3FXIA

Crystal structure of the human tlr4-human md-2-e.coli lps ra complex
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
601
structure length
601
Chain Sequence
EPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Toll-like receptor 4
publication title The structural basis of lipopolysaccharide recognition by the TLR4-MD-2 complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 181
structure length 601
sequence length 601
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13516 LRR_6 Leucine Rich repeat
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3fxiA00
2A0ZA 4R07A 4Z8GA 5IYXC 1M0ZA 3WPGA 1GWBA 3WPIA 3ZYOA 4V2CA 1KOHA 3VQ2A 4Q62A 5CMPA 4C2BB 1FO1A 5B0NA 2ELLA 5GMGA 4R6AA 4CC4A 1K5DC 2JE1A 5AWDA 3G3AA 1QYYA 4IM6A 4R0AA 2P1QB 2WQWA 4RCWA 4FDWA 2WQXA 3WPHA 4CILA 1Z7XW 4R5DA 2BEXA 2Q4GW 1LTXA 2ASSB 4ARNA 2JE0A 2V9SA 2FT3A 4Q3GA 4LSXA 2V70A 4R6GA 1KOOA 1A9NA 1OTNA 1DFJI 2WQUA 3CIGA 3CIYA 2Z82A 1U0ND 3E3ZA 1XWDC 4LSCA 4L3AA 2OMZA 3SB4A 4Z79A 1M9SA 3O6NA 1XECA 4XGOA 4TZHA 2OMYA 3UL9A 1PGVA 3E4GA 2P1OB 4QC0A 2XOTA 1FS2A 3ZYJA 4PQ8A 1ZIWA 3G04C 4V2DA 1P8TA 2WQVA 2OMXA 1YRGA 4U09A 5D3IA 1DS9A 4OQTA 2Z7XB 2Y5QA 4K17A 2UZXA 4KXFB 2Z66A 3OJAB 4G8AA 4XSQA 2O6RA 4FD0A 4R58A 4P91A 1W8AA 4AY9X 3REZA 1FT8A 2O6QA 2OMUA 4R6FA 4ECNA 3RFEA 4R09A 3BZ5A 2CA6A 3CVRA 2Z62A 3W3MA 5LFNA 3W3JA 3WPEA 5HDHA 4CP6A 3M18A 1SQ0B 4LXRA 4BSRA 4M7EC 3KJ4A 2XWTC 1WWLA 5GMHA 4FHOA 2ID5A 3C6OB 4V2EA 4R08A 4Z64C 2Z65A 4LI1A 4B8CD 3E2JA 3ZYIA 3A79B 4R5CA 4AW4A 4C2AB 4QXEA 1FQVA 4Z94G 3C6NB 2Z7XA 3OGMB 4NKGA 2P1PB 3M19A 3OJAA 5A5CA 3GOZA 2ASTB 3RFSA 3WN4A 4BSUA 2V9TB 3UN9A 1O6SA 3OGKB 3JB9j 3PMHG 5B4PA 3UL7A 4Q3IA 3RGXA 3WPBA 3WPCA 2IFGA 5AWCA 3W3NA 1P9AG 4KNGA 4H09A 4LSXC 1O6TA 3RJ0A 4HQ1A 3G3BA 3W3LA 3O53A 4I6JB 1A4YA 1JL5A 4LI2A 5AWAA 3W3GA 3WPDA 1DCEA 4U08A 1H6UA 4RWTC 2Z63A 3UL8A 5GS2B 1XKUA 4P8SA 2UZYA 3ULUA 2P1MB 1D0BA 4FS7A 5GMFA 1XEUA 1H6TA 5HZLB 3RW6A 2P1NB 4GT6A 5B0TA 1P8VA 5IJCA 4RCAB 3ULVA 3RFJA 1XCDA 3OGLB 4R6JA 1OGQA 4ARRA 4YEBB 4U06A 4WP6A 1OZNA 4BV4R 4Z61C 3G06A 3P72A 3FXIA 4PSJA 3ZYNA 3VQ1A 1OTMA 2RA8A 5IJDA 4MQWX 1OTOA 1G9UA 4ECOA 3C6PB 4FMZA 5FTTB 1M10B 2O6SA 4CC4C 1OOKG 2BNHA 4NKHA 4CNMA 4MN8B 4L3FA 4QBZA 3RW7A 5GS0A 2OMTA 3RIZA 4PKIG 4XOSA 2OMWA 4CNCA 3E6JA 3G39A 4FCGA 5GQRK 4BSSA 4J4LA 2Z81A 5AWBA 3DZEA 2R9UA 5IJBA 3TSRE 4U7LA 3W3KA 1IO0A 5AZ5A 4PEQB 1M9LA 4UFRA 4LXSA 4PERA 4WYKA 4Y61B 2Z64A 4LSAA 3RGZA 2JQDA 3ULAA 1K5GC 2OMVA 5CMNA 3WPFA 4KT1A 4J0MA 4M7EA 1O6VA 2WFHA 4GLPA 4EZGA 2RR6A
chains in the Genus database with same CATH superfamily
2A0ZA 4R07A 4Z8GA 5IYXC 1M0ZA 3WPGA 1GWBA 3WPIA 3ZYOA 4V2CA 1KOHA 3VQ2A 4Q62A 5CMPA 4C2BB 1FO1A 5B0NA 2ELLA 5GMGA 4R6AA 4CC4A 1K5DC 2JE1A 5AWDA 3G3AA 1QYYA 4IM6A 4R0AA 2P1QB 2WQWA 4RCWA 4FDWA 2WQXA 3WPHA 4CILA 1Z7XW 4R5DA 2BEXA 2Q4GW 1LTXA 2ASSB 4ARNA 2JE0A 2V9SA 2FT3A 4Q3GA 4LSXA 2V70A 4R6GA 1KOOA 1A9NA 1OTNA 1DFJI 2WQUA 3CIGA 3CIYA 2Z82A 1U0ND 3E3ZA 1XWDC 4LSCA 4L3AA 2OMZA 3SB4A 4Z79A 1M9SA 3O6NA 1XECA 4XGOA 4TZHA 2OMYA 3UL9A 1PGVA 3E4GA 2P1OB 4QC0A 2XOTA 4NZTM 1FS2A 3ZYJA 4PQ8A 1ZIWA 3G04C 4V2DA 1P8TA 2WQVA 2OMXA 1YRGA 4U09A 5D3IA 1DS9A 4OQTA 2Z7XB 2Y5QA 4K17A 2UZXA 4KXFB 2Z66A 3OJAB 4G8AA 4XSQA 2O6RA 4FD0A 4R58A 4P91A 1W8AA 4AY9X 3REZA 1FT8A 2O6QA 4NZRM 2OMUA 4R6FA 4ECNA 3RFEA 4R09A 3BZ5A 2CA6A 3CVRA 2Z62A 3W3MA 5LFNA 3W3JA 3WPEA 5HDHA 4CP6A 3M18A 1SQ0B 4LXRA 4BSRA 4M7EC 3KJ4A 2XWTC 1WWLA 5GMHA 4FHOA 2ID5A 3C6OB 4V2EA 4R08A 4Z64C 2Z65A 4LI1A 4B8CD 3E2JA 3ZYIA 3A79B 4R5CA 4AW4A 4C2AB 4QXEA 1FQVA 4Z94G 3C6NB 2Z7XA 3OGMB 4NKGA 2P1PB 3M19A 3OJAA 5A5CA 3GOZA 2ASTB 3RFSA 3WN4A 4BSUA 2V9TB 3UN9A 1O6SA 3OGKB 3JB9j 3PMHG 5B4PA 3UL7A 4Q3IA 3RGXA 3WPBA 3WPCA 2IFGA 5AWCA 3W3NA 1P9AG 4KNGA 4H09A 4LSXC 1O6TA 3RJ0A 4HQ1A 3G3BA 3W3LA 3O53A 4I6JB 1A4YA 1JL5A 4LI2A 5AWAA 3W3GA 3WPDA 1DCEA 4U08A 1H6UA 4RWTC 2Z63A 3UL8A 5GS2B 1XKUA 4P8SA 2UZYA 3ULUA 2P1MB 1D0BA 4FS7A 5GMFA 1XEUA 1H6TA 5HZLB 3RW6A 2P1NB 4GT6A 5B0TA 1P8VA 5IJCA 4RCAB 3ULVA 3RFJA 1XCDA 3OGLB 4R6JA 1OGQA 4ARRA 4YEBB 4U06A 4WP6A 1OZNA 4BV4R 4Z61C 3G06A 3P72A 3FXIA 4PSJA 3ZYNA 3VQ1A 1OTMA 2RA8A 5IJDA 4MQWX 1OTOA 1G9UA 4ECOA 3C6PB 4FMZA 5FTTB 1M10B 2O6SA 4CC4C 1OOKG 2BNHA 4NKHA 4CNMA 4MN8B 4L3FA 4QBZA 3RW7A 5GS0A 2OMTA 3RIZA 4PKIG 4XOSA 2OMWA 4CNCA 3E6JA 3G39A 4FCGA 5GQRK 4BSSA 4J4LA 2Z81A 5AWBA 3DZEA 2R9UA 5IJBA 3TSRE 4U7LA 3W3KA 1IO0A 5AZ5A 4PEQB 1M9LA 4UFRA 4LXSA 4PERA 4WYKA 4Y61B 2Z64A 4LSAA 3RGZA 2JQDA 3ULAA 1K5GC 2OMVA 5CMNA 3WPFA 4KT1A 4J0MA 4M7EA 1O6VA 2WFHA 4GLPA 4EZGA 2RR6A
chains in the Genus database with same CATH topology
2A0ZA 4R07A 4Z8GA 5IYXC 1M0ZA 3WPGA 1GWBA 3WPIA 3ZYOA 4V2CA 1KOHA 3VQ2A 4Q62A 5CMPA 4C2BB 1FO1A 5B0NA 2ELLA 5GMGA 4R6AA 4CC4A 1K5DC 2JE1A 5AWDA 3G3AA 1QYYA 4IM6A 4R0AA 2P1QB 2WQWA 4RCWA 4FDWA 2WQXA 3WPHA 4CILA 1Z7XW 4R5DA 2BEXA 2Q4GW 1LTXA 2ASSB 4ARNA 2JE0A 2V9SA 2FT3A 4Q3GA 4LSXA 2V70A 4R6GA 1KOOA 1A9NA 1OTNA 1DFJI 2WQUA 3CIGA 3CIYA 2Z82A 1U0ND 3E3ZA 1XWDC 4LSCA 4L3AA 2OMZA 3SB4A 4Z79A 1M9SA 3O6NA 1XECA 4XGOA 4TZHA 2OMYA 3UL9A 1PGVA 3E4GA 2P1OB 4QC0A 2XOTA 1FS2A 3ZYJA 4PQ8A 1ZIWA 3G04C 4V2DA 1P8TA 2WQVA 2OMXA 1YRGA 4U09A 5D3IA 1DS9A 4OQTA 2Z7XB 2Y5QA 4K17A 2UZXA 4KXFB 2Z66A 3OJAB 4G8AA 4XSQA 2O6RA 4FD0A 4R58A 4P91A 1W8AA 4AY9X 3REZA 1FT8A 2O6QA 2OMUA 4R6FA 4ECNA 3RFEA 4R09A 3BZ5A 2CA6A 3CVRA 2Z62A 3W3MA 5LFNA 3W3JA 3WPEA 5HDHA 4CP6A 3M18A 1SQ0B 4LXRA 4BSRA 4M7EC 3KJ4A 2XWTC 1WWLA 5GMHA 4FHOA 2ID5A 3C6OB 4V2EA 4R08A 4Z64C 2Z65A 4LI1A 4B8CD 3E2JA 3ZYIA 3A79B 4R5CA 4AW4A 4C2AB 4QXEA 1FQVA 4Z94G 3C6NB 2Z7XA 3OGMB 4NKGA 2P1PB 3M19A 3OJAA 5A5CA 3GOZA 2ASTB 3RFSA 3WN4A 4BSUA 2V9TB 3UN9A 1O6SA 3OGKB 3JB9j 3PMHG 5B4PA 3UL7A 4Q3IA 3RGXA 3WPBA 3WPCA 2IFGA 5AWCA 3W3NA 1P9AG 4KNGA 4H09A 4LSXC 1O6TA 3RJ0A 4HQ1A 3G3BA 3W3LA 3O53A 4I6JB 1A4YA 1JL5A 4LI2A 5AWAA 3W3GA 3WPDA 1DCEA 4U08A 1H6UA 4RWTC 2Z63A 3UL8A 5GS2B 1XKUA 4P8SA 2UZYA 3ULUA 2P1MB 1D0BA 4FS7A 5GMFA 1XEUA 1H6TA 5HZLB 3RW6A 2P1NB 4GT6A 5B0TA 1P8VA 5IJCA 4RCAB 3ULVA 3RFJA 1XCDA 3OGLB 4R6JA 1OGQA 4ARRA 4YEBB 4U06A 4WP6A 1OZNA 4BV4R 4Z61C 3G06A 3P72A 3FXIA 4PSJA 3ZYNA 3VQ1A 1OTMA 2RA8A 5IJDA 4MQWX 1OTOA 1G9UA 4ECOA 3C6PB 4FMZA 5FTTB 1M10B 2O6SA 4CC4C 1OOKG 2BNHA 4NKHA 4CNMA 4MN8B 4L3FA 4QBZA 3RW7A 5GS0A 2OMTA 3RIZA 4PKIG 4XOSA 2OMWA 4CNCA 3E6JA 3G39A 4FCGA 5GQRK 4BSSA 4J4LA 2Z81A 5AWBA 3DZEA 2R9UA 5IJBA 3TSRE 4U7LA 3W3KA 1IO0A 5AZ5A 4PEQB 1M9LA 4UFRA 4LXSA 4PERA 4WYKA 4Y61B 2Z64A 4LSAA 3RGZA 2JQDA 3ULAA 1K5GC 2OMVA 5CMNA 3WPFA 4KT1A 4J0MA 4M7EA 1O6VA 2WFHA 4GLPA 4EZGA 2RR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A0Z A;  4R07 A;  4Z8G A;  5IYX C;  1M0Z A;  3WPG A;  1GWB A;  3WPI A;  3ZYO A;  4V2C A;  1KOH A;  3VQ2 A;  4Q62 A;  5CMP A;  4C2B B;  1FO1 A;  5B0N A;  2ELL A;  5GMG A;  4R6A A;  4CC4 A;  1K5D C;  2JE1 A;  5AWD A;  3G3A A;  1QYY A;  4IM6 A;  4R0A A;  2P1Q B;  2WQW A;  4RCW A;  4FDW A;  2WQX A;  3WPH A;  4CIL A;  1Z7X W;  4R5D A;  2BEX A;  2Q4G W;  1LTX A;  2ASS B;  4ARN A;  2JE0 A;  2V9S A;  2FT3 A;  4Q3G A;  4LSX A;  2V70 A;  4R6G A;  1KOO A;  1A9N A;  1OTN A;  1DFJ I;  2WQU A;  3CIG A;  3CIY A;  2Z82 A;  1U0N D;  3E3Z A;  1XWD C;  4LSC A;  4L3A A;  2OMZ A;  3SB4 A;  4Z79 A;  1M9S A;  3O6N A;  1XEC A;  4XGO A;  4TZH A;  2OMY A;  3UL9 A;  1PGV A;  3E4G A;  2P1O B;  4QC0 A;  2XOT A;  1FS2 A;  3ZYJ A;  4PQ8 A;  1ZIW A;  3G04 C;  4V2D A;  1P8T A;  2WQV A;  2OMX A;  1YRG A;  4U09 A;  5D3I A;  1DS9 A;  4OQT A;  2Z7X B;  2Y5Q A;  4K17 A;  2UZX A;  4KXF B;  2Z66 A;  3OJA B;  4G8A A;  4XSQ A;  2O6R A;  4FD0 A;  4R58 A;  4P91 A;  1W8A A;  4AY9 X;  3REZ A;  1FT8 A;  2O6Q A;  2OMU A;  4R6F A;  4ECN A;  3RFE A;  4R09 A;  3BZ5 A;  2CA6 A;  3CVR A;  2Z62 A;  3W3M A;  5LFN A;  3W3J A;  3WPE A;  5HDH A;  4CP6 A;  3M18 A;  1SQ0 B;  4LXR A;  4BSR A;  4M7E C;  3KJ4 A;  2XWT C;  1WWL A;  5GMH A;  4FHO A;  2ID5 A;  3C6O B;  4V2E A;  4R08 A;  4Z64 C;  2Z65 A;  4LI1 A;  4B8C D;  3E2J A;  3ZYI A;  3A79 B;  4R5C A;  4AW4 A;  4C2A B;  4QXE A;  1FQV A;  4Z94 G;  3C6N B;  2Z7X A;  3OGM B;  4NKG A;  2P1P B;  3M19 A;  3OJA A;  5A5C A;  3GOZ A;  2AST B;  3RFS A;  3WN4 A;  4BSU A;  2V9T B;  3UN9 A;  1O6S A;  3OGK B;  3JB9 j;  3PMH G;  5B4P A;  3UL7 A;  4Q3I A;  3RGX A;  3WPB A;  3WPC A;  2IFG A;  5AWC A;  3W3N A;  1P9A G;  4KNG A;  4H09 A;  4LSX C;  1O6T A;  3RJ0 A;  4HQ1 A;  3G3B A;  3W3L A;  3O53 A;  4I6J B;  1A4Y A;  1JL5 A;  4LI2 A;  5AWA A;  3W3G A;  3WPD A;  1DCE A;  4U08 A;  1H6U A;  4RWT C;  2Z63 A;  3UL8 A;  5GS2 B;  1XKU A;  4P8S A;  2UZY A;  3ULU A;  2P1M B;  1D0B A;  4FS7 A;  5GMF A;  1XEU A;  1H6T A;  5HZL B;  3RW6 A;  2P1N B;  4GT6 A;  5B0T A;  1P8V A;  5IJC A;  4RCA B;  3ULV A;  3RFJ A;  1XCD A;  3OGL B;  4R6J A;  1OGQ A;  4ARR A;  4YEB B;  4U06 A;  4WP6 A;  1OZN A;  4BV4 R;  4Z61 C;  3G06 A;  3P72 A;  3FXI A;  4PSJ A;  3ZYN A;  3VQ1 A;  1OTM A;  2RA8 A;  5IJD A;  4MQW X;  1OTO A;  1G9U A;  4ECO A;  3C6P B;  4FMZ A;  5FTT B;  1M10 B;  2O6S A;  4CC4 C;  1OOK G;  2BNH A;  4NKH A;  4CNM A;  4MN8 B;  4L3F A;  4QBZ A;  3RW7 A;  5GS0 A;  2OMT A;  3RIZ A;  4PKI G;  4XOS A;  2OMW A;  4CNC A;  3E6J A;  3G39 A;  4FCG A;  5GQR K;  4BSS A;  4J4L A;  2Z81 A;  5AWB A;  3DZE A;  2R9U A;  5IJB A;  3TSR E;  4U7L A;  3W3K A;  1IO0 A;  5AZ5 A;  4PEQ B;  1M9L A;  4UFR A;  4LXS A;  4PER A;  4WYK A;  4Y61 B;  2Z64 A;  4LSA A;  3RGZ A;  2JQD A;  3ULA A;  1K5G C;  2OMV A;  5CMN A;  3WPF A;  4KT1 A;  4J0M A;  4M7E A;  1O6V A;  2WFH A;  4GLP A;  4EZG A;  2RR6 A; 
#chains in the Genus database with same CATH topology
 2A0Z A;  4R07 A;  4Z8G A;  5IYX C;  1M0Z A;  3WPG A;  1GWB A;  3WPI A;  3ZYO A;  4V2C A;  1KOH A;  3VQ2 A;  4Q62 A;  5CMP A;  4C2B B;  1FO1 A;  5B0N A;  2ELL A;  5GMG A;  4R6A A;  4CC4 A;  1K5D C;  2JE1 A;  5AWD A;  3G3A A;  1QYY A;  4IM6 A;  4R0A A;  2P1Q B;  2WQW A;  4RCW A;  4FDW A;  2WQX A;  3WPH A;  4CIL A;  1Z7X W;  4R5D A;  2BEX A;  2Q4G W;  1LTX A;  2ASS B;  4ARN A;  2JE0 A;  2V9S A;  2FT3 A;  4Q3G A;  4LSX A;  2V70 A;  4R6G A;  1KOO A;  1A9N A;  1OTN A;  1DFJ I;  2WQU A;  3CIG A;  3CIY A;  2Z82 A;  1U0N D;  3E3Z A;  1XWD C;  4LSC A;  4L3A A;  2OMZ A;  3SB4 A;  4Z79 A;  1M9S A;  3O6N A;  1XEC A;  4XGO A;  4TZH A;  2OMY A;  3UL9 A;  1PGV A;  3E4G A;  2P1O B;  4QC0 A;  2XOT A;  4NZT M;  1FS2 A;  3ZYJ A;  4PQ8 A;  1ZIW A;  3G04 C;  4V2D A;  1P8T A;  2WQV A;  2OMX A;  1YRG A;  4U09 A;  5D3I A;  1DS9 A;  4OQT A;  2Z7X B;  2Y5Q A;  4K17 A;  2UZX A;  4KXF B;  2Z66 A;  3OJA B;  4G8A A;  4XSQ A;  2O6R A;  4FD0 A;  4R58 A;  4P91 A;  1W8A A;  4AY9 X;  3REZ A;  1FT8 A;  2O6Q A;  4NZR M;  2OMU A;  4R6F A;  4ECN A;  3RFE A;  4R09 A;  3BZ5 A;  2CA6 A;  3CVR A;  2Z62 A;  3W3M A;  5LFN A;  3W3J A;  3WPE A;  5HDH A;  4CP6 A;  3M18 A;  1SQ0 B;  4LXR A;  4BSR A;  4M7E C;  3KJ4 A;  2XWT C;  1WWL A;  5GMH A;  4FHO A;  2ID5 A;  3C6O B;  4V2E A;  4R08 A;  4Z64 C;  2Z65 A;  4LI1 A;  4B8C D;  3E2J A;  3ZYI A;  3A79 B;  4R5C A;  4AW4 A;  4C2A B;  4QXE A;  1FQV A;  4Z94 G;  3C6N B;  2Z7X A;  3OGM B;  4NKG A;  2P1P B;  3M19 A;  3OJA A;  5A5C A;  3GOZ A;  2AST B;  3RFS A;  3WN4 A;  4BSU A;  2V9T B;  3UN9 A;  1O6S A;  3OGK B;  3JB9 j;  3PMH G;  5B4P A;  3UL7 A;  4Q3I A;  3RGX A;  3WPB A;  3WPC A;  2IFG A;  5AWC A;  3W3N A;  1P9A G;  4KNG A;  4H09 A;  4LSX C;  1O6T A;  3RJ0 A;  4HQ1 A;  3G3B A;  3W3L A;  3O53 A;  4I6J B;  1A4Y A;  1JL5 A;  4LI2 A;  5AWA A;  3W3G A;  3WPD A;  1DCE A;  4U08 A;  1H6U A;  4RWT C;  2Z63 A;  3UL8 A;  5GS2 B;  1XKU A;  4P8S A;  2UZY A;  3ULU A;  2P1M B;  1D0B A;  4FS7 A;  5GMF A;  1XEU A;  1H6T A;  5HZL B;  3RW6 A;  2P1N B;  4GT6 A;  5B0T A;  1P8V A;  5IJC A;  4RCA B;  3ULV A;  3RFJ A;  1XCD A;  3OGL B;  4R6J A;  1OGQ A;  4ARR A;  4YEB B;  4U06 A;  4WP6 A;  1OZN A;  4BV4 R;  4Z61 C;  3G06 A;  3P72 A;  3FXI A;  4PSJ A;  3ZYN A;  3VQ1 A;  1OTM A;  2RA8 A;  5IJD A;  4MQW X;  1OTO A;  1G9U A;  4ECO A;  3C6P B;  4FMZ A;  5FTT B;  1M10 B;  2O6S A;  4CC4 C;  1OOK G;  2BNH A;  4NKH A;  4CNM A;  4MN8 B;  4L3F A;  4QBZ A;  3RW7 A;  5GS0 A;  2OMT A;  3RIZ A;  4PKI G;  4XOS A;  2OMW A;  4CNC A;  3E6J A;  3G39 A;  4FCG A;  5GQR K;  4BSS A;  4J4L A;  2Z81 A;  5AWB A;  3DZE A;  2R9U A;  5IJB A;  3TSR E;  4U7L A;  3W3K A;  1IO0 A;  5AZ5 A;  4PEQ B;  1M9L A;  4UFR A;  4LXS A;  4PER A;  4WYK A;  4Y61 B;  2Z64 A;  4LSA A;  3RGZ A;  2JQD A;  3ULA A;  1K5G C;  2OMV A;  5CMN A;  3WPF A;  4KT1 A;  4J0M A;  4M7E A;  1O6V A;  2WFH A;  4GLP A;  4EZG A;  2RR6 A; 
#chains in the Genus database with same CATH homology
 2A0Z A;  4R07 A;  4Z8G A;  5IYX C;  1M0Z A;  3WPG A;  1GWB A;  3WPI A;  3ZYO A;  4V2C A;  1KOH A;  3VQ2 A;  4Q62 A;  5CMP A;  4C2B B;  1FO1 A;  5B0N A;  2ELL A;  5GMG A;  4R6A A;  4CC4 A;  1K5D C;  2JE1 A;  5AWD A;  3G3A A;  1QYY A;  4IM6 A;  4R0A A;  2P1Q B;  2WQW A;  4RCW A;  4FDW A;  2WQX A;  3WPH A;  4CIL A;  1Z7X W;  4R5D A;  2BEX A;  2Q4G W;  1LTX A;  2ASS B;  4ARN A;  2JE0 A;  2V9S A;  2FT3 A;  4Q3G A;  4LSX A;  2V70 A;  4R6G A;  1KOO A;  1A9N A;  1OTN A;  1DFJ I;  2WQU A;  3CIG A;  3CIY A;  2Z82 A;  1U0N D;  3E3Z A;  1XWD C;  4LSC A;  4L3A A;  2OMZ A;  3SB4 A;  4Z79 A;  1M9S A;  3O6N A;  1XEC A;  4XGO A;  4TZH A;  2OMY A;  3UL9 A;  1PGV A;  3E4G A;  2P1O B;  4QC0 A;  2XOT A;  1FS2 A;  3ZYJ A;  4PQ8 A;  1ZIW A;  3G04 C;  4V2D A;  1P8T A;  2WQV A;  2OMX A;  1YRG A;  4U09 A;  5D3I A;  1DS9 A;  4OQT A;  2Z7X B;  2Y5Q A;  4K17 A;  2UZX A;  4KXF B;  2Z66 A;  3OJA B;  4G8A A;  4XSQ A;  2O6R A;  4FD0 A;  4R58 A;  4P91 A;  1W8A A;  4AY9 X;  3REZ A;  1FT8 A;  2O6Q A;  2OMU A;  4R6F A;  4ECN A;  3RFE A;  4R09 A;  3BZ5 A;  2CA6 A;  3CVR A;  2Z62 A;  3W3M A;  5LFN A;  3W3J A;  3WPE A;  5HDH A;  4CP6 A;  3M18 A;  1SQ0 B;  4LXR A;  4BSR A;  4M7E C;  3KJ4 A;  2XWT C;  1WWL A;  5GMH A;  4FHO A;  2ID5 A;  3C6O B;  4V2E A;  4R08 A;  4Z64 C;  2Z65 A;  4LI1 A;  4B8C D;  3E2J A;  3ZYI A;  3A79 B;  4R5C A;  4AW4 A;  4C2A B;  4QXE A;  1FQV A;  4Z94 G;  3C6N B;  2Z7X A;  3OGM B;  4NKG A;  2P1P B;  3M19 A;  3OJA A;  5A5C A;  3GOZ A;  2AST B;  3RFS A;  3WN4 A;  4BSU A;  2V9T B;  3UN9 A;  1O6S A;  3OGK B;  3JB9 j;  3PMH G;  5B4P A;  3UL7 A;  4Q3I A;  3RGX A;  3WPB A;  3WPC A;  2IFG A;  5AWC A;  3W3N A;  1P9A G;  4KNG A;  4H09 A;  4LSX C;  1O6T A;  3RJ0 A;  4HQ1 A;  3G3B A;  3W3L A;  3O53 A;  4I6J B;  1A4Y A;  1JL5 A;  4LI2 A;  5AWA A;  3W3G A;  3WPD A;  1DCE A;  4U08 A;  1H6U A;  4RWT C;  2Z63 A;  3UL8 A;  5GS2 B;  1XKU A;  4P8S A;  2UZY A;  3ULU A;  2P1M B;  1D0B A;  4FS7 A;  5GMF A;  1XEU A;  1H6T A;  5HZL B;  3RW6 A;  2P1N B;  4GT6 A;  5B0T A;  1P8V A;  5IJC A;  4RCA B;  3ULV A;  3RFJ A;  1XCD A;  3OGL B;  4R6J A;  1OGQ A;  4ARR A;  4YEB B;  4U06 A;  4WP6 A;  1OZN A;  4BV4 R;  4Z61 C;  3G06 A;  3P72 A;  3FXI A;  4PSJ A;  3ZYN A;  3VQ1 A;  1OTM A;  2RA8 A;  5IJD A;  4MQW X;  1OTO A;  1G9U A;  4ECO A;  3C6P B;  4FMZ A;  5FTT B;  1M10 B;  2O6S A;  4CC4 C;  1OOK G;  2BNH A;  4NKH A;  4CNM A;  4MN8 B;  4L3F A;  4QBZ A;  3RW7 A;  5GS0 A;  2OMT A;  3RIZ A;  4PKI G;  4XOS A;  2OMW A;  4CNC A;  3E6J A;  3G39 A;  4FCG A;  5GQR K;  4BSS A;  4J4L A;  2Z81 A;  5AWB A;  3DZE A;  2R9U A;  5IJB A;  3TSR E;  4U7L A;  3W3K A;  1IO0 A;  5AZ5 A;  4PEQ B;  1M9L A;  4UFR A;  4LXS A;  4PER A;  4WYK A;  4Y61 B;  2Z64 A;  4LSA A;  3RGZ A;  2JQD A;  3ULA A;  1K5G C;  2OMV A;  5CMN A;  3WPF A;  4KT1 A;  4J0M A;  4M7E A;  1O6V A;  2WFH A;  4GLP A;  4EZG A;  2RR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...