3FXGA

Crystal structure of rhamnonate dehydratase from gibberella zeae complexed with mg
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
407
structure length
407
Chain Sequence
LSSVKDFPKIKAIRSFIIGGVGSGGDYHNVKGGHWLIDSDISTPASKWEQYKKSRTSWGINVLGSFLVEIEATDGTVGFATGFGGPPACWLVHQHFERFLIGADPRNTNLLFEQMYRASMFYGRKGLPIAVISVIDLALWDLLGKVRNEPVYRLIGGATKERLDFYCTGPEPTAAKAMGFWGGKVPLPFCPDDGHEGLRKNVEFLRKHREAVGPDFPIMVDCYMSLNVSYTIELVKACLDLNINWWEECLSPDDTDGFALIKRAHPTVKFTTGEHEYSRYGFRKLVEGRNLDIIQPDVMWLGGLTELLKVAALAAAYDVPVVPHASGPYSYHFQISQPNTPFQEYLANSPDGKSVLPVFGDLFIDEPIPTKGYLTTADLDKPGFGLTINPAARAKLIPSDYLFKVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rhamnonate dehydratase
publication title Crystal structure of rhamnonate dehydratase from Gibberella zeae complexed with Mg
rcsb
source organism Gibberella zeae ph-1
molecule tags Lyase
total genus 130
structure length 407
sequence length 407
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3fxgA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3fxgA01
2PA6A 4E4FA 3V5FA 4DXKA 2DW6A 2GGIA 3H70A 3S47A 2RDXA 3OTRA 3GC2A 3JVAA 1F9CA 3RO6A 3DGBA 3MQTA 3JZUA 1SJCA 3ZVHB 3DFHA 3DEQA 2OZ8A 2OQHA 3IJQA 1KD0A 1IYXA 4A3RA 2OX4A 2POZA 2PGEA 4IT1A 2XH0A 3P0WA 4IL0A 3PFRA 1BQGA 2QGYA 2PODA 3RITA 4A6GA 3D47A 5BOEA 3DDMA 3R10A 4Z17A 3VCCA 3V4BA 5FJUA 3DG6A 2QJMA 3GY1A 2GSHA 2FKPA 3DFYA 2AL2B 3HPFA 1R6WA 3SJNA 4IL2A 3DIPA 3CT2A 5FJRA 3VCNA 1E9IA 1WUFA 2PCEA 1SJAA 3SN1A 2P8BA 3VDGA 3JW7A 2O56A 4K8GA 2P3ZA 1JPDX 4A35A 3BJSA 3P3BA 2PGWA 3N4EA 3ZVIA 3ZVHA 2QDDA 1JPMA 3UGVA 3OP2A 5ENLA 5IDZA 1KKOA 3RR1A 1EC9A 7ENLA 4IZGA 4HCHA 1SJBA 2OQYA 2MUCA 3I6TA 3U9IA 4GGHA 3TOYA 3FVDA 1TKKA 3GD6A 3BOXA 3UCCA 1FHUA 4GYPC 2QJJA 2AL2A 4FI4A 4JN8A 2P8CA 3QN3A 3SSZA 3T4WA 3I6EA 2HXUA 1OEPA 1EC7A 4MMWA 4ENLA 1R0MA 4H1ZA 1JDFA 1MDLA 2P88A 4GFIA 2QVHA 2HZGA 3FJ4A 1NU5A 4HPNA 2PU0A 2P0IA 3UJFA 3H12A 4HNCA 4DN1A 3V3WA 3DERA 2QQ6A 4DHGA 2PP1A 3IJIA 4KEMA 3CAWA 3FXGA 4E5TA 3V5CA 2MNRA 3OZYA 3R0UA 1SJDA 4H19A 1RVKA 2XGZA 1EBHA 2AKZA 3N4FA 5J04A 3K1GA 2PU1A 4F4RA 3CXOA 3RRAA 3MKCA 6ENLA 3ENLA 2PSNA 4H2HA 2GDQA 3ZLHA 3D46A 4DYEA 4YWSA 3EEZA 1XPYA 3T9PA 3TTEA 2FYMA 3R1ZA 3MSYA 4MKSA 3CK5A 5FJTA 2GGGA 2XSXA 2GGHA 4KWSA 3PWGA 1JCTA 3ZLFA 3B97A 4ZA0A 3TW9A 3R25A 2PPGA 2PP3A 4HCDA 3P93A 4HN8A 4K2SA 2OO6A 3OPSA 3SQSA 1PDZA 2PTZA 3OW1A 3VFCA 1MDRA 4DX3A 2OG9A 2PTYA 2DW7A 3SN0A 1TZZA 5EU9A 4GMEA 3TCSA 1MUCA 4KPLA 4M6UA 4HCLA 3NO1A 4J3ZA 3ES8A 4IHCA 2NQLA 1FHVA 3N6JA 3Q4DA 3TQPA 3PK7A 3GO2A 4GGBA 4G8TA 4K1WA 3SN4A 3I4KA 1P43A 2OPJA 3UXLA 2GGJA 4HYRA 2ZADA 3Q45A 4G7FA 3UJSA 2PP0A 3IK4A 4E8GA 3T6CA 1EBGA 2AL1A 1ONEA 4ZCWA 2XH7A 2AKMA 3DG3A 3ES7A 2XH4A 3FCPA 4Z1YA 2OZTA 2OZ3A 4MGGA 4E6MA 2OVLA 3QLDA 3CYJA 3SBFA 4E4UA 1NELA 2OFJA 4H83A 3RCYA 3CB3A 4JHMA 2PTWA 3TWBA 4M0XA 1EC8A 2XH2A 3TWAA 3BSMA 3VC6A 4X2PA 3MY9A 4EWJA 3UJRA 3UJ2A 5FJOA 3DESA 2I5QA 1XS2A 2QJNA 4GISA 2HXTA 1DTNA 1P48A 2GL5A 3THUA 2OKTA 1ELSA 3FYYA 2CHRA 4KT2A 3R11A 2ONEA 3T8QA 3UJEA 4GIRA 3VC5A 3UCDA 1YEYA 5BOFA 1L8PA 1KKRA 3TJ4A 3UXKA 1W6TA 4HNLA 4IP4A 2QDEA 4ROPA 3DG7A 3N6HA 3VA8A 3H8AA 1BKHA 1PDYA 1TE6A 3IJLA 2OLAA 3S5SA 3FV9A 3H7VA 1ECQA 2ZC8A 4JN7A 1MRAA 3MUCA 2PTXA 1MNSA 2PS2A 5FJPA 1WUEA 3MZNA 2HNEA 3R0KA 3U4FA 4FP1A 3MWCA 3OZMA 3EKGA 3QPEA 3NXLA 4DWDA 1KCZA 3ZLGA 3PWIA 4J1OA 3KUMA 4IP5A 3QTPA 4GYPA 3TJIA 3NFUA 3NZGA 2PMQA 3RGTA 3QKEA 3STPA 2GGEA
chains in the Genus database with same CATH superfamily
2PA6A 3LBOA 3C56A 3W25A 1FTXA 4HJFA 2I17A 3GHRA 2E3ZA 4LC6A 4MOZA 3UY7A 3GC2A 4IIFA 1OADA 4HYWA 3JVAA 1FWFC 4AVOA 2BGQA 1QNVA 3TYDA 3WX7A 5EBAA 4GKTA 4DYKA 1KD0A 3LQLA 3VUPA 2JKAA 1OCQA 3OBEA 3O1NA 1OK6A 2NWRA 7REQB 1BQGA 3WJWA 2Z7KA 4LBSA 3LYEA 1SUXA 1VF8A 2AMXA 2VD9A 3SAZA 5CZTA 4BF9A 5BRBA 9XIAA 3ERPA 1E6SM 3LLDA 3AIWA 5AKQA 5D9MA 2R14A 1F4HA 5LNWA 3GNOA 4CD8A 3UFYA 1NDAA 3GHUA 3C0SA 3IJ7A 5DCDA 2EQ9A 4O8RA 2DZVA 3HQ1A 4KRTA 4D1JA 2VFIA 3ARYA 4X0VA 2AMGA 2CLFA 2QT3A 1CNVA 5DN1A 1JUEA 1XRFA 4XG1A 2VUNA 5IHRA 3EWZA 4XZNX 2Q8LA 5DF0A 2CBJA 3L67A 3GLCA 1FEBA 4S3EA 4IGHA 5IDZA 3GH5A 1GREA 4QSHA 1QASA 3LXAA 3AYTA 1ZMDA 3U9IA 2ICSA 3DFSA 1JD7A 1XLEA 4N9DA 4ZO9A 1PTGA 1VYSX 1W1VA 3V35A 4HU3A 1NSJA 3MO4A 2WZMA 2QNEA 4LY4A 4S1FA 4ZQNA 4XUGA 3PZGA 3MANA 2WSKA 4H4TA 3ITOA 5A6MA 1KBBA 4JHZA 1AMYA 4QEEA 5DCEA 4XBJA 3WNPA 3F5KA 2OYLA 3CGBA 3FN9A 1K03A 5E1QA 3B0PA 2Z2UA 1WCGA 1JULA 1W1IE 2A4AA 2ZRZA 2GSJA 2PWUA 2XIJA 3LD5A 5M1TA 5DMLA 1M7OA 2P0IA 4IGNA 4DN1A 2JE8A 1FP8A 3DHUA 4RE3A 1UCWA 5HQMA 3JUGA 3NEHA 3CZKA 4DHGA 1W3LA 1PIIA 4JOMA 3G1YA 3CAWA 5AFDA 2I57A 1S5TA 4QAIA 1AFSA 5H6HA 1QOXA 4Z2JA 5G2IA 5LIWX 1V08A 5H2ZA 1OHLA 4GX8A 2VR5A 3LB8A 2E6YA 1ZCOA 4F79A 3PULA 1OABA 3E02A 1M7PA 3ENLA 3M0LA 3S6TA 3KBVA 3UG3A 3DOPA 3B8DA 4ADUA 5I00A 4ZMGA 2HISA 1F3PA 5EFFA 4XBKA 1K4GA 3AHYA 3WQOA 4S3KA 4IICA 4GUJA 3VKJA 2E28A 1DJHA 1YXDA 4AD2A 1XWYA 3LHTA 1O5RA 4MWAB 4YTTA 2QCCA 3AXHA 2V30A 1Q63A 3WH9A 2CLHA 3WQ4A 3WH5A 1KV8A 4BWLC 2PP3A 1S2AA 4I9MA 1UR2A 1EYWA 3SQSA 1K1DA 2BTMA 1V6YA 3EXSA 3U2EA 4IJBA 1WDQA 2OU4A 2VR2A 3CLWA 4QXIA 4LNYA 2GLKA 4XZWA 3RM8A 1RD6A 5GJNA 1J5TA 3WK2A 5KITA 1JPKA 3WQEA 3DGHA 2AAMA 4CNSA 1ISWA 3NOEA 2GRTA 3BAWA 4J3ZA 4IHCA 1MXSA 4MB3A 3PG9A 4M56A 2E9MA 2NLYA 3U2OA 3AWOA 4RPPA 2BFGA 2GDUA 1MW3A 1FXQA 1A5AA 4V33A 3RU6A 3SN4A 1GVEA 1EJXC 4CQBA 3AMGA 1SO5A 4E3TA 3NSMA 5FKYA 4AEOA 3EF6A 4UMAA 1Q66A 3OHMB 1YBQA 3VZYA 5AECA 4P8XA 1ONEA 5ABFB 4CNNA 1KFLA 2J4GA 2J75A 5CJ5A 3LG3A 5LA0A 1BG4A 5AYBA 2OZTA 4S3AA 2WZHA 1I2QA 2FHBA 1I0DA 2X0HA 1A5KC 3WQ5A 2VDHA 3RNMA 1TIWA 2BGSA 3GFZA 3W74A 3CIXA 4UIOA 4MFDA 3BTNA 1FWTA 3HOJA 4H83A 3RCYA 4E4PA 2EGZA 3U8GA 3GZAA 3ABRA 3OA5A 1XRSA 2FVMA 2QF7A 2IKHA 2D3NA 3L4VA 4I8YA 3DBPA 3C86A 5E6YA 1UHVA 4FXFA 2PDCA 1EZ2A 4JTLA 1OFAA 1HGYA 1J10A 1EWEA 4DBUA 2ATMA 2CCRA 2OX1A 3WNMA 3EAUA 2Z26A 1C91A 3C2YA 2ZX9A 2WJDA 4I7UA 5DT5A 2VGGA 4TVDA 4EP8C 4BHYA 3FGCB 1V5XA 1W5OA 4FS9A 3GTHA 5K3VA 3VA8A 3MYOA 3H8AA 6A3HA 3EANA 4UOZA 1PDYA 3MMTA 7REQA 5HINA 3AJXA 4BS0A 1UD3A 4PMYA 3FHQA 1VPXA 1RJQA 3MUCA 3G22A 3N1AA 1OFBA 1OGSA 1DYSA 2ZUWA 4GX9A 3QPEA 3WLHA 5JCLA 3NXLA 4Y8EA 4Y9AA 1J18A 1HGWA 2OSXA 2WANA 4ZOBA 2PURA 4HU8A 1H2IA 4J9JA 1IQ8A 3GFYA 1GONA 4Z2IA 1GRHA 2J7CA 4EK7A 1KCXA 3WDPP 4NF7A 1B9ZA 1L6YA 4HK7A 4I5UA 4PBGA 1KBKA 3ZVHB 3DFHA 4UTJA 3LGGA 5H1WA 1Y5WA 4P8WA 1TRDA 3O7UA 1LCOA 5CBIA 2IKJA 5H8MA 2OX4A 4D6JA 2QCLA 4FPSA 1AL7A 4CKQA 4JYEA 2DFAA 4WCJA 2XFWA 1EKOA 5T9BG 5BOEA 1MUMA 2RUSA 2C7FA 1SW0A 4Z0SA 4XTIA 2DH2A 1WO2A 5CG7A 1V0KA 1W2PA 3B9DA 3FYOA 4MVAA 4PTVA 1EZWA 4UC5A 1UZ1A 1EJ7L 1GVOA 4NYUA 4UFMA 2VFGA 4H8UA 1J01A 4FEZA 4RNHA 1E72M 3HGSA 5LHEA 4B3KA 3IANA 3A9BA 2ZDSA 1UKPA 3H2AA 3UXDA 1V97A 2YB4A 4PB5A 5AYIA 3AUJA 3ZJKA 3NM1A 1P0BA 4GH1A 1DJYA 3CWOX 4Q7IA 1ZMCA 5F4XA 1V3HA 4UQBA 1X38A 4Q6JA 5AY7A 3QEZA 4ZE5A 2QUNA 1U5HA 3F03K 2CIPA 3CAQA 4GGHA 3TOYA 4DJEA 4DJFC 1V59A 3HG2A 4P8UA 1OINA 4XVEA 5HMFA 2PWVA 4LT9A 3AWNA 2QJJA 1FWHC 5CKSA 5BCAA 3ALFA 5BXTA 3CB8A 1V51A 1ZX9A 2QEZA 3N2XA 7CGTA 5BZAA 3RO8A 4H4VA 3N04A 3GTXA 4H4UA 1T40A 3M0HA 3TE9A 3WQPA 4GI4A 1Q8AA 2EG8A 3W7OA 2YZ5A 1GHSA 2WPBA 2QAEA 4UZSA 5HJYA 2QULA 1LM1A 3HV9A 1DJXA 2BLEA 2BXZA 4MWAA 2I1OA 3LMZA 1K9EA 2J3NA 4MY1A 4WY0B 4LALA 3E0IA 2X09A 2BX7A 3OZYA 3DAQA 2X8RA 2ZXAA 4QEHA 2ALDA 2GH5A 1TV7A 3OEXA 4LRTA 3KWSA 4F2TA 4ZQMA 4X22A 5HWNA 3N4FA 4JQ9A 3QH2A 4UTUA 3QY7A 4BEUA 3SCOA 1F6YA 4R88A 1D8WA 3VX0A 4LANA 1WDWA 3THCA 2W54A 3DH9A 4QLJA 3P80A 3CV1A 4I9TA 3HBLA 4BK9A 1UMYA 3PG8A 3S5YA 2E6FA 1TJ2A 1TPFA 4MKSA 4DZHA 2YCJA 3VNZA 5A8MA 5A8NA 3Q67A 1FY6A 3LN3A 2Y0FA 3W7GA 1UD8A 2XIBA 5DANA 2ZX6A 3QOKA 3NSXA 1JCTA 2VDGA 4M5PA 3CEUA 2XM1A 5ABFA 5I03A 1SR9A 2E5DA 5AYZA 3LUTA 4US5D 1UR3M 3WMLA 4IIGA 2PTZA 2XIMA 3ARRA 4EQWA 1LQ0A 3W01A 3M7WA 4AZBA 1MEWA 2POTA 3OGSA 4GG9A 4JR5A 2XWEA 1ISZA 3VNDA 4F0RA 2NQLA 3L5MA 1FCBA 1AW5A 3WF0A 3LQGA 1EJWC 1N7KA 1IEIA 2XYLA 3GXNA 3MKVA 2J8GA 4ZQPA 3Q4DA 4JIHA 4B4HA 4S3JA 3EPOA 3DC8A 1UJQA 4UR7A 4K1WA 3KVLA 1XKYA 2EG6A 3PZTA 1V7YA 1M6JA 2DZTA 4HKPA 1D7KA 2E8ZA 4M51A 1RPKA 5I3HA 4G7FA 3BGGA 1DJGA 1XD0A 1UG6A 3WQVA 1HKMA 4D6GA 5M17A 4EMIA 3VNMA 4GVFA 2D2JA 2WWDA 1PX4A 3PUDA 4AEEA 3UETA 4Z42C 1ICSA 1SVDA 3EEGA 4B90A 1M53A 3QLDA 2WMJA 4CCDA 3WH7A 1TCMA 3U7VA 2HS6A 1XCXA 3LMYA 1H1NA 3WQ6A 3E2SA 5FIPA 1HJQA 4AZCB 1WXZA 3O9NA 3NAVA 5HJXA 1E5NA 2V2DA 3SURA 4A8IA 4QJ4B 1VQTA 3TONA 2CKRA 3WMCA 1XICA 4HHHA 2IKGA 4GISA 4MUZA 1N8WA 2GL5A 4MB1A 3W88A 4X61A 3M44A 1NDWA 5AHEA 3QQ1A 4JDYA 3G1XA 3HJEA 1JNDA 2EPMX 2JIWA 2OYMA 1IHIA 5A6LA 5C2CA 3H2NA 1UH4A 3B9NA 4JTDA 4L9ZA 3R2GA 1P4CA 3C8FA 3GQYA 1KGUA 4ORMA 3HURA 4M3PA 1XSJA 1UJPA 4LVAA 2XVKA 3QZAA 3N12A 2ZUNA 3L4YA 2J6XA 1BVZA 2G3FA 1P6CA 2GQ3A 4PEKA 5IOBA 3W07A 4LOCA 4I90A 2CKSA 5GJPA 2ZCGA 3ZT5A 1VIZA 3EOEA 4RK8A 3ZLGA 3AU6A 3SIMA 3BGAA 5BWFA 3HMCA 3DGZA 3STPA 5KZMA 1KM1A 4B5UA 1PCWA 4ERIA 1X97A 7ODCA 4E2VA 3AMLA 1EIXA 5D05A 3CUGA 3A7UA 3MQTA 3P8IA 2H8XA 5GNYA 3SRFA 1IYXA 4ZTYA 3W1TA 5BMXA 3SUTA 3V5OA 2J27A 2R1PA 4ZXOA 2UBPC 1E6RA 3C0QA 3R10A 4P7QA 4TMBA 1GOWA 1AQ0A 1DXLA 4UTHA 1F8IA 1KV5A 5F1VA 1X6UA 4GYFA 4R7WA 3EMCA 3LSCA 3P61A 4BQ5A 3AFBA 4K8HA 1RVGA 1O5XA 3IVSA 4GY1A 2I7GA 2QV5A 3GXPA 3O0FA 2A21A 1WUFA 3W7KA 2NQ5A 1GV4A 5B7YA 1R46A 4BCEA 3JW7A 4CNPA 1HKWA 4K8GA 3BOLA 3PZIA 1TJ1A 1E0WA 4O12A 3KOZA 4UOJA 4D1IA 3N4EA 3WCZA 1SM9A 4AZ6A 3OP2A 1D3CA 4GQGA 1IWPA 3VZZA 3VIGA 3V1HA 2E6DA 5IBXA 2Y7FA 2NUWA 2I56A 2NQ9A 1JCXA 4WY0A 1LOQA 3OG3A 1W9BM 3FJNA 3WQ8A 5M2FX 2PDJA 1SFLA 3KOXA 4D9PA 4Z2GA 4XVDA 5IXEA 3K5XA 3APYA 4FB7A 3PB0A 3NTYA 2BC0A 4AISA 4QE4A 1IZCA 2ZXDA 3E0FA 4G9PA 2CLEA 2RGMA 3E5BA 4H4PA 2ACUA 4PMDA 3LSBA 3V75A 3T4WA 3URQA 3WLKX 1O1HA 1K9TA 2GUYA 1JOAA 1NTHA 3CGCA 2DT0A 3WF3A 4ZFCA 4R9OA 5BW6A 1K7XA 1EO5A 3BK0A 3E2QA 3SW6A 4QSFA 4RX0A 1MDLA 1QW9A 3W7IA 2QVHA 4PCNA 1MW2A 3WQCA 1QW7A 2J88A 1NQKA 1GZ1A 4GZEA 2EKCA 3DJGX 2ZZCA 2PU0A 2VENA 4YXGA 3MV11 5LNVA 4J3UA 3A3XA 1ONRA 2JK2A 4HSHA 4UTMA 3R12A 2DP3A 1DJQA 1TB3A 3TQ0A 3DERA 5AB3A 5LZLA 4TVUA 4HT3A 2WPFA 3BH4A 1YADA 4IQEA 5A95A 5FF4A 3WK1A 3R4IA 5HPCA 2OWWA 5CLWA 1VJIA 1F5ZA 2Y2WA 5T91A 3MVTA 4QS5A 3DK4A 4A3UA 1A47A 3I7RA 2XN2A 4AHQA 4JTCA 3KZPA 3OYZA 2NQHA 2DT3A 2YA2A 4FX7A 2A8XA 3KTSA 1GOQA 4DYEA 2HBVA 4HGXA 4JQAA 2WP5A 3T44A 5JBFA 2DUAA 1ITCA 4KEVA 4C5YA 1S3HA 4KCUA 2BC1A 2VNCA 2PRMA 3G1AA 4HA1A 1DE6A 1NWTA 1RJPA 3AZRA 4KFOA 2PAJA 1OFQA 3ZLFA 3LCLA 2PDFA 3ZJ6A 4PULA 4IMGA 1IEWA 2P3EA 3KS5A 3D3AA 4ZQRA 5AHMA 2ZOXA 3P93A 4MJZA 4Z08A 1PDZA 4YVPA 2YW3A 1T8XA 5FMHA 4M1BA 5TNVA 1YXYA 1OFDA 2DIEA 3ZFHA 4U10A 2DW7A 7XIMA 1MXGA 4HN4A 3S3GA 4LYRA 2TODA 1TV8A 4IXXA 1SO4A 1JZ5A 1WAUA 2VEKA 3R6IA 3Q2DA 1EJRC 4AZCA 1YPXA 1XM3A 1DTUA 2FGLA 2WWCA 2ZVIA 2ZZBA 4ICMA 1WYIA 5TBOA 3NDOA 3A9IA 4XK2A 3BV4A 3KHDA 2FMNA 4A8RA 2E5AA 1W1A1 1I1XA 4YHGA 1CXLA 3ARWA 3HO8A 4W87A 1CLXA 3WH6A 3SQPA 2WNQA 4GLEA 4O18A 4UCGA 3H4GA 4XAFA 1QPOA 2D22A 4JNYA 2WKLA 4MGGA 3QZEA 2ISVA 4JFUA 4A21A 2CHNA 4DZAA 1OD8A 2DSVA 1U2YA 4ZQOA 1XC4A 2Z2BA 4H8NA 1B3YA 1XYAA 2G0WA 2FDMA 1LRTA 3CWNA 1XIIA 4OBTA 2QF8A 2P0OA 2ZUTA 1R3QA 2WHMA 2XH2A 1G69A 3WEMA 4C6QA 2FMOA 2X05A 2WOQA 3NSNA 1UR4A 1JXKA 1KBJA 4KRZA 3ONCA 3OVQA 4LNCA 1NDVA 3EXRA 1EYEA 3BAYA 4EXAA 5HUOA 4D6EA 5LNUA 3W84A 3VM7A 3I3DA 4LEFA 3WNOA 1P7TB 1H0GA 1W32A 3VC5A 5CZKA 3LHVA 4IMAA 4LUJA 3V1PA 3U48A 4QNEA 4PH6A 3P81A 1YW1A 3BAIA 3UXKA 4IP4A 4W8LA 1NHRA 1VEOA 1S5WA 3MUY1 2BCPA 2VEFA 2VZTA 2EQ7A 3H22A 1Q6EA 1VAHA 1A5SA 3QV6A 4KERA 4C6DA 3RCNA 2QXWA 1DIDA 1SFJA 2ZC8A 1PX3A 2AQWA 3FYPA 2PS2A 2J7FA 4W8BA 1UKTA 2HNEA 4M82A 3GHTA 2YFOA 3B0YA 3W71A 3VU2A 4AHOA 2BY3A 3DH7A 7TIMA 1LL7A 4K7YA 1NOFA 2WBGA 3EKGA 1GKRA 4GRSA 2G95A 3P74A 4PBFA 1V03A 2CETA 3LLFA 4J1OA 3HF3A 1UH3A 3TJIA 3W82A 1H11A 5BXRA 3AS2A 3RGTA 3VKAA 2UWFA 4F0MA 1TTIA 4O1BA 1UBPC 4GQ0A 3M46A 1YTKA 3FOKA 2R1NA 1UR9A 1VBUA 1ZTVA 4IGSA 1ZAJA 1VFUA 4HNVA 4C5ZA 4HNNA 3WLIA 3SCRA 3AU2A 3ONBA 1WZMA 3M0XA 4ZOEA 2PUZA 3WQDA 1OT1A 1PZ2A 5AYYA 1KM5A 4RE4A 3FG2P 4Z17A 2IPGA 1VIWA 2CLKA 1YPFA 4AZ7A 1ZGDA 4LSBA 5FJUA 5CZSA 2CYGA 4EKJA 1KXVA 1E9ZB 2NZLA 4C6JA 1FCVA 1KCLA 1XQLA 4P7LA 4OBRA 1OCNA 4O17A 1E9IA 3BMVA 3ZO9A 5C55A 1QK0A 1S39A 2CZEA 2DSUA 3HPSA 2D2OA 2VO5A 4QIUA 3NQGA 1LG1A 3ZT7A 3VIHA 4ZO6A 3S9YA 2IQ0A 2ZXBA 2ZE3A 3TDFA 1OC5A 4QFUA 1QU4A 1GVYA 2WSQA 2VX5A 4L80A 4OBSA 4LVBA 3W24A 2A6LA 4AYGA 1CGYA 1JGIA 2GVYA 1HJWA 1C9WA 3MYPA 2X8CA 2DT1A 4Q8WA 2PDGA 2CWXA 3HZ3A 2BY0A 1GSNA 4OWGA 4QM1A 4S38A 1MFVA 2DZPA 4GWEA 5EL1A 1FHUA 3CQJA 3PS7A 3DJJA 3ATYA 1MWOA 3LDVA 1QJWA 3BMWA 4EPBC 1BFNA 4KEUA 5A3HA 4JQ4A 5CPMA 1TPDA 3LI0A 3VK5A 1P6BA 4C6OA 3H4KA 2J8FA 3CIWA 5HR7A 3VDAA 1XCFA 2P88A 1PHWA 1PKNA 4ATWA 3R94A 2CITA 4JN6A 3L2MA 2J9XA 4WHBA 2PC8A 2PFHA 4RE0A 1FFQA 2WHKA 5FS9A 1CXIA 3VNJA 3PZUA 5CAHA 3OZPA 2J6VA 4PCFA 2Y8KA 1J93A 1EGZA 5ABEA 6XIMA 3W2UA 3LPGA 1MEIA 2ZZ6A 4MG4A 1H7WA 2VZOA 4W7UA 4WEVX 3TC7A 4B3ZA 1X7IA 5F2MA 3QXBA 3H24A 3WD0A 5F2GA 5FJJA 1JYWA 3EKLA 2W91A 4EOUA 3MKCA 1NEYA 3R13A 2PSNA 4G1KA 2D3LA 1H09A 1CYGA 1J0YA 3MS8A 5F7UA 1GRTA 2V67A 1JL8A 5ECVA 1TMQA 4QNWA 2AOSA 1VKFA 3HTWA 2YDRA 5DMNA 5FJTA 2GGGA 3LCGA 4US6A 5BXPA 3WLTA 5C2XA 1CLVA 2VP8A 3L0GA 4AZIA 2CLLA 3W86A 2PDIA 3TW9A 3MHFA 1Q2RA 3N29A 2YPIA 2VVSA 3UZXA 4HN8A 3TSBA 2FHCA 2VT0A 1H0IA 5EFDA 2WNWA 3ZSSA 1N5WC 3CC1A 1KXTA 4GI6A 2WMFA 3WLMA 2E09A 1MDRA 1B57A 3NXFA 2CZDA 5HBFA 3ALGA 1XIHA 2XVGA 3TTQA 5A2BA 2OWXA 3CGEA 4HOZA 3DFPA 3QC3A 1Z42A 4YTQA 3WUGA 5ECUA 4E0CA 2E1DA 4H7ZA 1XLCA 3B9EA 4AF0B 4BKNA 4CCZA 1V93A 4DJFA 3RLUA 3GWQA 1NARA 5D30A 1R38A 2QCNA 1HL2A 2FZBA 3A4XA 1DBTA 3LERA 5ABTA 3HFTA 1OFOA 3TTSA 2A85A 2R1LA 1TWDA 3AIUA 3CBWA 3LZ5A 4M7SA 3SDOA 1FDZA 1SU5A 4TTGA 4XWUA 3CS2A 1BWKA 3NOYA 4CU8A 1WP6A 3CPUA 5A6KA 1EP2A 4E6MA 4D8LA 4D8ZA 4MB4A 1JF6A 3GH4A 3PHAA 4R85A 4GD0A 2A3HA 2NQJA 1F73A 2ZQ0A 4HQVA 1H7XA 4PGLA 2W55A 1BQCA 3M0ZA 4O57A 1T5AA 4KETA 3PSWA 1TCDA 4E8CA 3G3MA 5C6MA 2XG9A 1WQ5A 1B5TA 2X8HA 1JI1A 3TWAA 3A5VA 3W2NA 1W5QA 1AQMA 4CD5A 4B5VA 4EWJA 5CPNA 4NILA 1JUKA 1BRLB 3BSGA 1L2QA 4IMEA 2YVFA 2A7NA 4M29A 1ZY9A 3MI3A 3N3TA 3UERA 3MP4A 4AY1A 4IOTA 3W6MA 4DZ5A 5H8PA 1XSKA 3NQMA 4FLQA 5HJLA 3RRXA 3VD3A 2VFHA 2VMFA 4ATDA 4XBSA 4XSMA 1YEYA 2YBTA 4W85A 3MBDA 1YQ2A 3IAQA 1NVMA 1CI1A 5AC8A 3AIEA 4DWSD 1PUDA 3PZNA 1BKHA 3UXIA 3JU2A 1ZENA 2VX7A 2XIQA 2HPMA 1POJA 1QNSA 4L6HA 5HMSA 3L68A 4XD4A 2Z00A 5CGQA 4C6NA 3MUAA 4PMJA 4IQDA 1XGZA 3BV7A 1T99A 3W73A 2FPTA 5E5CA 5EMLA 1SFTA 2UY2A 2BGNE 1M41A 3KRBA 5KSWA 1KCZA 2VQUA 4IPNB 1UR8A 3WD3A 3QW4B 1YDOA 4MNMA 4NNCA 2ISSA 2CWNA 4QP0A 1M7JA 2PZNA 4E2DA 5JCIA 4HYVA 3KCLA 2J7DA 2ALRA 4AHPA 3JZEA 1BSLA 3EX1A 4QAWA 1NWSA 3S47A 3S83A 1LQ2A 3OVRA 2IPJA 2PDWA 3LTYA 3RN6A 1H50A 1UASA 4KWOA 2OQHA 4F8XA 2H9AB 3L23A 5GVJA 5GQBA 1XI3A 5GNXA 1GW1A 3UNTA 1VFOA 1F3TA 2PODA 5U25A 3N3MA 4UTWC 2C1HA 1VEPA 3VCCA 3LCWA 1Q1WA 3PJXA 2DIJA 3WD1A 5KINA 4BY3A 3W1RA 1OY0A 4CCCA 1X39A 2IPWA 2XU2A 1Z7AA 1WX0A 2Z1VA 1ZPTA 5ABGA 1W1YA 3NR0A 2AL2B 4PCPA 4JTJA 3GG0A 3UG4A 4FLRA 2GWNA 5XIMA 2C91A 4X63A 1N61C 3MB9A 1TRIA 2HVNA 4UTFA 3DK9A 3KZSA 1QNOA 2ACSA 2YLAA 4LB4A 1Q7MA 2ISDA 3V0TA 4Q8OA 4XIAA 4JTKA 3ITXA 3ZVIA 1UMLA 3SB0A 3AICA 2GWGA 2ZE0A 5ENLA 5A8QA 3MBFA 4CLMA 1A5MC 2JALA 4N2YA 2GR2A 4DEFA 3VPLA 1OFRA 3TK7A 3GDBA 2ZZ5A 5FL1A 3UEQA 3SI9A 3L0KA 4Q8VA 3RJYA 1UZ4A 2HE8A 1V79A 3O05A 1FWRA 1JDCA 4K39A 1C93A 1XG3A 2C13A 4ACZB 5E9AA 3I6EA 2WMIB 1XLJA 1NJJA 4MMWA 1X2GA 1H60A 4OOZA 3THAA 3TUUA 4FX8A 2H3DA 4H1ZA 5DMMA 5E9XA 4JS3A 2FFCA 4YWIA 2QAPA 4C90A 4YTUA 5EMYA 1BKSA 4WSKA 4BV6A 1UOZA 3VOFA 4BEQA 1H7NA 3GSMA 4I3GA 4LC8A 3NNTA 3QR3A 3WDQA 3NIYA 5F2IA 4CN6A 3E9AA 2WVTA 4XISA 3VGHA 1ZQ5A 3STEA 1H2JA 4HJWA 5D2TA 2W3SA 2Y5JA 3ARPA 3PC0A 3TNOA 4DI8A 1JYVA 1QNQA 3QFEA 2Y88A 3QRHA 4A8LA 4WGXA 3G2GA 3GDLA 2H3BA 5E70A 5CPTA 1GVIA 1UWTA 1Q2SA 3CO4A 6ENLA 1R5YA 1LTDA 4DO5A 1RM6B 1Q6RA 2EJ1A 1ZBVA 3CO8A 3RPMA 1XUZA 5K7JA 4M6QA 4F0SA 2PRLA 4NI8A 2BY2A 4Q8UA 3T9PA 3PPCA 3TTEA 3H23A 3LB0A 2VGBA 3M0KA 3QF0A 4O1EA 1B3VA 3PAJA 4ADWA 3AALA 5D9NA 2OEJA 3W7DA 4IP7A 1W8GA 1T41A 4KS0A 3D6NA 2I5GA 3W3OA 5A2AA 2CZVA 4OOUA 3W72A 1P1MA 1PZ0A 4X0NA 5AHLA 1J0JA 3EDDA 3IJ8A 3QSRA 4EPDC 1GG0A 1LT8A 2D0GA 3GXDA 3I10A 5IRPA 1RV8A 1JEZA 2FGZA 3OW1A 4HOWA 1ONXA 4XX6A 2B0MA 4JDBA 2AQOA 5FOOA 1V0LA 1MUCA 4PTNA 1Q6FA 4HCLA 3MKKA 3CUIA 3RDKA 3LRMA 1FHVA 1VS1A 1Z6KA 4P5UA 5D8WA 5CSYA 4L64A 2EBNA 4A3QA 1XANA 2Y6ZA 5CJMA 1TV2A 3NL2A 1UKSA 1K02A 1YE6A 4GGBA 3SSJA 2D73A 3I7SA 4BQ4A 1DWAM 2DJXA 3PANA 2FH8A 5H91A 2F61A 3K8MA 4FAMA 1UPPA 2XN1A 4AWTA 3T6CA 1EBGA 2WKGA 3GVVA 4H9VA 1MQPA 4KQNA 2XH7A 4RZ4A 1ISVA 4CU7A 1GYLA 2KZHA 4FALA 1JRPA 1V6UA 3NVZB 2RH9A 4LUIA 2BHUA 4DLFA 1GQJA 3TLQA 2PWHA 2HDJA 2HE5A 4XB3A 1RP9A 4M1RA 1GRGA 5MHBA 4NG3A 4Q8NA 1UB3A 1IE7C 3DENA 3GU1A 1NFPA 1DE5A 4HHPA 3TIMA 5C54A 3UJ2A 3TJLA 4ZO7A 4D71A 1TTQA 3H6OA 3V7PA 3OU8A 4U31A 4Y8FA 1N5XA 3AO0A 1QI5A 2NX1A 3FA4A 4G7EB 4DF2A 3AS0A 1XH1A 3QFBA 3EWBX 4S39A 3PB2A 2QCHA 2GYIA 1L8PA 2HMCA 1YNQA 1UBSA 3T81A 3K1DA 4AD3A 1FWIC 2JGQA 5DT7A 5BNKA 1V77A 3BLLA 1DJIA 2FZDA 3LOTA 2WAGA 2QDGA 1PIFA 1RSCA 3FV9A 2VZSA 4B9YA 3A3WA 4LVDA 3WK0A 1BTMA 5D2WA 2G5WA 4IIDA 3HG4A 3LPPA 2NSXA 1BSIA 1S2TA 1FHDA 4AX7A 1HP4A 3HGOA 3GYEA 1DXEA 3RX3A 3SADA 2FZMA 3W7HA 5K9XA 2FTPA 4YPJA 4PUJA 2ZDRA 3EKZA 1GOOA 1QATA 4DF1A 4EF9A 3QTGA 2CEQA 1EGVA 1ESWA 4S3GA 1T96A 4YVXA 3VIOA 2CFFA 3NEVA 3MDUA 1OD0A 3CYVA 3RU8X 1TE1A 5A8GA 2NVCA 1H41A 4KBXA 3AMDA 4GINA 4DXVA 4APNA 4IH3A 4YYCA 3R43A 3M7SA 5I0DA 1LOLA 3RR4A 1HKIA 1E70M 1DL3A 1DWHM 3HV8A 3LU2A 1MZHA 1VHNA 2Z28A 1N8IA 2JIEA 1RBOB 1ZJAA 3L5LA 4L4LA 4BQ2A 4YTSA 2B31A 4QJ5B 4Y9PA 3EWYA 4XZHA 2REQB 4JTFA 4C6EA 2Y8VA 5LYRA 4ACZA 3WFZA 2Z6IA 2WMIA 1YTDA 5G4HC 3USZA 4PTWA 2WPEA 3VCNA 1DXFA 3URHA 3EOLA 4NZ1A 5LXEA 2PCEA 1A80A 4GRTA 3LNMA 2XJ7A 1J12A 4JYFA 3STFA 3EUB3 3DZ1A 2WBKA 1TZ9A 3CH9A 3TYAA 1W17A 3BAKA 1JPMA 3H7RA 3G18A 1KRMA 2DZBA 4WJ8A 3K46A 3RR1A 4NEWA 4OV4A 3FW6A 2EQ6A 2IKIA 3I3EA 4NZ5A 4GH3A 3KBWA 6TAAA 1KFBA 3UVIA 1EIBA 2OSYA 2YFNA 2HROA 1TKKA 2AGKA 2PD5A 2HV5A 1U1UA 3EDFA 3UWQA 3KBJA 2PF0A 4FI4A 3GFXA 4ZBCA 3AIRA 1VBGA 3GKAA 1Z69A 1JDDA 4J40A 3TSDA 1OF6A 5F2LA 3IUDA 1RK5A 4KFPA 3BOFA 3EDEA 4DBDA 3LXDA 3B8UA 1R0MA 4H6QA 1UOKA 1C29A 2NVDA 4HZMA 1NU5A 1O68A 5D02A 3BG3A 1CEOA 3OIXA 4TVYA 3ARSA 4MLJA 1JQXA 3TYUA 5HR6A 4UZUA 3TP4A 3UXAA 3MCMA 3SGZA 3C0LA 5KEZA 1X2HA 1J4EA 4MYXA 2CNCA 1L0PA 1G9HA 3B05A 3TFXA 2VGFA 3UYIA 2W5FA 4O19A 1KBIA 4FR1A 2Z1SA 4C6PA 4LF1A 3NQFA 5BU9A 3KDOA 1OT2A 5TF0A 4UNKA 1A4LA 4Q22A 1EQPA 2J7HA 3EWXA 1H7RA 1WDRA 3K1GA 2PU1A 3NGFA 4GBDA 3II4A 3QGKC 4LWWA 1QK2A 3S9ZA 1B0IA 4PYSA 2CBUA 4H2HA 5D03A 2PDPA 4K68A 2ZA3A 4EF8A 2YVGA 4DAIA 2F9RA 5I2UA 2Z25A 4YVVA 2IUZA 3EEZA 3TYBA 1Y65A 4UQEA 2ZIDA 4O16A 3NZPA 2FYMA 2WYSA 1U22A 4KIRA 4HSNA 1XP3A 1CPUA 4ML9A 3WLPA 4IMFA 3AMCA 3LHUA 4NAEB 4ZB0A 5I23A 1E1FA 3EX3A 4DJEC 3NVVB 3BG5A 4H8HA 1QPQA 1YHTA 4XZBA 3MSRA 4PTMA 3NGJA 2AQVA 2OO6A 3BICA 2CFYA 1J9YA 4N6EA 3N11A 3Q6JA 2PB1A 3WLNA 4JX5A 2PLCA 4ERAA 1KTBA 4IX2A 4EMJA 3E3HA 3F5JA 3IGSA 5I06A 2OQLA 1AQHA 1I9CB 2J8TA 4Q32A 4YNGA 1MMFA 4PUMA 1GK8A 2FLIA 1L6FA 4WZHA 4EPEC 2O4QA 4LYPA 4H4QA 4G2DA 2NLIA 2QPSA 3LXBA 1FP9A 2R9RA 3LCIA 4I6KA 2ZRYA 1RBLA 1N2VA 2GQWA 2XN0A 1R30A 4HU4A 1ZNNA 4HYRA 4FNUA 4G7EA 5DXXA 3BZGA 2ISFA 3VNKA 1CTNA 3SIZA 4GJJA 3ZR5A 4UFJA 4B2DA 2GK1B 3EOOA 2OEKA 4OU1A 3T0DA 4Q8MA 3FCPA 2OZ3A 1G6CA 1VJZA 4J3SA 4WDWA 3W81A 2W61A 1WOBA 3PBMA 3TYZA 1ALDA 2X41A 4Q4KA 1VFLA 3LNPA 4M52A 3CHDA 3PTKA 1EC8A 1I2RA 4AB4A 4NZCA 4N02A 3VC6A 4GZJA 4EQXA 1DIEA 3WLRA 1KO0A 1ZJBA 3QBUA 5K4ZA 2HQAA 1W5MA 4MY8A 1LVLA 3BMXA 3WG6A 1XS2A 2X40A 4AWUA 2ZZ7A 1AW2A 1S5NA 4MM1A 4O11A 3GRIA 5CH9A 1XISA 3SM0A 3EWWA 4GXWA 2Q8ZA 1K7EA 4N4QA 3MI2A 2CLIA 2PDKA 2QPUA 3WQGA 1VGAA 1LROA 2QJIA 1FWDC 3A6OA 2ZTJA 5E0FA 1I1WA 4JIPA 1ECQA 3CZEA 4QRNA 1TPUA 4RV8A 3G0SA 4GQRA 4MTVA 3W7LA 2OCZA 8RUCA 2QLYA 4NJHA 2REQA 3B8TA 3VD5A 2WKJA 4DWDA 3LCXA 1WKEA 3I7QA 4RXFA 2RHGA 3KWXA 3WLQA 4PMZA 2IS7A 3KFTA 3ZS4A 3L12A 4TQTA 4DBSA 3AMKA 3FEQA 3NURA 3H53A 1DQXA 4A8NA 8XIAA 1X1ZA 5CSUA 1VFMA 4FX9A 1LL6A 1KFJA 4GK8A 4AIOA 5BXSA 1MOKA 4PTXA 4WIWA 1K8XA 1W3HA 3DC0A 4PRWA 4A3RA 4CN1A 1TELA 1QO5A 2OSWA 2WSYA 1GCYA 3URBA 2RABA 2FFIA 4AIBA 2V5CA 3AJ7A 3PUGA 1CB2A 1J6PA 3IV8A 3A5FA 4J3XA 5F4SA 1VBRA 2HVOA 3DFYA 3UA3A 2X1TA 2NV1A 2ZC1A 3TN6A 6XIAA 4HBKA 1TPWA 4W7WA 1XRVA 2VCCA 1PAMA 5RUBA 1F3XA 4UR9A 1POKA 4HB7A 1RY8A 3EA2A 3G24A 1HVQA 3NL3A 3W1QA 1W3NA 3V18A 5HNNA 1PSCA 3HIJA 1UP3A 1X8FA 3SQLA 1BGAA 5HULA 4B4FA 3PZMA 3PZVA 4BI7A 3VKCA 3VYLA 4GIEA 4FXSA 5EB8A 1LLOA 3EYPA 3A24A 2Q71A 1UW9A 2ZKMX 4I9JA 2XZ9A 4O28A 3UGVA 1Q6GA 1XDJA 5DELA 3KHJA 3VTRA 1HJXA 3WO8A 5I3DA 4IWWA 4HCHA 3W29A 3OLDA 4ERGA 3WJSA 4AZHA 3MUIA 4PE8A 4JX4A 1S5MA 3IRDA 4AY7A 3CHEA 4Y90A 5C9RA 3RIKA 1UUMA 3DYOA 1PS9A 2P8CA 2CLPA 3QN3A 5XIAA 4NT0A 1M5WA 1FH9A 1PTAA 2O55A 3MSGA 3O8AA 1P0KA 1IEQA 3MVIA 4KMQA 2V2CA 3GNNA 5BMWA 3QMTA 3MMUA 1CXFA 3FJ4A 1WZAA 1YXCA 4D72A 4C6KA 1H7PA 1M04A 2W9MA 5GJMA 2EPNA 4CGTA 3BVJA 4N42A 3QHMA 4KWUA 4HNCA 4A3YA 4H4WA 1X6NA 2TRSA 3M4HA 3GD3A 3QYSA 2VD8A 1V3JA 3W53A 1SMDA 5LHFA 1OYCA 4UFLA 3N14A 1GQLA 1LRQA 4J2MA 5DMYA 4Y9OA 3FXGA 1JROA 3R5EA 2NVKX 1NM9A 1PZ1A 5HXMA 3V5CA 3H4XA 3TX9A 1XH0A 4JTTA 1MW1A 3Q65A 2A79A 2WV8A 1W3IA 4H19A 1RVKA 4U33A 1W9DM 1IXPA 4LCRA 5D33A 4CQ8A 1X8CA 1FWEC 4S3DA 2C71A 4JBRA 2YA0A 4LGXA 4BQ3A 3QPYA 3GNDA 3A7RA 1AG1O 3UWUA 3RPTA 1IT8A 1S1PA 3DHFA 3W1AA 4UTWA 4PMXA 3JS3A 3LM3A 3R1ZA 3CK5A 5FI8A 5IBXC 3HRDC 1RQEA 3E49A 1FWJC 2X1SA 4B9ZA 3N2BA 1JCNA 1FOBA 4GABA 4W5ZA 1OIFA 3L9CA 4S3FA 2GSEA 1P6WA 1TMLA 8A3HA 4N0RA 3OZOA 3GU9A 2V69A 4C6IA 1HIZA 5BRQA 1ZP4A 2GK1A 4PRRA 1BPLB 2VRQA 2INZA 1JFXA 2OGYA 4HA0A 3LZ3A 2WHLA 2V2HA 3BZJA 1N82A 2D69A 1IWAA 1R87A 4LJ3A 4GMEA 1F8WA 2B81A 3D3FA 4BFAA 3EAOA 5C9XA 1CW2A 1GOKA 3SUVA 3RJXA 2DVTA 1A5OC 1Q5MA 3CL7A 5AOUA 5J5RA 1BZLA 4JFTA 5IM51 1P0DA 4IF2A 2H6RA 2PWEA 2X16A 1VLIA 1SW7A 4DQWA 4LUSB 3LX9A 3TQPA 2BBFA 3CV6A 1KRBC 4PB3A 1KFKA 3S0CA 3AS3A 5I3JA 4J28A 1D3GA 2GGJA 3OODA 4BZYA 3EB2A 3ARQA 1TSIA 3KAOA 4CVWA 4JTIA 1EP3A 1XV8A 3GYCA 1BF2A 1FWGC 3P7YA 1E0TA 5D37A 4UQDA 1Y0EA 4TXEA 3C4UA 2OR2A 1RCOB 3H26A 3MZ2A 3LI1A 1JZ3A 3BW3A 4W93A 3AM9A 1EXBA 1JCMP 1Y7VA 2V82A 1Q6CA 1QHOA 3ZIZA 4ZZ9A 2V3EA 2DU2A 1UC5A 1O5KA 1ECEA 4JHOA 4Z1DA 3BPWA 3IWPA 1CXEA 1KGWA 3K30A 3VMOA 4AU0A 1W3KA 3EPNA 3V16A 4WD0A 4ZE4A 1VEMA 1JZ2A 4GO9A 2PLMA 5EY5A 4B16A 3MV01 5C9UA 2DORA 3VX1A 4D6DA 2VI0A 3A47A 1O12A 3EXTA 2GR1A 4XAYA 3BARA 1GTHA 3FDGA 4HNUA 1CCWB 1Y5XA 3KBMA 1W56A 2J25A 4GY7A 3SCUA 1K4QA 3DYPA 4QG9A 4WOQA 3A3HA 3ARTA 3PBWA 1US0A 1YDYA 2Z1WA 3QW3A 1KLYA 3NDZA 3EX2A 5AZ1A 2V3GA 2OOFA 4UNIA 2J47A 1E0VA 3DECA 4MUPA 4IMDA 4AG0A 4IJCA 3DFQA 3W7QA 2D1ZA 3H7VA 5I7GA 4CD6A 2O4MA 2O7SA 4DM2A 2HK1A 1IV8A 4AD1A 3WL1A 1KR0A 2GVGA 3AISA 4IQLA 1A5UA 4ASTA 2DQXA 1EOKA 4PMOA 5K4XA 3MI6A 1UH2A 4YLWA 3TW6A 1WA3A 3P2VA 2IXVA 3QMRA 3ARXA 3SZ8A 1IT0A 4HZ6A 4L4MA 1OK4A 2P53A 4NX0A 4DXKA 4A22A 2GGIA 1XYLA 1CX9A 4K38A 3F5LA 4F3HA 1JEHA 1AMKA 1ISXA 1F9CA 1EUAA 5ER0A 1IEXA 4IIEA 1LWHA 2OZ8A 4HP5A 4U2ZA 3GDKA 3KL0A 1XIBA 4LB3A 3WLSA 4IT1A 2XH0A 2WW5A 1BG9A 1LUCA 3UT0A 4H01A 4B15A 1GJUA 1KQZA 3ARUA 5REQB 2DZSA 2YVJA 2A1YA 1TQJA 1O4UA 2VRJA 3IC9A 3G1HA 2B7OA 2C6QA 4GC3A 1LT7A 3DG6A 2INFA 5HNTA 1GVFA 3PM6A 3UWZA 1GPFA 2WPGA 3H55A 1D7YA 4EE9A 1Q7QA 4QDMA 1H63A 3PZOA 3CH0A 5DO8A 3M64A 4QQ3A 4ADSA 4X60A 4WJXA 1MYRA 1QI4A 2C0HA 4C7DA 2QUVA 3AZSA 3TNBA 1VYPX 4NIRA 5M3WA 1K7FA 2V9DA 3EB4A 1W5PA 1B90A 4POCA 4PMUA 4RPQA 1K6WA 4YS1A 4GCAA 5FSDC 2GJLA 3KLLA 4X9SA 4GI9A 3R8HA 2CLOA 1HX0A 3TYCA 4YTRA 1CXKA 4JTEA 4JX6A 3N2TA 1R8LA 4GKLA 1BYBA 5EPDA 2X7WA 4HK6A 3INPA 2B4GA 3T2PA 4W86A 2KX9A 3R7MA 3NZQA 2QUTA 4QROA 3W7EA 2ZUVA 1GGOA 5FS6A 4OVXA 1WBJA 2GFTA 6CGTA 1V02E 4Z0JA 2ZTKA 5K2ZA 2XM2A 3S6DA 3MJMA 3R79A 4I7WA 1E4MM 1GG1A 2ZUSA 1VCVA 2JF7A 2XVNA 1UUOA 3T8LA 1KTCA 4UXDA 2ZX7A 4RZBA 3GXMA 1RY0A 5TIMA 5C7VA 2PRHA 4IPLA 1UZDA 3NWRA 2YYTA 3S46A 4FNRA 4U28A 1CDGA 1A49A 4WDTA 2XWDA 2DY3A 3QHNA 1NDYA 3CGDA 1HKVA 3OA3A 4Y7EA 4L7ZA 2RDWA 2WK2A 4WGHA 3S2CA 3AHVA 2Q02A 4Q7BA 3S5ZA 4X3ZA 4NI3A 2UZ9A 4EIVA 1GQNA 3D46A 4MPKA 5LIYX 3I65A 3VABA 2R8WA 1RH9A 4LUSA 4N6FA 2V3BA 2HEJA 1YLVA 1XLBA 3WQFA 1UD5A 1FWWA 1FH7A 2DZXA 2GZXA 1N8FA 5HQEA 3C3NA 1G0CA 4Y2WA 4AIUA 2VWSA 4PL2A 1QAPA 4L1GA 1N55A 4AH7A 4HVXA 4US5A 1HKKA 5LSMA 1N60C 1V7AA 4EQRA 3F2CA 1XDLA 1GYMA 3KRZA 4K2SA 1ZU8A 5GPRA 2YYUA 3P62A 4I8DA 4J3VA 3WD4A 3ABSA 4QX4A 4NAFB 3BWWA 3TCSA 1QHPA 4PUNA 3RLHA 4MJMA 3VOIA 3BQ6A 3CHCA 1CECA 3PNUA 3W2LA 4R7JA 5HWMA 3H7UA 2C79A 4QCFA 5J8LA 1VFTA 2JFEX 2VZUA 5DLCA 4OUEA 1BLIA 2DDXA 5A6BD 3GO2A 1R3TA 3MDWA 1O66A 1ZY8A 4G1NA 4YIWA 3W7PA 3QY6A 2E5BA 2JQXA 5BU6A 5I09A 3B0VC 4WDXA 4J35A 4Q4MA 3Q45A 3OGRA 1PE1A 3B9AA 1QWGA 5BROA 1NIUA 2E3TA 3W1NA 3L66A 3VDBA 1E6ZA 2W62A 3B3DA 4F9DA 9RUBA 3ES7A 1PWLA 4H6KA 3R07C 2VXNA 3G5EA 3ISIX 3ITTA 3W7CA 1PV8A 3NQBA 3W1LA 6REQA 1PPIA 3OC4A 2BSLA 1NF0A 3SBFA 1QT1A 1V3KA 4H41A 4H7VA 4PSRA 2HJPA 2YL8A 4AUBA 3XINA 3DUGA 1QI2A 3CTTA 1Q4NX 4Q8QA 2EAWA 3S5OA 3A13A 1XLFA 3B8VA 4JCMA 3W00A 2RJGA 1PKYA 2PDYA 2GOUA 2R91A 3BQ5A 2VTFA 1PHQA 3UQNA 1UR1A 2FVKA 3FIGA 1BTCA 2VC5A 4JXCA 3GBDA 1U30A 3VGDA 2OZ0A 1XR2A 2WJEA 1MQRA 3STGA 2E0PA 3MO7A 3E38A 3TH6A 1W9PA 1P0NA 3AXXA 4ES4A 2Q8XA 4K8EA 1V6TA 3LTSA 2JBMA 3PBYA 1TO3A 1V0MA 3P60A 3DG7A 3CL8A 4GUIA 3WBYA 3S5NA 1ZZMA 2CLMA 1SO3A 4MWAE 2J62A 4JICA 2WXDM 3GB6A 1ITQA 1BWCA 1PJ9A 5REQA 1IWBA 1PYFA 2X30A 2RDUA 4Q4QA 1BWLA 3CEPA 1M01A 5C9WA 1WUEA 4TR9A 3TC3A 1SMAA 4NJIA 3OLGA 4FP1A 5FJIA 4GHRA 3GM8A 4CNTA 2V81A 3HB9A 5AC5A 3F1QA 2VGIA 3TLLA 1XDIA 3TMQA 3GDMA 1ICPA 3VM5A 5HANA 3K13A 3SCQA 3S9IA 3H2FA 1PIGA 5I07A 2P5NA 1TVPA 2VELA 4Q4SA 1JUBA 1Z48A 2BHYA 1XLIA 2WBAA 4XD3A 4H4ZA 3T05A 1O6IA 1AD4A 1JVNA 2XFRA 3GG1A 4LU0A 3RM9A 1ZBCA 3M1ZA 2WO5A 4DUOA 4Z1AA 3KS6A 4LF2A 2VM8A 4ICNA 4M19A 4W88A 4Z2LA 1PVNA 3NQEA 1OX5A 4MKNA 4MY9A 4DJDD 1FIQB 2DZWA 1KWGA 4JPGA 1UIOA 1YX1A 2VFFA 4AY8A 1K8YA 4AQLA 4HMNA 3URAA 2F2KA 1E6QM 5DFAA 4K36A 4GNVA 1ADSA 1KWKA 1HL8A 2PCQA 1XINA 2RKXA 3P5YA 3PP7A 4WF7A 1K9DA 4LS1A 4C7GA 4LS0A 1NHQA 1XIJA 1CGXA 3AHZA 2G3IA 2BVDA 4F0HA 1SW3A 3QGAC 3RPDA 4GCXA 3PR2A 3WMSA 1I8JA 4O1FA 1JRCA 1TUFA 5BYWA 1WDPA 1THFD 4JNMA 1C8QA 4OIFA 2XSBA 4A35A 3VAVA 3G1RA 3BJSA 4GR1A 3GR8A 1E4IA 4TOQA 3E96A 5I3IA 4I9AA 4H9MA 1W3JA 4JZ5A 1SGJA 1V3LA 1MZRA 1YRRA 2GJXB 2QUMA 1C3FA 3B4UA 7ENLA 2J9ZA 4QTGA 2A3CA 1UWQA 2Y4SA 2PZ0A 4F66A 3TQKA 2WCAA 3FHAA 3BSHA 3GD6A 4JTSA 1OG6A 4AW7A 4CD4A 2QAFA 1XLMA 3K4AA 2WQDA 1YE4A 4AVFA 1FCQA 4JN8A 4JTAA 1FFVC 1QNRA 3T07A 3THQA 3ABZA 5I77A 2XVPA 1WZKA 1JAEA 3BG9A 1CGUA 3WUEA 2I5IA 4M80A 1EC7A 3BL3A 2ZFAA 4U3CA 4OECA 4JIQA 4LV4A 1TPC1 1QOQA 3F2DA 4O13A 4CQ9A 2FPYA 1SR0A 4IPJA 1E9YB 2GR3A 1HJSA 1ODUA 4NJKA 3RLVA 2O9PA 1JI2A 2WZEA 2FZ8A 2QQ6A 2PP1A 3M0VA 1RCQA 1AA1B 1CIUA 2QCFA 2WOVA 3UGRA 4N9BA 4E5TA 3S2LA 1GORA 1U5JA 3RMEA 1ZUAX 1WKDA 3N17A 3TKFA 3HG5A 1C92A 1OCJA 4NAFA 1O95A 4P7NA 2OELA 5FD0A 2ZX8A 3CXBA 4R7OA 4XAZA 3NL6A 5FSEC 3N2MA 2J9YA 4IFKA 4N9CA 1L9WA 3W85A 2WM0A 4TUFA 2ACRA 2VURA 3O0HA 3FAWA 3S2JA 2YW4A 4GZ7A 1OGBA 3SUUA 1W54A 2OOGA 2QV4A 4QQUA 2XSXA 3UZJA 3RAOA 1R47A 2DPEA 4RW5A 4DELA 1JXJA 2GGHA 2VRKA 4FF7A 1RPXA 1VCFA 4RNJA 5EGRA 3CU2A 3N25A 3TR9A 3OLIA 1PXGA 1W1ZA 1A3WA 2ON3A 3OPSA 3WEZA 3IJ9A 1HFBA 4C6BA 4INFA 3AI0A 4LVGA 2XGBA 3SRDA 1NF7A 3RX2A 1ZBWA 2RFGA 4QCEA 2VFEA 4DX3A 3SGGA 1ENUA 2D23A 3GR7A 3T2OA 5FEPA 3G77A 4D6FA 4FSAA 1H61A 3ES8A 1EOMA 1PWMA 4XO6A 3T1GA 5CC5A 1RQBA 3EA3A 1S2UA 2IXUA 1HN1A 3HPZA 4FIQA 3SO7A 5JIPA 1GVQA 1A3HA 3IGXA 1XIDA 4Z2HA 3SR7A 1FKWA 1FQ0A 4PODA 5JCMA 1TJ0A 4R53A 3KBSA 3TFCA 1AZ1A 1R9ZA 4FOKA 2YIHA 3OBKA 2OJPA 3APTA 4ZB2A 2ZADA 3EDJA 4WXZA 3HPXA 2PP0A 4E8GA 2ABBA 4FXJA 5A8PA 4TV6A 4H2CA 4GE8A 3ORWA 2WVVB 5CAKA 1EQCA 2BODX 3KBNA 3AXIA 3DI1A 1WV2A 3CZGA 3W1XA 4WKFA 3W1PA 2YB1A 1XLGA 1XHGA 2G3MA 4E4UA 3FLUA 1FXPA 3L4TA 4J4KA 1R2TA 3ZR6A 1GWJA 3S42A 1C7SA 1XRTA 5DQPA 4JHMA 3CUFA 4CEXC 2YCEA 2Y61A 5A8OA 2QUUA 3II1A 1R85A 4LIIA 3WUFA 2CHOA 4FNPA 3FXYA 5CQ1A 4JKKA 3UR8A 2PGRA 2YJQA 4GPNA 1R3YA 2FZNA 2DZAA 3CUXA 1Z32X 3VMPA 3P6LA 1FBAA 3KX6A 4RJEA 1K9FA 4GO8A 1J6OA 2RJHA 3QJAA 1B9BA 4FIRA 2NPXA 3CIVA 1MI3A 2EPOA 3D0CA 2HPIA 1MQQA 4GYKA 2OYKA 3AC0A 3PVFA 4ROQA 1KKRA 4GY0A 1OZMA 4TV5A 4HNLA 1XLKA 4ROPA 7PTDA 3FJLA 2QGHA 3I6RA 2GR0A 1Q8JA 1W1B1 1FWNA 1XD1A 1BXBA 3BUVA 5FL0A 1XBVA 2HVMA 1BWVA 1J2BA 5EMUA 1CGWA 4Q4OA 5IHSA 2BNJA 4PUEA 1E73M 4JFVA 5JQ9A 3B40A 4ICCX 1E6NA 1NWUA 1FWCC 1FH8A 4UQ9A 1TTPA 3KUMA 1Z3NA 4RUBA 4MIMA 1GOXA 2WLZA 2YL9A 2W63A 3B8SA 3QKEA 1LQAA 3SUWA 1KFWA 2P76A 4JAWA 4E4FA 3H21A 1YYAA 1TWSA 3RYSA 3BLDA 4UTTA 1CB7B 5HMEA 3N4AA 1SPQA 4DWSB 2PDUA 3LK6A 5D09A 3MCNA 2GJXA 1HQTA 5D9OA 4QGCA 2C16A 2YCLB 2POZA 2QCEA 4MKVA 5IFPA 3PJWA 3WLJA 3P0WA 4IL0A 2QGYA 3ABQA 4FXRA 2A3AA 3OYXA 2VDIA 3UY8A 2H90A 4MADA 2V5BA 3BURA 5LIKX 2F6UA 3GVQA 1MXDA 4MFEA 3W83A 1XYZA 3MMWA 5JH1A 4PMQA 3BANA 4H6RA 1E1EA 3UF9A 2YBUA 3M5ZA 4IL2A 1TPEA 3DN5A 2YL5A 1UWSA 1XFBA 1DQUA 3CZJA 4ZTXA 4H9XA 2VEMA 1XPGA 3M0JA 3BJFA 3NYDA 3K8KA 4F40A 4AMAA 3GC5A 3OIHA 3QV8A 3PWAA 3N15A 3E0LA 4DB7A 4HA3A 5MKGA 3H2MA 1LWIA 1G1YA 3IVUA 4L4PA 3KVJA 2LLEA 2C14A 2R82A 4R9XA 3V0SA 3FKRA 1EH9A 1DWJM 3FVDA 1UP0A 2DSWA 3VD4A 4YJ5A 1LJYA 1QMLA 2WCGA 1ZSXA 3VI2A 1NP2A 2YXXA 1NAL1 3NPWA 3N9RA 1D7FA 3RCMA 1VJSA 2OT0A 3E2VA 2J78A 3AYSA 3KOWA 2BXVA 1QPNA 4HMCA 4U4MA 1F8MA 3QFAA 1ADDA 2DZUA 3PJTA 1C7TA 3LHYA 2NX3A 3LV6A 4NX5A 5FACA 4KWVA 3VIFA 3GX9A 3H2OA 4O14A 5M5DA 5XINA 4H9TA 4GI8A 1AJZA 1AVAA 3UJFA 4NRRA 1UKOA 2YQUA 3SGUA 1OCBA 1QDSA 2NSOA 1KM3A 3D5HA 2XFFA 1R9YA 2DSZA 2XFYA 3PFMA 4UB9A 1E4LA 5I5RA 4K1GA 4EMWA 1XYFA 5JCKA 7TAAA 4FNQA 4KPRA 4MB5A 1M03A 3O2LA 4Y96A 1W2VA 3NZRA 1X1NA 4O0ZA 2XGZA 4TMCA 1Q4WA 1F05A 5HQLA 5J04A 3WBWA 3O15A 2ZICA 4LAZA 3N13A 3U5YA 3CXOA 1SSGA 1EEXA 2Y5SA 2Z24A 3U7BA 1RA0A 1F6KA 2V5LA 3WK3A 3PTQA 2TSYA 3Q94A 2IMRA 3W02A 1OSEA 2J74A 5BRPA 4Q33A 3LRKA 4ILSA 3WBXA 1J8VA 3W76A 5KMYA 1RLDA 5G2WA 3NM3A 3WMBA 3UPWA 2EXOA 1EFZA 3PAOA 2XGIA 3R89A 2Y8UA 4N7QA 3E74A 4O52A 3BC9A 4QITA 5ABHA 3KTCA 1ME9A 2WVVA 1TYPA 5BOOA 1B1YA 3KDNA 4IPIA 3WIJA 3E5PA 1VDVA 3CQHA 3AHTA 2X2GA 2FDSA 4C60A 1XQKA 3R58A 3UD6A 1EPXA 1TA3B 3IK2A 4XQ6A 3AMZA 3M0YA 1GVSA 3VIJA 1GHRA 3APGA 1J0ZA 2PDHA 4FNTA 4V1YA 5C0QA 3WYZA 1HJVA 5M03A 1OBAA 1EF3A 2IPFA 2Z7GA 3QC0A 1QBAA 1XLHA 3TOPA 1MEHA 4DPQA 3S1WA 1XGEA 3GNPA 4XD5A 4WSHA 1XFCA 3HPAA 1EDTA 1DV7A 5HNRA 1RHCA 3M5XA 2CU0A 2E68A 1E6XM 4URIA 3SRKA 3ANUA 1LLZA 3UCQA 1XYMA 3ELFA 3NQ8A 3M9YA 4G56A 2XH4A 2W6RA 5PTDA 4CNUA 1VQZA 2RGLA 3W7RA 4ZOAA 3S2NA 4LVFA 4AEFA 1YDVA 1NELA 5CC3A 5CLTA 2QHAA 2YGYA 4OGZA 1JCJA 3GAKA 1OX6A 3CV7A 3EMQA 1EPVA 3B4YA 3UJRA 3CQ0A 3P5ZA 1ZHAA 4NQ1A 2BWGA 1DWGM 4CD7A 2EQ8A 4K7VA 3QQWA 5I24A 1E5JA 5FJOA 4EXQA 4TX6A 2HXTA 2A7PA 1DTNA 3REQB 1SO6A 4FK9A 1ELSA 3S8HA 2DT2A 3DHDA 2QZRA 3R11A 3N34A 1JG9A 3VCRA 4UUIA 5G5IA 1XHCA 5JH2A 4DWSA 2DUXA 2VHLA 3LBCA 1RZMA 1VP5A 5D04C 4JKLA 2YCLA 2CXEA 3TAOA 3GVRA 4LW7A 3AUOA 2ISWA 3SQMA 2QCDB 1L6SA 5KZDA 3GR4A 2O9RA 2PTXA 3NJ3A 1MNSA 3WF2A 1LF1A 4KKXA 4NY2A 3U4FA 3ANVA 1I2NA 1SZFA 1F07A 3RMJA 3BGJA 2WVUA 4C7FA 1X98A 4BURA 5EMJA 1TR1A 4GYPA 2HWGA 2Z0IA 3NFUA 1PEZA 3AAMA 2BASA 5T26A 3GS6A 3EWDA 5T8GA 4GIAA 1IT7A 2DW6A 3G8RA 3QY8A 4CNOA 1VD6A 5LKYA 4W4QA 3U3HA 2RDXA 3DU0A 3OBAA 3WN6A 1F2JA 3MHGA 4GJ1A 3L7RA 4HHLA 4NHVA 1TUXA 2W0UA 1M65A 2A3LA 4E2OA 3L4ZA 2PGEA 4D6CA 4R34A 1H51A 2E8YA 2O92A 2WNZA 1FCUA 4D6IA 2VWTA 4H9YA 1LBFA 3OO2A 4DO6A 4QG6A 5CSRA 1ZJHA 3B04A 1V02A 1QFEA 2XHYA 4UTIA 3S1VA 1OG0A 4Q4PA 2YDSA 4J56A 2NUXA 1ODZA 3SUSA 2FKPA 3N73A 5C70A 4O1CA 4QR6A 1H49A 1HO4A 1W3TA 1IZKA 4K3ZA 1VFHA 1ICQA 3U2ZA 1SJAA 2CBVA 5AYXA 1V3IA 1US3A 1JZ6A 4DNMA 3FA3A 2PDNA 1K77A 3A4AA 1BYAA 3BLOA 3WFLA 1TYTA 1WBHA 1XYBA 3A7AA 1REQB 1Q13A 3B0XA 2GUBA 2J7EA 1MSSA 4QJ3B 1M1BA 2WC4A 4GBUA 5A5WA 4TTUA 3VUSA 2DV0A 1OX4B 1AH0A 5TR3A 4GUGA 4IZGA 3KL5A 3AYRA 3OGVA 2MUCA 3I6TA 1GPWA 4KFNA 4LH8A 2TYSA 4UTKA 2XDFA 2F5ZA 4KW2A 3BOXA 2X1RA 1XJBA 4N9EA 1QR7A 3GKFA 1OWQA 1B31A 3W87A 1WB0A 4JIEA 4WRHA 4H9ZA 1DJZA 1SZGA 3V36A 2VVNA 4FOJA 1O5QA 5EBKA 4WY0F 2G37A 4ENLA 1R3SA 4MSSA 5IDIA 4GFIA 4PBEA 3G1FA 5CEWA 1F74A 2W66A 3HN3A 2JEQA 2UY3A 4IX0A 1BXNA 1QHZA 3CV2A 1XBYA 5F1UA 1OJTA 4DI9A 1FFRA 3GBEA 5E6ZA 3VKDA 4K7ZA 4QG8A 2MNRA 3W26A 3GH7A 1W1PA 1SJDA 4Z1CA 4IM4A 2G3NA 1GKPA 1OYAA 1IXNA 2VL4A 1WE5A 4JL1A 4JCLA 3IUHA 3WH8A 3NQAA 1OZQA 1A3XA 1TA3A 3U0HA 3B0UX 4NVTA 3PBVA 1NOUA 1RQHA 1GEQA 4FHAA 4AX6A 5FF0A 1GZGA 4MDOA 4DBWA 3E0WA 2Y7DA 4NZJA 1EF2A 1XLAA 2W0HA 3NS1B 4ZODA 3LV5A 1ME8A 4M6VA 5KVIA 4M6PA 4KWSA 3NRZB 1QWKA 4IMCA 4W84A 1XLDA 3GNRA 1FEAA 1J11A 3B97A 4HSOA 1UQZA 1XC6A 4H7CA 1WYGA 1DPMA 5JUVA 3L5AA 4ZR8A 1TR9A 2BOEX 1TX0A 1S2VA 2Z1XA 1LRNA 2OG9A 1NFBA 1MO9A 3RK8A 4Q6XA 3VNYA 1JCLA 2F7FA 3RILA 3WDHA 3WF4A 5H8UA 5JVLA 3NZ1A 1G4PA 2XTKA 2BV9A 3WF1A 1U33A 2X0YA 1TIMA 2PDBA 2A7RA 1ONWA 1C8VA 3NQCA 1Z9AA 1AZ2A 1NDZA 4RCXA 4F9JA 3N6JA 2PWDA 3PK7A 1E4NA 5FF3A 4YL2A 2DUZA 4EXBA 3REQA 3TR2A 1UKQA 3N19B 3BLKA 3MTWA 3MMDA 1VFSA 4RKAA 3OHIA 3NG3A 2CC0A 4G5DA 1V4YA 3UG5A 4TX8A 2Q3OA 2Q3RA 4ZCWA 1OIMA 2PDLA 3MUXA 4KF1A 5JU6A 1YNPA 4M81A 3DG3A 4DAFA 5G1TA 4RW3A 3VMNA 4W9TA 2GQAA 2MANA 4O50A 1V8EA 3MPGA 4Q8TA 3OQ8A 4XAPA 2YL6A 1H1ZA 2QCDA 4BF7A 3C61A 2F84A 4P7RA 3TWBA 5A6SA 6ALDA 2FTWA 4S2CA 1J0HA 3ZWTA 3T09A 1GJWA 5HPOA 3MY9A 3TROA 3L5OA 4MJ4A 3GTNA 3ICJA 3DFOA 4J3TA 2RDTA 3EX4A 2VEPA 3CMGA 3LGDA 4EANA 4Q7NA 4H50A 3PY2A 2ZWYA 5C2GA 4JD4A 3UPBA 4KT2A 1KC7A 2NQZA 2ONEA 3NO5A 2UV8G 4PUKA 1LLWA 3C8NA 3P82A 5FEXA 2WOIA 3GG8A 3GUGA 1EBDA 5DXYA 5DY3A 3A12A 3OVGA 5A2CA 1W6TA 3WEOA 4L4OA 3WJZA 1EJUC 3S2MA 3TCEA 4PUDA 1E40A 4S23A 5DEZA 4O0KA 1JZ8A 5KETA 3HFYA 3UR5A 3K2GA 5CJNA 1OJXA 5LNSA 1DWIM 4DLMA 1I6NA 2KAUC 1H5VA 3EOSA 5AHFA 1OQFA 4RDYA 1R7OA 1KBLA 2VEIA 1CLKA 1GQIA 3W75A 1KB3A 2Y7EA 1DHKA 1FVPA 2GGEA 3FS2A 1XH2A 3NDYA 3VOCA 4ZEPA 3HQOA 3TMLA 3VOHA 1XKJA 1IR1A 3FGCA 3DK8A 2V3FA 2J7GA 4W89A 1EP1A 1REQA 1RAKA 3RO6A 1KFCA 5CPOA 3K4WA 1HUVA 4XSLA 1I2PA 1UIPA 3IJQA 3NQ6A 5DX7A 3G6LA 4GACA 1OX4A 1S5VA 5HDRA 1W0MA 3MT1A 1XYCA 3SR6B 3PFRA 3VGEA 3WKZA 3KOFA 2ODOA 3PJUA 3TTOA 4I7VA 1UWAA 2VOMA 1E43A 2WNNA 5TD4A 3BAJA 3MW7A 3VIIA 1F3WA 2GSHA 4JIIX 3MC5A 3GUWA 3C2OA 3LS9A 1OC7A 3EWCA 3DIPA 4NEVA 4EQSA 3CT2A 1D3HA 2Y62A 3QR1A 3CJPA 3VDGA 3K4DA 4AZ5A 5D8ZA 4ZL1A 3NVTA 3W37A 2Z29A 1Q65A 2PDXA 3TV8A 1AH3A 2ZBTA 3WBAA 4LBRA 2PGWA 2A3BA 3QV7A 2V38A 3R8GA 1VB9A 1Y8BA 3ZVHA 3EB3A 3AROA 4EACA 4AAJA 4V15A 4QISA 2D0FA 2BZNA 5DY2A 5CG0A 3P8JA 2BXYA 4ZOCA 3LA4A 4K8DA 2BG5A 4LV9A 1G7VA 4OT7A 5L6UA 1T8QA 3L8KA 1W1TA 4N4PA 3ZWSA 2EG7A 3G1VA 3UCCA 4FLOA 2NV2A 2NXIA 1A0DA 1IF2A 4DJED 4GNKB 1GERA 1D8CA 3TA9A 5EBUA 3DCPA 3WY1A 2YAUA 1F3EA 1PL9A 1EEPA 2NXHA 4J3WA 3DGRA 1JZ4A 3UBPC 2Y63A 3U4AA 1YTEA 1W37A 1T3QC 4HZ8A 3HGJA 2V6AA 4FO4A 4IIHA 2X8GA 3DX5A 4GQBA 2HCVA 3UR7A 4BI6A 1LWJA 3FNDA 3PN8A 4ZXLA 4RNIA 3GIQA 4DM1A 1CXHA 3PSVA 3QR0A 5TQLA 2XZ7A 2NT1A 4DYJA 1A5NC 1HKJA 2FGBA 4ZSTA 4RLIA 2I9UA 1D2KA 2GPTA 1HTIA 4MWAD 1B3ZA 3BLEA 5C7HA 4MDPA 1JF5A 5DBUA 4KCWA 9CGTA 3L2LA 3UWWA 2F6XA 3IJ6A 2G4FA 4W7VA 3R0UA 3VKKA 3NQDA 4DVOA 3C6CA 1KR1A 2R9ZA 2AKZA 1GVRA 2W3ZA 3NVDA 4JY9A 1ZBKA 4B3LA 2FB3A 2C19A 2QJHA 1K8ZA 1PKMA 2XISA 3U6WA 1G4TA 3UR2A 1C8XA 1F61A 2AAAA 3FSTA 1XPYA 1LBMA 4R27A 4LBUA 4NYYA 4YWOA 1BGGA 3QQ0A 2YR1A 3CUHA 1DIKA 1ME7A 1EO7A 4L61A 4RDWA 4FF5A 1TPH1 3W6YA 3C0JA 3TXZA 2BDQA 1YQZA 5D4YA 1PYMA 1SYTA 3LENA 2R94A 3SY8A 1TREA 3O06A 2IW0A 3R25A 4Z1BA 2VC9A 2WZTA 1FDYA 3T4CA 4IIBA 1K70A 1N63C 1TJPA 3UVAA 3TC6A 8XIMA 2J79A 4PMRA 2E4TA 3JR2A 2GUUA 3Q58A 1W91A 4ZGYA 3LCHA 4KPLA 4M6UA 1HJUA 3FA5A 3W22A 4LAOA 1P0EA 3VNIA 3J7HA 1BD0A 4XZLX 4HNTA 4W8AA 1JAKA 3EMZA 1W31A 4LS2A 3BE7A 3RLGA 4YHEA 5CCZA 1UWIA 4B5TA 3SJ3A 1DKWA 4R3UA 3BW4A 3LM7A 2ZZ0A 2WJFA 3CWHA 2CESA 4G8TA 4RDVA 4DJDC 5JBEA 4M7TA 3IV3A 4JYDA 3NPVA 4C1LA 3AS1A 5CBJA 5AHIA 3UXLA 1DQWA 1RLCL 4OFCA 1YDNA 2DH3A 4GYJA 2Z4GA 3IK4A 3B03A 5C9ZA 1QI3A 4ZSUA 2DIKA 2D0HA 2FH6A 3E2RA 3E1F1 1J0IA 3T08A 3VDCA 2GOKA 1CGVA 3QLLA 3KCOA 3UNDA 2P10A 1DJWA 1S2CA 1VC4A 1CBGA 4JFWA 3S6OA 1ONFA 3KM8A 1H4PA 4LYKA 1ZJIA 8TIMA 2J77A 1OC6A 4L5ZA 3M47A 4DNHA 4E3VA 4AYSA 3ZQ9A 4PTDA 3W70A 3PTDA 4IFOA 2WB5A 3FY1A 4NXKA 3PZ9A 3RHGA 4XUYA 1TPB1 4O0QA 1JPHA 3CQIA 4B5SA 2I5QA 1G94A 3IIOA 4AVNA 3G8EA 1T7LA 4P2VA 1FDJA 1XIEA 1P1XA 3W28A 2FQIA 5HA7A 5A1AA 3ZT6A 4GIRA 2VJXA 1DEDA 3RUBL 1SZNA 3MA8A 1EA0A 3CM4A 1KTNA 1TV5A 2OODA 3W9ZA 3E6EA 1ZL1A 3T55A 2QDEA 4GA8A 4NRSA 4C1NB 2WVSA 3EWUA 3T0BA 1O1ZA 2YLLA 2G41A 4IG2B 5AVHA 5CZJA 4YCOA 2Y24A 4KGLA 1NQ6A 3S5SA 3G1DA 4V1XA 1MRQA 3GZ3A 3CZ8A 4HA4A 4ORIA 5FJPA 3C52A 1EA9C 3GG7A 4O10A 3SCPA 3C2RA 4S3CA 4QS6A 2V5KA 1G7UA 1RP8A 1M6IA 3O6YX 2BOGX 2UY4A 3CUZA 1JFHA 4C6LA 1ZCCA 5DRIA 1Z89A 3CPRA 1Q6LA 1C90A 2FZ9A 4HPXA 2PBOA 3KEHA 3KP0A 2BVYA 1CENA 1JYNA 2OT1A 4PA8A 4U5IA 3B9OA 1GJPA 1B4EA 5D2XA 5D32A 1UYQA 3F4NA 4OV9A 5FAJA 3ARZA 1A4MA 3TA6A 2WLYA 3HW2A 4S2BA 2QJGA 3W6LA 4A6GA 3WBEA 1A5CA 1TTJA 3CL6A 4JQ2A 4X2RA 4YN5A 3GIYA 4WR3A 2V3AA 2QS8A 4NL1A 2QJMA 4FOUA 1FWAC 2OKOA 4RZ6A 5FS7A 3DBNA 1VFFA 3GHSA 1RXOB 4M24A 5FJRA 1RUSA 1A5BA 3HQPA 3T2QA 2V68A 1GOIA 3PBGA 2ADAA 3SN1A 1U1JA 1W8SA 2OWCA 2BHZA 4GZIA 1YIXA 2P3ZA 3OVPA 4FR6A 2I9EA 3HJZA 4WSJA 5B80A 3WL0A 2HQMA 4DRSA 3NUKA 2WSRA 4KCVA 2F2HA 1UD6A 3MP3A 3RF9A 3ZYZA 1I0BA 3M07A 1EC9A 2YBVA 3L4UA 2PLKA 1SJBA 3QGVA 3TW7A 2VX4A 1RK6A 3I4EA 5K9DA 3QZ6A 4NNBA 1EJSC 4HPHA 4LA1A 1H3GA 4BWLA 5AHNA 2GVEA 5AC4A 5LIXX 1EDQA 4DO4A 2ZRWA 4ZQCA 1K3UA 3CHFA 3W7MA 1JNEA 2W27A 3HM7A 4R5EA 4LQ1A 1PO9A 1XW8A 2V5DA 4EWND 5J5DA 1C9DA 4RE2A 3T78A 1KGXA 1P5BA 2HZGA 2YXGA 4RXGA 3UG8A 1K6AA 3GXIA 1TV3A 1UA7A 2RAGA 4UOQA 4DF0A 4LY8A 5HWJA 4MPQA 1Q3NA 4GXMA 3VVGA 3M0MA 2E40A 4GUHA 3POCA 1KXHA 3COTA 4Y9MA 2DVXA 2JKPA 1ZALA 1BVWA 3UWYA 1J5SA 4H4XA 2E67A 3ME3A 4J5NA 2PDQA 3WDJA 4Q4RA 3KTXA 2JK6A 4YCPA 4PFHA 3HMJG 3NQ7A 5CPLA 2FPVA 3PZQA 1I60A 4PR4A 3PTMA 1EDGA 2J24A 2ZRXA 4NZ4A 3B9JB 3EDKA 1Q6QA 2YCKX 2B7QA 4MNJA 3VOGA 1S46A 3LPOA 4CUCA 3MU7A 1AUSL 5G2HA 1AQFA 1WXJA 1VCGA 1TQXA 2QCMA 4XIMA 3H54A 1GUVA 4XV0A 2VFDA 2OEMA 3O6CA 3PWGA 4PCSA 3M16A 3GTIA 2NV9A 4LEQA 2A2IA 1US2A 3EPMA 3U5UA 2ZRUA 1WXYA 5TAOA 3KE0A 5HATA 3AYVA 3SRHA 3F4WA 4JKMA 3P67A 3TYEA 2C8NA 4AC1X 2C3DA 1FECA 1FHLA 5GNZA 1ZP3A 3GIPA 4K37A 2WZIA 5JCNA 3IAPA 1H62A 3TAKA 4PB4A 1TZZA 4MLRA 3AIVA 4CEUC 1G5AA 2BVWA 1UP2A 3M5YA 3MCOA 4Z2KA 2G96A 3NQ2A 4UTLA 4LCSA 2BB0A 3N18A 1E9LA 1EGMA 2VQTA 2CXGA 3UZZA 1RD5A 1Z8AA 4U5KA 2L5HA 4A29A 4NU7A 1EWDA 2PC4A 4XD6A 4LX4A 4Y6GA 4F0KA 3ZSTA 1O94A 4H00A 4J27A 2G97A 4XZIA 3QOMA 5HK4A 4ZOHB 2BY1A 3WFAA 3UJSA 2P1FA 1B30A 1A0EA 3UESA 3ITLA 1KM6A 3KCJA 1M9HA 5LGZA 1CT5A 2E6AA 4AZGA 3CTLA 3A23A 1JJKA 5FAGA 4B5NA 5G4WA 1KN0A 1O7AA 1OGGA 2OVLA 5KVHA 4Q8PA 4C1NA 4O53A 2PTDA 4IG2A 1IGWA 3G1SA 2OFJA 1OF8A 2C1IA 3EBVA 3GAYA 4Q3MA 3FAXA 1PKLA 2FJKA 1E1CB 4M0XA 3IS4A 2Q09A 3T7VA 2YDAA 3BSMA 4KGJA 2WMGA 1A0CA 1ZAIA 5FESA 3ITCA 1XLLA 3LADA 1KM4A 3VDHA 3ARVA 4IUGA 2EPLX 4MAZA 4ONVA 1UUQA 5E09A 5CPSA 3THUA 5F4WA 2D20A 2HRWA 1PBGA 2CHRA 2PE4A 3VKBA 2PLJA 3T8QA 3UJEA 4KCTA 1H7OA 3GXTA 5FF7A 4PN2A 2FTYA 3V0UA 3UCDA 3NYZA 5D2YA 2FIQA 2WC3A 4HU0A 4CQDA 1H5YA 4TVCA 1VENA 3WENA 5CPQA 3N6HA 4HD5A 4HNOA 4XO7A 2R1MA 3NA8A 4WLCA 2C1GA 2VX6A 1RA5A 2R1KA 1TE6A 3IJLA 3W2KA 1LUCB 2OLAA 1NP0A 3RFAA 1JR1A 4EVZA 3BJTA 3FKKA 2D2GA 4PRTA 4H3DA 3A4WA 3UPMA 1DXIA 4JN7A 4GUFA 4PSPA 3TVAA 3TU9A 3R0KA 2NWSA 1DNCA 1QBBA 2JEPA 3HGRA 3UP8A 3C2EA 5G5GB 3UW6A 1UROA 1XF0A 3ECQA 3PWIA 5G5HB 4PUUA 1AJ0A 3UZWA 3KLKA 3NZGA 3VILA 1GT8A 3VINA 3QPZA 1CWYA 2EKGA 1P7TA 3EOUA 4AMCA 1B3XA 4O4VA 2OTDA 5I3KA 4C6CA 3PG6A 4HPJA 5HNUA 2X2YA 4HPGA 1UA3A 4ZO8A 3BAXA 4JIRA 3GNXA 3S1GA 4BJHA 2WMKA 1Z44A 1EB3A 3DEQA 2CZFA 3G6MA 2VKZG 2Y1HA 2YDQA 2G3JA 5D2VA 2XSAA 1DHPA 2F38A 1TX2A 4H4RA 1AH4A 1WKFA 1WOAA 1LPFA 1QW8A 3W1MA 2R6OA 2OLSA 5I3GA 1ZS2A 2DGAA 1KRCC 3DDMA 3ZOAA 2AAQA 2X42A 3V4BA 2ESCA 3PPFA 2ZX5A 2ZVRA 1E6PA 3ZJ8A 3LXCA 2OGJA 3GY1A 5CC6A 1XIGA 2E9LA 3BCFA 1GRAA 4A4AA 1HO1A 3IIXA 1LYXA 3O6DA 3URNA 2D24A 1ZRQA 2E5CA 2I14A 3GVWA 3T0AA 3AN1A 1LORA 2NT0A 4DY1A 2OMAA 3H2CA 2IQDA 2P8BA 3KVMA 5KTLA 3KVKA 1U83A 3KRUA 1F6PA 4KRUA 2BP1A 3GRSA 3P3BA 4MZ1A 1K8CA 1VPYA 3HA1A 3EA1A 1PB0A 1DIOA 1RJRA 3FSUA 3I3BA 4EAMA 2W4XA 1FUYA 3AXMA 3PNZA 4QLKA 4L9XA 1TYGA 5CGMA 2Y5EA 4UCFA 1UD2A 1EUNA 3KP1A 1AODA 1UR0A 3LHWA 4AD4A 3P84A 2OQYA 2ZXQA 4PCTA 4MNLA 3VD7A 1JGMA 2PWGA 2QR6A 1S2WA 4WVXA 1PZ3A 3D9XA 1GOMA 5CC7A 2IQTA 2QDHA 2X99A 4AD0A 4O54A 2YSWA 4UTTC 2C3ZA 5C5YA 4D6HA 3F4CA 3QSTA 5AC7A 3H2EA 5KZ6A 3NPUA 1Q85A 1KM0A 3C3UA 2Y7GA 6TIMA 3GU2A 2CDUA 2X50A 2AGTA 4EM4A 1JCYA 5HAOA 1XBXA 2GJNA 2Z27A 4EPKA 2TAAA 3NO3A 3QMSA 1VBJA 1B54A 4C6FA 2QPXA 3WZ0E 1JIBA 4LFYA 2C15A 3KOYA 2WPCA 1ADOA 4DZIA 4F2BA 1EBHA 3MUZ1 3IGUA 1UWUA 2ZUUA 3GE7A 4UR8A 1L8NA 3NQVA 4IISA 3RRAA 2FJUB 3FFSA 2HSAA 4OTKA 4C1KA 4WK9A 2ANUA 3AXKA 3G3DA 4A2SA 3W23A 1WZLA 4ALDA 3VE9A 2Y85A 4LAKA 4H4SA 3M6DA 3TJXA 4UFKA 4KEZA 2VCBA 3MSYA 1KM2A 3E0VA 3ID7A 1E15A 4FA3A 1R3RA