISQPNTPFQEYLANSPDGKSVLPVFGDLFIDEPIPTKGYLTTADLDKPGFGLTINPAARAKLIPSDYLFKVPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rhamnonate dehydratase
publication title Crystal structure of rhamnonate dehydratase from Gibberella zeae complexed with Mg
rcsb
source organism Gibberella zeae ph-1
molecule tags Lyase
total genus 130
structure length 407
sequence length 407
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3fxgA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3fxgA01
1KD0A 1KKRA 4IP4A 3DGBA 4MKSA 3QLDA 4GGBA 3S5SA 5FJOA 4E5TA 7ENLA 4IL0A 3KUMA 4A3RA 3DESA 4HYRA 3QPEA 4Z1YA 2PGWA 2P0IA 1MDRA 4GYPC 2FYMA 1F9CA 2GSHA 3UJSA 3CB3A 3PK7A 3BJSA 4FI4A 3H70A 3SQSA 2OLAA 4GFIA 3FJ4A 1FHUA 3GC2A 2XGZA 1KKOA 3EKGA 1OEPA 2AL2A 3TTEA 3MKCA 2XH0A 4G7FA 1IYXA 2POZA 3DDMA 3GO2A 4J3ZA 1NU5A 4K1WA 4DHGA 1ONEA 2ONEA 3OZYA 3MSYA 3UCDA 2AKMA 2DW6A 2MNRA 3IJLA 3CAWA 3TJ4A 5J04A 3Q45A 3ZVHA 4DWDA 1R6WA 3N6HA 3ENLA 4K2SA 4G8TA 3DG6A 3VDGA 3P93A 3BOXA 4A6GA 3R0UA 4M0XA 3D46A 1SJAA 3V3WA 3VCCA 1SJCA 2AL2B 4GISA 1PDZA 3JW7A 4HNCA 2XH7A 4GYPA 1R0MA 3TQPA 1WUEA 1EBHA 3FCPA 5IDZA 2PA6A 3I6TA 4HNLA 4H1ZA 1FHVA 3CT2A 3THUA 3B97A 3ZVHB 3GY1A 3HPFA 2PU0A 1ECQA 2OPJA 3DFYA 3NFUA 2PP1A 3V5FA 1EC9A 4IP5A 3R0KA 5FJUA 3PWGA 1BQGA 4E8GA 3N6JA 4Z17A 3R25A 3OZMA 4A35A 4H2HA 1YEYA 2OX4A 2QVHA 2GGIA 3N4FA 3ZLFA 2AL1A 4E4UA 4HCDA 2PGEA 3SSZA 5BOEA 2OFJA 4K8GA 3T6CA 2CHRA 5FJPA 3P0WA 4EWJA 2PMQA 3UJFA 3TJIA 2XSXA 3STPA 3ES7A 1SJDA 1BKHA 3ZLHA 1PDYA 3TWBA 4KEMA 3VC6A 3TWAA 4H83A 3CYJA 3OPSA 2GGHA 2PTYA 1TZZA 3RR1A 3H7VA 2OQHA 3ZVIA 3FYYA 2QQ6A 4KT2A 3ZLGA 2MUCA 2XH4A 2OG9A 3RRAA 3RCYA 1TE6A 4X2PA 6ENLA 1TKKA 3VC5A 1EC7A 3IJIA 3T4WA 3MUCA 2PODA 3RITA 2PP3A 4JN7A 2ZADA 1XPYA 3SBFA 4YWSA 3JZUA 1KCZA 2PTZA 4JN8A 3OP2A 3TOYA 3TW9A 2AKZA 3D47A 3FV9A 3UGVA 3VCNA 2O56A 1P43A 4ZCWA 4GGHA 3FVDA 4DX3A 2NQLA 2HZGA 3MQTA 1MDLA 3PFRA 2GL5A 1EC8A 3Q4DA 3SN1A 4DYEA 4MMWA 3QTPA 2QJMA 3H12A 3ES8A 1SJBA 3DIPA 1MUCA 1DTNA 4FP1A 3NZGA 1JPDX 3OTRA 1W6TA 4IHCA 2OVLA 4HPNA 2GDQA 3T8QA 3N4EA 3UXKA 3R11A 3VFCA 3SN4A 3H8AA 2PU1A 2GGJA 3MWCA 3GD6A 3RO6A 1MRAA 3QKEA 3SN0A 1L8PA 3CK5A 1XS2A 2OZTA 2ZC8A 3T9PA 2QDDA 1NELA 1EBGA 2OQYA 3V4BA 5FJTA 1JPMA 2P8CA 3IK4A 3U4FA 1JCTA 2HNEA 1P48A 4GMEA 3MZNA 3NXLA 2P8BA 1E9IA 4J1OA 3UXLA 3DFHA 2GGGA 4H19A 2QDEA 3EEZA 1ELSA 2I5QA 3K1GA 4DXKA 4KWSA 3S47A 2OZ3A 3FXGA 3V5CA 2PTWA 4GIRA 4ENLA 4IT1A 2PS2A 3TCSA 3P3BA 3PWIA 3DERA 5EU9A 3VA8A 1MNSA 3RGTA 3R1ZA 3OW1A 4HN8A 5BOFA 4HCLA 2RDXA 5ENLA 2HXUA 3DEQA 2GGEA 2PCEA 2FKPA 2QJJA 3IJQA 1JDFA 4IZGA 4ZA0A 4DN1A 3CXOA 3I4KA 3UCCA 3R10A 3UJ2A 4ROPA 2OKTA 4KPLA 1WUFA 3SJNA 3UJRA 2QJNA 2XH2A 4HCHA 2PSNA 2PPGA 2PP0A 3BSMA 4IL2A 4MGGA 3UJEA 4E6MA 4JHMA 3DG3A 3I6EA 3DG7A 4F4RA 1RVKA 3NO1A 2OO6A 3U9IA 2OZ8A 3QN3A 4E4FA 4M6UA 2PTXA 2DW7A 2P3ZA 3JVAA 3MY9A 5FJRA 2HXTA 2QGYA 2P88A
chains in the Genus database with same CATH superfamily
1KD0A 1XLLA 2EXOA 4R7WA 3GYCA 4IGMA 2NVDA 3DGBA 3H24A 3I4EA 4QRNA 3OVRA 4GGBA 1MMFA 3VO0A 2I5GA 4F40A 1HF6A 3OBKA 1U83A 2PGWA 1PL9A 2QIIA 4R53A 1QWGA 1TMQA 2RABA 3ZSTA 1WBHA 2BLEA 2A7RA 3DKJA 3PR2A 3CB3A 1ZBWA 4NY2A 1UWRA 4RNFA 1ONRA 5CGMA 1JRPA 3LGDA 1UA3A 1XUUA 3UZZA 3BH4A 1QNVA 1JDCA 1UR8A 3B04A 1DYSA 1AW2A 2OGJA 4RNHA 1Z42A 4A29A 8XIAA 4IFKA 4FLRA 3ZOAA 3F7JA 4J3ZA 5GJPA 3SCVA 3M1ZA 1CCWB 4RPQA 1G6CA 3DH7A 3IJ8A 1OG6A 4JQ1A 4L4OA 1SZEA 3MHGA 3RX2A 1N5XA 1UC4A 3OG2A 5LA2A 1UR1A 3A7AA 4HMNA 1DJWA 1JFXA 1EJSC 2QCMA 3LSBA 2PBOA 3V3WA 3WNNA 3VI2A 2BVYA 2YCLA 4LY8A 4JKMA 3UFYA 2ZTKA 3N73A 4PZVA 4KBXA 5BRQA 4HNLA 1K6AA 3MI6A 3VOGA 1TYTA 1HO4A 4XSMA 3R07C 5HWNA 3ZVHB 1U30A 2PDYA 1TPH1 3DCPA 1LLWA 5I5RA 5CZJA 3KRUA 4YWOA 3V5FA 2JEPA 4B4FA 1R3QA 4I9JA 1M41A 4ROQA 1AH3A 4JCMA 1W3JA 4MDOA 2VEMA 4G9PA 1FWRA 4V15A 1EXPA 4NZCA 1W1B1 4PL2A 3QM3A 2CLHA 2A21A 2BHYA 1W5QA 3CWHA 3B06A 3B8WA 4PMYA 2PGEA 2HVMA 3AYVA 2QCDB 4PA8A 4LYKA 2CLEA 2WVUA 4UTWC 4HYWA 1FO4A 4YTQA 2CHRA 1E6QM 4PSRA 1C7TA 3POCA 4H04A 1ISXA 2ZXQA 3EB4A 3SQLA 5I79A 3MPGA 1HKMA 5FEXA 3UXDA 4JIPA 1BKHA 3CS2A 1IT8A 1O95A 4PTXA 3FKRA 3GXDA 2GVEA 3VKAA 1QMLA 2YAUA 1WDPA 5JCLA 4B5WA 3FGCB 2E8YA 4RZ4A 4ES4A 1DEDA 4PMNA 3KL3A 1ZAIA 4UTHA 5BMXA 1L6FA 3TFCA 1I2NA 3LM3A 5A5WA 3LCWA 2E25A 1FCBA 5MKGA 2MUCA 1LQAA 3A12A 2YIHA 1Q65A 1WPCA 4MIMA 1AZ2A 1Z44A 2DZUA 1TKKA 1QTWA 4ZENA 2E09A 4DYKA 4Q4RA 4AYGA 1TCDA 1D7YA 2DFAA 2FVKA 3WLLA 2DIJA 3QYSA 3GK0A 3ARZA 3W01A 2CLKA 3GYEA 3MHUA 3RM9A 3W1PA 3ELFA 2HRWA 3IGXA 1KCZA 5AOUA 3T81A 1V02A 4I6KA 2WKGA 4LW7A 1D7FA 2VOTA 2WP6A 4MB1A 1WDSA 3GC4A 2OLSA 3W29A 4DO7A 1MXSA 5DFAA 3V1PA 1XLMA 3S6TA 1MDLA 4O19A 3PUEA 2POTA 5LNUA 3NRZB 4LY4A 2UY3A 3NSMA 2XIQA 5E70A 4O8RA 3CTLA 2Y85A 4QP0A 2J8FA 2Y8KA 4OV4A 3UBPC 4L6DA 3AZSA 5DY3A 3TW7A 5CSRA 4JZ5A 3DHPA 1TVLA 5D05A 2J8GA 5HNNA 4ZO9A 1K9DA 1DE5A 1OFRA 1PKLA 4W7WA 4AXKA 4QAIA 2PU1A 3P81A 1J6OA 3I7QA 1CEOA 1Q6RA 1KR1A 4D6CA 4WXZA 5K3VA 3ZWSA 4LAZA 2HEJA 2X7VA 4ZGYA 1XD1A 2QHAA 1S46A 1R9ZA 3T8LA 3PJUA 1F05A 3HGSA 4TU1A 2EPMX 2H3BA 4Q8TA 4DY1A 2P50A 1J5TA 2YBUA 2X8HA 2J8TA 1JDAA 1KLYA 2WWCA 4FX9A 2O9RA 3LNPA 4JQ9A 1LLZA 3PUOA 3GU2A 3S5NA 3DFHA 4YS1A 3E12A 4MNJA 3U2ZA 4NEWA 5LXEA 1JDDA 4GBDA 4Y9MA 5CJ5A 1EGVA 1YRRA 4O1BA 4YCOA 4R3UA 1XBVA 4D6JA 1W2VA 3GFYA 2CC0A 1MNSA 1WX0A 2VGIA 2V5DA 1I9CB 2ZVRA 3VDBA 1TRDA 2VX4A 4YNGA 4ZQOA 4PCPA 1J0HA 5BYWA 4BFAA 2ACRA 1JZ2A 3S6OA 3CPRA 1WZAA 2VDIA 3QXBA 1E0VA 3LADA 4LYRA 3WQCA 2J9YA 2ZTJA 3S9ZA 3WLPA 3LLDA 4JHMA 2DZSA 1VEPA 1QUMA 3G1FA 1SFTA 1V5XA 3IK2A 1R47A 5FIPA 2Z1BA 5AYYA 2FJUB 3CQJA 4CNNA 4Y8FA 3LCLA 5FEZA 3WLNA 1C7SA 1WCGA 4JS3A 3UGRA 3GD4A 1YXYA 3VZXA 1HKJA 1ZL1A 4JIIX 4HN4A 3ZFHA 1OCJA 4ZQMA 3EPOA 3CEPA 1NVMA 2D3LA 4H6EA 3TN5A 4JTKA 2Z0IA 2WPFA 4I8YA 4MKNA 4B9YA 1I60A 4LBSA 2R1LA 1FWIC 2V5LA 2XSBA 4Q3MA 1GNXA 3BJTA 3GDMA 5U7SA 1VR6A 4LV9A 3M0JA 3WEOA 1H49A 3CUGA 2RDTA 4OHQA 4YVPA 4O15A 1XIDA 1H2JA 3GVGA 3H53A 5IOBA 1VQTA 2JEQA 3F2DA 3H70A 4QCEA 2QUUA 2NX9A 1HIZA 4QR6A 2D2HA 3DGRA 4G1KA 4QHRA 4EVZA 2Z2UA 3EXTA 3O07A 1LJYA 3GH5A 1NFGA 2D22A 1GOMA 2ZA1A 4O14A 1LLOA 3BW2A 2C3DA 3GHTA 4XAYA 4WY0B 3IJLA 1OFAA 2W79A 3SCOA 3A21A 2WC4A 1ITQA 4WKFA 4NHVA 4XZNX 1VPQA 3QGAC 1OC5A 2PDFA 3S1GA 3N6HA 4K2SA 1E15A 4HD5A 3DG6A 6REQB 1RY0A 1JFHA 1WDRA 3F4NA 4Q8WA 3GHSA 1B54A 4M56A 4E38A 4FX8A 1ZP4A 3GVVA 3M0VA 4M7SA 7ODCA 2TPRA 2XH7A 4PUEA 2ODOA 2QULA 4GNVA 1V08A 4I5XA 2YA0A 1TVNA 4TX9A 5E0CA 5IXEA 1JYWA 4GCAA 1BF2A 1MO0A 3TA6A 4NJHA 3THUA 3B97A 3FG2P 3EKZA 3ABRA 1JZ3A 1ECQA 3QHOA 4A05A 4QEHA 2G37A 1FWBC 1EC9A 3L4UA 2C71A 1BSLA 4X2RA 1ITUA 4J57A 4CCDA 3CU2A 3B4YA 1MEIA 3NUKA 3LHZA 4CNPA 1FFRA 3KHJA 2VHLA 2YL8A 4JIQA 1MEWA 3G22A 3A23A 3CQ0A 4REQA 3KWXA 4GI4A 3M7SA 3AYTA 4FIQA 2VMFA 3W71A 4K8DA 3T6CA 4XAPA 2P5NA 3S5YA 1KGWA 1Z41A 3ANVA 3WLTA 5PTDA 2WMJA 3QSRA 5I07A 1F6KA 1TWSA 1XIBA 5TNVA 4K6AA 2WPCA 3LTPA 4IM4A 4P8XA 2YFNA 3E2RA 2F6KA 2FPVA 1XHCA 3BCJA 3LQLA 2GVJA 3ALFA 3BSGA 2O7SA 3EOEA 1G94A 1UWAA 2PDXA 1XLIA 3ITTA 1XYAA 2G3MA 3GDRA 3AXMA 4JOMA 3AN1A 1GORA 1S3HA 4B92A 1Q6EA 1GKQA 1XIEA 3P67A 3CH0A 3N11A 1LM1A 3N13A 3ZJ7A 4ALDA 2E9LA 3PZOA 3GNPA 1A5KC 3CIWA 2PD9A 3QMSA 3GHUA 4WSJA 4A2SA 2E77A 2R24A 3IJ6A 3KL0A 3AIBA 1W2PA 1E5JA 2PODA 3THAA 5DMLA 5HPOA 1B3OA 4CQAA 1EGMA 4JN7A 4EM3A 1XBYA 1P4CA 3HW2A 4DUOA 3HOJA 4MUPA 3L4XA 2OXNA 1PB0A 5HULA 3RLVA 3W1TA 4RDVA 1W3LA 4JTSA 1E6NA 3IPWA 4UIOA 1WZLA 1EIBA 1VJIA 3K5XA 2EO7A 4M1BA 2XJ7A 2W27A 2WB5A 3P8IA 3EWZA 1EC8A 3GG8A 1YTDA 4H4VA 1H0GA 3QMRA 4AB4A 4JL2A 5LIYX 1A50A 2EG6A 4C1NB 3IIPA 3LK6A 2EGZA 3O0FA 2FQIA 2J6XA 2XFYA 1V3LA 1OABA 3HU7A 1ZJIA 1D8CA 2BB0A 1QK2A 3C0LA 1OBAA 4XB3A 2WVSA 4NAFB 1H11A 1JUEA 1IR2A 4PBEA 4I8DA 5C70A 3QKEA 1L8PA 4DAFA 3LSCA 1XS2A 3WIJA 4MDPA 1R38A 1TMLA 4X22A 2YDQA 4UUIA 3C0SA 4HSNA 1JCTA 4IJCA 4LH8A 2WBKA 2HQMA 5HJXA 2P76A 5CGQA 3LHWA 1BZLA 3GG1A 3FLUA 1J2WA 1VB9A 4H19A 1CZ1A 1KRAC 3TH6A 1O4UA 4AEFA 3C52A 1UZ1A 2V2CA 2GQWA 1PZ2A 3TC6A 1CXKA 1FWFC 5C9UA 2ZZBA 2WK2A 1HJXA 1OK4A 2VT0A 3SY1A 1M7XA 4QGCA 1JROA 4HU0A 4GYFA 4F0RA 1XP3A 2D20A 4POCA 2ZZ4A 4OE7A 2OKTA 2YCEA 4AC7C 5JRBA 2QLYA 3R4IA 4OQVA 3PSVA 1GEUA 2PPGA 3GXIA 2V2HA 2VZTA 3NL6A 1V3JA 3VGEA 1F6YA 1R9XA 3S5OA 1RD5A 1FWEC 4IMCA 2DGAA 3NO1A 4DZIA 4W85A 1EX1A 3AZRA 3W7DA 4BQ5A 3L65A 3AHYA 1G4SA 1VBUA 2CETA 5HJYA 4UB9A 4PUMA 2WV8A 5CGTA 3WUEA 4CUCA 2BY1A 2QUTA 4Q8PA 1UG6A 2P88A 3S1WA 4X9SA 1UPPA 1QR7A 2ZZ6A 1SZFA 2NUWA 3KS6A 1SUXA 1YDOA 5C0QA 5L6UA 2PF0A 4U28A 5EY5A 5AC4A 4HJFA 3NPVA 1DOSA 1IXOA 4MB3A 1CT5A 2G5WA 3BVJA 3M9YA 1K03A 1J9YA 4QDPA 4XUYA 3IS4A 4JEJA 2W6RA 4MWAE 1UD4A 1PTDA 3ABSA 2ZX6A 3SR7A 4AIOA 2VQUA 4CVWA 1XPGA 3V0UA 2X42A 2C6QA 4MUZA 2NT0A 3WF3A 4KF1A 4CCEA 3GZAA 5CPQA 1JF5A 4FNTA 4HNVA 4LNCA 2GWNA 2JKPA 4V27A 4IFRA 1NU5A 2W3RA 3L0KA 2HJPA 2XVLA 3SIZA 4H9XA 2DIKA 3MW7A 4WDXA 5DELA 4PUNA 1EX5A 1T5AA 9RUBA 1D7KA 1DE6A 4JTTA 3TJ4A 3KZPA 4NZ5A 5I3FA 4FF5A 3ENLA 1XIJA 4LB3A 1MW3A 2DV0A 1OFBA 1XISA 1VS1A 1FUYA 3SO7A 3TJXA 3VDCA 1L9WA 2DDXA 3LB0A 4J3VA 3LPPA 1VFMA 1V6VA 4IFKB 4FNSA 4IUOA 4YTTA 4HNCA 3BGAA 2BVDA 3SI9A 2H6RA 4HU3A 4UR9A 3TYAA 3NZQA 3HF3A 1V3HA 1OF8A 3B0VC 5I3DA 1Q6GA 3WJSA 1MI3A 5CLTA 4R7JA 1H2IA 3EX6A 2ZUTA 3TW6A 3NEHA 1OFPA 3RM4A 3NQBA 1W32A 2GLKA 3ZZ1A 2OSYA 2X7WA 4FF7A 1E43A 1Q4NX 3E0VA 4KPRA 3ME3A 4S3GA 1SM9A 4E8GA 2OR2A 3GDTA 4ORMA 2Z25A 3R25A 2YCLB 2X99A 4GY7A 4YL2A 2VO5A 5GPRA 3W1QA 3W1RA 4MKVA 1XCWA 4C7GA 2PB1A 2YBTA 1LOSA 2Z2AA 3N9KA 4TOQA 3EMZA 1HXJA 3T0BA 3GFXA 3AMKA 3E5PA 3WDRA 2A3BA 2CWNA 1RA0A 3DAQA 1E4LA 3GM8A 3ONCA 3PZIA 4QDWA 4HOWA 3VD5A 2V8ZA 3RG6A 1H50A 3CAVA 3VD4A 5EB8A 1S7MA 2IKIA 2WQPA 4GO8A 5H1WA 5D03A 5HDRA 3AIRA 1HP4A 3QV9A 3H7RA 4Q7IA 3TE9A 1OVDA 1DWAM 1XFBA 1OJTA 3B40A 4RL3A 5G1MA 2VVSA 2PTYA 1SPQA 1XLGA 4CN1A 3H2FA 3VNJA 1EA0A 4L7ZA 1TA3A 2PBGA 3UNDA 4HVXA 3PBYA 1I45A 5EBUA 3AFBA 2DZWA 4JYEA 4FNRA 1IHIA 4S3JA 6ENLA 3L5LA 3PTKA 3TVAA 1YNQA 3IACA 2C19A 3UWQA 4RW3A 4W4QA 1OWQA 3W1XA 3SW6A 3PAOA 4MPKA 4ONVA 3WBEA 3LX9A 6TAAA 1B4KA 1JCJA 4YXGA 2JFEX 1AFSA 4J40A 2VFFA 1FWSA 5TF0A 3WMSA 4UZUA 4AY8A 1PYFA 5MKGB 3P82A 1K7FA 1DWGM 3BXWA 2DSZA 2J27A 1EUNA 2CYGA 4Z0SA 2VDGA 2WCAA 2W62A 4LALA 4ML4A 3N17A 3WQ6A 4D9PA 3O3RA 4GY1A 3V0SA 5AHLA 4UFJA 1GONA 2BZNA 1FKXA 3UETA 4XTDA 5LIWX 1QPRA 2WO5A 1NY1A 3UZJA 3WD4A 3G8RA 1M7JA 4JN6A 2FTWA 1R2RA 1UC5A 1WDWA 2OVLA 2QPUA 1OD8A 1NDZA 5CG7A 2CERA 4HU4A 2YYUA 5AKQA 1M7PA 3DC8A 1DJZA 4EPKA 1FXPA 1XYZA 3EDKA 3N4EA 1BLIA 2G8ZA 1W3HA 3CHEA 4G2DA 4NAEB 1RPKA 3SB0A 4MSSA 5A3HA 2UV8G 3NPUA 5G4WA 1L8NA 4PRTA 3K4DA 1HGYA 3NXFA 4K8EA 4I9MA 2W5FA 5CLWA 1XM3A 3AI0A 5JCIA 1GCYA 4O4VA 2YYTA 2G41A 4H4YA 3C8NA 2NV2A 4QTGA 5A6AA 1YLVA 2HTMA 3B9JB 3W7NA 1GETA 4ZSUA 2J7HA 3N2OA 4O18A 1B3YA 3TUUA 3CL7A 3KDNA 2W3ZA 1A5AA 3LN3A 3DK9A 4ATWA 1ITCA 1IIGA 3S47A 4AEOA 3WLOA 4S3BA 2OZ3A 1E6XM 3CNYA 5BU6A 1JEHA 2F2HA 4W8LA 4GBUA 1JG9A 3PBGA 1EWDA 2A1YA 3DHFA 1CXEA 1AJ0A 5TIMA 1TWIA 4U31A 2OSXA 2VENA 3MDWA 5ENLA 1GRFA 2HXUA 3BLPX 1C9DA 2PCEA 3IJ9A 4JD4A 3TNBA 2IKHA 5AYBA 1GVRA 1RLCL 5DX7A 6CGTA 1BXNA 1YYAA 3UWYA 3GRTA 3HJEA 4XK2A 4O0ZA 3U2OA 3KVKA 2XIBA 2PSNA 4GY0A 3URNA 4UMBA 5EBKA 2OT1A 3WK2A 3PJTA 3SZ8A 3KOYA 3CV7A 4BI5A 2ISDA 3MBFA 3WZ0E 3LI1A 4WJXA 3WQ8A 1A5LC 4CD5A 3AS1A 1FRBA 4Q33A 5IM51 4W84A 5JIPA 5C2CA 2YSWA 3THDA 2V3GA 5I2UA 5JH2A 3AMLA 1GESA 5FF4A 1F74A 3I3EA 1GQJA 1JQVA 1Q6CA 4C60A 4ICNA 5LGZA 4BWLA 1HKIA 4DJFA 1RVGA 1MW0A 4FIRA 2DVTA 1ZENA 3VTRA 5XIAA 4UFIA 1FCUA 1ZUAX 3FHAA 4PH6A 1FBAA 3DFPA 3CZGA 1E4NA 2YDSA 5FJJA 3KTSA 1QO2A 2Z6JA 4RK8A 1WOBA 1EZ2A 3NAVA 4OTKA 3VKJA 4GXWA 1VYRA 3O9NA 3WLRA 4GFIA 3TLQA 3W7MA 4ZSTA 3DFOA 2AL2A 1UD8A 3HJZA 4E8CA 2XIOA 3QJAA 3QYQA 4LUTA 1IYXA 2TRSA 3WO8A 4QISA 2ONEA 4H4IA 5CG0A 2IQTA 4CD6A 4I6VA 2XINA 2VL4A 3UG8A 4DWDA 1XYCA 4AZGA 4Q8OA 5E09A 4Q8MA 3KX6A 3FVMA 2I16A 4OV9A 3BOXA 4C6CA 4UTMA 1Q7ZA 1QO5A 4J2MA 3LNMA 5CAHA 1EPXA 4NJKA 1PDZA 4KETA 4FDCB 4K39A 2W66A 1WA3A 3LPGA 1TZ7A 1WKDA 3CIVA 1DV7A 1Q6DA 1NQKA 3LGGA 4FAMA 3IIXA 4AYSA 2QJHA 3EWWA 1CYGA 4PL1A 1E0TA 3G6MA 3DH9A 1BVZA 3DK4A 1CXHA 3TV8A 3SRFA 3NQCA 3N25A 4NJGA 4NZ4A 3M5VA 3TTYA 3D6NA 1Q85A 4S3DA 4YLWA 4RCXA 2XN2A 4YYFA 1BTCA 2G50A 2Y7GA 5HXMA 3N4FA 3UZ5A 3W2JA 3ZLFA 3VGDA 2FB3A 4UBPC 1VYSX 4NNAA 2W0HA 3LCGA 4GVIA 1CI1A 2FHCA 1ADSA 1N2VA 3U8GA 2QAEA 1M03A 1FKWA 1VFHA 1AMKA 3OC4A 1GREA 4IIDA 1GWJA 3NQFA 3ES7A 4DB7A 1H4PA 3VIFA 3COTA 3WDIA 5CAKA 2WMFA 4H7CA 1CLKA 3OGVA 3OPSA 4AX7A 1VEOA 4EM4A 5K9CA 3WH6A 3LY0A 1J10A 5CC7A 4H01A 4REQB 1N8WA 1A53A 3KDOA 1YXCA 3S1UA 1JPIA 4JYFA 1V6TA 1QXLA 2E9MA 1IWPA 2XH4A 3VOCA 3CM4A 3AICA 2BTMA 1KWGA 2JKAA 1ZBCA 3QQ1A 4PTNA 3CASA 1TE6A 4NZ1A 1W9VA 3NQ6A 3NPWA 3ZR5A 1W9PA 3VC5A 1BYAA 1ZFJA 3H2CA 3NGFA 4Q4MA 1ZDLA 3MJYA 5I06A 3HURA 1XXXA 3U7VA 1QHPA 5CPLA 3RITA 1LOLA 3U57A 3A5VA 3UG3A 1U1UA 3BAYA 4YWSA 3C2VA 1XIHA 2GQ9A 3PULA 4C1KA 1ZU8A 5A6BA 4OBRA 4XWUA 3LPOA 3L23A 3B0PA 1G69A 1X7FA 2CLLA 4IPLA 3KTXA 1TX0A 4RPPA 3FYPA 3RX3A 1XIMA 1OD0A 1QRQA 2RFGA 4LUIA 1SZRA 2WHMA 3PZQA 2GJRA 1SR0A 4BKNA 1IEIA 3SN1A 1P1MA 1SSGA 2CNCA 1SJBA 2WOWA 1WKEA 3OTRA 1KBKA 4L4LA 4LX4A 3H2OA 5A6JA 1Q13A 1Q6QA 5KZDA 2BS9A 2HV5A 4GUFA 3PZUA 3WBWA 4P7NA 1AG1O 3RPMA 3JUGA 3W7LA 3SIMA 2O9PA 2E6YA 2X2GA 3UXKA 3ARWA 2WMIB 4HHHA 4W5ZA 1OFOA 1PZ0A 1DXFA 2VELA 4O50A 4OFCA 3CH9A 3SRDA 1OADA 3VNYA 4JICA 3CZ8A 3A9IA 4HSHA 1BWKA 2OQYA 4PMOA 4QNEA 4QEEA 3PUDA 4UQDA 1VBJA 4D1JA 1GRTA 3GU9A 3W02A 3AXKA 2P8BA 2EJ1A 4XG1A 4GX9A 2WSKA 3FA4A 3SADA 3AAMA 1GJUA 2E5CA 4DXXA 4LUYA 1IZKA 3V5CA 3BG9A 1VFFA 4GKTA 1MVYA 2BBFA 3NO5A 2WHLA 2HMCA 2PDGA 2WXDM 3L5AA 4G6CA 4BWLC 4A8IA 3R1ZA 4DJFC 4V2XA 3ICJA 2NVKX 1PWMA 1DQXA 2VC9A 2WOQA 1G4PA 2JBMA 1K8XA 2WMKA 1XGDA 2QMKA 3UJ2A 4EKJA 3G1YA 1DIDA 4JTRA 3MUAA 3OYXA 1TELA 3GR7A 2Z4GA 3UY7A 4HMCA 3P6LA 4O52A 3GG7A 1ZHAA 3ERPA 4LEFA 4K7ZA 4Q4PA 1A80A 4B15A 3SGUA 1BXBA 3CB8A 2XHYA 3S9YA 2OZ0A 1VJSA 1RVKA 4J27A 3K1DA 3APYA 1RJRA 1THFD 2NV1A 3LS9A 2NXGA 1ZPTA 4TV5A 4XBJA 4XZHA 2E3ZA 3TN6A 2UZ9A 4G7EA 1F7BA 2X41A 5AHMA 8RUCA 4QXIA 2Y88A 2KX9A 2V3AA 1UCWA 1IXNA 1VZWA 5DLCA 3DGHA 2F84A 4KW2A 3AOFA 1TV4A 3QLDA 4CD8A 1E4IA 2C16A 1ONFA 2XDFA 1H62A 1XCFA 3WF1A 1KTCA 3K8LA 3UCQA 4Z2IA 4IXXA 5JCNA 3RAOA 2VGFA 3H2MA 4FXSA 4IOTA 1K70A 5FAGA 2I9UA 2NQ9A 3VIGA 2V5JA 4NSBA 3VKKA 3GS6A 3L7RA 1J01A 4UOZA 1R3TA 4MLRA 1C8QA 4OU1A 3VNMA 2W9MA 4GZIA 2AAMA 3FJ4A 5AHNA 3WH9A 3TYDA 3NOEA 1OIMA 3CPUA 1OEPA 1VDVA 4QM1A 1CGWA 1VJZA 1PJ9A 1W1PA 1K3UA 1XG4A 2VFGA 3WLQA 1Q4WA 1WBJA 1VLIA 3TYCA 3WFAA 3ZXWA 2O9TA 3C0JA 3DFNA 4P7LA 4PR4A 3AIVA 2CU0A 5I24A 1CW2A 3GUGA 2V9DA 5J8LA 4AZCA 5IFPA 1W91A 3WCZA 3C2EA 4MYAA 3DENA 2DUAA 3N2BA 3QC3A 3OEXA 1XFCA 1F3WA 3D46A 2BASA 4S2BA 3URAA 3FAXA 3TYEA 4AD1A 5M1TA 3GR4A 1FA2A 3GKAA 4GYPA 2AMGA 1E0UA 1R0MA 4RDYA 4GLEA 1QHOA 5D38A 1E4MM 2FJKA 2WMHA 1LP6A 1JCYA 1QFEA 3CO4A 1WXJA 2NVAA 1NP0A 3N2TA 1EA9C 4H7VA 1KM6A 5TQLA 1AZ1A 1SU5A 3MSRA 3NFUA 4WOZA 3LCXA 5CZKA 1GVYA 4AVFA 1FWNA 3TDFA 5D4YA 3RUBL 3P14A 3E0IA 3O16A 3PNUA 3E38A 1RY8A 2QVHA 5JMUA 5EPDA 4WK9A 4ZXOA 4M80A 5G2WA 3QKZA 3KBSA 1UMLA 1I8JA 2ZXAA 1FCVA 2BODX 4QG8A 2BXZA 3AMGA 1IGSA 4WZHA 1US3A 4A8RA 1FFUC 1UH4A 3LZ5A 2FGZA 2X16A 4UFMA 3L8KA 3OYZA 4DNHA 4J28A 4TR9A 3ZQ9A 3QGVA 1PXGA 1M65A 1R7AA 3VC6A 4AZBA 3WDJA 1KBBA 1UWSA 3TEVA 1ME8A 3CYJA 3Q37A 4R27A 2YW3A 4JCLA 2LLEA 3R13A 1J6PA 3RR1A 1A0CA 1CXFA 5G5HB 3FYYA 3NTYA 1PSCA 3MCNA 1KV8A 1ZMCA 2WJFA 3C6CA 3L2LA 1QNPA 2YJQA 3AMCA 1U2YA 4QAWA 3W7OA 1W31A 1E9LA 1EJTC 3VX0A 3ABOA 1YBQB 3T44A 2ZWYA 3S6DA 2QZRA 3THCA 3KAOA 4RJEA 2XZ9A 5D2VA 3G1HA 3GQYA 5AVHA 2V5CA 2ZADA 3Q65A 2BOGX 1E0WA 3B8DA 1QWKA 4H4TA 1UIOA 4S2CA 2VWTA 4BI6A 3G24A 3PSWA 1TA3B 3D47A 1Q8JA 2YKKA 3VCNA 2EEXA 2XFWA 5ER0A 1QAPA 3E49A 4PTWA 3O6CA 3RXZA 2BOEX 3O2LA 1LT8A 3RIKA 1ZY9A 1DWJM 2TPSA 1PIGA 2VCCA 3BGGA 1X8FA 2IUZA 2R82A 3WK3A 1ZCCA 1TWWA 4PMVA 1YE6A 3LGEA 1T8QA 2HSAA 4Y9OA 1GRGA 3G1DA 4UCGA 3W1NA 5I78A 3Q94A 2FMOA 4Q8QA 3PN8A 4EX4A 2WVVA 2JIEA 2VCAA 1GVSA 4GUHA 3C86A 1YQZA 2ZA3A 4CQBA 4GFSA 3F4DA 3ANYA 3GZ3A 1EXBA 1GYMA 1WXYA 4W7VA 1UQYA 3WD2A 3W7RA 3STFA 3UR8A 1GJPA 3V4BA 3IGUA 3VE9A 1XICA 4BQ4A 5FL1A 3WFLA 7REQA 2PWEA 3IUHA 4XO6A 3RYSA 1XLEA 1UWTA 4JAWA 1OF6A 5EFFA 1E6SM 3LLXA 1JAKA 5LGXA 3K30A 2OO0A 4Z1AA 3BAXA 4PFHA 1TUFA 2G4FA 1JDEA 4XQ6A 4JKKA 3DI1A 3EOUA 1KFKA 3ANUA 4L1WA 5FS9A 1DJXA 3M64A 4ICMA 3IGHX 3WQ5A 1FQ0A 4OBTA 4RE4A 3WQGA 3EB2A 3RU6A 1FHDA 4X60A 3LCIA 1JDFA 4ZA0A 2PEVA 1DKWA 3I4KA 5XIMA 4AUBA 1RXOB 3BPWA 4KPLA 3TYBA 4P7RA 1IEXA 2WSPA 4Z1CA 2DH3A 3BSMA 2WWDA 3JRKA 2NSOA 2OYKA 3AROA 2VD8A 1N55A 3BAIA 3I3BA 4ZQNA 2QCDA 2BMBA 3KOFA 3UT0A 5U1OA 3G0SA 3KCJA 1H7RA 3UWWA 1XGEA 1O94A 4NXKA 3EWUA 4KRTA 1TJ0A 4IX2A 3B4UA 1GOOA 3CZJA 1ZY8A 1GOWA 2E0PA 4C65A 2NX1A 2XU2A 3CZKA 1R85A 1NWTA 3IEBA 5ABFA 2WHJA 4DM2A 3DX5A 2A6NA 2RGMA 4ZO8A 2Z00A 1GZJA 3C4UA 4NI8A 4E5TA 1PZ3A 2CITA 4LJ3A 4C6FA 4IL0A 2NQZA 4DNAA 3B9AA 4R88A 1LL6A 3LOTA 4GYPC 2JQXA 1REQB 2YA1A 4EQXA 2OYLA 1ZS2A 5JVLA 4GNKB 3CMJA 1Q8AA 3GRIA 1J18A 4B2DA 1VKFA 3OLIA 1XQKA 3IJDA 3IANA 5FESA 4JKLA 2FZMA 2CWXA 4NX0A 4LFYA 3D9XA 2FZDA 3PPGA 4I5RA 2IPJA 6ALDA 1XYFA 3PPFA 1DHKA 1ISWA 2V67A 1QBBA 4QIUA 3W2NA 1Z3NA 3MS8A 2J77A 3QV8A 2ZXBA 1KFJA 3IJ7A 4DEFA 4RE3A 2P53A 2ACQA 3QFEA 1UR3M 5T9BG 1HZYA 3CT7A 3G1XA 5BRPA 1DJIA 2JALA 2AL2B 3LENA 5EMKA 2RKXA 1NFPA 1R87A 3F03K 3NWRA 4PBFA 4LUTB 3WN6A 3W37A 2PLJA 4MJ4A 2PA6A 3O6AA 4JGDA 1X8CA 3MKKA 4B2DD 3RF9A 1I0BA 1JL8A 3WSUA 3EANA 3GLCA 1D9EA 2YBVA 1KQZA 5BZAA 2NWSA 1N7KA 3QLLA 2GR3A 3OGRA 2ISVA 3EWYA 1OJXA 3BARA 3TU9A 3CGCA 4N4PA 2G0WA 4LVAA 1EJWC 3GAKA 1V02E 3N6JA 4LCRA 2DEPA 2WNNA 2L5HA 1ZCOA 2G3NA 2C79A 2XG9A 1FP8A 3NG3A 5IRPA 1AW1A 4P8WA 2Y89A 3H23A 1JVNA 2WBAA 3TJLA 3N3MA 3WQOA 2PDHA 3G18A 5HQLA 1W37A 2NXIA 1FCQA 4FZIA 3CO8A 2DU2A 1OB0A 4E8DA 4HNOA 2J7CA 3IUDA 2J7BA 1W54A 4X61A 2J13A 1TVPA 5AHEA 3NQVA 2OWXA 4W7UA 1PDYA 1NSJA 1P0NA 3B8IA 1V0KA 3EOOA 2D1ZA 4N9DA 1VD6A 3ARTA 3E2QA 3SCUA 4RV8A 4O1EA 4GQ0A 2J4GA 1GOXA 3TONA 3H7VA 3W53A 3ATZA 1I2PA 3TKFA 5LIKX 4HP5A 3V16A 1O5RA 2BSLA 3PBMA 2Y2WA 3FYOA 3CGDA 2JKEA 1RPXA 3G0UA 4FK9A 1JYVA 9XIMA 1HO1A 3ARVA 4DRSA 4W87A 2GVYA 1FP9A 4EXQA 4CLMA 5TR3A 3M4HA 3VABA 1K8YA 3BWWA 2Y70A 3LHTA 3VNDA 3F5LA 2GPTA 4UQCA 4O1AA 2IXVA 2RGLA 1SO6A 4UXDA 3EAOA 1DHPA 1M9HA 2PLMA 3UF9A 1FH7A 5C54A 2PTZA 4GWEA 2YX0A 2ZBTA 7TAAA 1P7TA 3GWQA 4F2BA 4IPIA 3SRHA 3MSGA 4ZXLA 4X3ZA 2YLLA 5JQ9A 3B3DA 3AXHA 1KQYA 1XDIA 1XIGA 1EUAA 2B31A 4WHBA 3VGBA 3W86A 2WZTA 1NOFA 1OC6A 3PANA 1OSEA 1TYGA 2NQLA 3WLIA 3PB0A 4PC8A 3VE7A 3FSUA 4US6A 4O54A 5HOSA 1S2AA 3DIPA 2E3TA 4UTLA 3D3AA 2QCHA 4LAUA 3UG5A 1TPEA 4LCQA 3LERA 2C15A 4FOKA 1LBLA 4S3AA 1S2CA 3U2EA 3UERA 2XSAA 4PODA 2ADAA 1UPMB 4QDMA 5CPOA 2RDUA 4HPNA 3V7PA 2GR0A 2ZRZA 4Q4SA 1W1A1 2PWVA 5I0DA 3L5MA 4ZEPA 2GGJA 2HPMA 1US2A 1XRFA 3UPMA 3KW3A 3S2MA 5AC5A 4CGTA 1BG9A 1GG0A 3ZIZA 1QK0A 4AD3A 1FWHC 3WUFA 3CGBA 3WDHA 1BVWA 4S3FA 4IXHA 4WY0A 1DJNA 2FB2A 2E7FA 3QOKA 1A4MA 2E6FA 3QOMA 3MUIA 5KSWA 1KFEA 4PCTA 5C8BB 3AMDA 3MDUA 1MEHA 1TTJA 3WKZA 1UD3A 1SW0A 3SUVA 1IXPA 4BEQA 2GGGA 3W87A 1LWIA 2I5QA 4MB4A 4KWSA 5I3IA 1JPKA 1ONWA 2V2DA 3QF0A 2NV9A 1XL9A 3WQDA 2PS2A 4GINA 5HMDA 3TCSA 1H0IA 4EACA 1A5NC 3MO4A 4GYKA 1XR2A 5LZLA 5FKYA 3RGTA 4RV3A 3W22A 1ZK7A 1B3XA 4IZGA 4XIMA 4JIHA 1GQKA 1VRXA 4UFKA 3GTHA 1EFZA 1GOKA 5LHEA 1NP2A 1XLFA 2YL9A 5D02A 2WSRA 3UG4A 1WQ5A 4A4AA 3UVIA 3UWVA 5H6HA 3W81A 3DG7A 3K8MA 1W56A 4FLOA 1OYAA 3MZ2A 3LEPA 2FHBA 4NF7A 3FEMA 5DF0A 3LMZA 3WQPA 5JBFA 5GJNA 2X50A 3MY9A 4UZSA 3TCEA 3U4AA 1JXJA 1CGVA 3BW3A 4R33A 2WOVA 1VH7A 3O8AA 3QSTA 1DPMA 3DYPA 3T07A 3W25A 4HNTA 4TXEA 1GRAA 1DJYA 3EWCA 2CCRA 1JEZA 4C7FA 4DXVA 2A3HA 3AS0A 1GT8A 3A3HA 7ENLA 1T8XA 3W76A 3KUMA 4EXAA 2QDGA 4MY9A 4B5TA 1V93A 3C61A 3STCA 3ETRB 4D6HA 1J2BA 3R79A 5CBBA 3HN3A 3UU0A 4G7EB 5CPNA 3M47A 1MZHA 2DZXA 3WNOA 2XGZA 4BY3A 4LT9A 1B2YA 3VKDA 2QCFA 1ESWA 1X2GA 3W75A 5K9DA 3B9NA 2POZA 2IMRA 3LXBA 1J11A 2VP8A 1GVOA 3CAKA 3D0CA 4DHGA 3IGSA 4DYJA 1ODZA 3EBVA 4NRRA 1OINA 2BNJA 2VYOA 2DW6A 5CSUA 3CAWA 3KXQA 4AVNA 1NH6A 3MYOA 1E1FA 2HE5A 1E73M 3W7HA 4RZ5A 3LM7A 3NSXA 3A47A 1LQ2A 3MT1A 3C56A 1W3TA 1VFSA 3SFKA 4KRZA 3BCFA 2OJPA 1SB3B 3EUB3 4N0RA 1PV8A 2RHGA 2W0UA 3UZWA 1NDYA 3AC0A 4TV6A 1ZALA 1Q6FA 1EEPA 2PGFA 1VFTA 1X97A 3V35A 2WC3A 1TIWA 4AZCB 3VMPA 1E1EA 4MZYA 2GUUA 5GQBA 4GCXA 3DFQA 4GNJA 4IP5A 3AHXA 4US5A 3R0KA 2WOIA 4CD7A 2OU4A 5FEWA 3OZMA 3W7KA 1OCNA 4M52A 3AHTA 1NM9A 4LOCA 4E2VA 1XDJA 1PX3A 3VIIA 3SDOA 5BOOA 1EP1A 1JNEA 4OT7A 1E9ZB 2C18A 3SSZA 2YXGA 4CNTA 1E6ZA 1W8GA 3PG8A 3GVWA 4BA0A 3AIEA 1XANA 4YHGA 2YVFA 3R94A 2OKOA 3DJJA 2YQUA 2A85A 2ZFAA 4GPNA 2XSXA 3ZWTA 1O5QA 4Z1BA 2FZ8A 1ODUA 3LV6A 2D2JA 4CQDA 4PYSA 1QHZA 2QJIA 2H90A 3URBA 1EP2A 4US5D 2RDWA 3CEUA 1ZMDA 1BG4A 5FD0A 1KA9F 1TWZA 3KWSA 4NRSA 3DU0A 2CESA 3L5OA 4H6KA 4DBSA 4N02A 4IQEA 1RUSA 4NASA 5B7ZA 3ZLGA 4KEUA 1F8WA 2FDMA 3UVAA 2E5BA 3G8EA 3CQHA 4JFUA 2Y24A 3C3NA 3LXAA 5A6TC 4X2PA 3BUVA 2J88A 3WQFA 2V5BA 3CLWA 4P61A 2ZC1A 1X1NA 1Q2RA 3PS7A 1QDSA 2ZZ2A 1ZXIC 4C5ZA 3MUXA 4KFOA 2P1FA 4N9CA 1HL9A 1PTAA 3BQ5A 3PAJA 1J8VA 3OP2A 4FLSA 1ZJHA 2EKCA 2QPXA 1W9BM 5H91A 2ZIDA 2Z1XA 1N8IA 4AY7A 4HZ8A 2Y63A 2PI6A 3RNMA 3TSDA 1I1XA 3AXXA 4WD0A 4IMDA 1H5VA 3C3UA 3RR4A 1F3EA 4HB7A 5DMYA 3LD5A 3LRMA 3MQTA 1HQTA 3CZEA 2VI0A 3NYZA 1LG1A 3E5BA 4DYEA 4NZ3A 3T40A 3WG6A 4OVXA 5LNSA 1DTNA 1TJ2A 2UWFA 2G4JA 5F2MA 1W9UA 3GUWA 5HWMA 3D3FA 2W54A 1QATA 4AH7A 6A3HA 1X7IA 4DF0A 3PC0A 4GG9A 1S2UA 2DSVA 3TLLA 2INEA 3HA1A 1M6JA 4H41A 4LSBA 4GRTA 4M51A 3GFZA 3KHDA 4NU7A 1UWIA 4DPQA 1UD5A 3OHMB 5FAJA 4A3QA 4YIWA 2H8ZA 1YDVA 4O4WA 4EWND 2ZRYA 3BW4A 4IIGA 3T1GA 1KFCA 4UQAA 3A3XA 1CGYA 3CV6A 4RKAA 5GNZA 4YVXA 2E5AA 1Q2SA 2VEIA 5KZMA 2FFIA 4HHLA 2XYLA 1EJRC 2Y7DA 1NJJA 3SY5A 2H8XA 3WQVA 2V5KA 3C2FA 4D2JA 2B7NA 2I56A 2VX6A 4J1OA 3UXLA 5FEPA 3RCNA 4R85A 3OQEA 2PDIA 1HTIA 4R9OA 5HNUA 7XIMA 4QG6A 1TREA 1NOWA 3M0KA 4Q8NA 3DBPA 2WVVB 4F9DA 1Q66A 3FXGA 2YZ5A 4GIRA 4FMVA 2VFIA 1LL4A 1ZJBA 1HJWA 1I2RA 4J35A 1TPUA 4NKCA 5AB3A 3L4TA 2SFPA 4F3HA 2ZKMX 4TTGA 1XDLA 4E4PA 1XD0A 1H63A 3OW1A 1XRTA 1OCBA 7REQB 9XIAA 4CCCA 1A5BA 4HTBA 1L2QA 4WKAA 2W63A 1T41A 1WDQA 3BAKA 1L0PA 1FXQA 1W1IE 2VC7A 3VILA 2TODA 2Q8XA 4HGXA 3MANA 1XCXA 4B90A 4B5XA 3KCOA 1DIOA 3SCWA 2WSQA 4CEXC 2VZSA 4FX7A 3ZT5A 3AIUA 4AVOA 1V79A 1YPXA 2Y61A 4LIIA 4GQQA 1FWTA 2R1NA 1RHCA 1EJXC 5GVJA 1UD2A 3NPXA 2WM1A 4TX8A 4NI3A 5T91A 1OFEA 3FS2A 1XGZA 3CUJA 4NNCA 5FI8A 1CENA 5H8MA 3E0LA 4RZBA 1JZ5A 4M5PA 2YL6A 1TV5A 3QR0A 3ITXA 3PBUA 2OWCA 3H2EA 2GSEA 3A7UA 3R8RA 3JR2A 2Y8VA 3UJSA 4RLIA 5D2TA 4H9UA 1SMDA 4OOUA 3CWNA 3GXPA 1H1ZA 2VRQA 4JTEA 5ABFB 4IX0A 2NLYA 2OLAA 4DZ5A 3GNXA 3M5ZA 1EF3A 3GW0A 1QW9A 1TPC1 1UUOA 1GRBA 4ZTYA 1K4QA 1EB3A 4GIEA 4Q7BA 1GYLA 3UD6A 2CZFA 4AXNA 3H4GA 4I9TA 1DXIA 1EYEA 2OEMA 3Q67A 4HQVA 2PFHA 1P0EA 1VFLA 4IWWA 4FR6A 4B5NA 3PTMA 6TIMA 3W7QA 3BGJA 1W9XA 4U5KA 3PG9A 2QUVA 2X2YA 3Q45A 2OWWA 3IIOA 2BV9A 2CZ5A 4W86A 1PIIA 3TZFA 4PB4A 4DF1A 3UWEA 3ATYA 1N8FA 1BFNA 3H21A 1Y65A 3RHGA 1LWJA 3VUSA 4EMWA 1SJCA 4GISA 4MHBA 1QNRA 1EQPA 1IE7C 5LIUX 3REQA 5HA7A 3GXFA 1KCLA 1SYTA 5EMJA 5DT5A 1VIZA 3KS5A 4MJZA 1RP8A 1EHNA 1FHVA 4OWGA 4LVDA 2PDLA 2PU0A 4MAZA 2YVGA 5LSMA 2WLZA 4MADA 1GGOA 1VLWA 4Z2KA 2WKLA 4CNOA 4NAEA 2JF7A 5A8NA 4XTIA 4IIHA 1Y5VA 1L6SA 4GO9A 3UP8A 4FR1A 3AM9A 4ZB5A 3G1AA 4HMDA 3QFBA 3WLMA 3WQEA 4CU7A 3QY6A 5HMFA 4KCUA 1VCGA 3H4XA 2VGBA 1G9HA 1JPHA 5FJPA 5I23A 4EWJA 2PMQA 1FEAA 3GTIA 1KRMA 1O12A 4S38A 3FNDA 4MZ1A 2C7FA 3QRHA 5JU6A 5U4NA 3WH7A 5FS7A 1EP3A 2A5HA 4XO7A 3NQEA 4JNYA 1GEHA 2D73A 2RUSA 4UR8A 1G4EA 3VM7A 5BWAA 1K8ZA 4L5ZA 2D69A 3SGGA 1R2SA 1JF6A 2IPFA 1XX1A 2ZE3A 3M43A 3IVSA 3EXRA 4O8AA 2CXEA 1K9TA 1IV8A 3NIYA 3T2QA 1KB3A 2PC8A 4IP7A 3EX1A 1IEQA 3CUXA 3VNZA 5D2YA 4K68A 2NSXA 3OBEA 3WL1A 3LCHA 1XBXA 4FNQA 1CGXA 4DO4A 3T2PA 1AQMA 1I0DA 4NP7A 1VHCA 5BXTA 5AFDA 1BQCA 3P84A 1V0NA 3WD1A 3HBLA 5M17A 3N6QA 3B0UX 3VGHA 1W1YA 2Z24A 4B16A 3QC0A 2ZE0A 1FVPA 2V30A 4AZ6A 4O53A 4H50A 4DUXA 4KFNA 4LPCA 4JTIA 1B3WA 8A3HA 3JZUA 1XLHA 4JN8A 1NDVA 1KRCC 5C7VA 2NW0A 1VRDA 4NYYA 2BG5A 2Z6IA 3TP4A 4J4KA 3K13A 2O56A 2V68A 1P43A 4HIBA 1NAL1 1W5PA 1J0YA 1C29A 4I9AA 1BYCA 1XLKA 1LTDA 3Q4DA 2GR2A 3JU2A 1SR9A 1M3UA 1PCKA 3I7RA 4J3UA 4PUDA 3TXZA 4H8UA 3AUOA 1RCQA 4M6VA 1Q63A 1GOQA 5DY2A 1P7TB 2EJAA 2GUYA 3BURA 5I3HA 1JCXA 3GNOA 3PY2A 1KBIA 2PRLA 1EQCA 2PZ0A 2VEKA 1S5NA 2V6AA 2QV5A 1BHGA 3T8QA 3TAKA 2Y6ZA 1G4TA 4KMQA 1UQZA 4OIFA 3VFCA 1SMAA 1ICSA 3RO6A 3AS2A 1MRAA 1YNYA 3CBWA 3QHNA 3CK5A 5FF2A 2IKJA 3VZZA 4IGSA 1ZLPA 2J7EA 3THQA 3SEPA 2GFTA 1IZJA 5DXYA 1ZGDA 3TMLA 2XM2A 4EMJA 2GJXA 1OCQA 4HHPA 3E1F1 4XKYA 4AMCA 1J4EA 4R5EA 2GQ8A 1T96A 3CTTA 1TB3A 4ZBCA 1J96A 2R94A 4EQWA 1J12A 5DANA 3CLMA 3WDQA 4F79A 5G1YA 3ONBA 2GJPA 3L4YA 4UTUA 4Q4QA 1NARA 1UIPA 3A6OA 3GAYA 3KE0A 1O1HA 5ABHA 5I03A 3SQPA 4HPXA 1GTHA 1X1OA 2IPWA 3PZGA 3UQNA 4FS9A 4D6IA 2FKPA 2Z26A 4DO5A 3R10A 3CHVA 4RE2A 3NZRA 3NVWB 1KGXA 4IJRA 3M07A 2R9ZA 3A22A 3OIXA 2VJXA 2W3SA 3HTWA 4HT3A 2WJZA 2HE8A 4HU8A 4IG2B 1MQRA 2E9BA 1HP5A 4S3KA 4D8AA 1CPUA 5CKSA 4MFDA 4XISA 4O0KA 3IVTA 4QQ3A 2Y8UA 1L2UA 3ID7A 4QS5A 1EGZA 3NDOA 3U5YA 3GTFA 3C8FA 4WCJA 1BSIA 3MV01 2V3BA 1R3YA 5FJRA 3ZM8A 2WPBA 4F0LA 3UY8A 2UY5A 1I2OA 2GVLA 3N18A 3EB3A 1E6PA 5H8PA 2ZDRA 4GZEA 4IP4A 3A7RA 3NVZB 4JQ2A 5HJLA 2VUNA 2QCEA 2ZX8A 1OGGA 3DBNA 4GUJA 3MI3A 3OG3A 3RPTA 4NYUA 1J0IA 9CGTA 1H6VA 3U7BA 3L67A 3GNDA 3OU8A 2P0IA 2Y1HA 2UY4A 1SO3A 2XFFA 3GTXA 5FCZA 4IH3A 2DQXA 4L56A 1TQXA 3CUZA 4KGLA 2RJHA 3L4VA 4V28A 2GJNA 4RE0A 4J3XA 4W8BA 4Y90A 1J0KA 4QLJA 3EDDA 2ZUSA 3KBJA 4YVVA 4EQRA 1ZAHA 4HSOA 3LI0A 3MKCA 1I6NA 1O66A 5D04C 3RLUA 1PHWA 2BY0A 1J0ZA 2J7GA 1PHQA 2TMDA 3N9RA 4M6QA 1XH2A 2WSYA 4GD0A 1TG7A 3E2SA 5J04A 1D3HA 4H3DA 4FA3A 4NILA 4IMFA 3N2MA 4P2VA 3E0FA 3BCDA 2ALDA 4L6HA 3W7EA 3PPCA 5CC6A 3NNTA 4LANA 3BMVA 1TPWA 4LRTA 2NVCA 2C0AA 3O05A 5KTLA 1K7EA 1TSIA 3UPBA 1QPKA 4DAIA 1GQLA 3TXVA 4B91A 3SCNA 4UTFA 3GXTA 4O17A 2Q8LA 3A4XA 3NM1A 1BEUA 4WRHA 3W23A 4DZHA 4L6OA 3GY1A 5I02A 1F4HA 2X8CA 1M68A 2OPJA 2YZRA 1TWDA 4C6KA 4N6EA 4DBDA 2WMIA 2A3CA 4LGXA 4TMBA 3PWGA 4L64A 1BQGA 3MBDA 2QVNA 4DBWA 2A2IA 2A3EA 3TQ0A 4QBXA 3A4AA 2KAUC 1EYWA 3T0CA 3PM6A 3GVQA 2XGIA 4LWWA 3LRLA 5JCMA 3VOJA 1BTMA 5CC3A 3L21A 3MTWA 2Z29A 1PX4A 3VFLA 3QZEA 3HFTA 3P5YA 2ICSA 4AW7A 4B9ZA 2XFRA 4N6FA 3II1A 3AJ7A 4KEZA 3HQOA 2PF8A 2PDUA 3W6YA 1YHTA 3CJPA 1GPWA 3HGJA 3M44A 1RQEA 2XIJA 3W07A 3PP7A 4GACA 5IBXC 2PGRA 3BE7A 3P61A 1UUMA 4IPPA 3USBA 3VPLA 5T8GA 3T05A 3OJGA 2B0MA 3APTA 4NIRA 5C5YA 3V0TA 3TR2A 3SCRA 5I3GA 2YXXA 3VU2A 5FSDC 2J78A 4MG4A 5HK4A 4C6LA 4P8VA 2F61A 3O0KA 5HR7A 2VZVA 4HK6A 2BHUA 3WY1A 5A6KA 1X2HA 1PWLA 2WCSA 2A0NA 2YFOA 1V7AA 5HAOA 1E51A 3VIHA 4S3EA 4S3CA 1S1RA 4U5IA 1UHVA 3BLOA 2WZHA 2ZOXA 3WD3A 4ACYA 2PP3A 1XPYA 3LTYA 4XBKA 3B8TA 1CDGA 1TTPA 3NQ2A 1WOAA 3LHYA 5BU9A 1Z89A 4UTKA 2CKRA 4WSKA 1B4EA 4MF4A 2AKZA 4X0VA 1MZRA 2VX7A 4W88A 3CHCA 1PX8A 4KWUA 2X0SA 4KQNA 5CZTA 1SZGA 1I4NA 5KVIA 5HMSA 5BXSA 3KRBA 2Z1VA 2WVTA 1EJUC 3CHDA 1AQFA 2PDCA 2QJMA 2DJLA 3T09A 3ITGA 3KVMA 3LLFA 1VFOA 3FAWA 4FP1A 3O6YX 1JPDX 3VD3A 1P1XA 1FY6A 2F9RA 1FWWA 3LMYA 4JTLA 4K38A 4QFUA 3UYCA 1I75A 2BGQA 1VP5A 3A4JA 5F4SA 1S2VA 1E56A 1TCMA 5D9MA 3W82A 4AC1X 3B8VA 1Y8BA 2DUZA 1GUVA 1UYQA 2X40A 3OVPA 5HQMA 2CDUA 3H8AA 4MM1A 2NXHA 5E0KA 3DK8A 4YU1A 2A3LA 2XGBA 1TQJA 4XAGA 3FJNA 3TN4A 4MWAB 3T9PA 3OB8A 3S0CA 2B7OA 1PPIA 2AQWA 3T0TA 4C91A 2R1KA 2DVXA 1CWYA 3IK4A 3HFYA 3GNNA 1JR1A 3KVLA 4CQ8A 1XYLA 1UROA 1ZAJA 2QJGA 2YPIA 5A1AA 3W74A 1S1PA 2B81A 2BGSA 3RJYA 1DIEA 1GHSA 3KCLA 4PMZA 1ELSA 1AJ2A 3VMNA 4WDTA 1IXQA 5EMUA 4FLQA 2J47A 4ATDA 3FJ6A 4ENLA 4O1DA 1K9EA 4FX6M 3VDAA 4B5UA 1PE1A 5G4EA 5AYXA 3LZ3A 5C9RA 1ENUA 2HK1A 4C5YA 1SVDA 1CXLA 3LBOA 2DVUA 2VM8A 3VKBA 7PTDA 1NF7A 1XLAA 4AIEA 2VQTA 3ZO9A 2NLIA 1M1BA 4LV4A 2HBVA 5EKYA 1RR2A 3SJNA 1K77A 2XH2A 2FZNA 3MU7A 2ZA2A 4ATLA 4IL2A 4GKLA 3UJEA 1B30A 4WEVX 1VBGA 1AH4A 3FA5A 3MKVA 4M3PA 2GOKA 4HHMA 1EWEA 3RO8A 1H41A 2ZXDA 1EDTA 4S1FA 2PTXA 3QV6A 1ZB5A 1TPB1 3W2UA 1H09A 5HMEA 3R7MA 3ZR4A 4GIAA 4HYVA 1T40A 4X0NA 1TV3A 3U6WA 3UR7A 4C6EA 4XD4A 4WSHA 2OEJA 4QITA 1EO7A 3EAUA 1P0BA 2E67A 5E6ZA 2WZEA 4Q6XA 2ZUUA 3W3OA 3WYZA 4DBEA 1W1ZA 1UBSA 5K4ZA 4TO8A 3WENA 4FB7A 2PDMA 4U33A 1MDRA 1UD6A 2I9EA 4ZQCA 4GX8A 2OB3A 1E6RA 1W5MA 1LPFA 3URQA 1M53A 5M3WA 1X1ZA 1Y5XA 1YBQA 5LNRA 3SQSA 2J62A 2WANA 2Y62A 1F2JA 1IF2A 1DWFM 3GC2A 5E9AA 1WP6A 3WUGA 3NSNA 3NA8A 2FIQA 3LG3A 4PMQA 1J79A 1W9DM 3HPSA 5K4XA 3SCQA 4L80A 3SCTA 1LQ0A 2XIMA 3TNOA 1IGWA 3QH2A 2ACUA 1UR2A 3DDMA 4FALA 3KRSA 2FZ9A 2DZBA 4AWTA 4W93A 2WW5A 1YTKA 1GTEA 3UCDA 4BF9A 2MNRA 3LQGA 2OX1A 2Q8ZA 1EDQA 2EPOA 3TYZA 3ZJ6A 4AIBA 5BWFA 4MNKA 4EXBA 4XZWA 2WZMA 2PWHA 1WYGA 1D3GA 4AHOA 4IIEA 4OBSA 2C0HA 1SW7A 2V6OA 3ITVA 4ERIA 3GU1A 4DJEA 4LEQA 3BTNA 3T0DA 4U2ZA 4JY8A 1KFBA 1C9WA 2C91A 5KEZA 2ZX9A 5CBJA 4KCTA 5ECUA 3CIXA 3DFTA 5G2IA 1QI4A 1JZ7A 4JTAA 2FDSA 1Y5WA 2WZIA 3F2BA 1MW2A 3M5XA 1B0IA 2CBJA 1MXGA 1SZNA 1XH0A 5CXPA 1UR4A 5DCBA 3EPMA 4H4QA 1PUDA 3NR0A 1F61A 2VD9A 1VF8A 2ZX7A 4M24A 5H8UA 4F0SA 1VQZA 1PO9A 1ISVA 1ZNNA 1OZMA 4UWMA 2IQ0A 4AWEA 4APNA 2YOCA 3REQB 1TX2A 2GWGA 3O6DA 4A35A 5HPCA 1OT2A 1XINA 1XLJA 4DQWA 2C1IA 2ZUNA 4GJ1A 2NZLA 4XZMX 2IQDA 4XD5A 1STZA 1NTHA 4H00A 1V3IA 3KOZA 4DJED 4IICA 2VC6A 3GBEA 1XBZA 4MJ2A 2UBPC 5HATA 2W61A 3KZSA 3NZ1A 2REQA 1T7LA 1Q1WA 4ZL1A 5DMMA 2IPGA 3LUTA 1N60C 3UXAA 3HPZA 4O1CA 3S3GA 5CEWA 2J74A 4FO4A 4LUSB 3UA4A 1W5NA 3KOWA 4UTJA 3CGEA 4XD3A 4Y8EA 4RNIA 3T08A 3GXNA 3IIVA 1D2KA 1E3XA 1VCVA 1G7UA 1K9FA 4L9YA 5A94A 1TV7A 3TYUA 1CX9A 2ZQ0A 3MB9A 5F1UA 3W1UA 1GEQA 2QQ6A 1O5XA 4BHYA 1TV2A 5AECA 4LF2A 1A49A 2NUXA 2J7FA 2E1DA 1JNDA 3RRAA 2PWDA 3FFSA 1OZQA 4ZE5A 1AW5A 2A8XA 3WK0A 4BV6A 4WUIA 3P60A 3M46A 3APGA 3XIMA 1YX1A 3M6YA 2NX3A 4JTQA 3B03A 1JYNA 1VGAA 1TZ9A 1DORA 1DIKA 2NUYA 3CMFA 2ZUMA 5EMLA 2Z7KA 2DZTA 3TN3A 1EL3A 3G0XA 3HG3A 4GXMA 3ARRA 2BC1A 4JDYA 5IHSA 5F4WA 4A3YA 1S38A 1XUZA 3TK7A 2HWGA 4HOXA 4C1LA 1CBGA 4E2OA 4EIVA 3GIYA 2HZGA 4E2BA 5A2CA 1E0XA 2VDHA 4Y9NA 3SCPA 3EDJA 3V5OA 2BDQA 1MXDA 2GK1A 4MOZA 1MUCA 1EH9A 2X09A 1G7VA 4H4ZA 4C6DA 1REQA 1OGSA 1NOUA 3NM3A 4GUGA 3SAZA 2AAAA 3OOQA 4PULA 3WLHA 4JFVA 1LVLA 3DI0A 3GTNA 3WLSA 2O9OA 2D0GA 3EWBX 1YPFA 3KBNA 5C6MA 3UYIA 1W8SA 2J66A 3NL3A 2PWUA 3MWCA 5D37A 5I00A 5A69A 1QVBA 1T6MA 2O7QA 1TPFA 4V33A 5BNKA 4JYDA 1Q3NA 1HKVA 4WDWA 3S2CA 1KCXA 3AALA 1BGGA 1JIBA 1HGWA 2PC4A 3VNLA 1F76A 3AU2A 4RR4A 1RLDA 2CIPA 3OVGA 4CCZA 2VTFA 3KM8A 4MNLA 2HISA 5M03A 3R43A 2EPLX 2C14A 3K1GA 3USZA 5JBDA 1C8YA 5E93A 4IT1A 7A3HA 1V6YA 4H8HA 1ZSXA 4GIYA 4PCNA 2E6AA 3IARA 2GJXB 1UKQA 4UQ9A 3R12A 4XKYB 3N2CA 1QPQA 2GGEA 3Q6JA 2X0YA 1MFUA 3E02A 3KBWA 1OT1A 2NQHA 4ROPA 1V97A 4LAOA 2ATMA 4UNLA 2QJNA 4YCPA 2QF7A 3W83A 3NQ7A 3I10A 4S39A 4XBSA 1J5SA 3C2YA 1FDZA 4UTIA 2H3DA 3PVFA 3BZGA 4A3UA 4F8XA 1Q6OA 4KESA 3VIOA 3HG5A 2A4AA 1YXDA 1CIUA 1W0MA 1S5WA 2QIWA 1OX5A 2WPEA 3VD7A 3WEZA 1TTIA 1LCOA 3F5JA 4CU6A 3WJZA 1PYMA 2H9AA 4CEUC 1GKRA 3TROA 1WZKA 3SURA 2QGYA 4LB4A 2UY2A 1E70M 3BANA 4TX6A 3EMCA 4W9TA 1HN1A 3FSTA 3DYMA 3ZT6A 3S83A 1E9YB 5LIXX 1ZRQA 1OC7A 3DC0A 3M0MA 5HQEA 3KRZA 3CWOX 1JULA 2VZOA 4DJEC 1FHLA 1R3SA 1TTQA 3DESA 4HYRA 4KWOA 5A8QA 2VX5A 1ZJAA 3BAWA 2I14A 5IDIA 2JGQA 1RALA 3SJ3A 1ECEA 4IFOA 2WM0A 4GA8A 2YGYA 5F2LA 2QGHA 2Z1SA 1GV4A 4H4WA 4HZMA 1E71M 2Q6ZA 3AIQA 3HM7A 2GQ3A 3RM8A 1GVQA 3PJWA 4MY8A 3W0KA 2X0HA 1AK5A 3INPA 3QEZA 4ZQPA 3TTEA 4UTTA 3VUPA 2XH0A 2VWSA 4DZAA 1KTBA 2PZNA 1LZOA 5GNYA 4O1FA 4Y7EA 5C55A 3ITYA 4JIRA 4GE8A 4FSAA 4Z2LA 3T55A 1UBPC 4WOQA 4PEEA 1VIWA 4OKDA 4DNMA 4HZ7A 3R0UA 1JI1A 5C71A 4RXFA 5AHIA 1PVNA 4EP8C 4ZVJA 2PRHA 4UNIA 5CCZA 5C2GA 3W28A 1AMYA 5IDZA 5HUOA 4YWIA 1JI2A 2NQ5A 1Q5MA 4JR5A 4H1ZA 1KBJA 1JZ6A 4ZO6A 4DELA 1Z69A 1JRCA 2O4MA 5AN7A 4F66A 5IFTA 1YQ2A 5U25A 3M41A 4J5NA 3AO0A 4LRSA 3W24A 3QTGA 1RA5A 3S2NA 3ABXA 3W73A 4J2PA 3DZ1A 3OZPA 2DZPA 4C6NA 3LCFA 1LG2A 1OYCA 1YEYA 2GGIA 4QE5A 4URIA 2AL1A 4WX2A 4E4UA 3O1NA 2YCIX 1R7OA 1ZZMA 3SY8A 1OG0A 4RXGA 2PD5A 4K8GA 3NDZA 5ABGA 3WMBA 3UW6A 3P0WA 3AS3A 2BGNE 4OUEA 1S2TA 4O0QA 5A6MA 1CECA 1XIIA 3WNPA 2JK6A 2QW5A 2YDAA 4K3ZA 4AU0A 4EK7A 3ARQA 2JK2A 1OQFA 2CPUA 3CMGA 2MANA 4KEMA 3FEQA 1V51A 4AD0A 4TVYA 4NT0A 2DPEA 3MCOA 2Y7EA 4ZE4A 2ISFA 4E3TA 3DGZA 3KBMA 5D2WA 4JIEA 2WP5A 3HV9A 1EIXA 4HMEA 1YE4A 2ESCA 3QY8A 1XDMA 2PLKA 2HS8A 2PDPA 4H8VA 3DHUA 2CEQA 1B31A 4N9EA 1LYXA 1XF0A 4WKHA 5LXXA 5MF5A 3MO7A 5M5DA 2GSJA 4P7OA 1XG3A 4YPJA 3NURA 4CU8A 5KITA 4QE1A 1BD0A 3M0HA 5EYWA 4J3WA 3W7IA 2XUCA 1V6UA 2QEZA 4C6JA 2V63A 3GHRA 5I09A 2D2GA 1JOAA 3GVRA 2VEPA 4QJ1A 2YLAA 4V1XA 4JTGA 1JQXA 3ITOA 1C8XA 3AWNA 1HG3A 1V03A 1W5OA 1ML1A 3N4AA 4BCEA 4GGHA 5FF0A 4ERAA 4JFSA 4JX6A 3NVVB 3VGGA 1A0EA 4OJYA 4MMWA 3GD3A 2OEKA 5MHBA 2PAJA 1QI3A 1YW1A 4GQBA 4QX4A 3HO8A 1W6TA 3WQWA 2CXGA 2VGGA 5CZSA 5D9PA 1MUWA 5LNVA 2NWRA 4AISA 1QOQA 1QBAA 1MQPA 4IHCA 3LRKA 4DBUA 2OELA 2WNQA 2YDRA 4AZHA 4YMZA 5EFDA 3R2GA 2WHKA 5AY7A 1E1CA 3P5ZA 2GQAA 4O16A 3SUSA 3PNZA 3W38A 4C7DA 1V7YA 1V0MA 1RCXB 5REQB 2ABAA 4NZFA 2XZ7A 1H3GA 2EPHA 3AUJA 2V81A 5F7UA 3W00A 3OA5A 5FJTA 4JTUA 4LBUA 1R86A 4PMJA 4Q22A 4JHOA 4AWSA 1X98A 3OA3A 4GMEA 1C91A 1VPXA 2CBUA 2EG8A 1HL2A 1VCFA 1LORA 3ZYZA 3WH5A 2QDEA 3EOSA 4HPJA 3HGOA 3W7GA 3BC9A 1JZ4A 1T99A 1FDJA 1TRIA 2PTWA 1IT0A 3JS3A 3VD9A 3WELA 1GERA 3H54A 1S3TC 1UKTA 4H6QA 1XV8A 1UR0A 1JD9A 1XH1A 5CH9A 2Q3OA 5LA1A 2OOFA 2R1PA 2RDXA 3TA9A 2DSWA 4AMAA 4DN1A 3UCCA 1AD4A 1K1DA 2CW6A 2R6OA 4PCSA 3G77A 3I68A 3MMUA 1AOGA 1CB2A 2VRKA 3W1MA 1IEVA 1KM5A 1PBGA 3G1SA 3K2GA 3BLDA 3R0DA 1L6WA 3NDYA 1LUCB 3I6EA 2GJLA 2A79A 4HA1A 4AY1A 4I3GA 1NHSA 3BLIA 4NJJA 2J25A 1MRQA 4AEEA 4JTJA 4UTTC 3BAJA 4F0MA 2QCNA 4U3CA 1GRHA 2P3ZA 3W2KA 2F8QA 4HKPA 3OIHA 2RAGA 2VKZG 1EOMA 4LF1A 4KEVA 4LYPA 3NEVA 1RD6A 5E1QA 1SFSA 1CGTA 4NJIA 3BK0A 4JBRA 2J7DA 1Q1RA 1MOKA 2PRMA 4HJWA 4AWUA 1G0CA 1UP0A 3GDKA 3S5SA 3VIPA 4EF8A 1LRNA 3AU6A 2Z1KA 2BWGA 4A3RA 2CZEA 3AHVA 5CPMA 4BJHA 1LOQA 5FA5A 5A8MA 1ZP3A 1RBOB 1PKMA 1XQLA 4WGHA 4GJJA 4U2YA 3HMCA 4IQLA 5DO8A 5F4XA 1FWGC 2BC0A 3QV7A 4JTCA 3E74A 1HVXA 4BEUA 1K6WA 4J3TA 3MA8A 3TSMA 3AHZA 3VDHA 3UA3A 4G7FA 3NCOA 5DRIA 4MNMA 4PUJA 1S39A 1S2WA 2Y5EA 3NVTA 4YTRA 2XVNA 2O4QA 3LV5A 3MJMA 3RJXA 3BO9A 1MQQA 4H9YA 4PN2A 4QROA 2F38A 1EPVA 3MVTA 1E72M 4GC4A 5TAOA 6XIMA 3QQ0A 3JW7A 4P7QA 4AIUA 3TX9A 3MVIA 4QNWA 4H4PA 3WJXA 4K1GA 4ACZA 3TQPA 4ADSA 1EBHA 1TO3A 4H4XA 1NWRA 1D8WA 2GZXA 3QGKC 4HA3A 1Q45A 1UB3A 4EAYA 4F2UA 5BCAA 4TVWA 2BP1A 2WNZA 1YDYA 3EX4A 2D23A 4QJ3B 1X6LA 4A21A 2I17A 3NS1B 1R3WA 1QPOA 2X1UA 3KLLA 1Z48A 1XC6A 2VFHA 4PMUA 2QPSA 2DSUA 4GQGA 1DXEA 2F6XA 4LVFA 5FJUA 5LNWA 1V3MA 2ZYFA 4LC6A 4EPDC 3U0HA 3C5QA 1XWYA 2D0FA 4B5SA 1TJPA 5ECVA 4ADWA 4TIMA 4JTDA 3S5ZA 4H2HA 2NT1A 2OX4A 1DP0A 1VBHA 1UW9A 5CZ0A 1UUQA 1KLZA 3VGFA 4LA1A 1C93A 3CHFA 4J3SA 5C2XA 4DUWA 3EA1A 3MC5A 4PTMA 3L68A 5I6SA 1WXZA 4GABA 3TJIA 3BV7A 1ME7A 3B9DA 2ZX5A 4TQTA 3ECQA 3NVDA 2ON3A 2ZZ0A 5JBEA 4D8LA 3TWAA 3B0XA 2Y0FA 4ML9A 3EF6A 1LWHA 1UH3A 3AJXA 4UQBA 5KMYA 3O0HA 4NVTA 4YTSA 3E0WA 4HTYA 1KXTA 5G5IA 3RN6A 1XKJA 1XYMA 1C3FA 1V3KA 2REQB 2C8NA 3QFWA 4OZOA 5A8OA 1BPLB 2Q71A 3FJLA 4XZBA 2CFYA 1CTNA 2VURA 4HA4A 5B80A 1W1TA 5HBFA 3RCYA 1RAKA 1JZ8A 2HK0A 1FIQB 1A3WA 1Z8AA 1EC7A 4PTDA 3PJXA 5K9XA 3FN9A 3ALGA 4GUIA 3MUCA 1NFBA 1XSIA 3SBFA 1H5YA 2R9RA 3LDVA 3TZNA 3UESA 4A2RA 1KBLA 2P0OA 1NDWA 3XISA 4F0KA 4JPGA 1UZDA 2FVLA 4H2CA 4L9XA 4MJMA 1QI5A 2FH8A 1PS9A 1XJBA 3E2VA 1MSSA 1UJPA 3KOXA 4R7OA 5E0FA 3U5UA 4DX3A 4YHEA 2X1RA 1VFUA 3H7UA 2FPTA 3PFRA 4EF9A 3RLHA 4S23A 1OGBA 2XN1A 5TBOA 1PIFA 4WIWA 4AFYA 3HG2A 1O60A 1GVEA 4ASTA 5C9WA 3VIMA 4J56A 1LDCA 1RBAA 3TC3A 2CZDA 5AC7A 2JIWA 4R9XA 2CFFA 3F2CA 2CKSA 4PRWA 3A3WA 3GW3A 5IHRA 3AMZA 2J9XA 4UFLA 3D5HA 4PMXA 1EOKA 3EMQA 2QAFA 2D2OA 2CHOA 5AVNA 1YDNA 4Y9PA 2QR6A 4I7UA 4XZLX 3N9SA 4F0HA 2C3CA 1RV8A 3GD6A 4PCFA 5CJMA 2XVPA 1QNSA 2GK1B 3I7SA 1GK8A 1Z32X 1DQWA 3ZJKA 2OZTA 4J7RA 2QV4A 4XV0A 1NWUA 4NNBA 2EQ7A 1NDAA 4Q4KA 4CVUA 1JPMA 2A6LA 1A47A 1F8MA 2B7QA 2TYSA 3GKFA 4K7YA 3U4FA 3UXIA 1GQIA 1K8CA 2BX7A 3AWOA 5E9XA 4CN6A 2X8GA 1B9ZA 3NXLA 3B0YA 1PKYA 3QR3A 4LC8A 4HPGA 2TAAA 2P3EA 4DVOA 4MZ8A 4WXYA 5JUVA 1ISZA 3G1VA 2BXYA 1KXQA 4BQ3A 5BOFA 1BAGA 2C1GA 3R6IA 4LVGA 1SFJA 3S42A 3QMTA 1LF1A 1LRTA 2ZZ7A 4EANA 1UMYA 4IPNB 4B3KA 3G1RA 3WK1A 3HMJG 1YIXA 2QF8A 3SUWA 4AAJA 4DLFA 3DG3A 3F4WA 1OYBA 2WYSA 4F4RA 4WVXA 2OZ8A 3QN3A 4JNZA 2W67A 1KFLA 1KCKA 3QVQA 2WJDA 3BDKA 2DUXA 3NO3A 4CQ9A 3DKLA 1IEWA 2VR2A 4WJ8A 4ADUA 2VOMA 4L65A 1RJQA 3QQWA 3PUGA 5JXQA 4D1IA 1UZ4A 3H6OA 1KXHA 1KKRA 3EOLA 4UCFA 2HPIA 4DO6A 1W3KA 1BWLA 2GDUA 1PCWA 1C8VA 4XSLA 1I2QA 1S5TA 2G3FA 5FJOA 3QHMA 3OLGA 1F8IA 3MSDA 5G1TA 4AF0A 2EG7A 3M7WA 1EKOA 2P10A 2ASHA 3H22A 3PFMA 1LT7A 2WJEA 3XINA 3E9AA 2FYMA 5I77A 4TTUA 4K8HA 2ZZ3A 2W92A 1F07A 4G5DA 2H9AB 3IWPA 4H6RA 1H61A 3I65A 1GW1A 2ZWZA 4ZOEA 2EBNA 1TJ1A 3UR2A 1FWJC 5D8WA 3U2CA 2GRTA 3RDKA 3EKGA 5A8PA 3W7JA 3ABZA 2NPXA 3VAVA 1UH2A 3O63A 3BG3A 5GJMA 2DP3A 4ZODA 4EPEC 3GO2A 1DQUA 1I1WA 4K1WA 4O10A 3I3DA 4KCVA 3OHIA 3EX2A 3OZYA 3SFWA 3CUFA 3OLDA 4IMAA 4GOAA 2AKMA 1FWDC 3CZLA 4XZIA 3Q2DA 2E4TA 4BF5A 2AMXA 1KC7A 4A8NA 3WMCA 3DECA 4Z2GA 1OX4A 4A6GA 3QZ6A 2YL5A 5ABEA 1KM4A 1SJAA 2WQDA 1CLXA 1R9YA 1XYBA 1JCMP 2ZVIA 4Q8VA 1QOPA 4PMDA 1H1NA 1B9BA 1C90A 3WBAA 1WKFA 1FH9A 1ZBKA 1X39A 4NEVA 4XUGA 2XWEA 4CN4A 3STEA 1UP2A 3A24A 1YNPA 4LXFA 3H2AA 3FW6A 4PRRA 1DVJA 3M5YA 2O0TA 2J6VA 3L2IA 4GI9A 4BI7A 1RM6B 2FLIA 4FOUA 1GVIA 1X38A 4L9ZA 2ATSA 1ADDA 2EQ8A 2RJGA 5BXPA 1UKPA 2AGKA 4IUGA 1F4AA 1F73A 3N3TA 1EO5A 2QAPA 4HCDA 4UMCA 3P2VA 5EGRA 1ZTVA 5BOEA 3T4CA 4DF2A 3AIWA 2HCVA 3C2RA 3LTSA 4MLJA 1BYBA 1XIFA 3UJFA 1Z6KA 2GR1A 1KO0A 1W3IA 1V4YA 1CXIA 4TVCA 3W2MA 1SJDA 3U48A 4L1XA 1EBDA 3SUTA 1TE1A 4JFTA 4ZZ9A 4UR7A 4H83A 2PDNA 3CL6A 1B90A 2HVOA 2PDKA 3W88A 2EHHA 3RX4A 2INFA 4GQRA 2D24A 1MFVA 1U33A 2YW4A 3E6EA 1POJA 1JCLA 3BLLA 3EZ4A 1LRQA 1AA1B 3R8GA 1WV2A 3HIJA 2PDWA 4KT2A 1RQBA 3MUZ1 4DJFD 2E8ZA 5CSYA 2ZICA 3BOFA 4FXFA 2OCZA 3E96A 3OVQA 1KV5A 2CBIA 3GH7A 2WAGA 3R89A 3V75A 3L2MA 7TIMA 4MVAA 3O15A 2FVMA 4JTFA 2YVJA 4IG2A 4QJ5B 1F5ZA 3IUIA 5HR6A 4LS1A 1O7AA 4TUFA 3A4WA 3I6RA 4Q6JA 3LU2A 2G96A 1GW9A 1P0DA 1E3ZA 3TOPA 1O5KA 4X9YA 4HNNA 2J24A 2HNHA 5C9XA 5I3JA 4U10A 3S46A 5A2BA 3DOPA 2EPNA 1GVFA 4GVHA 4C6MA 1NIUA 4WF7A 4AD5A 4D6EA 5HWJA 4AD4A 1DJHA 3W1AA 1ITXA 2EQDA 2CLMA 3VM5A 3VYLA 4JQAA 2E68A 3FKKA 4C6QA 3KBVA 2GL5A 3TTSA 1BKSA 5FS6A 3NZGA 5F2GA 2WMGA 3SUUA 3Q58A 1F3XA 2VFDA 1V6XA 1BWVA 4ZTXA 1RSCA 4QQUA 3WEMA 2DORA 5L9FA 3L0GA 2HQAA 5HNRA 3S1VA 3BSHA 1K02A 4IF2A 1WNOA 3QR1A 3IC9A 1OFQA 2GDQA 1IR1A 1LL7A 3SN4A 1KRBC 3RU8X 3WBXA 3W4RA 5AZ1A 3ARSA 1FWAC 3F1QA 3EKLA 1RJPA 2ZC8A 4ILSA 1ONXA 2I1OA 3BJFA 1EZWA 2E1WA 5TD4A 3W9ZA 1G1YA 5JIWA 3HPXA 4UOQA 4D8ZA 4K36A 2OYMA 3EXSA 3FIGA 3HB9A 3ZT7A 5D9NA 4M1RA 4MY1A 2PDJA 1P48A 3EA3A 2F6UA 1B57A 5KZ6A 3MP3A 1ZQ5A 4F2TA 2WPGA 5DEZA 3GDBA 3BICA 1E1CB 1OY0A 4GZ7A 1TV8A 2BY3A 5DCEA 4ADTA 4H4RA 1OM0A 4I90A 2DZAA 2FGBA 3OBAA 3MP5A 1DWIM 4ZO7A 2AAQA 2ZDSA 5B7YA 1TR1A 3MWAA 3PWIA 5EU9A 3QW3A 1TIMA 3TMQA 2G95A 3FDKA 4B4HA 2OSWA 4HCLA 2QJJA 2Z27A 3IJQA 1FEBA 1K7XA 3EWXA 4ZB2A 3RMJA 3IAPA 4AHPA 2R91A 4QS6A 4Y6GA 3OGSA 4ORIA 2ZZCA 1RK5A 3VVGA 1AODA 4RDWA 4DJDA 1VHNA 2VNCA 3SRKA 4RNJA 2QS8A 4ZQRA 1K4HA 4N4QA 2CBVA 1SGJA 4YTUA 1UOKA 3U9IA 3CV1A 3KLJA 4D71A 3TAOA 4IIBA 5BRBA 3AZTA 3FK4A 2IW0A 2W91A 4INFA 1BRLA 1QW7A 1M01A 1X6NA 4E2DA 1NHRA 2HXTA 4BS0A 1LBMA 4IIFA 3CQIA 4Q8UA 1RP9A 4KWVA 4H4SA 5KVHA 2KZHA 4XX6A 1B5TA 4G1NA 5A6BD 1AVAA 4XAZA 3PG6A 3LXDA 3KLKA 3L4ZA 3QPEA 2AGTA 4DJDD 2A7NA 1GZ1A 2Z1WA 3P0XA 1TUXA 3N2XA 5EA9A 4NG3A 3PZVA 1H7XA 4HBKA 2O92A 4FI4A 1SO5A 3C0QA 3P80A 3V1HA 3NZPA 5FMHA 1F3PA 3STGA 2NQJA 4H4UA 1OK6A 1GYNA 1NHQA 1O68A 1BF6A 2WKJA 2PDQA 3RPDA 3GR8A 1VAHA 2BVTA 2IKGA 4JQ4A 4UFHA 1ONEA 4NXSA 1M5WA 1CNVA 4QSHA 3MCMA 3VOHA 1ICQA 4Z08A 3CAQA 3H4KA 1XRSA 1JAEA 2V82A 1Z9AA 3GIPA 2ZRVA 1R6WA 2BHZA 2G97A 5CPSA 1R3RA 3H4WA 3L9CA 1GSNA 1JUBA 2DSKA 1WE5A 5AZ0A 4DWSA 5CPTA 4PSPA 2CHNA 2Z7GA 2X05A 3A13A 1VENA 1MO9A 3IRDA 3R58A 1KM2A 4UOJA 5F2IA 4RW5A 3UNTA 5CJNA 4LUJA 1B3VA 4HZ6A 3NQGA 5CC5A 2B7PA 3VK5A 3CT2A 4A8LA 4LAKA 5C7HA 1A5OC 3T78A 1A3HA 3HPFA 4AHQA 3N04A 3B8SA 1JGIA 4TVUA 3OQ8A 1ME9A 1YMYA 2YXOA 4PUWA 2VVNA 4B3ZA 4ZFMA 2ZRUA 5A6SA 3UZYA 2EAWA 4ACZB 1P0KA 4M81A 4MWAA 1AQ0A 4JXCA 4MAVA 4DWSD 1VEMA 3PWAA 1P6WA 4CKQA 1IZCA 4LAMA 3WNKA 4W89A 3L4WA 4C6BA 3BLEA 4JY9A 3TTQA 1R30A 3BOLA 2O55A 2QUNA 3STPA 4TMCA 3W70A 4PB3A 2W55A 1WYIA 3TWBA 3EEGA 4XVEA 4P8UA 5T26A 5BXRA 4NQ1A 5FJIA 2FPYA 1ISYA 1YKWA 3B8UA 2ANUA 1N62C 2BVWA 3LYEA 1KM1A 3GH4A 4GI6A 5D8ZA 1TZZA 3HZ3A 4CQCA