3FXGA

Crystal structure of rhamnonate dehydratase from gibberella zeae complexed with mg
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
407
structure length
407
Chain Sequence
LSSVKDFPKIKAIRSFIIGGVGSGGDYHNVKGGHWLIDSDISTPASKWEQYKKSRTSWGINVLGSFLVEIEATDGTVGFATGFGGPPACWLVHQHFERFLIGADPRNTNLLFEQMYRASMFYGRKGLPIAVISVIDLALWDLLGKVRNEPVYRLIGGATKERLDFYCTGPEPTAAKAMGFWGGKVPLPFCPDDGHEGLRKNVEFLRKHREAVGPDFPIMVDCYMSLNVSYTIELVKACLDLNINWWEECLSPDDTDGFALIKRAHPTVKFTTGEHEYSRYGFRKLVEGRNLDIIQPDVMWLGGLTELLKVAALAAAYDVPVVPHASGPYSYHFQISQPNTPFQEYLANSPDGKSVLPVFGDLFIDEPIPTKGYLTTADLDKPGFGLTINPAARAKLIPSDYLFKVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rhamnonate dehydratase
publication title Crystal structure of rhamnonate dehydratase from Gibberella zeae complexed with Mg
rcsb
source organism Gibberella zeae ph-1
molecule tags Lyase
total genus 130
structure length 407
sequence length 407
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3fxgA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3fxgA01
4HNLA 2PS2A 3D46A 2OZ3A 3S5SA 2I5QA 2ZADA 1PDYA 3ES7A 3VCCA 2PTYA 2PTXA 3OZMA 3VFCA 2NQLA 2MUCA 2PGEA 3S47A 2RDXA 3IK4A 3RGTA 3MUCA 1BKHA 3BJSA 3UCDA 4G8TA 4G7FA 4M6UA 4H19A 3DIPA 2QDEA 4MMWA 4DWDA 4E8GA 2DW6A 3DFHA 3ZVHB 3HPFA 3TWAA 3ZLGA 1TKKA 2XH4A 3NXLA 2OZTA 2QVHA 3OP2A 1SJBA 3ZVIA 3JZUA 3PK7A 3ENLA 3SBFA 3DG6A 4H2HA 2GL5A 3TWBA 3PWGA 2O56A 3JVAA 1P43A 4GFIA 1ONEA 1TZZA 3UXLA 3N4FA 3FXGA 2FKPA 4DYEA 4FP1A 4H83A 4IL0A 2AL2A 2PTZA 4GGBA 3CT2A 3TW9A 1MRAA 3DERA 3EEZA 3GY1A 3CB3A 1EC8A 2P3ZA 2AKMA 3RRAA 4EWJA 1BQGA 2AKZA 1WUEA 3STPA 4Z17A 3ES8A 2XH7A 2HXUA 2QJJA 4K1WA 4KWSA 2HNEA 2XH0A 3U9IA 3SN0A 4GISA 2OQYA 4HYRA 3B97A 3RCYA 3VDGA 3TTEA 2QJMA 4F4RA 4GGHA 3OTRA 1JPMA 1NU5A 3R0UA 2P8BA 4K8GA 4JHMA 3UGVA 3BOXA 3H12A 3V4BA 5FJRA 1FHVA 2QDDA 4HPNA 2ONEA 3TQPA 4KT2A 1MNSA 3ZLFA 1WUFA 1P48A 3RR1A 3VC5A 5FJTA 1JPDX 4MKSA 2PPGA 3JW7A 3QTPA 5BOEA 3R0KA 2QJNA 3QKEA 3TCSA 4ROPA 3IJQA 3UJFA 3SN1A 4H1ZA 3QPEA 2XSXA 4ZA0A 3GC2A 1XS2A 3MQTA 4DHGA 3IJLA 3SJNA 5EU9A 3R10A 4KEMA 3OW1A 1EC7A 3NZGA 3DESA 2PA6A 4FI4A 4IT1A 1JDFA 1KCZA 1DTNA 2QQ6A 3FYYA 3NFUA 3R25A 1RVKA 1KD0A 1L8PA 3GO2A 1R0MA 3UJ2A 4A3RA 4IZGA 2PP1A 4HCHA 1IYXA 3P93A 3TJ4A 3UJRA 2OX4A 3BSMA 3N6HA 3KUMA 5BOFA 3OZYA 3N4EA 2GGHA 1FHUA 4Z1YA 2PP0A 3T4WA 2AL1A 1PDZA 3H7VA 3R11A 1EC9A 2GGEA 3MSYA 3DG7A 4IP5A 3TJIA 4DXKA 1EBHA 4JN8A 3K1GA 4E5TA 3V5CA 1OEPA 2OZ8A 3IJIA 2POZA 3CXOA 1SJCA 5ENLA 5IDZA 2PU1A 2P0IA 1ELSA 2XGZA 3H8AA 3RITA 4E6MA 3H70A 2PP3A 1F9CA 1MDRA 3THUA 3I6EA 2OKTA 3V3WA 2ZC8A 2OVLA 2OFJA 3Q45A 3MKCA 4JN7A 3VC6A 2DW7A 2PTWA 4HN8A 4J1OA 3U4FA 3NO1A 3OPSA 4MGGA 3SSZA 3P3BA 3FVDA 3CAWA 1YEYA 3I6TA 5FJPA 2GGIA 3DGBA 3PWIA 3DFYA 1EBGA 3CK5A 3UJEA 5FJUA 4DN1A 2OG9A 3I4KA 3V5FA 4GYPC 3T9PA 3VA8A 3T8QA 1MDLA 3EKGA 3UXKA 4HCDA 2FYMA 4E4UA 2PODA 4M0XA 3MY9A 4X2PA 3ZLHA 4ENLA 4A6GA 1SJAA 1JCTA 4J3ZA 2OO6A 2QGYA 3TOYA 4E4FA 3RO6A 7ENLA 2HXTA 2PGWA 2OPJA 2GGGA 4KPLA 3SQSA 3D47A 2P8CA 4GYPA 3R1ZA 1W6TA 2P88A 4IP4A 2GGJA 5FJOA 3CYJA 1KKOA 2PSNA 3DG3A 4ZCWA 4A35A 1SJDA 4IL2A 1R6WA 2PMQA 1E9IA 3N6JA 3P0WA 4YWSA 2MNRA 3MWCA 3FCPA 3UJSA 3FJ4A 2HZGA 3Q4DA 3SN4A 1TE6A 3FV9A 3PFRA 2XH2A 1MUCA 3UCCA 4HNCA 3DEQA 3ZVHA 3T6CA 3QLDA 3DDMA 2GSHA 4HCLA 4IHCA 2PCEA 2OLAA 2OQHA 1ECQA 4GIRA 4K2SA 6ENLA 1NELA 5J04A 3VCNA 2GDQA 3MZNA 2CHRA 2AL2B 1XPYA 4GMEA 3QN3A 1KKRA 3GD6A 4DX3A 2PU0A
chains in the Genus database with same CATH superfamily
1SZRA 1J6PA 2OZ3A 5CG7A 3W73A 1YBQB 2RFGA 3GRTA 1AQ0A 5CPTA 2MUCA 2FVKA 1Q63A 2DT3A 1TTIA 2Z29A 3O1NA 3CS2A 4HPXA 4RZBA 2DZXA 1EOMA 2QDEA 1KR1A 4WGHA 3DFHA 1F8IA 4MNLA 1E5JA 3TWAA 1VIZA 2D2OA 3QY8A 1SFJA 3PP7A 5JIPA 1NHPA 4L1WA 4Q4KA 4E2DA 1K8CA 5AVNA 1QHPA 4O17A 5IBXC 4AH7A 4I5XA 3HFYA 4J2PA 4JTAA 3W0KA 3C56A 3NPXA 1JZ8A 1S3TC 9RUBA 1PTDA 2GZXA 2Q8XA 4DVOA 3CB3A 4K37A 1YQZA 1A53A 3B0VC 1DJYA 3EOSA 1QOXA 2A8XA 1W3KA 3BC9A 4XZLX 5FJIA 3EWYA 1TZ7A 4NT0A 2BC0A 1XYLA 2E6AA 4KWSA 3ITOA 3MUIA 3EX3A 1RALA 3HF3A 1H7OA 4M5PA 1V08A 2C1IA 1XFBA 4H6KA 5AY7A 2W9MA 3P60A 2OXNA 3T0BA 1U30A 2BOEX 2XZ7A 4QG9A 3H12A 2NT0A 4X3ZA 2VGIA 1Q7ZA 3S1UA 1LG2A 1KFWA 3EX4A 4HPNA 1UQYA 1XLJA 4W8AA 4HNUA 3UGRA 1P48A 5M2FX 5FIPA 1JPDX 2YCLA 1G7UA 3NEHA 3A9IA 3PFMA 1LROA 4QFUA 4GUFA 1OABA 4GOAA 2ACUA 4E8DA 4ZL1A 2V3DA 1BVZA 1XPGA 3EX2A 3AYTA 4NX5A 4E3VA 1XLIA 2WSQA 1V7AA 1XM3A 1GYMA 4RPQA 5TR3A 5HQLA 3DHUA 4O1EA 4BHYA 1N55A 2OTDA 5LSMA 2TPRA 2V68A 3B3DA 1WPCA 4M1RA 3QMRA 1QMLA 2YL6A 4JY9A 5BRQA 2H3BA 3O0FA 1IGSA 4S2CA 3RLHA 2Z1VA 4HA3A 3I4EA 4JFWA 4X22A 4IGMA 3IIZA 1OZMA 2Y8UA 1EIBA 1UOKA 4OHQA 1GW1A 3BV7A 3QR3A 4FA3A 2PDKA 3BMVA 2QMKA 3WD1A 2VXNA 2BBFA 4K8DA 3ZM8A 1RR2A 4DXVA 2WYSA 5JCLA 2BB0A 4ECLA 1FHUA 3OC4A 3GTHA 5D38A 3WDQA 5E1QA 4IMGA 3SUWA 1YPIA 3NS1B 4WKHA 4MIMA 4EACA 3BLOA 4WY0F 3GXTA 3WH7A 2YSWA 4HBKA 2GGEA 1QNSA 2FH6A 1WB0A 1J0KA 3ID7A 2EF9A 1HN1A 1RHCA 1OFPA 4AIUA 3RPDA 1TVPA 4C6LA 5BZAA 4FXRA 1YTKA 4QDWA 3FYOA 4AWSA 1E3XA 1O68A 3ZOAA 2XVKA 1OB0A 3AIQA 2AGTA 2WC3A 3OEXA 2IKHA 4AG0A 1KNWA 5B7YA 2OB3A 1QK0A 4J4KA 4KIEA 4FR1A 5A8NA 4PRWA 4QROA 4HOZA 1ISXA 5I3HA 4J1OA 4F0HA 3ZT5A 1V59A 2CHNA 1G6CA 2W67A 3NVWB 3BTNA 2V3EA 1FCUA 2R9RA 4RNJA 3MP3A 1R2SA 5C71A 3BLFA 5D37A 3DGBA 3DECA 1EH9A 1K6AA 3ATZA 3PSVA 3G1RA 4M3PA 2BODX 3UZXA 2G3NA 1NP0A 2SFPA 3UVIA 1IE7C 4C6OA 3TOPA 5FJUA 4NAFA 2G8ZA 3OQ8A 1MDLA 5G4HC 1TVLA 2PC4A 4QQ3A 3SUSA 2QW5A 1VBRA 1TTQA 3KCOA 2P3EA 4PSRA 3AOFA 4FX7A 3QH2A 4DM1A 3CMFA 2J7EA 4MY8A 1FWTA 3T42A 3AU2A 1A3WA 3CV1A 1N8FA 1B4KA 3B0UX 3CQIA 1EJ7L 3WDHA 1K8YA 3ZWTA 1TQJA 1UD4A 2WK2A 1R38A 2PGWA 2F2HA 4JDYA 3PG6A 4KPLA 1OFDA 2PDQA 1BG4A 4J3XA 3UG8A 2P88A 4GRSA 1AA1B 1YDNA 1F8WA 1GVSA 1UBSA 5JUVA 4YYCA 1K4GA 3AZRA 1JYVA 3P61A 3MP4A 1O5QA 3SUTA 3ITGA 4IOTA 1OF6A 1UROA 5A2AA 2HZGA 3Q4DA 5TQLA 1GRHA 4QJ4B 2FHFA 3LNMA 2HQMA 3ZJKA 1F6PA 2VZOA 1KW1A 1BPLB 4AUBA 4RKAA 2W55A 4GRTA 4M52A 3ARVA 3KS5A 2A7PA 3URNA 4IUOA 3MP5A 4UOJA 1G4EA 1TPWA 1C3FA 2NUWA 4GIEA 6ALDA 3ARYA 3P67A 3GD6A 4LWWA 5XINA 3PJTA 3CASA 3LHYA 1NHSA 1N5WC 1CGYA 1QVBA 3ITTA 4QISA 4PTWA 4Z0SA 1VBHA 3FEQA 2FB3A 1Z9AA 2GJNA 3PZGA 2G50A 5BYWA 3CZLA 3HG4A 1DJZA 4G7EB 1BXNA 3PG9A 3VIOA 3FAXA 1MO9A 1KC7A 3NA8A 5CBJA 3KVMA 1KN0A 4JKKA 4TR9A 3G18A 5A8OA 3W70A 3UXIA 3DK4A 3AIWA 3PJUA 4H9ZA 2PCQA 1CT5A 1VBJA 4GQ0A 2R6OA 1UKTA 3CPRA 5I06A 4N6EA 3FVMA 3E6EA 4NRSA 3GNRA 4XZBA 4PL1A 4O1CA 1H1NA 2DP3A 2OR2A 2E3ZA 1QI4A 3SR7A 3EPOA 3WK3A 1UPPA 4PN2A 2PTZA 4GGBA 3B9OA 1TV7A 4CD8A 1TWWA 4ZE4A 3TW9A 3WYZA 4O50A 1R7AA 3GDRA 5D9MA 4GUGA 1S2WA 5E9AA 2PZNA 4JCLA 1JZ5A 2GR3A 4U4MA 2AKZA 4IIHA 2PI6A 2OEMA 4KERA 4WK9A 2XH7A 2Z1XA 2G0WA 3I7SA 3N34A 4U2ZA 3W22A 1FWJC 1D8CA 1CNVA 1DV7A 1KCLA 3GYCA 1BYDA 5EMJA 5U1OA 1FCVA 4M51A 2EAWA 3QFWA 3GG8A 1QPOA 2XIIA 4CNTA 6PTDA 1EPXA 2NXGA 2CIPA 2JK6A 3W82A 2VP8A 4KT2A 2VFGA 1DPMA 1IEVA 3KOYA 4US6A 4CQ9A 5K3VA 2I56A 3CJPA 1DJXA 3U7BA 4AW7A 3W7NA 1GEUA 2J27A 1I0DA 1C93A 5A6BD 4S3DA 3IJQA 3UJFA 2PWFA 4Q8WA 1AMKA 2DVUA 2X0SA 2EEXA 4Q6XA 3A21A 4DYJA 3R7MA 3WQFA 4IGNA 4W9TA 3OBAA 3GW0A 1Z48A 3KFTA 1KTBA 1Y7VA 3GKAA 1XF0A 5AHLA 5GNZA 4GO8A 2PA6A 2GOUA 1K7FA 1NDAA 1FH7A 5DELA 4FDCB 1FFQA 5K9XA 3IJ8A 5I02A 3P8JA 4C6NA 3DXIA 1S5WA 3IIXA 4PR4A 2D2GA 4M8UA 3LGEA 1V6UA 3R25A 3GO2A 4GCXA 3SI9A 3VVGA 3PUEA 4XK2A 4QS5A 1EPVA 4UNIA 2V38A 3K30A 1V6TA 4LPCA 1O6IA 2A7NA 1GWJA 4A8IA 1GZ1A 3AHTA 1E56A 1W5NA 3URHA 1W3IA 4R53A 4ML4A 3TLLA 3E2VA 2AL1A 2YDAA 4MPQA 2GJLA 3MC5A 3P5ZA 1E4MM 1FCBA 4U3AA 1XX1A 3NQ2A 4QLLA 5K4XA 4HIBA 2ZZ7A 1P5BA 5BRBA 4ROQA 3NEVA 1KA9F 4CU8A 3ABZA 4JQ3A 2ABBA 2FJUB 3M9YA 3WNMA 3M0VA 1WBHA 4IISA 3VO0A 3HGOA 5CKSA 1DQXA 3N2MA 3KDOA 3BV4A 3H70A 3L2LA 1WNOA 3K1DA 4UC5A 1KBBA 4I8YA 1A5MC 1QFEA 4NILA 1XRTA 2ZC8A 1TJ0A 3MPGA 4U10A 1A80A 4AVOA 2V5DA 1I2OA 3LLDA 4IPLA 4D71A 4TX6A 5C54A 1MEHA 4LAUA 1JXKA 1RD5A 3SECA 3IAQA 3QGAC 5AECA 1W1B1 2R1PA 1J10A 2D2HA 3PULA 2HBVA 6REQB 1HVQA 5HMEA 3SURA 4EWND 1QOQA 4KRZA 3PWIA 4R34A 2PDMA 1JDEA 5M17A 8A3HA 2FTWA 5I03A 4QLKA 1XD0A 2HPIA 4AXNA 2FPTA 3W86A 1A5KC 1F73A 3S1VA 1ZTVA 2VOMA 1PZ3A 3TLQA 1ZJBA 3C52A 4EQRA 3EKGA 1ZDLA 4WGXA 4U5KA 3ARPA 2QF8A 2J88A 5AHFA 3ALFA 1Q1WA 4Q4QA 1OINA 2D69A 3R94A 4B2DD 1XKYA 4JDRA 4PB4A 1MXSA 1IR2A 5D2XA 3E5PA 3KBMA 4XIAA 5KTLA 4LUTA 1SZFA 4PMOA 3LNPA 5C70A 5K9CA 4TO8A 1UKQA 1QDSA 2GK1A 1Z3NA 3AS2A 1ZBWA 3VX0A 1HIZA 5TNVA 3W74A 4O8AA 3SADA 2ANUA 2RKXA 2JQXA 1Q3NA 1W56A 2LLEA 2VENA 2BHYA 3KVKA 4A35A 3F1QA 1VQZA 3QW4B 3BLLA 2PGFA 3KTSA 4DBEA 1E9IA 2C19A 3G8EA 2C7FA 4UOZA 1RLCL 3LPOA 4O18A 3S83A 4HNOA 3ZXWA 4EPEC 1UH2A 4GHRA 1TE6A 1OG0A 1XRVA 3I7QA 3TTYA 2O9RA 1FEBA 1XIDA 2J7BA 2YYTA 5DMNA 2BXVA 2UV8G 4UIOA 4YL2A 3BAXA 3KOWA 4JICA 1RD6A 1I60A 3M41A 1D8WA 3ZVHA 1XBZA 3E2QA 3FKKA 4QE4A 2ZZBA 4AF0A 4KQNA 1GNXA 3FNDA 5FF3A 3NRZB 2C0AA 6ENLA 3E1F1 3WH9A 4C6MA 4IFKB 3GTIA 2W5FA 3MMWA 4MTVA 2WPEA 4O14A 4O1BA 5AZ1A 1QOPA 4I9TA 4EPKA 3VD5A 1F3PA 1NF0A 1A5SA 4MAZA 2PS2A 1RLDA 1U5JA 1H62A 4P8XA 4HT3A 4QE1A 1U33A 4QE5A 1LBFA 3WQWA 5ECUA 5HQMA 3CGTA 2V8ZA 4JTFA 1TPDA 3RGTA 1PKNA 3RRXA 1QRQA 3I6RA 1EZ2A 4N9DA 3AN1A 4H19A 4DJED 1H60A 3DIPA 1L6GA 4MMWA 4MSSA 3UFYA 5DY3A 4DZHA 3POHA 4YWOA 1V5XA 4Y6GA 1FXPA 1W5PA 4EQXA 3JZUA 1Q2RA 3SBFA 1JCJA 1RK5A 2WMKA 3PWGA 3KWXA 2F2KA 3NM1A 4GFSA 1XH2A 2FKPA 2DVXA 4DYEA 3BPWA 5U7SA 2XM1A 3DH9A 1OX4A 3LMYA 3W84A 4AYSA 3W4RA 1PE1A 5ABHA 1OT1A 4NZCA 3HMCA 1SQ7A 1VIWA 1KV8A 4FO4A 3IC9A 2BHZA 3CWNA 1A50A 3DFNA 5DMLA 4K1WA 4QS6A 3QQ0A 2H8XA 1RXOB 3V0TA 1KLYA 3UZ5A 4C6KA 3C0LA 4DWSD 3KBWA 1JPHA 4A8RA 3A5VA 3NOEA 1JROA 4BQ3A 2XVLA 3HTWA 3MVTA 4NI3A 3MO7A 4XBJA 4F40A 1OC6A 4NYUA 1ZBCA 1ZZMA 3O0HA 2BX7A 3CL7A 5DT5A 3M6YA 2FZBA 2WQDA 4NEVA 1SZNA 1BFNA 4DEFA 3KBVA 5A6SA 1W9UA 3BH4A 3ABQA 3R0KA 5B7ZA 1WZKA 3DBNA 3OODA 5D33A 4S3FA 4ADSA 3IACA 4RLIA 3IIVA 3IPWA 3OW1A 1RBLA 3MWAA 1E0XA 2X41A 2VNCA 1EDQA 1M41A 3LEPA 2Y7FA 3KX6A 4NY2A 2BY2A 2R82A 3FDKA 2G3MA 2G37A 2UY4A 1Q6FA 1WP6A 1W5MA 2BG5A 5K4ZA 1TUFA 3MI2A 3OBEA 2F7FA 2GUBA 1GJPA 3W26A 4P61A 1W1YA 3P74A 4KFNA 1XJBA 1RVKA 1L8PA 3UJ2A 2EXOA 4IZGA 2O4QA 2VGBA 1UHVA 3H7RA 3Q65A 4YVPA 3F4DA 3GIYA 3RX3A 2PD5A 4MKVA 3W72A 1XANA 2QDHA 3GG7A 2XDFA 4LBUA 4V2XA 5BW6A 1LWJA 5MF5A 1XICA 4AFYA 2AOSA 1OM0A 3TW6A 2YW3A 1HG3A 4EOUA 3EA2A 1UUOA 2V2HA 4ZMGA 4NZ1A 4XVEA 1P0DA 3U8GA 4HD5A 1CENA 2C3ZA 2HROA 4B5TA 2E9BA 4PTNA 2QDGA 3W81A 1A0DA 2VUYA 3VOCA 3O6CA 1JVNA 3T0DA 1XBXA 4TVDA 4OU1A 5DRIA 1NP2A 1X97A 1BKSA 1LOSA 2DPEA 1JPIA 1PO9A 2VR5A 2A85A 2YBTA 1J93A 1VPYA 1VFFA 3MKCA 1GQIA 2W62A 3CIVA 3H2EA 1AOGA 3O63A 4QR6A 1GK8A 1WAUA 2EPHA 3L5MA 1IQ8A 3W2LA 3QHMA 1X1ZA 2Y7EA 3LI0A 4C6BA 1EXBA 4C6CA 3G1DA 2FZMA 1QK2A 3UYIA 3H4WA 3QXBA 2Y85A 4DLFA 3IUIA 4LRTA 4H7VA 4PRTA 2Z1KA 3NYZA 3WELA 3SCUA 3JS3A 2FGZA 2WM0A 5BRPA 3I4KA 4UZSA 1LOLA 2PLMA 3HQPA 1O5RA 3Q94A 4IQJA 1XV8A 1QI3A 1UP3A 4I9MA 3HBLA 4BF7A 4DI8A 5G2IA 3EDKA 3LHZA 3VOIA 2I5IA 3CGEA 2ABAA 1GQLA 1KRBC 1NARA 4FNSA 1GEQA 2OOFA 3H6OA 4MPKA 1TYTA 1VYSX 1MUMA 3LMZA 4KFOA 3GNPA 7ODCA 2F8QA 1TPEA 2QIIA 3EB3A 1A5LC 3VIGA 3IGHX 1VRDA 3BZGA 3VKDA 5C9RA 3GZ3A 1MW2A 2QVNA 4CU6A 3AROA 4R7WA 4Z1DA 5U4NA 3DG3A 4BV6A 4IP7A 2VGGA 4IL2A 2WO5A 1R6WA 4X9SA 3GYEA 1H4PA 4YN5A 3RNDA 5HWMA 1B0IA 3ARUA 1MFVA 5G2WA 3WJZA 3WD4A 3XIMA 5C5YA 1GHSA 1JEHA 3GTFA 5KZEA 5A94A 3FA3A 5EBAA 2FZ9A 2BVYA 4A05A 3WJWA 3UJSA 3GM8A 2NX9A 2DT1A 2XN0A 3T07A 3W23A 1JYNA 3TYEA 4HNCA 3ZMRA 1UP2A 2BXYA 1IEQA 5EMKA 1GETA 3N14A 2OLAA 1N60C 5GJPA 3N17A 2Z1SA 3GU1A 2OSWA 3IS4A 4NZ3A 5CZJA 1QWKA 3KVJA 3U5YA 1Q2SA 2NQ9A 2OO0A 3UZJA 2YKKA 3QOMA 3U2OA 5CXPA 3EF6A 2OELA 5CPNA 2J7DA 2YCIX 3CC1A 3RF9A 1M6JA 4PMQA 4HK5A 2AMXA 1DXFA 2E25A 5REQB 1N63C 3LUTA 4I3GA 4D72A 4NKCA 3VD4A 3URBA 3DU0A 1CLVA 1NOUA 2ZUSA 1EJRC 1XYBA 1ENUA 2XH4A 4A3YA 4IF2A 4WSKA 3O16A 1PX4A 3D6NA 4PBEA 1R8LA 3PPHA 2V9DA 3B05A 2J4GA 5D9PA 2QJIA 3ENLA 2FTPA 2H9AA 4H2HA 5JH2A 3FGCB 5CSUA 2UWFA 5J5DA 4LIIA 4CEUC 1QNRA 3AJ7A 1AQFA 1CPUA 3W85A 2WMJA 2W63A 4D1IA 3MVIA 2FMNA 3IIOA 4GE8A 4B5NA 4Q8NA 3WQ6A 2FH8A 5D9OA 2QAEA 1B3WA 3DFPA 2PURA 1JCXA 2CERA 2QNEA 3GDLA 3IV8A 3WLIA 4H2CA 3GC4A 1JD9A 3CUZA 3WMCA 5XIMA 3REQB 3KRSA 3NVVB 1C90A 1RA0A 4QNEA 1GYLA 3BICA 4C60A 2NT1A 4YTRA 2ZWYA 1R86A 4LF2A 2QF7A 3I3BA 4S3EA 2PWDA 2KAUC 2YA1A 5C2GA 2ZTKA 2ZDSA 4EM4A 4DAIA 4GUJA 4YS1A 4L5ZA 1PB0A 1MNSA 1QPRA 4WX2A 1GERA 2CZDA 2ODOA 3L2MA 3VC5A 2CYGA 2PPGA 3EXSA 3GD4A 3NURA 2WW5A 3GDTA 1SSGA 4ROPA 3KDNA 3W28A 2X50A 3MW7A 5GPRA 3CM4A 1TMHA 4NZFA 4XV0A 1PZ2A 3T40A 2DZAA 3VGFA 2XVNA 3ITCA 1SO5A 1EC7A 1PKMA 4KEVA 2J25A 3IGXA 1EGZA 2AGKA 3DI1A 1CI1A 2WWDA 4LSBA 3DESA 2BCPA 3G24A 2BY0A 3AM9A 2D2JA 1O1ZA 3IRDA 4JD4A 6XIAA 1UC4A 2QCDB 3G1VA 1K6WA 3FYYA 1N7KA 4ES4A 2F5ZA 1LWIA 3PBVA 4DXXA 3LLFA 3LM7A 3KXQA 1DJHA 1XGDA 3IK2A 5KVHA 1KR0A 3OA3A 2TSYA 1KFBA 3ABOA 3MV11 4BI5A 3USBA 3H7UA 3W37A 1POJA 2ACRA 3M07A 4XD5A 4AD4A 4PODA 2E6FA 1H51A 2HDJA 3ARZA 3A47A 1F2JA 4RDWA 1EO7A 4HPJA 4OIFA 3GDBA 4JTEA 4BF5A 1MUWA 1ONWA 5EA9A 4AD1A 1RAKA 2TMDA 2VWTA 3DI0A 5KMYA 5C2CA 5ENLA 4LGXA 4PE8A 4PFHA 1TJ1A 2WZTA 3U6WA 3E9AA 3HGRA 3MKKA 1ISVA 3NQ6A 1OFEA 1H1YA 2FB2A 4JCMA 1MDRA 1TO3A 1NWSA 4JFTA 5AFDA 3V3WA 2Y6ZA 2OFJA 2WLYA 3GS6A 3WDRA 4PUDA 2ZZ4A 3Q45A 5HATA 3VNJA 5CJMA 1QBAA 3M5YA 1S5TA 3W1LA 1D7FA 2PTWA 4LRSA 1GHRA 4BK9A 3TU9A 1S1PA 3UCQA 4ICCX 4NHVA 3OPSA 5C8BB 1A5CA 4D8LA 4MWAD 2XSBA 4AIEA 1RV8A 4REQA 1TPH1 1WE5A 4NZ5A 1UZ1A 3CH9A 5A8PA 3CZGA 1I1XA 3PJWA 3UZWA 3WLSA 3UJEA 1G0CA 3RK8A 3PZOA 1WCGA 2WHMA 2KX9A 4FR6A 3O07A 3FG2P 3S1GA 2PAJA 3THAA 3S5ZA 1TVNA 3P14A 2NVDA 3BLEA 4GJIA 1EWEA 3RDKA 4O4VA 5CPLA 3MMTA 2INEA 3N12A 2A1YA 2B81A 4Q3MA 1K9TA 4EVZA 4DJFD 3NVDA 5LNVA 3W76A 1H63A 2C79A 3QPZA 2E5CA 1QAPA 3WUGA 4WKFA 1C8QA 2OEKA 3G1SA 4DBSA 2JGQA 2PD9A 3WD2A 3IWPA 2XUCA 3C8NA 4UTFA 4UNLA 1UASA 1XIBA 2WVTA 5HNNA 3EPMA 4Q8UA 1U1JA 4ZQCA 1ZL1A 4A2SA 4E4FA 3PSWA 2NVAA 1Q6DA 1QCWA 2HXTA 1YXYA 3UPWA 3C2EA 3TMQA 2I7GA 2JF6A 5AC8A 4R3UA 4H4RA 4X60A 3UD6A 1TWDA 5FF2A 1CXFA 3HQNA 3M5ZA 2JIWA 3VM7A 4WOZA 4B3LA 5I2UA 3F5LA 3TIMA 4G6CA 3MV01 1LL7A 1UUMA 3HIJA 4IX2A 5BXSA 3HO8A 3F2DA 4Q7BA 1GG1A 1GTHA 1S5VA 3N4AA 3FCPA 4YTSA 3PFRA 3OQEA 1M1BA 1NQKA 5A6LA 1GVOA 1P6CA 2QHAA 4Q4PA 2A4AA 3NQEA 3VK5A 1H49A 4C1NA 1XLKA 1VJSA 2ON3A 1JG9A 2ZXDA 2DZSA 3KCLA 1R3QA 2P50A 5CLTA 1IHIA 4NJIA 2JALA 3EOUA 1RQEA 5A6TC 4KETA 4J40A 3BGJA 4WDUA 1JEZA 3QKZA 3S1XA 5IFPA 1BWLA 3E74A 3SR6B 4GVGA 3IRSA 5ABTA 1QXLA 1E0VA 4FOKA 4I7UA 2PBGA 3OHIA 1M7OA 1K03A 2DZUA 3M0XA 1W2PA 3KP1A 1UR0A 2V63A 3DX5A 4NZJA 3NQFA 4TVUA 4CNPA 5CLWA 4UQEA 4M6UA 1HJQA 1PCKA 1GKQA 5HR7A 2PZ0A 3ZR4A 3WEOA 1EL3A 1F76A 2D1ZA 3F7JA 1BQCA 3L2IA 1IXNA 3VDAA 2WMIB 2NWRA 4O19A 1EB3A 2E67A 1VF8A 2C18A 5CBBA 2ACQA 3VOGA 2YIHA 1YDYA 2YCEA 3B40A 4GFIA 3F4NA 4F66A 4NNAA 3GHTA 2BOGX 2Q3RA 1ZXIC 3HN3A 4CCEA 4XAFA 4DO7A 2D24A 2NSXA 1R46A 3P6LA 3EEZA 1S2VA 3G1FA 2E9MA 4DJEA 1P7TA 2QGHA 4D6EA 2GSJA 1ZMCA 3L0GA 4L7ZA 3PPFA 1YPXA 1XSIA 5DO8A 1JDDA 3IANA 1ZS2A 4PB3A 2VFDA 2XH0A 4GISA 4HYRA 1DE6A 1ONFA 4CQ8A 1V97A 2WWCA 3RNMA 5LNSA 1B1YA 3RCYA 1G4PA 2J47A 4CD5A 4JPGA 2H90A 3M64A 2A3HA 1ZBVA 3LU2A 4H6QA 3WQ4A 2VQTA 2GPTA 1G4TA 2BVWA 2BV9A 1NVMA 1KGXA 1HZYA 3T2OA 4EMWA 1WDSA 4R9OA 5I23A 4HMNA 4M6VA 1VYPX 4JNZA 5AYYA 3LHTA 5JRBA 4C7FA 4LT9A 4DYKA 2J3NA 3FHAA 1GZGA 1C8XA 4F0KA 3KCJA 4V15A 1OF8A 3LG3A 1R30A 2GJRA 2DUXA 3W7KA 3DHFA 2HJPA 3LERA 4L1XA 1W31A 1NM9A 3WNKA 4OTKA 3W9ZA 4LA1A 5EU9A 2WLZA 1FX6A 1YRRA 4DWSA 3CAKA 1NHRA 3NZGA 4JX5A 4ZSTA 3LB8A 2YXGA 2AAQA 1N8IA 3U7VA 1FKWA 1IT0A 2Y70A 3IJ6A 3WDPP 1UWQA 4NJGA 3H4KA 1J79A 4ZR8A 4GD0A 4W86A 2PDXA 3T44A 1ZX9A 4XISA 5HWJA 1WDQA 1YDVA 3NFUA 3NNTA 3STFA 1UCWA 1KD0A 3KL3A 4NP7A 4XIMA 5CJNA 4NASA 2INFA 3QZEA 1XLEA 1HNYA 4YHGA 4EF8A 2ZVRA 4PBFA 4PSPA 1FWRA 1IYXA 4H50A 1OWQA 1ZBKA 3FY1A 3WBAA 2C1HA 5FF4A 1AFSA 5GJMA 3TJ4A 4GJJA 4PUKA 2V3AA 4H8UA 4MB4A 1DJWA 5I6SA 1FOBA 5JBFA 5HUOA 3T4WA 3W2UA 3BQ6A 1R2TA 2V3FA 3PC0A 4B5SA 4LAZA 3WF2A 3BW3A 4JTHA 1W9DM 4FPSA 2CLOA 3GNDA 2E7FA 3ZWSA 4D6DA 1PWMA 3GVGA 1H2IA 5FEZA 3I68A 4Q33A 1V79A 4E5TA 3V5CA 3W7RA 3R8RA 2A6NA 2P0IA 4JAWA 3SY8A 3TYAA 2QPSA 5HA7A 3FN9A 3CXBA 1GVFA 4RZ6A 1RQBA 3TN3A 1S2UA 1VBUA 2YFOA 4PB5A 1LQAA 4Q8VA 4D8AA 2R24A 3C3UA 4MJ4A 3GE7A 3S9YA 3W6YA 4YYFA 1OT2A 4QJ3B 3HZ3A 2YZRA 3LX9A 4S3GA 4PUEA 3WN6A 1NEYA 1G01A 2H3DA 4UB9A 2CFYA 5FJPA 4ZENA 2EPOA 4AC1X 2GGIA 4NG3A 5GNXA 1EO5A 4ACYA 2QULA 3VZYA 1R87A 1D9EA 3TK7A 1Q85A 5H8MA 3TQ0A 4U5IA 1J18A 3COTA 1TR9A 3TUUA 4GI9A 1EJVC 4LB3A 2QMJA 3O3RA 8CGTA 2E68A 4JX4A 3BG5A 4LY8A 5ABFA 4F9DA 1BWKA 3W53A 1WDPA 3W7GA 4NIRA 3WD3A 1O5XA 1PEZA 4MFEA 3RR4A 4GZEA 3NL6A 2Z4GA 3RIKA 2B7NA 1GEHA 2BVDA 3CV6A 4IM4A 3ZLHA 4AY8A 2OOGA 1MXDA 2OWXA 4OZOA 2V5LA 3QBUA 3KLJA 3RN6A 2ASHA 3AHYA 1JOAA 3DKJA 1AK5A 2X05A 2V3GA 3F2CA 1BHGA 4X2RA 1SW0A 3UY8A 3VCRA 4MG4A 2VEGA 2YYUA 3TOYA 4PH6A 2VM8A 1EP3A 1FWHC 1NH6A 3W1AA 5A95A 3UG4A 2J7CA 3HG2A 5CEWA 1DXIA 5E93A 3NXFA 4GYPA 1VC4A 1DBTA 1JCYA 2A5HA 3GRSA 2GGJA 1GORA 3BAYA 3CLWA 1XW8A 2WSYA 3M7WA 4AD0A 1EA9C 2JGYA 2PDIA 3WH6A 3LCFA 5EFDA 3S2NA 4RL3A 3CL6A 4ZOBA 5C55A 4HNVA 4H4ZA 1WDWA 2NXHA 1QTWA 2H8ZA 1ITUA 4AZCA 2J66A 1P6BA 5KETA 5CSSA 3QR0A 4UUIA 1VP5A 3RG6A 4P7QA 4CQBA 3E12A 2WKJA 4IHCA 1XIMA 2RUSA 5FL0A 2VZUA 1C92A 3RLVA 4TVCA 5E9XA 3DKLA 2PWGA 4GYJA 3E0IA 5G1YA 1VHNA 2I5QA 1TRDA 1HP5A 1WX0A 3KHDA 2ZZCA 1DVJA 5FAJA 2WOQA 1FWAC 4JOMA 4MWAE 2JKEA 4Z08A 4FF7A 2W3RA 2I9EA 2J7HA 1BF2A 4YCPA 4Y7EA 1SB3B 4TTUA 3WBXA 2ZYFA 2X8CA 1KCXA 4HZ6A 1E5NA 2WOVA 2A3EA 4GVHA 3ZVHB 2V5KA 3ETRB 2GFTA 1CXHA 4MY9A 3L8KA 4GZ7A 3PTKA 4M7SA 3TR9A 1JDAA 1XWYA 1EEPA 1C9WA 4RW5A 2O9PA 1RH9A 2VFEA 4UFMA 4WDWA 1NIUA 4PUJA 1B9ZA 4KKXA 1W32A 1XDIA 3HPAA 1QJWA 1E51A 4PUUA 4CNOA 1MZHA 3HGJA 1P43A 4PMUA 1I2PA 4A8NA 2ZX5A 3QZ6A 1BRLB 2UZ9A 1GXFA 5FS8A 3GUWA 4TTGA 2DSZA 3K13A 1NFPA 4H83A 1JAEA 2AL2A 2GQ3A 3T81A 2ZRVA 4V1XA 1MRAA 2VD8A 2ZA2A 1TFVA 2P3ZA 2CZFA 1JUBA 5HJXA 3SCSA 1FP8A 3LY0A 2IQTA 3LSBA 2HXUA 3QQWA 3SN0A 5LNRA 1GQJA 4JXCA 1R3RA 1OFBA 4A21A 4Q22A 3R0DA 4F4RA 4ZTXA 4O0QA 1QW7A 1H6VA 1XIJA 1EZWA 3VU2A 2WZHA 2V5BA 4JHMA 5A3HA 2NVKX 2D22A 2ONEA 3ZJ6A 3R79A 2VC5A 3GIQA 3M47A 1RUSA 1LBMA 5DN1A 2O9OA 1WXZA 2CW6A 3BJTA 1DWJM 2J74A 1C8YA 5D09A 5EBUA 4H1ZA 3IUHA 1VHCA 5AYIA 4H4VA 2GQAA 3OB8A 3N11A 2E9LA 4H4XA 1D7KA 3PG8A 3E0FA 3BWWA 2X16A 4XKYB 1OG6A 4DJEC 5AB3A 1CGUA 4FZIA 2ZX7A 1OY0A 3R13A 2PDNA 3V16A 1OQFA 3OHMB 1RCXB 4KCTA 5JCKA 3FK4A 1AJ2A 5HPOA 1X6LA 1KCZA 1VBGA 4E2BA 2QEZA 1EBDA 4WVXA 3PZUA 4ZSUA 3AAMA 3SFWA 4RE3A 4A2RA 4MNMA 1JDCA 3BG9A 5BCAA 4O4WA 5D2YA 4A3RA 4S3JA 3O7UA 2YB4A 2XYLA 4L6DA 3AMCA 3F03K 3HU7A 3AXKA 2EJ1A 3A5FA 4UFKA 4URIA 2W3ZA 3U57A 2FGBA 1KRCC 2ZZ5A 3LRKA 1UC5A 1J5TA 5TIMA 1LVLA 2YBUA 4H3DA 2Q71A 3SUUA 3UU0A 1LRNA 1ADSA 1ZJAA 1YX1A 5A1AA 7REQB 5E09A 4LV9A 4PFMA 4LANA 1C9DA 3AS1A 1F4HA 3TV8A 3TSMA 2EKCA 5IDZA 3N29A 1W2VA 5A8MA 3RITA 5HMFA 2EJAA 1J5SA 2A21A 4ZO7A 4AISA 3VKJA 4F0SA 1OCNA 1SU5A 4PMNA 3UPMA 4QJ5B 3THUA 3I6EA 3PAOA 2PB1A 3PBGA 5KSWA 2GUYA 1YXDA 1EQPA 1YW1A 3OVRA 5EMYA 4HP5A 2Z00A 3W75A 1B3YA 1B3VA 3MHFA 4FXSA 3N13A 5CSYA 3BUVA 4BWLA 1SFSA 4HN8A 2Y8KA 2DY3A 3IUDA 4QTGA 1GCYA 1WZMA 3ME3A 4LAMA 4KWUA 1SSDA 3SZ8A 3G3DA 3R6IA 3GXNA 4AB4A 1AL7A 1L0PA 1ICPA 2PDWA 1UG6A 3M6DA 1JJKA 3SQPA 1JCLA 1EIXA 5I3FA 2VKZG 1KM0A 4HMEA 4UWMA 5HXMA 5CAHA 1V0NA 5AYBA 4ZEPA 1H09A 4HCDA 4PMRA 4GXMA 3NZRA 1P4CA 4JFVA 4RK8A 1EYEA 3DFSA 4ZB0A 4HGXA 4MB1A 4X2PA 3S9IA 1BYAA 2VX7A 3M5VA 5I07A 1VDVA 4JDBA 4P7RA 2GDVA 4A6GA 5C9WA 2V30A 1W91A 2Q8LA 1ICQA 4MWAA 1PJ9A 2BS9A 4RJEA 4A3UA 1E4NA 4C7DA 1Q45A 4DELA 1A5OC 2ISSA 2WKGA 1X2GA 3ATYA 5I0DA 3D47A 1DKWA 1E6QM 4H8NA 3W7LA 1X1NA 4O11A 3YPIA 3S42A 1DIOA 4NNCA 1UYQA 4YTQA 3F5KA 3O8AA 4HYVA 1PV8A 4MVAA 1SJDA 3SAZA 3H2FA 1OZQA 3LTSA 5MKGB 2PMQA 1GRAA 2IXUA 3KAOA 2HPMA 2WP5A 4BF9A 5AZ0A 3IGSA 3LBMA 2AAMA 4AHPA 1RCOB 3S4TA 3SCQA 4YWSA 4DJFA 5C9UA 2WPGA 3MWCA 5HQEA 4UTWA 1Q6GA 3CUGA 4MNJA 2ZX8A 1CCWB 4XO7A 2PF8A 4ZQRA 3I65A 3FV9A 1H7XA 4RNHA 4EAYA 3H2OA 1D3CA 1M01A 1OGSA 1BYBA 3RXZA 3QEZA 4LX4A 2R1KA 1R7OA 3AMLA 1VFUA 2YA2A 2V0TA 1FH8A 3MSGA 5DCBA 2EPNA 5FS6A 3CQJA 3UNDA 2EPMX 4HHMA 4WIWA 4BQ5A 4FALA 4IPIA 5DT7A 4Y2WA 1A5AA 4JTTA 1STZA 4JQ4A 2YBVA 4DX3A 4OECA 4PCNA 1LT8A 4Z2LA 1UWUA 4JEJA 4PZVA 3H4XA 1ZLPA 3W1NA 3AHXA 4GA8A 2ZVIA 1TIWA 1I0BA 2X99A 2CETA 3H2NA 2ZRWA 4RZ5A 2PTYA 2NQLA 3O05A 2CESA 3UCDA 1CGVA 4WJEA 4OGZA 1RVGA 4R88A 4YCOA 1EUNA 4GQRA 1LDCA 2ZWZA 2W54A 1BD0A 1LORA 1TWSA 5JCIA 3URAA 1TKKA 4GYFA 4B4FA 3IJ9A 3NR0A 3UA4A 2XZ9A 4EK7A 2Z1WA 4Z2GA 1ZENA 2VR4A 7TAAA 2RDWA 2Y61A 3SGZA 4N4QA 3RLUA 3CUIA 2A3BA 2WBKA 1JNEA 4PCFA 1FWIC 1LOQA 3A7RA 5G1MA 3NL5A 1VZWA 4Y9MA 4GJ1A 3VNKA 5C6MA 3N4FA 4Z0JA 1W8GA 4E4PA 1QNQA 4HNNA 2YZ5A 2I57A 1FVPA 1DNCA 3GY1A 4FOUA 3AFBA 1XUZA 1FEAA 4I8DA 5LA0A 4CNUA 1WUEA 3ALGA 3NG3A 2WJZA 1AH0A 2CBIA 2VL4A 1F5ZA 3W6LA 4AZ6A 4TVWA 4JS3A 3A22A 4H6RA 3TTEA 4C91A 1VEOA 1OADA 1TELA 2GVLA 1Q4WA 4EKJA 1E6SM 2I17A 3P81A 4ILSA 3V4BA 4N42A 4N2YA 5AYXA 4BI6A 4FX8A 3NTYA 2X0HA 4WXYA 1WUFA 1MQPA 3CUJA 2OLHA 2OMAA 2X8HA 1PSCA 1I9CB 3QLLA 2PEVA 2NXIA 4O1FA 1XG4A 2Y62A 5CGQA 1IEXA 3CMJA 4AC7C 2J8GA 4GACA 1F8MA 1V3KA 3IJLA 2J8TA 4NNBA 3MCOA 2OGJA 3PB0A 3UR2A 1K4HA 1ZHAA 5FI8A 3UNTA 2CPUA 2BLEA 1XD1A 1FHDA 3RX4A 5HUPA 3NJ3A 3DFOA 3EB2A 4DF2A 3A4WA 4H8VA 5FD0A 4F79A 4MYAA 2ZZ1A 4PL2A 1WBJA 2ZA1A 1OYBA 1QPQA 4JQAA 9CGTA 4LFYA 3PZNA 4MOZA 3ZJ8A 2W61A 5AHNA 2CXGA 4XAZA 3E0VA 4D6JA 2FPYA 4NXSA 3ZJ7A 2PWVA 5I77A 2DIKA 2PDFA 3E5BA 4PULA 4IG2B 1FP9A 4H9VA 4NSBA 1DQUA 3CLMA 5LNWA 1JCMP 4RUBA 3W02A 2J7FA 3GH4A 5G5HB 4QAIA 2Y4SA 2GVGA 4UBPC 2RABA 3SIMA 4AZBA 2XM2A 1XINA 2VO5A 4QGCA 2DZVA 4QX4A 2JK2A 2NZLA 3CQHA 1FQ0A 3M5XA 3GW3A 1Q1RA 1JGMA 4UFHA 1AW2A 3KP0A 3TQVA 5A2CA 2HQAA 2POZA 5CH9A 4KIRA 4K36A 1U5HA 1PYFA 3GFYA 3UWEA 4M24A 2G41A 2I5GA 3L65A 1OIFA 3LN3A 3WMSA 2VFFA 1UKPA 4AAJA 3LA4A 5H91A 1W1A1 1F9CA 4QSHA 2VOTA 3L4XA 4V27A 3B9AA 1H3GA 2E5DA 4F2TA 1K9DA 3W25A 3QR1A 2QLYA 1PVNA 1DXLA 5JCNA 4W87A 4UTMA 4UTTC 1JCNA 1V02E 5F4XA 1HKKA 3FVDA 3M46A 4LV4A 4CUCA 4GQBA 1XLBA 1AH3A 2DZBA 2J7GA 1RSCA 3LCWA 3TYDA 1SPQA 4UTKA 3MCNA 4O10A 1OC5A 3QGKC 3GR8A 4N02A 3WY1A 1T40A 3LYEA 1TR1A 3ABSA 2YQUA 4IQLA 1WDRA 2EQ6A 1XKJA 4TV5A 3B8TA 1Z32X 2IUZA 3OLGA 2UBPC 4Q8QA 3C5QA 3VNDA 4MKNA 5IOBA 5SWUA 2QPXA 5AHIA 1D3HA 3IEBA 3GK0A 2VVNA 3ANUA 5LZLA 4JNMA 3TMLA 2VUNA 2D20A 5FAGA 2W0UA 1JFXA 2I1OA 3OIXA 3VGGA 3HRDC 3Q58A 1GOWA 1E6NA 3RMEA 1O60A 1F7BA 1ZAHA 1EOKA 1ONRA 2VEFA 3MDWA 4O28A 2GVEA 2JEPA 3MDUA 1XYZA 3W24A 1ZJHA 5EB8A 3WQPA 2GRTA 5A69A 4MF4A 1GRGA 4CCDA 4O53A 1GVYA 4PMVA 1PIIA 2G4FA 4JR5A 4C5ZA 4D6IA 3V35A 4H9UA 1V6XA 1S2AA 2POTA 4MM1A 3F4WA 2GSEA 3BOLA 3CGBA 4RNFA 4OBRA 4KMQA 3NPWA 1ZP4A 4GC4A 1R9ZA 5F2MA 3Q37A 2QPUA 1KRAC 1GRFA 4J9JA 1YTDA 1MI3A 2VELA 4XAYA 3CZKA 4TMBA 4XTDA 1HF6A 2V82A 4RZ4A 2YLLA 1J8VA 4IQEA 3W1RA 4JTSA 3VOHA 4C1KA 2OSXA 3DDMA 3OU8A 4EMJA 4XSMA 1F61A 2HE8A 5D4YA 4DBWA 2F38A 1UIPA 4A22A 3CU2A 2YL8A 5J04A 3UG5A 4I6KA 1PHWA 1X7FA 4P5UA 2OLSA 4H4QA 2CHOA 4MWAC 3WLHA 1H5VA 3EBVA 2J78A 1OIMA 2GUUA 3PJXA 5FEWA 2WC7A 1IT7A 3MKVA 4S2BA 2D23A 2UY2A 3BGGA 1XRFA 4JKMA 4JNYA 2QCEA 3DCPA 2PGEA 2CITA 1LLOA 2A3AA 4GBUA 2OYLA 1O7AA 3ARSA 2A7RA 2VC9A 2G3JA 4Q32A 1Y5VA 4CN6A 1W3LA 3PZ9A 5CJ5A 1V8EA 4DJFC 1MEWA 3MYPA 4JIRA 1KLZA 2QVHA 4DUOA 3LGGA 3C6CA 3TJXA 3VM5A 1VFHA 2V69A 4MDOA 1GGOA 4DUVA 2PDGA 3QPYA 1BLIA 5G5IA 4F2UA 2RHGA 3V1PA 1US3A 1XLMA 3IGUA 1GQKA 4MZ1A 4DQWA 3NO3A 3JVAA 3FLUA 1PIFA 5CBIA 1C91A 3RO8A 2AQOA 4UFJA 1XLAA 3VNLA 2G95A 2HTMA 3OLIA 2BY3A 3CT2A 3QYQA 1T0OA 4DM2A 2BNJA 3BO9A 1NJJA 1ZQ5A 3D3AA 1EKOA 4EWJA 1WV2A 5C2XA 2B31A 1Q6LA 3AZSA 3DBPA 3T1GA 2QJJA 3HMJG 4ATLA 5FOOA 1TWZA 3U9IA 1TV8A 2OQYA 4QP0A 1JZ6A 1SO3A 4IH3A 3W07A 4G7EA 2Y7GA 8XIAA 3ERPA 2R14A 1TYPA 1JPMA 2B0MA 2CXEA 4R9XA 5M3WA 3NSMA 3KBSA 3WBWA 4UTIA 2X2GA 3AWOA 5BOOA 1G4SA 2V6OA 1JF5A 4J3UA 2Y89A 4QJ1A 3VUPA 1ZCCA 1D2KA 3NUKA 3CHDA 3LBCA 5G4EA 3AMGA 3CEPA 4TQTA 3CAQA 3ANYA 4O8RA 3BAIA 5BOEA 3ZT6A 1EX1A 3DGRA 1P1MA 5CC7A 1P7TB 3C0SA 1KWGA 5LKYA 2VI0A 3GC2A 3NZ1A 4RPPA 3TYUA 4HA0A 4MAVA 1KXHA 2PWEA 3SJNA 4JIHA 5D8WA 4L61A 4KEMA 1ISYA 5F4WA 4UCFA 4N4PA 3N9RA 2WPCA 1IT8A 3E2SA 4RDZA 1V02A 5HBFA 4ZFMA 4HU4A 1JYXA 4IT1A 3KBJA 1ZAIA 3L4UA 3WQDA 1EXPA 4LVBA 2GYIA 2Z1BA 1XYMA 4LF1A 1K7XA 3H21A 4O16A 3WQVA 4XAPA 1UR9A 1MO0A 1K77A 3EEGA 1V6YA 2ZQ0A 5DEZA 2WNNA 1G67A 2O4MA 3EUB3 3M0IA 2FVLA 4LUIA 1MMFA 2CFFA 2GVYA 3AIUA 3BCFA 4LVGA 1Y8BA 3FIGA 2WHLA 1NSJA 1WKFA 1Y65A 4O54A 2J6VA 4R85A 2G3FA 4Z1YA 4DNAA 4K7ZA 1N5XA 2V6AA 2XSAA 1QW8A 3EOEA 3PZQA 3MSYA 3CQ0A 3TJIA 1YIXA 1EBHA 4LQ1A 1E1CB 4I7VA 4ML9A 1PPIA 5M1TA 3AICA 3U3HA 3GIPA 1LBLA 4P2VA 3FEMA 1TX2A 3T78A 2DSVA 4M1BA 3LSCA 1PX3A 2QCFA 1PYMA 1C7TA 4U33A 4KGLA 1QBBA 3G2GA 3FDGA 1LUCB 4F9JA 4H9TA 3POCA 2W6RA 1PX8A 1LLZA 4JN7A 2O7SA 2DW7A 3VGDA 2R1LA 3TDFA 4BY3A 3WK0A 2G5WA 3ZQ9A 5HDRA 3BW2A 2IXVA 4MGGA 5FF0A 1SR9A 1JI1A 2FZ8A 1NY1A 1W1TA 3DAQA 3EA3A 2OZ0A 4EIVA 4M6QA 1FWGC 4P8VA 4IGSA 5ECVA 3RU8X 5KITA 4ADTA 3MMUA 2NSOA 1KWKA 6TAAA 1OCJA 2BMBA 5C7VA 4HOWA 3BCJA 3NZPA 2V2CA 3TONA 1UH4A 3P5YA 2R8WA 3PHAA 3CZ8A 1X8CA 4M81A 2WVVA 1TCDA 1GJUA 3UXKA 3EOLA 5EYWA 2QJHA 4H4TA 4UR9A 4JTIA 5CAKA 1DWAM 4A3QA 5F2GA 1OK6A 3GD3A 4GUHA 4LEQA 1GOOA 2QCMA 5G4WA 1MQRA 4AZ5A 1Q6EA 1SJAA 2AMGA 2WSKA 1MRQA 2QCCA 5KZ6A 4J57A 4YXGA 1LWHA 5KZDA 1Q4NX 1ADOA 3WMBA 3RO6A 1MWOA 2VDIA 3HFTA 3NDYA 4ZODA 1GOXA 1LG1A 5AHEA 3IAPA 3GRIA 1M7PA 3WFAA 4S23A 6REQA 2J9XA 4AD3A 2ZFAA 3MBFA 4IP4A 3NVZB 5GQBA 3GVWA 3OIHA 1QR7A 3GTXA 3SCNA 1BF6A 4BS0A 2D3NA 1U1UA 3LTPA 4ADUA 1OCQA 1FWFC 1Y5WA 3PR2A 4HZ8A 3TNBA 4Y90A 3FJ4A 1OVDA 1TIMA 3P8IA 5BMWA 2XISA 1SVDA 2A79A 3TW7A 1VFTA 4UTHA 3DC0A 2WKLA 1FH9A 5PTDA 4H7ZA 1OD0A 1C7SA 2X8RA 1XIGA 1E73M 3L23A 4FNPA 2EPLX 3URQA 4H4PA 1DL3A 2G3IA 1UUQA 3NQMA 2REQA 3UEQA 3MSRA 3W2JA 1Q8JA 1QO2A 2PLKA 5D2WA 1MFUA 3UBPC 4E3TA 3CB8A 4ZTYA 4C6EA 2VEPA 1L6FA 4M29A 5LHFA 5T9CE 3CHFA 3AS3A 1VGAA 4YPJA 2W0HA 1KM2A 2DZWA 2OWWA 1H1ZA 3TE9A 1E3ZA 1UQZA 2EQ9A 4XAGA 3EDEA 1VLWA 2RDXA 3QOKA 2GR2A 5EMLA 1W9BM 1SYTA 4GI6A 3W2NA 3MSDA 1NFGA 4F48A 1KRMA 2OJPA 1MXGA 1FCQA 5D02A 3PZMA 3UF9A 1VYRA 1BSLA 3PK7A 3TTQA 4CGTA 2OODA 4GY0A 3FAWA 1V3JA 2OKOA 3IJDA 2WBAA 4B5UA 4JEQA 2DORA 4F8XA 1V6VA 2CLEA 4IFKA 5D8ZA 3S6OA 3DC8A 2A3CA 4BFAA 1O4UA 3W7JA 1Z8AA 4B9ZA 4TX8A 3HOJA 2ATMA 5HR6A 2XIQA 2TAAA 3QMTA 2QCHA 1JI2A 2CWNA 3STPA 2CLKA 2ZRXA 3DFQA 5CZSA 2CKRA 4XZWA 1M04A 2JKAA 3CIXA 4W7UA 4NVTA 4W88A 4XTIA 3K8LA 4EPBC 2PTDA 1AH4A 2QJMA 1DJQA 2VX5A 2PDHA 3CPUA 5IBXA 1GVIA 1HL2A 4K8GA 2IPFA 2ZUWA 4IIBA 4S3CA 3WUFA 2X0YA 2R1MA 5F4SA 1JL8A 5I3KA 3K8MA 3VE9A 3WUEA 4L56A 1QUMA 4GX9A 3RU6A 4MKSA 1D3GA 1W54A 3E0WA 4AXKA 1GSNA 4DPPA 2QJNA 4EXQA 5EGRA 1OYCA 1PL9A 1VH7A 3MBDA 4FEZA 4YMZA 3SN1A 1YLVA 3A13A 3S5NA 3J7HA 5H8PA 3PAJA 3KRUA 1H61A 3KL0A 4K8EA 4JYDA 5JU6A 1GONA 2WMHA 1XYCA 1EA0A 3L12A 2WCSA 1V51A 3RM8A 3W7PA 3KM8A 1GOKA 5DF0A 4P7NA 1LF1A 5BXTA 1F6KA 4GH1A 1WYGA 1JD7A 1M65A 3B9NA 2IPGA 4GO9A 3AXXA 2F84A 1FBAA 1TCMA 3S9ZA 1AODA 4XQ6A 5CGTA 3MYOA 2XINA 5AOUA 1SM9A 1O95A 3ONCA 1LQ0A 5CGMA 5C9XA 4X9YA 1P0BA 1W3NA 3ZS4A 1H0IA 3A6OA 3N9KA 1GJWA 1B5TA 2WNZA 2E09A 3TQKA 1T8QA 4H8HA 3UJRA 2XFRA 2FQIA 2PF0A 2WMFA 1YQ2A 3OZYA 2DEPA 4OOUA 5GNYA 3DHPA 1FDZA 2YX0A 3RX2A 3VILA 1OJTA 4NX0A 4UFIA 2Y88A 1NDZA 5JBEA 3AHZA 3FSTA 4LUYA 1XHGA 3FSUA 4B5WA 3R11A 5LGZA 3DG7A 2IKJA 4L80A 2IS7A 3PZVA 1FFUC 4AIBA 4LUSB 5F1UA 1TWIA 1H41A 4CCZA 4UQBA 3TSBA 4RW3A 1TUXA 4EE9A 3EWBX 1EHNA 4PTDA 2D3LA 4FS9A 2OYKA 4H9MA 1K9FA 3WEZA 3AC0A 2OKTA 4C6DA 2WJEA 2DQXA 3WF1A 3VZZA 2RAGA 3PTDA 5KVIA 2ZC1A 3BGAA 4ALDA 1VFOA 3CBWA 3L0KA 1F4AA 3LCHA 3V7PA 1BEUA 2RGMA 3S5OA 1GRTA 3K4DA 4X0VA 4L9XA 2VD9A 1OJXA 1ZFJA 4Q8TA 1UD5A 3P62A 3CAWA 4S1FA 2BC1A 5JMUA 3MJYA 3WO8A 1AQHA 1OX6A 1XIIA 4RE2A 3C8FA 3DFYA 2GVJA 4LTSA 1XDJA 4QEEA 3R8HA 1EBGA 1HKJA 4WD0A 5TAOA 1AVAA 4AU0A 2ZKMX 3VA8A 1CECA 4AX6A 1A47A 1RK6A 2AQVA 3B0YA 4QCFA 2NPXA 3T09A 2X2YA 4AMCA 1E71M 4DZ5A 3KOXA 3KBNA 1BG9A 4EXAA 1WXYA 4IXXA 4INFA 1I45A 2A2IA 3O6AA 2TYSA 3BAWA 2MANA 5KINA 3VDHA 4POCA 2H6RA 4W93A 1REQB 4ZB2A 4F2BA 4FB7A 3TYZA 3A23A 4LAKA 4LS1A 3HQ1A 4JTCA 4G9PA 1U5VA 7TIMA 4AEEA 1V3LA 3BARA 4MUPA 1XGEA 3OVPA 1IXQA 3SQSA 2ESCA 2WQPA 1S5NA 1UW9A 1SO6A 1OYAA 1QO5A 2OSYA 1CDGA 5B80A 1KKOA 1ALDA 1TZ9A 4IGHA 4JTKA 3ZR6A 3RCMA 3K8KA 1EEXA 4B9YA 3WK2A 2XFYA 5DBUA 5H2ZA 1QATA 3GNNA 3EDJA 1ESWA 4AZIA 1BWVA 1Z69A 4PMXA 3RCNA 1U22A 3PBMA 1B3OA 4BKNA 2IQ0A 3H26A 4H01A 2YCJA 4MWAB 1DP0A 1J01A 4DUXA 2WPBA 8TIMA 3W3OA 5E0FA 2WSPA 1V3IA 1E6XM 3H23A 4JFUA 4KRTA 4Q8PA 4AYGA 3W1PA 1H2JA 2BXZA 1LTDA 5ER0A 3IVUA 3VCNA 2BFGA 3AISA 3WK1A 2VCBA 2HWGA 1DHKA 4IMEA 1L2QA 1IWBA 3QN3A 5AC6A 6A3HA 1P6WA 3S5SA 4C90A 4FNQA 3LM3A 4QAWA 4MHBA 5FF7A 5A5WA 2NV2A 5JIWA 4J2MA 3CEUA 1EDGA 3OZMA 4Z1CA 1I2RA 2IPJA 4WKAA 5C0QA 1W1IE 3LRMA 2E28A 5A8GA 3GC5A 1RJPA 4WJ8A 1Y5XA 5FS7A 1OFAA 1DQWA 1UR1A 4HPHA 2DW6A 2JFEX 3SW6A 4ZZ9A 4GLEA 3RHGA 4J3SA 1M9HA 4U31A 3SUVA 5LIXX 4K7VA 2XN2A 1SJBA 3CGDA 1N82A 1WOAA 3N6QA 3EX1A 1AJZA 3R12A 2DJLA 4Y9AA 1SMDA 3EKLA 4GG9A 4KFPA 3V75A 4G1NA 3SCVA 3W2KA 3WJYA 2DGAA 1XLCA 4HA1A 3QC0A 2EG6A 1ONEA 1TB3A 4UNKA 1UZHA 2YVFA 1G7VA 3TXZA 3OJGA 1LRQA 4DO4A 2VURA 2WHJA 4MFDA 3B8VA 2AKMA 4DRSA 3DZ1A 3RRAA 1W9PA 4ZOEA 3UY7A 3W87A 3LS9A 3II1A 1UKSA 3SRDA 3SY5A 3BLKA 3DJGX 4FNTA 2ZZ6A 3WBEA 1ZALA 4L4MA 3B8SA 4Z17A 3S2CA 5CPOA 4LC6A 5FEPA 5IHSA 1SW3A 1DWGM 5GVJA 4HSNA 4PMJA 1F3WA 4HOXA 1RZMA 1B2YA 2CNCA 1A49A 1QHOA 2DT0A 4GVFA 4CD7A 5EY5A 1A3XA 5G2HA 5BROA 3VIJA 2X42A 5REQA 4GGHA 5I79A 3GXPA 4NJHA 3BOXA 1CEOA 4ZO8A 4H00A 1THFD 2QDDA 1WAWA 4D6GA 1R85A 1DIKA 4NEWA 5FJTA 5LIYX 3BLPX 1J0JA 2GJXB 3FGCA 2VEMA 3OG3A 1EX5A 4TMCA 2C1GA 3SRHA 2UY3A 5CSRA 3AYSA 3QPEA 4GKTA 3QHNA 2XSXA 5CQ1A 1XS2A 1AZ1A 1V03A 1NTHA 3HV9A 3TP4A 1QNVA 3MQTA 3PBWA 2YGYA 1EP1A 2RDTA 1UB3A 2X1IA 2CC0A 2VC6A 3G0XA 4WJXA 3UR8A 4MUZA 2QUVA 5AHMA 3VZXA 3TROA 2HVNA 3USZA 2YW4A 4H4IA 4JQ2A 2CZ5A 1KFKA 1W5QA 3S5YA 3REQA 1WA3A 3L4WA 1FKXA 2RJGA 1OFQA 1VLIA 3VNYA 2EQ8A 3HW2A 1MW0A 3GG0A 3THDA 1PCWA 4PCSA 4HU8A 4LYPA 1R0MA 3W1MA 3GWQA 3CPGA 3ONBA 2DZTA 1EQCA 3GXIA 4O1DA 4EP8C 3AJXA 3CAVA 1TE1A 4US5D 3N4EA 2VDHA 1ZY8A 5IHRA 3SRKA 1KM6A 3D9XA 2VMFA 4WHBA 2XN1A 4FLRA 4C5YA 3L4YA 3V0SA 4YJ5A 2Q09A 4MJMA 1WZAA 5BNKA 3GXDA 2QUTA 4QXIA 3I3DA 3GU2A 5LIUX 4FK9A 2B4GA 5L9FA 2WZMA 3B4YA 4BCEA 1DJIA 3L7RA 4O15A 3LPGA 3B8UA 1T96A 1R5YA 4OV9A 2OVLA 4E0CA 2QUMA 2QCDA 5J5RA 3CZEA 1UOZA 4R27A 4CCCA 3L66A 1HT6A 2FTYA 3S2MA 3VOJA 1XXXA 3SB0A 4JTDA 3NZQA 1RY8A 1Z41A 3CNYA 3HJZA 4GZJA 3PNUA 4KCWA 2WANA 3LRLA 3B9DA 1CGWA 2E8YA 4Q4MA 3VIMA 4DN1A 4FNUA 3KLLA 3AIEA 1ICSA 1HJUA 4WSJA 1HGWA 1E0TA 2WC4A 4HHPA 4YHEA 1HKIA 1XIEA 2F6XA 1FECA 4AWUA 2VRJA 1H11A 3SGGA 3PUOA 3W01A 4JHOA 2PFHA 2Z2AA 4XD4A 1UD6A 1CB7B 4LBRA 1YPFA 5JCMA 1JZ7A 4J3ZA 3OOQA 1P0NA 1QASA 3OGVA 1MQQA 2NQ5A 4LCQA 3E49A 2Y5SA 3HPSA 4CLMA 1ZPTA 4ZOCA 1HL8A 1E72M 3N04A 4IPNB 1TYGA 3AIVA 3F4VA 1AZ2A 2NLYA 1UR3M 1KFCA 1WKEA 2ZZ3A 4ZCWA 3IVTA 3S1WA 2G97A 3NQ7A 2Z26A 3PTMA 1KTNA 2KZHA 1HKWA 4GXPA 3DHDA 1XH1A 3II4A 3UWWA 4WY0A 2MNRA 1R9XA 1CLKA 3NPVA 2W91A 4B90A 1MW3A 1L6WA 4RXFA 3P0XA 1DJGA 5GRTA 1PAMA 4YU1A 1JYWA 1G9HA 4O1AA 5JBDA 3QLDA 2X7WA 2RH9A 3W2MA 3ARTA 3C3NA 3ZO9A 1WKDA 2DUAA 2GR0A 2WVSA 2VFHA 3T05A 4UR7A 3AS0A 2YJQA 4DB7A 1X6UA 1KB3A 3TFXA 3L5AA 1W17A 2GDQA 1VFSA 5K7JA 1J9YA 4LNYA 3K4WA 2EBNA 3KOFA 4OT7A 2F6KA 2ZADA 4YVXA 5DRCA 3TX9A 4FLQA 2DSWA 3GNXA 1WO2A 5BXRA 2W3SA 3AI0A 2D0HA 3MUZ1 5E6ZA 1E1EA 1R3TA 1FHLA 3IK4A 3G77A 3WL0A 4QLJA 2YVGA 2HRWA 2NVCA 4G8TA 3G1XA 4M56A 2WPFA 3C2FA 3DFTA 1SFTA 1EHAA 3W83A 2QYGA 3HPFA 3ZLGA 2BDQA 2YR1A 1IXOA 1IV8A 3OP2A 3G8RA 3VOFA 4ERIA 8XIMA 3KWSA 2WNWA 3TC7A 1TMQA 3LPPA 3DG6A 2FJKA 1GPWA 2FLIA 2YCLB 3TWBA 3HM7A 2O56A 4GIAA 2HISA 3BMWA 1X38A 4KW2A 2DZPA 2V67A 1KM4A 3DYMA 2TPSA 5BU9A 1ISWA 3QM3A 4MY1A 1XUUA 3PM6A 2E1DA 1E4IA 3PUGA 1V0KA 1CGXA 1LCOA 1UJQA 1JIBA 1S39A 2WZIA 1LQ2A 3M1ZA 5HULA 1OX5A 1JUEA 3O9NA 4RR4A 4JTGA 4O13A 3HJEA 4DI9A 1X98A 2C0HA 1UZ4A 4OFCA 3O15A 1ODUA 1PWLA 3ZYZA 4LVFA 5FACA 3SCWA 1H50A 4FHAA 1UD3A 2FZNA 3T0TA 4ZOHB 2EG8A 1E70M 3UGVA 4B16A 5A6JA 2Z2UA 2WMIA 4GC3A 4HHLA 4IIFA 4P8WA 1KXQA 1VD6A 4MDPA 3W7QA 1WKYA 1FWDC 3RR1A 3LENA 4HPGA 1BYCA 1DWIM 3VKBA 3F5JA 8RUCA 1UP0A 1I6NA 4M19A 3TNOA 1W1VA 3TCSA 3E2RA 3W1UA 4G2DA 4WDXA 2B7PA 1RBOB 3CZJA 4ZA0A 1HJWA 1XSJA 3WSUA 3IJ7A 1XBVA 1R3VA 3WDIA 4Q4OA 2J79A 4NU7A 3WH5A 3R10A 5DY2A 1HJVA 1VCVA 2IW0A 2BVTA 2NQZA 4FI4A 2PDLA 2ZDRA 4K38A 4ZQPA 2NV1A 3OLEA 3ARXA 3VYLA 4CD4A 4J3VA 3GUGA 4E2VA 3M0KA 3ORWA 5I3JA 1W1PA 3N3MA 2HK1A 3CH0A 2CEQA 2C6QA 1DIDA 4HA4A 2ALRA 1Z44A 7A3HA 2PP1A 3BAKA 1IZJA 5U25A 4HNTA 2X1SA 4GABA 3APYA 2Z28A 3P93A 3MS8A 1A4MA 1AW1A 2PDBA 3ITVA 3N2BA 3AUOA 3R43A 4KPRA 5CCZA 1F6YA 3HB9A 3TZFA 1GKPA 3VMNA 3VGEA 2V5CA 3VPLA 1X1OA 2PRHA 1PBGA 4NAFB 2XFFA 4GNJA 3H7VA 5D2TA 2X30A 3QHOA 1OGBA 3WQOA 3TZNA 1BWCA 4JN8A 4DJDD 4L4OA 2VWSA 3A3XA 3IJIA 2BP1A 1JRPA 1SJCA 2XHYA 5AC4A 2IKIA 3ZIZA 3PZIA 2XTKA 3EMCA 3T2QA 1BSIA 2GWGA 2CBJA 2XGZA 1HXJA 4IQDA 1JFHA 4DZAA 2PP3A 2NUXA 2DIJA 3TYBA 3N9SA 1E4LA 3TAKA 2BOFX 5I09A 1J12A 2CLPA 3DK8A 1W8SA 1J0ZA 3GHUA 1HQTA 3O06A 1HO4A 3WF3A 3H2CA 4AD2A 3GNOA 4XBSA 1M03A 1YXCA 1JZ4A 1K4QA 1TA3A 5DMMA 1X2HA 1M3UA 4W89A 3EDFA 3WBYA 1L8NA 4H4WA 2QS8A 1RPXA 1EJSC 4XZMX 2YA0A 2BTMA 1IEWA 4DAFA 3QC3A 2PLCA 1GTEA 3W1TA 1BGGA 1Z42A 4H04A 2VEIA 3VGHA 1KO0A 4LYKA 5ABGA 4AY7A 4QHRA 2X09A 2DT2A 3LADA 4FLSA 4KGJA 1X6NA 5FCZA 3EWDA 1A0CA 4LJ3A 1HGYA 3KE0A 2PDCA 3IVSA 2C14A 3RPMA 4N9CA 4IJCA 1NF7A 2WP6A 2ZCGA 1N8WA 1K8XA 1I8JA 3WLTA 3TJLA 3OZPA 4B92A 3RFAA 3NVTA 4N0RA 4PGLA 1NFBA 3EX6A 3CL8A 1TMLA 3ZZ1A 2YDRA 3HV8A 2HE5A 1A0EA 3U2CA 3M0JA 2Y5EA 3M0LA 3SSJA 3E02A 3MB9A 4D6FA 4DO6A 1D7YA 3R1ZA 3B03A 1AW5A 3U4AA 4XUYA 1KXVA 2WVVB 4GBDA 5FJOA 3CYJA 2BWGA 4UTLA 2CDUA 3OA5A 1GV4A 5BXPA 1RCQA 5BWAA 1M6IA 4HTYA 3WLPA 1I2NA 4GNVA 4QDPA 4B91A 1AD1A 3W1XA 1PUDA 4IMAA 2XIJA 4Z2KA 2XJ7A 1ZY9A 1E9LA 2OU4A 1MUCA 4IFOA 4I6VA 1CXIA 1QT1A 3DEQA 3TCEA 1XI3A 1XYFA 3T6CA 1N62C 2HV5A 1GVQA 4ATWA 4Y96A 2OQHA 3VMOA 3HG3A 1E1FA 1R3YA 3B9JB 4K39A 3N25A 4ZGYA 4L6OA 4J28A 3CWHA 4FAMA 1MEIA 1MYRA 3WIJA 3N2XA 3B8DA 1LYXA 1RP8A 3PANA 1KGUA 2OCZA 3GR4A 4UFLA 4TU1A 1W0MA 4P7LA 4H4UA 3ES7A 3VCCA 1QPKA 3VIPA 1DOSA 1UR4A 1B90A 2PDJA 1KGWA 2DSKA 3FFSA 4DNHA 5MHBA 1E40A 2E6DA 1UWIA 1BKHA 2PE4A 3V36A 3S0CA 1FWWA 1UR2A 3A4AA 4G7FA 4QITA 3QFBA 5EMMA 4ERGA 1VAHA 3D0CA 4YNGA 3VDBA 2V5JA 4W4QA 3RM9A 3SY1A 1ZB5A 1UBPC 1UPMB 3S2LA 2REQB 4CVUA 1Q6QA 1S5MA 4HQVA 1EDTA 3ZVIA 3R89A 3QZAA 2GL5A 1KM5A 3W29A 3KEHA 4J3TA 4MYXA 3UXLA 2XWEA 1YADA 4HSOA 2GDUA 1DORA 4FP1A 5D32A 4HJWA 1WZLA 1BZLA 1NOFA 2P0OA 3OYZA 3T2PA 1SMAA 4RX0A 1YMYA 3NL2A 4C6IA 3P84A 3ZSSA 4LNCA 4MJ2A 4QIUA 1OC7A 1XQKA 3KZSA 3VKCA 4D2JA 3OBKA 1J0HA 2EQDA 2ZZ2A 3L68A 1RJRA 3ZFHA 3GBDA 5J8LA 3DGHA 4EPDC 1FWBC 2YB1A 2X7VA 3BDKA 1NOWA 1OFRA 2L5HA 2QR6A 1PKYA 4U2YA 1U83A 2PWHA 3TR2A 4QRNA 3EDDA 1J0YA 1QW9A 4OVXA 2YL5A 5CPSA 2C91A 3TQPA 2R1NA 4RE4A 4RDVA 1W37A 1ISZA 2Y2WA 3ZLFA 3ZR5A 1Y0EA 3LV6A 1F05A 1XP3A 3VNMA 3RPTA 5BU6A 3MJMA 3QYSA 2HCVA 3EYPA 1BRLA 4PA8A 4B5XA 1Z6KA 3HA1A 3EWCA 3MMDA 2QUNA 1EJXC 3AXIA 2E1WA 2OT1A 3T4CA 4WRHA 4I5RA 4YIWA 4WZHA 5HNTA 5AC5A 3UWQA 3GLCA 4ZXOA 1TG7A 2ISDA 3VIHA 3UZZA 4H9YA 3GB6A 3WFZA 4AZ7A 2CLMA 3WLQA 4J7RA 5CC3A 1YYAA 9XIMA 5A2BA 1UWTA 5RUBA 1KQYA 1POKA 3C86A 3H2MA 1C8VA 5EPDA 2WOWA 4GYKA 3A12A 2Y8VA 2ZA3A 4UQAA 4AEOA 3WLNA 5HNRA 2XVPA 4KEZA 3ZSTA 2OX4A 4TX9A 1T8XA 2Z25A 4A3HA 3WNPA 2ADAA 3LLXA 4KWOA 1VCGA 3LPFA 4LVDA 2VRQA 3QY6A 4Z1BA 3UVAA 5HWNA 1IWAA 4NAEA 3PNZA 1H5YA 4IP5A 1US0A 1TREA 3W27A 4DXKA 1A3HA 3K1GA 2Z7KA 5I00A 3EWZA 4XKYA 3ANVA 1KQZA 1M7XA 5E70A 1K7EA 5FSEC 3AXMA 4HMCA 2X1UA 1BTMA 1ELSA 5FL1A 2RJHA 1IIHA 2ZX6A 4O0KA 5K2ZA 4ZB5A 3IV3A 1X8FA 2ZUNA 3FA4A 2I9UA 4US5A 4LUTB 4PUWA 1ZJIA 2YLAA 1F3TA 1JNDA 3V0UA 3HQOA 3FYPA 3WJSA 2GK1B 3PVFA 4JTLA 3P3BA 3I6TA 4ZBCA 4J35A 2HK0A 4GQQA 2D0FA 4JZ5A 4JBRA 1ZU8A 4IPPA 3CQKA 3CWOX 3EA1A 5HJLA 3WLOA 1I2QA 2TRSA 2C15A 2E4TA 3L4ZA 3MTWA 1VS1A 1H0GA 2EHHA 3VIFA 1E15A 1ZNNA 1RJQA 3V5FA 3SQMA 4UZUA 4IXHA 5TD4A 3QV7A 7REQA 1HJSA 1SFLA 4IIEA 4HYWA 2PGRA 2FYMA 3WENA 5CZTA 4E4UA 3CUHA 2W66A 1LL6A 1O66A 2VTFA 1LRTA 2DDXA 4Z2JA 1EGMA 1B9BA 1XLHA 3N3TA 1T41A 4PRRA 4AF0B 2WSRA 4ZVJA 3SCOA 1KBKA 3NDZA 4MB5A 2NV9A 2QGYA 1BXBA 1SW7A 1CBGA 1FY6A 1PKLA 3PB2A 2VJXA 4Q4SA 3ABXA 4OKDA 1CXLA 2DV0A 4LS0A 2CLFA 1E6RA 1VFLA 2JF7A 2PC8A 2I14A 4A29A 3DJJA 1OBAA 2ZUVA 2DFAA 2QXWA 4YTUA 4GI8A 1E6ZA 1T99A 1GQNA 4C6FA 5FSDC 2ZRZA 4HU3A 1WQ5A 4UMBA 3M4HA 2DJXA 3LK6A 3QV9A 3WLLA 2DH2A 2YFNA 3FJLA 2WM1A 2G96A 3SN4A 2J75A 2XH2A 1F74A 3AYVA 3GVRA 1ME8A 2OGYA 3NAVA 4W5ZA 5DX7A 3TFCA 3U48A 3B4UA 3BVJA 3VGBA 2GSHA 3TTSA 2VR2A 1FWCC 1LL4A 1XCWA 3C2VA 1XIHA 7XIMA 1HX0A 4WOQA 4JX6A 1OX4B 4GMEA 2P5NA 4XZIA 3VABA 4P7OA 1XLDA 3CTTA 1EUAA 2X1TA 3D46A 5DMYA 4LB4A 3NQBA 2ZIDA 3S8HA 1PDYA 3GVVA 1E6PA 5AKQA 4WLCA 3VFCA 4DY1A 3PBYA 3PUDA 3QW3A 2QUUA 3B0XA 4KWVA 4JTUA 3S47A 3ABRA 4LY4A 1E43A 1JQXA 5MKGA 3XINA 5H8UA 3SQLA 4ZXLA 3M0HA 2YXXA 2UY5A 4C6PA 2CZVA 2ISWA 4ACZA 3N2OA 2BY1A 3LXAA 3UA3A 2WMGA 1UWSA 5HK4A 3W7CA 3NXLA 5TBOA 5KZMA 4JYFA 2XIOA 4NZ4A 1GYNA 4HSHA 1S7MA 4HKPA 3CT7A 2ZTJA 1O12A 3W71A 3WNOA 4V1YA 4HJFA 1K02A 3T0CA 4IPJA 3WEMA 1TX0A 3OO2A 1TZZA 2CZEA 4GWEA 3CGCA 4QCEA 4R5EA 3UQNA 2VDGA 1GT8A 1K8ZA 2GR1A 4F3HA 1GUVA 1W3TA 2ATSA 4Q6JA 3I3EA 3M0MA 3EKZA 4QM1A 3B8WA 1L6SA 2ZXBA 1F3EA 4N7QA 4XX6A 3P2VA 2J13A 5H6HA 4ZQMA 1Q6CA 2OX1A 5F1VA 1YNQA 1AD4A 2HNEA 3QQ1A 1B3XA 3OGSA 2CBVA 3W7OA 2WJFA 4DWSC 2ISFA 3LOTA 2CLIA 4S3BA 3WUBA 3LXBA 1ONXA 4ADWA 3MCMA 3R0UA 3VDCA 2ZZ0A 3N1AA 2VZVA 1PIGA 2VYOA 5DQPA 1TV5A 2VX6A 1FHVA 5DANA 4NF7A 3H55A 4JTJA 2WXDM 4I9AA 5EMUA 4FSAA 4N6FA 3AU6A 4JIIX 1O1HA 3KLKA 1E0UA 3ICJA 1XR2A 3QTPA 4HMDA 1Q8AA 2HEJA 2C13A 5G5GB 4W8LA 2NUYA 2Q6ZA 4PCTA 3DUGA 2NQHA 3R07C 4E38A 1W9XA 3EWXA 3CYVA 2PLJA 3W7DA 4DHGA 2YL9A 3WKZA 1RPKA 3M43A 2WCGA 1PHQA 3AALA 3GG1A 4DBDA 4JQ9A 5T91A 3UERA 6TIMA 2YXOA 3H2AA 1FUYA 1P0EA 4PTXA 3NQGA 5FJJA 3F4CA 1V6WA 4CQAA 2IKGA 1I1WA 2VZTA 2X40A 2HS8A 4GX8A 2BGNE 1B4EA 1DTNA 1G69A 4I90A 2CLHA 1IF2A 3MUXA 4IIDA 3VD9A 4NL1A 3O0KA 1KTCA 3LQLA 1L6YA 2QAPA 3A4JA 2YVJA 3NVYB 2Y5JA 3CHVA 2GOKA 3LZ3A 5CC5A 4GVIA 4JTRA 2XFWA 4ZQNA 4CVWA 1TPUA 3STGA 5GJNA 3R58A 4L4LA 4FMVA 1J6OA 3DOPA 3JU2A 3WQCA 4L9ZA 2E6YA 1ZRQA 2Y7DA 3LDVA 2AQWA 4F0RA 2G4JA 2ICSA 1PDZA 4R7JA 1J2WA 3WNLA 1XL9A 1EC9A 1P1XA 4L64A 2XIBA 4IMCA 3MI3A 3WD0A 1IIGA 4LU0A 2Y63A 3VD3A 2PU1A 3UZYA 4GY1A 3PF3A 1GOQA 1XCFA 3H8AA 5IM51 2ZX9A 3N2CA 4GKLA 5D05A 4E6MA 2V81A 1QI5A 2XGBA 3LCIA 3WF4A 1XLFA 3R2GA 2Z6IA 3LHWA 3EANA 3RUBL 1GOMA 2QCGA 4DNMA 3NQAA 3MU7A 3VD7A 3ELFA 4FOJA 3VUSA 4QG6A 2ZUUA 4ERAA 4X0NA 1HKMA 2F61A 5CPQA 4TVYA 3EMQA 4Z2IA 4EXBA 3V5OA 4IG2A 4WXZA 1ME7A 4PUMA 3C0JA 3LGDA 4JL1A 5BWFA 1DTUA 1XDMA 1GOIA 3TKFA 1TV2A 3NOYA 1GREA 2GWNA 4D9PA 4UCGA 4DJDA 1VR6A 3S6DA 3THCA 1S46A 2NX3A 4IX0A 3AO0A 3WDJA 1HFBA 3FKRA 4KWWA 3FXYA 4KCVA 2OG9A 3H53A 1BTCA 4GYPC 4XB3A 4CD6A 3TC6A 2GLKA 1KXTA 5LA2A 3MUAA 1DIEA 1NAL1 4XWUA 1L9WA 9XIAA 2Z7GA 3NQCA 3D3FA 3MY9A 3NM3A 4PEEA 3W7MA 4L6HA 4V28A 4KS0A 3KS6A 1FFVC 5A6BA 4W84A 1QPNA 2WHKA 1XSKA 4B3KA 4ENLA 1FA2A 4XD6A 1GVEA 1ECEA 3MI6A 1JCTA 4S39A 1SZEA 4L4PA 2ZBTA 1MSSA 3MO4A 5ABEA 4WF7A 2O0TA 2FGLA 1VB9A 1OFOA 5DCEA 5EBKA 4JYEA 2E40A 4JIEA 2D0GA 4PCPA 1KBLA 2DSUA 2ZUMA 1W6TA 1VEPA 5D30A 2FPVA 4LCSA 4Y9OA 4CU7A 4UTJA 1ADDA 3UR7A 1YKWA 3VXGA 4C1LA 3WCZA 1I75A 1YBQA 3BURA 2FDMA 3GDMA 3PN8A 3HPXA 4XG1A 3KRBA 5DCDA 1T5AA 4BEUA 3E38A 2GQ9A 4H4SA 3CO8A 4O57A 4B4HA 1S38A 3AUJA 2ISVA 1JZ2A 3UCCA 3A7UA 3LZ5A 1KM1A 1PZ0A 2NQJA 5C7HA 3LCXA 3OG2A 2PDUA 1UJPA 2H9AB 2Q01A 1TPFA 4LBSA 2PCEA 3ARQA 3DK9A 1EGVA 2Z2BA 1FDJA 1LZOA 2DUZA 4QG8A 2B7QA 4FIRA 3AMZA 3B0PA 1XC4A 5LXEA 5IRPA 1FDYA 4RXGA 1XPYA 3BMXA 4K68A 4LH8A 5D03A 1YHTA 2QKFA 2VC7A 3PBUA 1DEDA 3GHRA 5E5CA 3RAOA 2R94A 1LM1A 3DN5A 3KL5A 1TSIA 4HVXA 4TUFA 4WY0B 2CWXA 3BJFA 3LCLA 3BXWA 2WNQA 3BJSA 4DPQA 3RMJA 4PMZA 1AL8A 1GKRA 4Q8OA 5CZ0A 4PTMA 1TJ2A 1J96A 3STCA 1YTEA 4E8GA 4JIQA 1SR0A 1DWFM 1E9ZB 3MHGA 1F3XA 2OZTA 4S38A 4PC8A 4ZFCA 3KRZA 1OSEA 1IZKA 5CG0A 2NLIA 3C0QA 3NL3A 4NYYA 3UETA 4IJRA 1V93A 1AMYA 1XQLA 4BURA 4E8CA 3DERA 4G1KA 4J5NA 4AHOA 4F0MA 2VFIA 1O5KA 5HINA 3GZAA 4CNNA 4DZIA 4QBXA 3PWAA 3VIIA 4Z42C 4B2DA 3INPA 2XPKA 2FFIA 2VGFA 4DLMA 1VFMA 2OYMA 1MW1A 1UA7A 2HBXA 2VRKA 1J11A 1XYAA 3FS2A 3UESA 3BLIA 3SFKA 2J62A 3VDGA 3E96A 3ITLA 1A5UA 3G6MA 3NCOA 4WR3A 4HK7A 5HNUA 1ZGDA 3STEA 3G1AA 1JR1A 3L67A 3T7VA 2PWUA 2PUZA 1QNPA 3GKFA 1N2VA 1XIFA 1ODZA 3PPGA 1AUSL 1MVYA 4LOCA 4Q7NA 3VTRA 1GPFA 3DYPA 4YVVA 1LPFA 3U5UA 3BSGA 3VNIA 3V1HA 3QFEA 4O52A 3AYRA 1BGAA 3CMGA 4M82A 3QF0A 3N19B 3NQDA 2IQDA 3GTNA 1V7YA 3N18A 3E0LA 2C3CA 5LHEA 4AMAA 4UQDA 1JAKA 4C65A 3BG3A 4IMDA 3EXRA 1NWUA 4NQ1A 6CGTA 3B06A 3UXDA 5EFFA 3QSTA 2QCNA 3EAUA 4BQ2A 1NDVA 4U3CA 2OWCA 4EQWA 3SDOA 2QQ6A 4EQSA 4L65A 1K9EA 3LXDA 4HK6A 4MJZA 2EO7A 1US2A 1RM6B 2FDSA 1E55A 3SRFA 1AG1O 1AQMA 2WCAA 2X1RA 2QJGA 3S46A 3W7HA 1PXGA 1S3HA 1JF6A 1IGWA 2QZRA 4NXKA 4OBSA 1FWSA 3G1YA 1KBJA