3FXQA

Crystal structure of the lysr-type transcriptional regulator tsar
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
296
structure length
296
Chain Sequence
MLKLQTLQALICIEEVGSLRAAAQLLHLSQPALSAAIQQLEDELKAPLLVRTKRGVSLTSFGQAFMKHARLIVTESRRAQEEIGQLRGRWEGHITFAASPAIALAALPLALASFAREFPDVTVNVRDGMYPAVSPQLRDGTLDFALTAAHKHDIDTDLEAQPLYVSDVVIVGQRQHPMANATRLAELQECRWAFSSAPRGPGAIIRNAFARYGLPEPKLGLVCESFLALPGVVAHSDLLTTMPRTLYERNAFKDQLCSIPLQDALPNPTIYVLRRHDLPVTPAAAGLIRWIQHHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on the full-length LysR-type regulator TsaR from Comamonas testosteroni T-2 reveal a novel open conformation of the tetrameric LTTR fold
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Transcription regulator
molecule keywords LysR type regulator of tsaMBCD
total genus 95
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fxqA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxqA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxqA03
5LOMA 1ON1A 3Q29A 2STTA 4EF2A 2JT1A 2O69A 3IWFA 1IN7A 1R36A 3RNNA 3CUQB 1PBPA 1M5BA 5DCMA 4I9DA 3FXRA 4DCXA 3I4PA 4CICA 2GHBA 2I49A 3WTSC 2NNYA 2M5WA 3BP8A 1IXHA 2EV6A 3MPKA 4KQPA 3MVZA 3BWGA 2VT2A 5ICEA 4Y13A 1YTVA 4XBFA 3PD9A 3W9VA 1XCVA 2O51A 4ZDMA 4LP2B 2C6YA 5K2YA 4BDNA 1IUYA 1HW5A 1TQIA 4BDQA 3A3UA 3CUQC 2Y7PA 3T9UA 3LSWA 4OQOA 4P5OA 3P7NA 4RXLA 5I2KB 3SEYA 1USSA 5CYVA 5HS9A 3N97A 5E1ZB 3TQNA 5DYMA 2QRYA 4GWOA 3E3KA 3KP2A 4RA1A 3SEWA 2EB7A 1OKRA 3SERA 1MPDA 3WGIA 2EFWA 5K5OA 3BJAA 3HV1A 4DLDA 3SFZA 3GEZA 4GLIA 1N3XA 1H45A 2ETHA 4IY5A 3RPWA 2OCUA 3CFXA 3KEQA 1BM9A 1K7AA 2DO7A 3TO6A 2I3WA 1U5TA 2IA4A 3IOVA 1A8EA 2LF8A 3E6DA 1P92A 1HSJA 3FX3A 2ISYA 1KYWA 1DOTA 3C36A 4EQ7A 2VBWA 4OIOF 5CRYA 4GD5A 1SW1A 3V8LA 4F29A 3P9IA 3F11A 2QMWA 1IXIA 1I6BA 2REGA 1USYE 4QFLA 1SD7A 3CFLA 3U8QA 4HV5A 1STZA 2QM3A 2AXLA 3G3KA 2HWVA 1FQEA 5ILUA 3PUXE 4CYDA 4XLNF 4IPAA 5HDKA 5AONA 2XRNA 1GHCA 5AA2A 4IF4A 1ZARA 1ELJA 3VODA 3TQWA 1O3RA 5DEXB 4OFLA 5A5XA 1MGTA 2ZMEB 3KFMA 1MY1A 3ZMVA 5E1XA 1OYYA 3VVFA 2LAOA 3MZ9A 4HZFA 4KD5A 2Y0MA 2ZNTA 1IQ7A 5HVQC 2PT1A 4H5GA 4KPTA 3ECRA 4YFNF 2UZKA 5H8NA 5D5VB 4G6QA 2VOPA 3KE2A 4BHCA 3BJ6A 3S9MC 4Z2YA 4QHQA 2L01A 4IY6A 1R6ZA 4KN4X 4O3MA 1R9QA 5TPAB 3F8NA 3DELB 2GA2A 4AIKA 2QS1A 5J1DA 2BEOA 2XXUA 1FTMA 3HO7A 3RQTA 4A0ZA 2F35A 3HRTA 4UVAA 3RN8A 4AB6A 2QWWA 5DEXA 1IN5A 3H6WA 1JGSA 3WTTC 2NOOA 1BI0A 2RC8A 3K0LA 2V1DA 3IX1A 3EDPA 3QU6A 1ATGA 1HKQA 3VLWA 2ISZA 3KP7A 3F23A 4FECA 4C1TA 2NUVA 1BC8C 3D4GA 1ZU0A 4G77A 4TOZA 2D5WA 2P7VB 4Q30B 4IHTA 3ZQ7A 3M3FA 4YICA 1A04A 4OXVA 1GXPA 1TQMA 3ISPA 4G8NA 3SDFA 3FVOA 3FMRA 4GXSB 2V6CA 3SKPA 1U3EM 3LR1A 2LDUA 3QOPA 4I02A 4GGGA 2Z8DA 4CDGA 2ABHA 1E17A 2JPCA 2Q2EA 2HTJA 4FX0A 1B3LA 2RKMA 2HKXA 3UIFA 4LZ8A 5FLXK 4IB2A 4UV9A 1WODA 1Y20A 5D5XB 4GL0A 1LAGE 1U5TC 4ESBA 5BQTA 3HPIA 4JSDA 1O3SA 1RI7A 3F6OA 3K6XA 4FJPA 4BDOA 2BV6A 3CVGA 4YB6A 2O6AA 5AE4A 3C7JA 1Y3QA 2B65A 3LSLA 2HZLA 2DE2A 1HBXG 3Q27A 4OESA 2RC7A 3OEMA 3GUDA 4GF8A 2DQVA 1IXGA 2I3VA 2W25A 5KZTA 1H76A 3MWMA 2GWRA 1JVYA 1W7PB 5HDNA 2NNNA 4EVIA 1LFIA 1BC7C 2QS2A 4L9TA 5F6FA 1ZKBA 1B3HA 4DE8A 1P4WA 5HBCA 1F1ZA 2W85A 1R58A 4ZEBA 4OTEA 2I4CA 4R6YA 4IO7A 2O84X 2RVCA 2ZNYA 2FSWA 3E9XA 3BOQA 1ZLKA 1YFHA 2KIUA 2F7AA 1T39A 3C1DA 3KP4A 5I56A 4GYIA 1P4XA 3A3CA 2Z23A 2ZKZA 3D0SA 3K1MA 4HDUA 1FC3A 4ZEIA 1LB2A 3KN7A 4JQFA 3HRSA 3WE2A 3PUYE 2R6GE 3FXUA 2VC0A 1EZ9A 3V4GA 3V8KA 3PMVA 5ED4A 2ZMBA 4LG0B 2DVZA 2MLKA 2HGCA 1NNFA 3CG1A 3SESA 4YZZA 3ECHA 1FZPB 4RYAA 2K86A 1H9GA 5FFZA 4QWQA 1OYWA 2ZNSA 1B3EA 2DU9A 3FJGA 3SETA 1OLCA 5ITPA 3SZPA 1J5YA 3GF2A 1FBQA 3PU5A 2HOEA 5JK4A 4Q5TA 4H67A 1SD4A 2GH9A 4AB5A 3BZ6A 4Y17A 3SXYA 1H43A 4OENA 2MLGA 3IWZA 1XT8A 2PBIA 3IC7A 1YW8A 2VN2A 5HS7A 1LAHE 1FCKA 4U0WA 3LSFB 1FTKA 2HDCA 4EM1A 3OO8A 3W9WA 2ZFWA 3DLNA 3QP6A 5E17F 1R23A 3UK4A 1PB7A 2CO5A 2V84A 3Q9SA 1XD7A 2DTRA 2FMLA 2K27A 4RNSA 5K2XA 1YPNA 2V93A 1YCJA 5DDGA 1W7PD 1LVAA 2O8XA 3QPTA 4WF2A 3CIJA 4HLYA 1URGA 3I6VA 4KCDA 1L3LA 1B7UA 2UWMA 1MPCA 5I58A 3F6VA 4XKQA 2FNPA 4JWXA 1B7ZA 4XIGQ 3LA3A 3GZGA 3R26A 4Z7EA 3F8MA 4AIHA 1KQ0A 1N76A 1O7FA 4JB7A 2K4BA 4BQAA 2OZ6A 5KK1A 4DZ1A 1LQ1A 2ZCWA 1NKXA 2X7PA 5FGMA 2RF1A 4A5NA 4NF6B 1SVXB 5H8HB 1B1HA 5DD8A 5FB2A 3V7CA 1N3WA 4NF5A 2QBYA 3S9NC 4MTDA 4BXUA 3I71A 1SFEA 1XVXA 3HN0A 1MXUA 3MP8A 4YKJA 4F31B 1A54A 3JTGA 2L02A 4O3BA 1IEJA 2VONA 2CGPA 3N6UA 4H6DA 4KFQA 5H8SA 3U2RA 2VGQA 2AL5A 1ONVA 5ICGA 3FV1A 3Q28A 3QK6A 1XDUA 2V79A 1FQFA 4ZEFA 1X3UA 4ESXA 2OBGA 4P9UA 5TP9A 1URSA 1RYXA 1LAXA 1W5TA 1Y1MA 3KN3A 1HQCA 1SI0A 2W24A 2F6GA 3TDZC 4HW8A 4I09A 3EUHA 4U1OA 3T93B 4MEXF 4GCVA 2EK5A 3EF7A 1H3DA 3ZP5A 3T9VA 3T5XA 4YIIA 3JW4A 3N6TA 5ICCA 1UB9A 3L00A 4LD5A 2ZXTA 2VE9A 3ZN0A 3DPLC 3B02A 3IOUA 4QRZA 2O1LA 2IT0A 3PPPA 1PB9A 1JQFA 1JW5A 1NFTA 3FATA 4ZYHA 5ILSA 4XKRA 3L6GA 1ODDA 2VODA 5DVFA 4DQ2A 2Z99A 2XASA 1M5DA 1B5JA 1S29A 2F6PA 2HAVA 2RN7A 2XAFA 3CSBA 5CVIA 4GRKA 1A55A 5FHNA 3BROA 3WTYC 2IA2A 4A0YA 1AOYA 1Q1KA 2DPDA 4HLXA 4ETSA 3K02A 3RYPA 4KIBA 4KT5C 3NEUA 3MVWA 2GZWA 4M9SA 3PQKA 5CVRA 2MD5A 1S3JA 3BPXA 1J1NA 1ZRCA 2YLNA 3O9PA 4ZE9A 2NYXA 3OV8A 1MRPA 2K02A 1ZIUA 2M8CA 2Y7KA 1R1NA 4X9TA 2VT3A 3PQJA 5HS8A 1D3KA 2Z8FA 3CFZA 1OIBA 3CG3A 3OO6A 4JXIA 3E6MA 5EHSA 5E18F 2H09A 3U94A 3ZMUA 3C9HA 1B4AA 2YX7A 3O6BB 1XMKA 4U2RA 1FYMA 1R7JA 2XKPA 3PPRA 5CMKA 1EZOA 2RCBA 4NTLA 4R6KA 3KG2A 4R73A 3TMGA 5F1QA 2IRFG 2I6EA 3EYIA 3P9CA 4ESFA 2AYSA 1Z6TA 2OA4A 1QVSA 3TPAA 5HLIA 2P8TA 2O1MA 5CC2A 5CI5A 1SD6A 1H0MA 1SD3A 2MA3A 4F18A 4LK0F 3W6KB 3FM3A 2Q8JA 3I0TA 4PQJA 3KOTA 2FNCA 3OSQA 5BPDA 3I5UA 1TT1A 1MM7A 2H99A 4IRIA 2ZXJA 2FU4A 5B70A 3KOSA 2E7XA 2OJTA 1J75A 3N94A 3QRFF 2ANJA 4OMYA 3E5XA 1G4DA 3CTAA 3FVGA 3KJ7A 3HHFA 5ICQA 3KZZA 4THIA 4L9JA 2H9BA 1FX7A 4G7OF 4ZE8A 1Y0UA 2A07F 5ICFA 1HSTA 1T2KA 5D5UB 4Q4ZF 3RIRA 2M8EA 1R22A 5D4SA 1FQDA 4ZH4F 3R6UA 3RT8A 4OIRF 1QBJA 4R9FA 4G68A 2Q2CA 3HSFA 4BDRA 4B09A 4I98B 3OOPA 1T38A 1BJAA 1T0FA 1B3FA 4AQ4A 4LUBA 5BS6A 5IKBA 3J81K 3U72A 1PUEE 2KJBA 1TBXA 1FP1D 4QFKA 3SQNA 5I59A 1US4A 2UXNA 1U2WA 2VD3A 1MJ9A 3L9FA 4ONYA 3LSXA 3TKYA 2ONKE 4Z0IA 4EMSA 2MBFA 4IRGA 1HKTA 4XTCQ 2PLYA 2ZYMA 3DV8A 2ZNZA 3RPQA 4EJOA 2XX9A 3NQOA 4D0PA 1WRJA 1B58A 2F5XA 2Z33A 4HBLA 1SW4A 2XKOA 4FT8A 1FSEA 4IXAA 2P0SA 1EH7A 2BBYA 1QQIA 2I48A 1FQAA 4OWDA 2EV5A 2K7LA 1IUDA 4H65A 2DWHA 3WGHA 5CM6A 6PAXA 2UVIA 1TFDA 3QU3A 1M5FA 4S05A 1B4HA 1XVYA 2DWJA 1ZG3A 4EGYA 3QXMA 4N07A 4R75A 4WEDA 1IITA 4Q5SF 3I3VA 5ICTA 3DXJF 4ELPA 4IO2A 3MCZA 1K78B 5ITOA 4EM0B 2YPNA 1Q1HA 1G3WA 5DUIA 4GQOA 3K6UA 1XGMA 5JHUA 1DTGA 3G3GA 2O6GE 5LGTA 4KIGA 1UHWA 2IPQX 2VBYA 2WKYA 2YPRA 1ZN2A 3PUVE 4U22A 3GFJA 2Q0OA 3E97A 3GFLA 4EQBA 2X26A 2XX8A 4IGRA 3KEOA 1O57A 5L3FA 5LRSA 3C31A 3JSPA 1O7LA 5H8QB 2OWSA 1PB8A 3MAMA 1PDAA 1P1OA 2G9WA 2A5YB 1MD0A 2PT2A 1LEBA 2RC4A 2COMA 5K1YA 5D8LB 5I58B 3OOAA 5IT9Z 1FWZA 2QS3A 3C34A 4HCWA 2UVJA 3TTRA 2QZ8A 4EDPA 3G3JA 4WX9A 1U5TB 4QFNA 4JK1X 1AH5A 4NEDA 1IIWA 3M9AA 1MH3A 5BUUA 1A40A 4LFUA 1ZG1A 1EV7A 1W5SA 3IJOB 1JEUA 1S50A 2Y48A 3WAFA 5K5RA 4N9HA 2LKPA 2UYFA 3VXCA 4G6DA 1BOAA 4KR5A 4OZ9A 5DV5A 1YLFA 4ZS9A 1O64A 1T98A 1M5CA 2VBXA 2Q88A 2PI0A 2JTVA 4M6YA 5F1RA 1OMPA 3ZN1A 3UORA 3FVNA 2CMOA 4UACA 1B1XA 1DPRA 1B0HA 4ZZDA 1FNNA 2DYXA 5FTIA 1IN4A 3K01A 4O3AA 2X4HA 3MBPA 4LA9A 1MQJA 1OMIA 3BJOA 5EEHA 4YFKF 1RIOH 3IHUA 1YW7A 2F5CA 4CGZA 1U78A 1SBPA 1RYOA 3IRQA 2HEOA 1NL5A 2V3TA 4I1DA 3V5AA 1Z91A 4UVCA 4KMUX 1FW0A 4U0VA 2YX4A 2YR2A 3QSLA 2QQ9A 2HS5A 3RPUA 1I6XA 3ZKLA 1P6RA 2XXWA 3G3HA 3LQQA 1EH8A 2QQAA 1BI2A 1I27A 4O3CA 4JBZA 1MPBA 2FE3A 1UTHB 1Y9UA 2IVMA 4R1HA 5HLHA 3U1OA 4LGWA 1Z05A 1CF7A 3VLVA 2H6CA 2DQLA 3C3WA 1L5TA 3H3GA 3Q25A 1LEAA 3GYHX 4BYYA 2DAOA 1IZ1A 3IB0A 1W7PA 3VB2A 2EFQA 4HX4A 1CE2A 3JYRA 5I84A 2AL4A 2KJCA 1P1UA 1RZ4A 4YB7A 4DXBA 2H94A 1BI1A 2XD3A 3GLXA 4HAMA 2XXTA 4PETA 3SEVA 5LGUA 5HOOA 5EEGA 3U1DA 4RAYA 1SAXA 5KCJA 2FBIA 4OIQF 4U0YA 1LDKB 2HR3A 1A8FA 2KIFA 3MJNA 3WODF 3FF5A 3GZ6A 2NRAC 4IGTA 5HDGA 2REJA 1FTLA 5CJ9A 2LF7A 3S9LC 3V89B 4ZZAA 3F21A 4EXLA 3LAJA 3HUGA 3KP6A 2ZYKA 4I0BA 4RK2A 2VHAA 4ENJA 3VDFA 3IKVA 3EQLF 4TV7A 4AWXB 3G7WA 4O5VA 3IB1A 5TU0A 1R1TA 2F7CA 5AIQA 3KLNA 4MGRA 1TWYA 4IO5A 1B0LA 3EHTA 4G2ZA 1IXRC 4OEVA 3GXAA 3O29A 1OQGA 5JEIA 2GIVA 3E6CC 3FJMA 4G8XA 2XAGA 3RTRA 1Z1DA 5LHHA 4C0RA 3R4KA 4KI0E 4DIGA 1E2XA 4P96A 1XB4A 5B7DA 4LLLA 1FBSA 4LQ5A 4DCYA 4F3GA 3TODA 4RPNA 1DPEA 5LEKA 1MM6A 1R1VA 2CWEA 2QSXA 4NE4A 1SDXA 4X1BA 2AS5F 2M87A 2NS0A 2ELHA 1LCFA 3MP1A 5DVIA 3PD8A 3NRVA 5L3BA 3J81Z 2NXOA 2D1HA 2VXZA 5AIPA 1R00A 3M8UA 4RPOA 3BKIB 4P0IA 3B6WA 2VD2A 2Y84A 4PGGA 1QO0D 5TPAA 1Y4TA 1IRFA 3O6IA 4OEUA 2HQ0A 4HOBA 2QS4A 5F7VA 4L0ZB 2P5LC 3KP3A 2ZNUA 3RT6B 2F5DA 4TLMB 3KETA 3TQLA 1JXSA 4UXNA 2F34A 1TLHB 4NF4B 2HAUA 3WTVC 1Y3NA 4OU0A 3VEPA 1VE4A 2NAZA 2E1SA 3FGSA 2FF4A 4ENMA 2UVGA 1U6GA 2CFXA 4LATA 1ZREA 4MQ9F 2XHDA 4A6DA 1RKMA 2HCAA 3TAJA 3HHHA 3PV0E 2GRVA 5AA4B 1UCRA 2GQQA 1ZJLA 3AAFA 4G7ZF 1J7KA 1KU3A 5J8CA 4RGSA 5ERIA 2A3SA 5JFRA 2JPBA 3WTUC 2OZUA 1KU2A 5I57A 4R2BA 5FD6A 1VFDA 3K9TA 5LEJA 4U21A 1HW2A 4NF8B 3K1PA 1T6SA 3TCGA 5CVJA 1B46A 2F8DA 4HF0A 3TDUC 2P1SA 2GA1A 2HYGD 3LC8A 1SYHA 4LMYA 3JZJA 1LDDA 1K78A 4U23A 1O3TA 3EPEA 1F9BA 1HSEA 4FX4A 3VLUA 2PMHA 3VOEA 4EJVA 1N7XA 4HYEA 4ELQA 2GHAA 2DWIA 5KDTA 3VFJA 2HFHA 3BDDA 3J7AO 1S7YA 4FEBA 1PDNC 4E70A 2R3SA 1WVJA 2CYYA 1OLAA 5I2NA 1ZGAA 1NNPA 2H27A 2E0SA 4X48A 5FTHA 1P2FA 2P5KA 5CMBA 2OU2A 2DFIA 1QGPA 1FP2A 2LNBA 1RUNA 1B5IA 1FTJA 4BNCA 2RV8A 1MXYA 3RUMA 5JI6A 1ZBMA 4EJTA 4WXCA 4JWOA 1N7WA 5AA2B 3ZMDA 3DP8A 4TQUQ 2PEXA 1FTOA 3TOBA 2YJPA 3N4MA 3I5OA 1AL3A 3GO5A 4JBAA 2LSOA 2BE5F 2KIMA 2XAQA 4M9ZA 4KFCA 1Y3PA 2QMXA 2TDXA 1PC3A 3CSGA 1P1WA 1XOCA 1NNTA 4G68C 1WKMA 5BMZA 4OETA 1MZBA 5LBQA 3KGCA 5DUKA 4EJWA 4OOIA 1QZYA 1SD5A 5DCMB 2QL3A 5AA2D 2DP8A 3M1EA 3E4RA 1B6HA 1YS6A 1LBCA 1B2HA 2IA1A 4TLLB 2QJEA 2XGXA 1JVXA 3FUZA 3MQ9A 5CBSA 5LHIA 2D45A 1OVTA 2Z8EA 4G68B 5DYHA 2FEZA 3TGNA 3I59B 4K3FA 4X1DA 1FYKA 1YAEA 3D5LA 1LB8A 3B6QA 1HKSA 1B40A 1A99A 4H1XA 2HYFA 5K5QA 4LB5A 4KYEA 4QSDA 3GFMA 2DK5A 1OQHA 1MH4A 3GXOA 4HQMA 4RS8A 1KGSA 3QUJA 3SHFA 2OWTA 2Q9TA 2CG4A 3O66A 2J5OA 1MDQA 2M1BA 4KMFA 1XS5A 3TTMA 3JAMK 4EM2A 4R72A 1LFHA 3DEUA 4BDLA 2FA5A 4XKNA 4BHPA 2J5PA 1OR7A 4UUVA 1K79A 2RNJA 2D2WA 1OYIA 2IP2A 4ZEDA 2L4MA 1MS7A 4XXUA 1XCBA 3U9GA 2Y7RA 1MDMB 1B59A 3PPQA 1MKMA 3DP7A 3PPOA 4DXCA 2W57A 2GXBA 4EGZA 3L2CA 3ILTB 3N5LA 4GYGA 3L6HA 3IJXB 3P7IA 5IAIA 2XVCA 3C35A 2WTEA 4ESWA 3TDJA 1S9TA 2Y7WA 2PBWA 4MHGA 3LUYA 2Q8KA 4P0GA 1GR2A 5JVTA 1K6OA 3H03A 1TQPA 1XHYA 2E7WA 3H06B 4GO1A 4R74A 3FIRA 4PGHA 2BJJX 4LB6B 4F39A 2A69F 2ZO4A 5L3GA 1AOVA 2OQRA 2H98A 3LWFA 1J59A 4MQVA 4ESJA 4HW0A 4R79A 2G7UA 3R61A 4ND9A 1I1GA 3BFUA 3MZHA 1J9IA 2A5SA 2PMSA 2I0BA 3F22A 4U4XA 1VSOA 1JETA 5L9SA 3LBSA 3U92A 1B05A 3WGGA 4A2UA 3M7GA 3KSXA 1MDMA 2MH9A 4ZECA 1WWXA 4Q0CA 3RLFE 4WEPA 2JZYA 3QAHA 2CW0F 3TEPA 3W6JB 5F64A 3CI8A 3ZS6A 2ZYOA 4HF2A 1LAFE 4LZ7A 5LRRA 3WTXC 4HA8A 3MEXA 1KWHA 2F5FA 5H8FB 2M30A 2XIGA 1DSNA 2DXRA 3EN3A 3T0YA 3IL1B 2VE8A 3F3XA 1UHMA 4OFOA 2OK2A 3TFLA 4BLAA 1QZZA 1MY4A 4U1ZA 1DMBA 3ML6A 3O2PE 5HLGA 2ESHA 4MTEA 4E0WA 2JSCA 3TO7A 2FBKA 4KN7X 5D6FA 5CVUA 3HTSB 3FVKA 5H8QA 4RB0A 4RGXA 2QLZA 3KN8A 1I69A 4M74A 4KIFA 1GVCA 4MBPA 1MXWA 3OSRA 1G3SA 1FLIA 3I59A 1QPMA 3FHZA 5DCFA 1Q35A 1ZH5A 3K2DA 4F1UA 2DW4A 3IKTA 3QAXA 1O3QA 5D8KB 1VTNC 1EU8A 3A09A 1XC1A 4ECFA 1GGGA 2QBYB 1SW5A 1YQAA 2VOOA 3HYIA 3JAMZ 3DF8A 5CLSA 5JR3A 4WCGA 2NVUB 1KU7A 3DM0A 1BKAA 3FMQA 1S6LA 3M3LA 3IRRA 2ZYNA 2UVHA 3MWBA 4F22A 5HPQA 2O0YA 2OD5A 1CGPA 4P55A 3GBAA 1Z7UA 2AIXA 2HXWA 1EH6A 1REPC 1D5VA 5IT3A 4RAZA 2VP1A 4YIFA 1FBUA 4LG0A 1OPCA 3T8RA 2PJPA 3KBRA 2X0LA 3DQVC 4M9XA 1L0OC 1SMYF 4G7HF 3UA8A 2Z3YA 2XXXA 1LB9A 4RB1A 1DPPA 4UNOA 5J6XA 4U7DA 1KU9A 4OVJA 3PMXA 3RTWB 1HXDA 3B73A 1S7OA 3V8XB 1N04A 3VXBA 4BHBA 1NH8A 4HF1A 1JEVA 4IO3A 5DT6A 3K0VA 5L3CA 3Q26A 3ELKA 5KDTB 2DWAA 1NH7A 3THIA 3QP5A 4HX7A 1KQ9A 1JHFA 3RKWA 3ONMA 2P6TA 3I64A 4H8JA 5I59B 1FYLA 1AMFA 2D3IA 4PFWA 4Q47A 3GLBA 2L3DA 5TJJA 2IJLA 2V1XA 3ULQB 2E1CA 3D4CA 4LZ5A 4WWCA 3K1NA 2HFBA 3OO9A 5ISUA 3LQRA 3RKYA 2HQRA 3ZPLA 1P4AA 4KICA 4DNCA 4A5MA 3S2WA 3DP4A 3EQ1A 3IAZA 5A2QZ 3MZ1A 2P4WA 1JNFA 3H4ZA 1G3YA 4AVPA 1R5HA 5L8DA 2M45A 2XXIA 3PPNA 1Y1ZA 2F7BA 3FJ7A 4ON0A 5I57B 1VFEA 4L0YB 3P9KA 2MC3A 4IO6A 4XLPF 1B52A 2XXHA 4AD9A 1SYIA 3LFKA 4RY1A 3OD7A 1POY1 3RI4A 4ZYDA 2DXYA 1GXQA 2UXXA 1LCTA 1SMTA 4PZJA 2PG4A 5LLQA 3FASA 3KJTA 5D5WB 2Q89A 4CO8A 4PCQA 1D9YA 3T9HB 2X7QA 4N9IA 3J80K 1B9MA 4F2QA 1T0KA 3WU0A 3GWZA 2I0CA 3ZSFA 1YIOA 4EF1A 2DBBA 2V3QA 1MQIA 2K4JA 2O7IA 3C18A 3KCCA 1B5HA 1O7TA 1IXCA 2RGVA 1ZGJA 1QKAA 1PP7U 3RKXA 4L9VA 3MZBA 4KDPA 1PEBA 3MPLA 5CBRA 1MXXA 4I2OA 5FFXA 2EFOA 4JWYA 4DXUA 3C33A 4NMYA 2Z9OA 1KQ8A 2G7HA 3ZMZA 4GL8A 1USYH 2A68F 3AXFA 2PQ8A 4JDFA 1A7LA 4KUMA 1DDNA 2XXYA 4EV0A 1SI1A 3FV2A 3IB2A 5CMMA 4F3SA 2W84A 1ZHFA 4G4PA 2CSOA 4GXAA 2Q2AA 1EZPA 1B3GA 4NB5A 2ZMEA 2A6EF 2ONSA 5JTYA 1N84A 3I58A 1FPQA 2RCAA 4RB2C 1ZRFA 3DFGA 1MY2A 2PMUA 1XDSA 2PX1A 2RDPA 1NNKA 3L09A 1P1QA 2BYVE 2L54A 2ACJA 2DOJA 3TKDA 4NF8A 2OZZA 1NHAA 1QUJA 1S8NA 4I0AA 4LONB 4EQQA 1M5EA 2D21A 4U88A 1ZYRF 4POXA 4OYVA 5L3DA 4UHTA 4A6EA 4EXKA 5FHMA 2DLLA 4PFUA 3VE1B 1MJAA 3VV5A 5DEQA 4HQEA 3CR9A 2Y7IA 3WG9A 1I6QA 5LHGA 1BBYA 4IVNA 2R9JA 2OAZA 4CZZA 2EJRA 1TFAA 2V25A 4NF4A 5TRDA 3H6TA 4ZZLA 3O28A 3OEKA 4QSEA 4OMZA 4PDKA 4OHNA 1DPUA 2RC9A 1UTHA 4UA8A 1I5ZA 4H5FA 2PVUA 1IRGA 3IR1A 1FY7A 3RGYA 4FIMA 5IT9K 3BFTA 3S2VA 2DSFA 1C0WA 1BN5A 2HKOA 2STWA 4H0EA 3OELA 3CLOA 3LA2A 1J0RA 3F72A 5H8HA 4S04A 2F2EA 1DTZA 2IEEA 3VVEA 2DS9A 1F4KA 1LSTA 2XXQA 3H92A 4HTGA 1QKBA 4F1VA 1XSXA 1B1BA 2FA7A 4MFIA 4BDMA 3H6UA 1JW4A 3S9EA 1Z9CA 2ONRA 4YKIA 1YW9A 4KA4A 2E1NA 1POTA 2JRTA 3J80Z 3RTFB 2D1VA 4P9FA 3M8FA 4I62A 3QYTA 3BBRA 4JSOA 1BP5A 1DP7P 2QUFA 1WI9A 1ZG5A 4YFXF 3WAEA 5KVRA 4C1UA 5FO5A 4GXOA 3GBBA 1H9TA 3MUQA 2H25A 4FATA 1YG2A 1SFUA 1B4ZA 3QUFA 3R6SA 5FLXZ 4MH5A 3V7SA 2DE3A 5H6RA 3B6TA 2VOZA 2O7UA 4QFPA 3UGWA 5BOXA 5EHMA 1XGOA 3E5QA 5J8FA 1QUIA 4YKPA 3TCFA 4ELRA 2A61A 5E1WA 1ZRDA 4YU0A 3E5UA 3G3IA 4XRFA 1MJBA 5H6QA 1B6AA 1MXZA 5A2QK 1YO5C 2B3BA 4RGRA 4MLQA 5FHOA 3HOSA 3R0AA 5KCJB 4YAHX 2XXRA 3GVAA 5I2KA 2R7FA 2DQRA 1PBQA 2B0LA 1G3TA 2FNAA 4LLGF 3OO7A 3U93A 2V9VA 3MW0A 3EYYA 4LK1F 3RJPA 3H7MA 2GXGA 4MEYF 3G3ZA 3W15C 2EWNA 2O03A 3OXNA 2P2AA 4R8HA 1D4NA 3RY3A 3B7DA 4I7HA 1ZAOA 1URDA 3HTUA 4NWDA 1Z7NE 2R7DA 1Z7ME 4RK9A 4F1YA 1CF7B 4CXFA 2KKOA 1S7AA 4UVBA 1JHHA 3IO6A 4N13A 3T22A 3FD3A 4ENNA 2YSRA 3F8CA 2O61A 5JTYB 2F36A 1FQBA 4I8CA 4HDVA 4WXDA 3G3FA 5I56B 4BH9A 1II5A 3MFKA 1ZLQA 5ELVA 5E8IA 1GV8A 2HTSA 3C32A 4QF9A 3SEUA 4NWCA 3L7WA 4WKMA 2WC2A 1QNTA 1Y4CA 3QIMA 2OQGA 3V8JA 4RB3C 1MQGA 2Z5UA 1TNTA 1BIYA 2L4AA 4F7ZA 1UIUA 4FHTA 2XXPA 1IXSB 1TXFA 4QLCU 3ILUB 4Y15A 2V1UA 1IW7F 3CJNA 3KLOA 4L5IA 3USDA 1W4MA 3HRMA 4N6PA 4OERA 1SFXA 2G93A 3FMSA 3KFWX 1Z6RA 4ZYGA 4LQ2A 3N26A 4PE5B 2HEUA 1ON2A 3R0JA 1QJMA 3GX4X 3K4UA 1B9NA 1MXVA 3MVYA 4O6JA 1YS7A 4L18B 3ODBA 4M1VA 3MP6A 1CB6A 1BIAA 3TTKA 1B32A 2YU3A 3REOA 5DVJA 1D8KA 2DPUA 2XXVA 2DK8A 3FXQA 3ZMSA 1R1UA 1WDNA 3DP6A 3GZ5A 2THIA 2FQ3A 4XKPA 1ZLJA 4PFTA 4Q48A 4LVQA 1MDP1 4HS7A 2RQPA 4A12A 4B8XA 2H6BA 4HV6A 5ILVA 2FMYA 4E0XA 2IW5A 4YMAA 3TUSA 4U4SA 4IHSA 2FXAA 4QFOA 3CUOA 2PYYA 2GAUA 4N0BA 1PP8F 3O2AA 3K2ZA 3S4UA 2O3FA 4YMBA 1IN8A 2EFNA 4ELOA 2XROA 1FT9A 3UN6A 3WTWC 1FQCA 3TCHA 2P6SA 3TTLA 1ULYA 2RKHA 3Q9VA 3O6GA 2Y75A 3DKWA 4ZEKA 1FOKA 5L3EA 1IN6A 2DT5A 3BY6A 1UIVA 4G8MA 1TW2A 2P5VA 4ENKA 4F19A 1LNWA 4FORA 4GVOA 4U7BA 3T96B 2OLBA 2WWYA 4H0WA 2VBZA 1TTYA 4G8HA 3KZGA 2G29A 3GFIA 1HW1A 3QPHA 4YB5A 3TOAA 1SW2A 4KHZE 1XSDA 3SZTA 3HIFA 2V3UA 3T1BA 1RUOA 3RYRA 4F3BA 4P11A 1QW0A 1B51A 3HSRA 4PFYA 3JSOA 1IF1A 1J2XA 1R5GA 1G6NA 1V4RA 1MG1A 1GVJA 1U8RA 1QULA 2F78A 4YKKA 5H8NB 3TZAA 2Z22A 1P99A 4L9NA 1JE8A 4FEDA 4HCYA 4M71A 4RJZA 2A5TA 1YYVA 2VC1A 3ECOA 3F8BA 1UTBA 3SEXA 3HRUA 2P7CB 5A5XB 3O3KA 4G94A 2A5TB 4KNYA 3BPVA 5AA3A 3ZKKA 2HQNA 1GTKA 1N0TA 4AIJA 5I2NB 3EETA 5LGNA 2B3FA 4KYDA 2UXAA 4IJAA 3HSTA 3UP9A 1AIVA 2IA0A 3WTZA 3TELA 4KYWA 3V83A 2ZBKA 3E13X 3C4MA 2PFBA 4EJUA 1OVBA 2A6HF 1LLSA 2CQKA 2MH2A 3ABUA 4KYSA 3Q5FA 4LJZF 5E20A 4OINF 1RNLA 1JW1A 1D3YA 1XN7A 3LSTA 4L5JA 4Q8RA 1LDJA 2F97A 2HZKA 2ZJ2A 2FBHA 3T9XB 4L17A 5E8GA 3M3KA 4LLNA 3KZYA 4XSZF 5CMCA 3F8FA 2W7YA 3IO4A 3IOTA 3H3ZA 4K2EA 1TNSA 5FD5A 4CHUA 1FSHA 2DVCA 4MLVA 4XSXF 1I1SA 4OFJA 4DDDA 4OMBA 1LJ9A 3H6VA 1LGBC 3VFZA 3EHUA 1XGNA 1VR5A 1V3FA 3PFIA 4GIZA 4WXJA 5AA4A 2HZTA 1MQDA 3ABTA 1US5A 5BWJA 4EQ9A 1F5TA 4RGUA 1USTA 4M73A 1UTBB 4I01A 1HSLA 3TYHA 3PMWA 3ZMTA 1H44A 1WQ2A 5D4RA 1BI3A 3V7RA 4ASNA 5H8FA 2QQBA 5TP9B 5HM4B 5AA1A 2CZLA 2PN6A 3HHGA 3MQ0A 5L9MA 4GFRA 4IO4A 3VVDA 2EA4A 3R7XA 3IOWA 5EYFA 3PUZE 4A0XA 2XUBA 4NHJA 5L9OA 3HOTA 3FZVA 3GW2A 1BTJA 3CUQA 3JV9A 3RDIA 3MC2A 3IL2A 3KP5A 3MVXA 4NF5B 1P1NA 3KEIA 3TTNA 4NF6A 5BPIA 5DTBA 2XAHA 3COAC 4KCCA 1TW3A 1UFMA 1YTYA 4ZYEA 1AWCA 3LA7A 3I53A 2WV0A 4EUOA 3ERED 4H8IA 3M8EA 1WSUA 3KSJA 4MNUA 1XGSA 5M2VA 1KA8A 3DPTA 4HX8A 3CO6C 2UYEA 2QVOA 1B7HA 1BIBA 4R9GA 2H5YA 2XHKA 1BLFA 3K6VA 2FRHA 2BGCA 4FE8A 3LAPA 1KYZA 2ESNA 1DUXC 1D8JA 3T66A 3WU1B 2XX7A 2KLFA 1LFGA 4G9YA 3R60A 4YG2F 5CVVA 1MY0A 3H3UA 1LBBA 2KRFA 4NQWA 2EV0A 4F3PA 2DE4A 1O63A 2F5EA 3CDHA 2QPQA 3IORA 2EFPA 2H4IA 2DI3A 1XSVA 4M6XA 1D9VA 4ZZEA 1UQWA 2ADUA 3K00A 4ISUA 3WE3A 3HSEA 1ANFA 1EH3A 3PUWE 1NMUA 3CRBA 2FOKA 4OIPF 3MAJA 1ZMGA 3O97A 3MZYA 5D6EA 1I6AA 2XD2A 4M4GA 4UV8A 3ROUA 3HCQA 3T8TA 2QYOA 3IK6B 4R2FA 3K69A 1SQYA 2R71A 2QENA 2EA2A 3E3VA 3K6WA 3JTHA 4R6HA 2I58A 2ALUA 4WXHA 2XAJA 1MQHA 1MY3A 2XV4S 1QUKA 3O6HA 4IRHA 3EHSA 3FM5A 3FWEA 2FYIA 4M72A 5DD4A 1R9LA 3E6BA 3TO9A 1ZTYA 4POWA 4F2OA 2O68A 3PGFA 2RINA 4GOTA 4WK8F 4QSCA 1XMAA 2I4BA 4BAYA 4FAJA 2NWJA 3G73A 3CO7C 4MF3A 5H20A 1F9NA 2OBPA 2GFEA 4PP0A 3OENA 1IAWA 3OMBA 1B9JA 3I54A
chains in the Genus database with same CATH superfamily
4JYKA 5LOMA 3FK6A 1ON1A 1YJWI 2ICWG 5IP6A 3RPUD 2STTA 4BE1A 3D1NI 3Q29A 4EF2A 1Z0XA 2JT1A 2O69A 3IWFA 1IN7A 1R36A 3RKQA 3CC2I 3RNNA 5I2KB 1FPGA 3CUQB 1QPIA 1M5BA 5DCMA 1PBPA 3FXRA 1D9QA 4I9DA 4HE0A 4DCXA 3I4PA 4CICA 2GHBA 3ZXSA 3WTSC 2B4LA 2NNYA 2I49A 3FDYA 4W1UA 2JJKA 2M5WA 4XLCA 3BP8A 3H5AA 4E7LA 1IXHA 2EV6A 3MPKA 4IHVA 4NC7A 3IAM2 4KQPA 3MVZA 1VFCA 3BWGA 2VT2A 5ICEA 4Y13A 1YTVA 4XBFA 3PD9A 3W9VA 1XCVA 2O51A 1E3PA 4LP2B 2C6YA 4ZDMA 4N8YA 5K2YA 2WBDA 1IUYA 4BDNA 3ZR8X 1HW5A 1TQIA 4BDQA 3CJTB 3A3UA 5J1YA 3CUQC 2LMDA 3S93A 3G4SI 3HOWJ 1JT6A 2Y7PA 3LSWA 4OQOA 4P5OA 3T9UA 5EGOA 3P7NA 3MKYB 2CS3A 2CZIA 4F55A 4RXLA 3LOCA 1USSA 5CYVA 5HS9A 4I76A 1NH3A 4NC8A 4CUGA 3OO6A 3HDDA 2E1MC 1P7IA 4OVTA 3N97A 5E1ZB 4GRIA 4II2A 4X8RA 4G12A 3TQNA 5DYMA 4RLFA 2QRYA 4GWOA 3E3KA 4C3JJ 3SJMA 1Z3XA 2EZHA 1IMCA 3AG2H 2CUJA 3KP2A 4RA1A 3SEWA 2EB7A 4AIDA 1OKRA 4OA4A 3SERA 2NVTJ 3MKLA 4GWSA 1MPDA 3WGIA 2EFWA 2XPVA 5K5OA 3BJAA 4MCOA 4IQ4A 1ZR2A 1RESA 1RETA 3SFZA 3HV1A 3T0JA 4DLDA 3GEZA 4GLIA 2HDDA 1N3XA 3CF2A 5BNGA 5KCMA 1H45A 4P56A 2ETHA 2PFZA 4IY5A 2OCUA 3CFXA 2E1MB 3KEQA 3RPWA 1BM9A 1K7AA 2DO7A 3KPHA 4PJJA 3TO6A 3FK7A 4GWUA 2I3WA 1U5TA 3D5SC 2DA5A 2IA4A 3IOVA 2DMTA 1A8EA 2OWZA 2QVVA 2Y5KA 1WJAA 2LF8A 3E6DA 3HPHA 1P92A 2CUEA 4A3BJ 1YHQI 1FPJA 1HSJA 3FX3A 3VWBA 1OCPA 2M0CA 3HZJA 2ISYA 4A3LJ 1KYWA 1DOTA 1QGXA 3R6UA 3ZCOA 3C36A 3GBGA 4F92B 2VBWA 4OIOF 5CRYA 2EZIA 4GD5A 1SW1A 3V8LA 4NN3A 4EQ7A 4F29A 3P9IA 3F11A 1Y6IA 2P0WA 2QMWA 2A5WA 2ZMEC 1IXIA 1I6BA 3DBLB 2REGA 3UNGC 3V42A 1USYE 4QFLA 1SD7A 3CFLA 1R4NB 4HV5A 1STZA 2QM3A 3U8QA 2AXLA 4BKXA 3G3KA 2HWVA 1FQEA 5ILUA 3PUXE 4CYDA 4XLNF 4IPAA 1BW5A 1RDXA 1ETWA 1OCTC 2VPNA 5HDKA 5AONA 2XRNA 1GHCA 5AA2A 4IF4A 2OJED 3HKZN 1ZARA 1ELJA 2WY7Q 1Y56A 1T0FC 1HDPA 2LKSA 3VODA 3TBIA 1YITI 1O3RA 1Q9DA 2HZDA 5DEXB 3TQWA 4OFLA 5A5XA 1MGTA 2ZMEB 3KFMA 1R6RA 1MY1A 3ZMVA 2L7KA 5E1XA 1OYYA 3D5RC 1NV6A 2LAOA 3MZ9A 1WH7A 3VVFA 4HZFA 4KD5A 1X2NA 2Y0MA 3MN2A 2ZNTA 1IQ7A 2VASA 5HVQC 2PT1A 4H5GA 4KPTA 3ECRA 4YFNF 2UZKA 5H8NA 5D5VB 4G6QA 1UMQA 1MMGA 2LLKA 4RAFA 1IRXA 1Z21A 2CH0A 2OCCH 2VOPA 3KE2A 4BHCA 4DZPA 4DI4B 3BZKA 3DPUA 1TWCJ 3BJ6A 3S9MC 4Z2YA 2HQAA 4BXFA 2ZJQF 4QHQA 2L01A 4IY6A 1MBGA 3HGGA 1R6ZA 3CC4I 2EH3A 2F4IA 4KN4X 2GOMA 4A69C 4O3MA 3F8NA 1R9QA 2GA2A 4AIKA 1P7JA 2XPUA 2QS1A 3DELB 5I3SA 5J1DA 2BEOA 3OS1A 2KT0A 4XLHA 2XXUA 1FTMA 3HO7A 2BVMA 4A0ZA 1LVKA 2F35A 3RQTA 5KNLA 3HRTA 4UVAA 3RN8A 2BW3A 2Q8MA 4AB6A 2QWWA 5DEXA 3DLLF 1IN5A 3H6WA 5JHFA 1JGSA 2NOJB 3O8HA 3WTTC 1FRPA 2XB5A 2NOOA 1BI0A 2RC8A 2GQ1A 2BY1A 5T3JA 1I39A 3K0LA 2V1DA 3IX1A 3EDPA 2O5RA 3DTEA 3QU6A 1ATGA 1HKQA 2JVGA 3VLWA 4BGDA 2ISZA 1BJZA 3HEFA 4PAKA 3KP7A 2TRTA 3F23A 1JT0A 2XWIA 4H45A 4NDLA 2HPGA 4FECA 2L5VA 4C1TA 2NUVA 1X1PA 1BC8C 2Q2EB 3RPLA 3D4GA 1ETYA 3K70D 1ZU0A 3E0JB 4G77A 4MJOA 2DDKA 2QSHX 2RQQA 4BQNA 3CC7I 4TOZA 2D5WA 5EDNA 2P7VB 4Q30B 1WJEA 4RLQA 4IHTA 2XF6A 3ZQ7A 3M3FA 4YICA 1A04A 4OXVA 1GXPA 1TQMA 3ISPA 3NAUA 4G8NA 3SDFA 3FVOA 2EZLA 3FMRA 2OTJI 3CDLA 2V6CA 4GXSB 2IGMA 3M1CA 4M3DA 1U3EM 3SKPA 3HUGB 3LR1A 2LDUA 3QOPA 4I02A 4GGGA 2Z8DA 4CDGA 2ABHA 1E17A 2JPCA 3OIQA 2DFFA 2Q2EA 3RPLB 2HTJA 3GTKJ 5FBPA 4FX0A 1B3LA 2RKMA 2HKXA 4JP0A 5IZ3B 4LZ8A 3UIFA 5FLXK 3CJQB 2XWVA 4IB2A 4UV9A 3BR5A 1WODA 1DK4A 2P81A 1Y20A 5D5XB 3DU6A 4GL0A 1FBGA 1LAGE 1U5TC 2E5ZA 1WVRA 4ESBA 2YUSA 2HPIA 5BQTA 3OYGA 3HPIA 4JSDA 1O3SA 1RI7A 2XRLA 3F6OA 3K6XA 1KONA 2AO9A 4FJPA 4BDOA 4YEJA 2BV6A 3CVGA 4YB6A 2O6AA 5AE4A 2LG4A 3C7JA 1Y3QA 2DOFA 2B65A 2WYKA 3CLQA 2HZLA 2DE2A 1HBXG 3LSLA 3Q27A 3WHCA 4OESA 2OF7A 2RC7A 1MBKA 3GUDA 3OEMA 2DQVA 1IXGA 4GF8A 2I3VA 1GDTA 2W25A 4BEHB 1T95A 1OJLA 5KZTA 4DIQA 4MFDA 1H76A 4MAGA 3MWMA 2DT6A 2GWRA 3CQZJ 1W7PB 3AG1H 1JVYA 5HDNA 2NNNA 4EVIA 3S3OA 1UJ8A 4CZCA 3CMYA 1BC7C 2F48A 1LFIA 4L9TA 2QS2A 2KP6A 5FKNA 5F6FA 1T2KA 1ZKBA 1SVMA 5E3LA 3OL3A 1FBFA 4D5CA 1HA8A 1B3HA 4NAPA 2XWKA 4AM3A 4DE8A 1P4WA 5HBCA 1F1ZA 2W85A 1R58A 4ZEBA 4OTEA 2I4CA 4R6YA 4IO7A 2F4MB 2O84X 2RVCA 2ZNYA 4Y7NJ 2FSWA 1VQ5I 3E9XA 3BOQA 1ZLKA 1YFHA 4II3A 2KIUA 2F7AA 1T39A 3C1DA 3KP4A 5F0FA 5I56A 4GYIA 4P47A 2ME6A 1P4XA 3A3CA 2Z23A 4LN5A 2ZKZA 2L0KA 3D0SA 3K1MA 4HDUA 1FC3A 3H35A 1PUFB 5F27A 4ZEIA 1LB2A 3KN7A 4JQFA 3HRSA 3WE2A 3PUYE 2R6GE 3FXUA 2VC0A 1X2MA 4Z6YA 3V4GA 3V8KA 1EZ9A 3PMVA 5ED4A 1R49A 4LG0B 2ZMBA 4UUTA 2DVZA 1S9HA 2HGCA 2MLKA 3QYFA 4D1QA 5LD2C 1NNFA 2JSPA 3ECHA 2DA6A 1FZPB 3CG1A 4RYAA 3KIOA 4YZZA 2K86A 1H9GA 1OCOH 5FFZA 4QWQA 1FEXA 2CQ7A 1OYWA 2ZNSA 1B3EA 2DU9A 2PX9A 3FJGA 3SETA 3ZOBA 2K5CA 1NV2A 1OLCA 5ITPA 3SZPA 1J5YA 3BG3A 3GF2A 2NXNB 3BR0A 1FBQA 3PU5A 1FOYA 2HOEA 5JK4A 1BA5A 1X19A 4Q5TA 4H67A 1SD4A 2GH9A 1YE9A 4AB5A 2CU7A 3BZ6A 4PDHA 2COBA 4Y17A 3SXYA 1H43A 2L9VA 4OENA 2MLGA 3IWZA 4DGWB 2PBIA 3IC7A 3G1LA 1YW8A 2VN2A 5HS7A 1Z7LA 4BJ5C 1LAHE 1FCKA 4MEVA 4U0WA 3H3VK 3LSFB 1FTKA 2HDCA 4EM1A 2EPFA 4HPQA 2Z2SB 4PK4A 3OO8A 3W9WA 4G6TB 2ZFWA 3ABMH 3QP6A 4XRMA 5E17F 1R23A 3DLNA 1PB7A 3UK4A 2CO5A 3CMMA 2V84A 2O7OA 3Q9SA 1XD7A 2DTRA 2FMLA 2MW8A 2ZZVA 2K27A 2KRHA 4PE5B 4RNSA 5K2XA 3ABLH 1YPNA 2V93A 1YCJA 5DDGA 1DGRM 1LVAA 1W7PD 2O8XA 3QPTA 4WF2A 3ZQFA 4HLYA 3S14J 1URGA 3CIJA 3I6VA 4KCDA 1L3LA 1B7UA 2UWMA 1MPCA 2ZZWA 5I58A 3F6VA 4XKQA 2FNPA 4E7JA 3OY9A 4N8GA 3BR2A 4JWXA 1B7ZA 4XIGQ 3LA3A 3GZGA 3R26A 4Z7EA 1JJ8C 1WFXA 3F8MA 1LE8A 1QHGA 2I8DA 4GX6A 4AIHA 1KQ0A 1YJ9I 1IG7A 5FLVA 1N76A 1O7FA 4JB7A 2K4BA 5F24A 4BQAA 1AA7A 2OZ6A 2ID3A 5KK1A 4DZ1A 3CJRB 1LQ1A 2ZCWA 4NF0A 1NKXA 2ZZXA 2X7PA 5FGMA 2K40A 2ME0A 2RF1A 4A5NA 2W82A 3CCSI 4NF6B 1IC8A 1SVXB 5H8HB 4A3MJ 5DD8A 5FB2A 3WU2C 5E3NA 3V7CA 5GAEJ 4J01A 2JA5J 2QBYA 4IKFA 1IDZA 1N3WA 4NF5A 4MTDA 3S9NC 4BXUA 2F6CA 1SFEA 3I71A 5F0CA 3HC7A 4CYCB 1XVXA 3HN0A 5CKTA 3MZ8A 1MXUA 3MP8A 3O8GA 5DTDA 4YKJA 4F31B 4MNCA 1A54A 4FTHA 2ZXIA 3JTGA 2L02A 4O3BA 1IEJA 2IAIA 2VONA 2CGPA 3IUOA 3N6UA 4H6DA 5E79C 4KFQA 4M3GA 3JRAA 5H8SA 1WJBA 3U2RA 1D5YA 2VGQA 2AL5A 1ONVA 5ICGA 3FV1A 3PNVA 3Q28A 3QK6A 1XDUA 2V79A 1FQFA 4ZEFA 1X3UA 1YX3A 1IJWC 4ESXA 2CV2A 2OBGA 2CFOA 4P9UA 5TP9A 1URSA 1RYXA 3ZGKA 5DW8A 1MNEA 1OLTA 1LAXA 3KYDB 1W5TA 1Y1MA 3KN3A 2ZSIB 1HQCA 1SI0A 1NG7A 2W24A 3TDZC 2F6GA 4HW8A 1NTCA 4I09A 1JUMA 3EUHA 4U1OA 1W36D 3T93B 4IO9F 2R5YA 2WB1N 1W36C 4MEXF 3GTGJ 2HI3A 2D5VA 4GCVA 2EK5A 3ZQQA 1H3DA 3ZP5A 3EF7A 3T9VA 3T5XA 1I50J 4YIIA 2KQRA 3JW4A 1NI9A 3N6TA 5ICCA 1UB9A 4IR8A 3L00A 4LD5A 2ZXTA 2FJ1A 3K4MA 2VE9A 3ZN0A 4B3XA 4A3KJ 3BCAA 1JUSA 3ZQHA 3DPLC 2VKVA 2X6WA 3B02A 2B63J 2O1LA 2IT0A 3IOUA 4QRZA 3U21A 4XF5A 3PPPA 1PB9A 1JQFA 1JW5A 1NFTA 3IV5A 3FATA 4ZYHA 5ILSA 4XKRA 1FPKA 1ODDA 2K9QA 2VODA 3L6GA 4DQ2A 5DVFA 2Z99A 1D0YA 2XASA 5KHDA 2F4OB 5IPAA 2Q1ZB 5F1JA 1ITYA 1M5DA 4BJTA 1B5JA 1S29A 1T08B 4IHXA 1EF4A 1NV3A 2DMQA 4UY8I 2F6PA 2HAVA 2RN7A 3D1RA 2XAFA 3CSBA 5CVIA 4GRKA 1A55A 5FHNA 3BROA 3WTYC 1MMNA 2IA2A 4A0YA 1AOYA 1Q1KA 4YRVA 2DPDA 3NWSA 2WAQA 4E7KA 1BK4A 3K4BA 3IH4A 4HLXA 4ETSA 4PFIA 3UR3C 2LTPA 3K02A 3RYPA 2EIKH 4KIBA 4KT5C 3NEUA 2R8TA 3MVWA 2GZWA 4M9SA 3PQKA 2DMUA 2MD5A 1S3JA 3BPXA 3C2BA 5CVRA 1ZRCA 1J1NA 4XN0A 2KQZA 3O9PA 1UG2A 4ZE9A 2DN0A 4QPQA 2NYXA 4BS9A 3CCUI 1NV0A 4IX7A 1UZCA 3OV8A 1MRPA 2K02A 1ZIUA 2M8CA 2Y7KA 1R1NA 3PFYA 4X9TA 1EYIA 2IEKA 2VT3A 3PQJA 3H0GJ 5HS8A 1D3KA 2Z8FA 3QOEA 1OIBA 3CFZA 3CG3A 2HXIA 4JXIA 2I10A 1IUFA 3E6MA 5EHSA 5E18F 2H09A 3FBNB 2AXTC 3OYMA 3ASNH 3ZMUA 3U94A 3C9HA 1K6YA 1B4AA 2YX7A 3O6BB 3FXBA 1XMKA 3RZDJ 1IDYA 4U2RA 1FYMA 1ACIA 1R7JA 2XKPA 3PPRA 5CMKA 1EZOA 4BY7J 1X3ZB 4BDZA 2RCBA 4NTLA 4MHFA 3KG2A 4R73A 2MG4A 4R6KA 3TMGA 1AWBA 1LEVA 3BQZA 2IRFG 2I6EA 5F1QA 3EYIA 2IS6A 3P9CA 4ESFA 4IL6C 2AYSA 2DA4A 1Z6TA 2OA4A 1QVSA 4AYBA 3TPAA 1QHHD 5HLIA 2FHYA 2P8TA 2O1MA 3K10A 4GFBA 1SD6A 1H0MA 1SD3A 5CI5A 5CC2A 1G0IA 2MA3A 4F18A 4A3IJ 2EQRA 4LK0F 1JKOC 3W6KB 3FM3A 2Q8JA 2DCEA 2VXDA 3I0TA 4PQJA 3OS0A 3KOTA 2FNCA 3TP3A 3OSQA 5BPDA 1WCMJ 2ALUA 3I5UA 1TT1A 1MM7A 2H99A 4IRIA 2ZXJA 2FU4A 2W4SA 5B70A 4NC6A 2LREA 2UUZA 4ABZA 3KOSA 2E7XA 2OJTA 1HC8A 1J75A 2ZC2A 3HBLA 3N94A 4JOMA 3QRFF 3HM5A 3E5XA 1G4DA 3CTAA 3C2GA 4OMYA 2ANJA 3FVGA 3HHFA 3KJ7A 5ICQA 4GX3A 3KZZA 4MIMA 4L9JA 2H9BA 4THIA 1FX7A 3FXOA 2HOTA 4G7OF 4ZE8A 2E71A 1B72A 4RAGA 1Y0UA 2A07F 4RMNA 1HSTA 5EJCA 5ICFA 5D5UB 3OYJA 2WAQN 3K4LA 3RIRA 1I3AA 4Q4ZF 1FTAA 4W97A 1NUXA 2M8EA 1R22A 2OCEA 5D4SA 4ZH4F 2CV1A 1FQDA 4LIVA 2X6YA 2FOWA 4OIRF 1QBJA 4PC9A 2NVQJ 4R9FA 1MIJA 4G68A 2Q2CA 3HSFA 4BDRA 4B09A 4I98B 3S3NA 3OOPA 1T38A 1BJAA 1T0FA 4BBRJ 1B3FA 4LUBA 3OYIA 2GLOA 4AQ4A 2JA8J 2CRGA 2DT7B 5BS6A 5IKBA 2LOOA 3J81K 3CD6I 4XOPA 3U72A 1PUEE 2KJBA 1TBXA 1FP1D 4QFKA 1INPA 3SQNA 5I59A 1LFPA 1US4A 2UXNA 1FPEA 1U2WA 2VD3A 1MJ9A 1XI6A 3L9FA 4ONYA 2R7TA 3LSXA 4KITB 3TKYA 2GOXB 2HXRA 2ONKE 4Z0IA 4EMSA 2MBFA 4IRGA 1HKTA 1UHSA 4XTCQ 1GVDA 5FKKA 1AKHB 2PLYA 2ZYMA 3DV8A 2ZNZA 3RPQA 4EJOA 2VUMJ 2XX9A 1FSAA 3NQOA 4D0PA 1WRJA 2GXAA 1B58A 1AHDP 3J7AY 2F5XA 3S17J 3VYSB 4HBLA 2Z33A 4IHWA 1SW4A 2XKOA 5DM6F 2AHQA 4FT8A 1FSEA 1TWGJ 4IXAA 1N75A 5KAIC 2N8GA 1EH7A 2P0SA 1Z3YA 2BBYA 1QQIA 2Y2ZA 2I48A 1FQAA 2QF7A 4OWDA 2ID6A 2EV5A 2K7LA 2WB1A 3ABKH 3S1MJ 1IUDA 2PFYA 1VQ4I 1LFUP 4H65A 2DWHA 4C3IJ 3WGHA 4OVQA 6PAXA 5CM6A 2UVIA 1DQUA 2H1KA 4PBQA 1HDDC 1TFDA 4OVRA 3QU3A 1M5FA 4S05A 1B4HA 1XVYA 2H8WA 1ZG3A 4EGYA 2DWJA 3QXMA 4N07A 2CW8A 4ZC3A 4R75A 3K2AA 1IITA 4Q5SF 4WEDA 3KEYA 1A6IA 4P1WA 3I3VA 2JA2A 2XSJC 5ICTA 1SC7A 5EQAA 3DXJF 4ELPA 1XT8A 4IO2A 3ROJA 3MCZA 2JVHA 3EKIA 1K78B 3OSGA 5ITOA 4EM0B 2YPNA 3FXKA 4BY1J 1Q1HA 2KHMA 2JUGA 4IOAF 1G3WA 5FKOA 5DUIA 4GQOA 5K7FA 1JI8A 3K6UA 1XGMA 5JHUA 1DTGA 3Q0VA 3G3GA 2O6GE 3S15J 3DBRB 4KIGA 1UHWA 2IPQX 2VBYA 5LGTA 1Z77A 1ZN2A 2YPRA 2FX0A 1A35A 1R4MB 3W6VA 3PUVE 3G2BA 3MMYB 4U22A 3GFJA 2DFEA 2Q0OA 2DJNA 3E97A 3GFLA 3OYDA 4BE2A 1ZR4A 2X26A 4EQBA 1XTAA 2XX8A 4IGRA 3KEOA 1O57A 5L3FA 5LRSA 3C31A 3JSPA 5EZGA 1O7LA 5H8QB 2XSDC 2OWSA 1ETKA 1PB8A 1LE8B 5FKLA 1P1OA 1PDAA 2WYPA 2K9LA 2G9WA 3IH2A 2A5YB 1MD0A 1SAUA 3CMEI 5EYRA 1G59A 1WZ2A 2PT2A 2CQXA 1LEBA 2RC4A 1R71A 2COMA 3BR3A 5K1YA 5D8LB 5I58B 3I55I 3CF5F 5IT9Z 1D0ZA 1FWZA 3OOAA 4Y33A 4XQFA 1ERDA 2QS3A 3C34A 2UVJA 4HCWA 2QZ8A 3TTRA 4EDPA 3G3JA 3TW6A 4WX9A 3RZOJ 1U5TB 2YS9A 4QFNA 4JK1X 2V9KA 1AH5A 4NEDA 1IIWA 3SESA 3M9AA 1MH3A 2V4CA 5BUUA 1A40A 4LFUA 4XL9A 1ZG1A 3FISA 2QA4I 1A6QA 1EV7A 1W5SA 3IJOB 1JEUA 1S50A 1CNQA 2Y48A 4CA0A 3WAFA 5K5RA 2F3DA 4N9HA 3OYHA 2LKPA 2UYFA 3RT8A 2HEUA 3VXCA 4G6DA 1BOAA 4KR5A 4OZ9A 5DV5A 1YLFA 4ZS9A 2R7UA 1O64A 4PF8A 2XXKA 1T98A 1M5CA 2VBXA 2BHZA 2Q88A 4F91B 2PI0A 2JTVA 4M6YA 5F1RA 3ZQCA 1OMPA 3ZN1A 3UORA 3FVNA 4I3EA 2CMOA 4UACA 3BG9A 1B1XA 1DPRA 2K9SA 5LDZA 3CESA 1B0HA 1WGXA 4ZZDA 4XICA 1FNNA 4C9YA 3OYEA 2DYXA 2FVZA 5FTIA 5EF6A 1IN4A 1FTTA 3K01A 1FMWA 4O3AA 2X4HA 3RCOA 4H46A 4HE1A 3MBPA 2LY2A 4LA9A 1MQJA 1OMIA 3BJOA 3HJEA 5EEHA 4YFKF 3HL2A 1RIOH 3IHUA 4XMYA 2P3NA 1YW7A 2F5CA 4CGZA 4CCKA 4E7ZA 1U78A 1SBPA 2FIXA 1RYOA 3MAMA 3OYBA 3IRQA 2HEOA 1NL5A 2F3BA 2V3TA 4I1DA 1YJNI 3V5AA 1Z91A 4UVCA 3FXLA 1QRYA 4KMUX 1FW0A 2WADA 2YX4A 4U0VA 2YR2A 3AFHA 3QSLA 2QQ9A 2HS5A 3RPUA 3PO2J 1I6XA 3ZKLA 1P6RA 3OOUA 2XXWA 2WAEA 3LQQA 3G3HA 1EH8A 3S2DJ 2QQAA 1BI2A 1I27A 3OR1C 4O3CA 4POWA 3SYTA 2LY9A 4JBZA 2BY0A 1MPBA 3S32A 2FE3A 4H4KC 1UTHB 1Y9UA 1NUYA 2LVSA 2IVMA 3DCFA 4R1HA 5HLHA 3U1OA 4FQGA 4LGWA 1Z05A 5EZHA 5CQEA 1CF7A 1VQ9I 3VLVA 4NUBA 2H6CA 2DQLA 3C3WA 5IYDJ 3OIPA 1L5TA 4AVZA 3H3GA 3Q25A 2Y0SA 1LEAA 3I4MJ 3GYHX 1ETVA 1MSFC 4BYYA 2DAOA 1IZ1A 5IP9J 1W7PA 3IB0A 3VB2A 2VKEA 2E2HJ 4PDDA 4V19K 2EFQA 4HX4A 3GZNB 3ESWB 1CE2A 3ZRGA 3JYRA 4XEQA 2AL4A 5I84A 2KJCA 1P1UA 1RZ4A 2BY2A 4YB7A 4DXBA 4D7NA 2H94A 1BI1A 2XD3A 3GLXA 4HAMA 2QKLB 2XXTA 4PETA 3SEVA 5LGUA 5HLTA 5HOOA 5EEGA 3U1DA 3PJRA 1OQYA 4RAYA 1SAXA 5KCJA 2FBIA 2LC2A 4U0YA 4OIQF 1LDKB 1ZQ3P 1FIAA 2HR3A 3BG6A 3HFUA 4A3EJ 2H8RA 1A8FA 2KIFA 2R5ZB 3WODF 3MJNA 3FF5A 5CQGA 3U65A 3GZ6A 2CZKA 5FJ8J 3SDBA 1VNDA 3NWTA 3VSKA 2EILH 2NRAC 2HOSA 4IGTA 3QYBA 2L9SA 5HDGA 2REJA 1QZEA 4D7MA 1FTLA 5CJ9A 2ZSHB 2LF7A 3S9LC 4PFPA 3AG4H 3V89B 5B5EC 2QFLA 5ESYA 4ZZAA 3JRGA 3F21A 4EXLA 3LAJA 3HUGA 3KP6A 2ZYKA 4I0BA 4N4OB 2VHAA 4RK2A 4ENJA 3VDFA 1SEUA 2DOEA 2M7BA 2XGDA 3IKVA 3EQLF 4TV7A 3BIGA 4AWXB 3G7WA 4O5VA 3IB1A 5TU0A 1R1TA 4RM3A 5AIQA 2Z1DA 3KLNA 4MGRA 1TWYA 2F7CA 4IO5A 1B0LA 3EHTA 4G2ZA 1IXRC 4OEVA 3GXAA 3O29A 1OQGA 4O7MA 2DYSH 5JEIA 2GIVA 3E6CC 3A4CA 3FBPA 4G8XA 3FJMA 1FJ9A 2XAGA 2BOLA 3RTRA 5JLXA 1SVOA 1Z1DA 5LHHA 3OXNA 4D5FA 2VJ4A 4C0RA 3R4KA 4KI0E 4DIGA 1E2XA 4P96A 2Q74A 3AL0C 1XB4A 3F9KA 5B7DA 4LLLA 1FBSA 4LQ5A 2H1LA 4DCYA 4F3GA 3TODA 4RPNA 1DPEA 1XC5A 5LEKA 4I3YA 3S1QJ 2HXOA 1MM6A 1R1VA 2CWEA 2QSXA 3SEQA 3L2RA 1SDXA 4NE4A 4X1BA 1JKRC 3JRCA 2AS5F 1G0HA 2M87A 2NS0A 2ELHA 1W0TA 5IOZA 1LCFA 3MP1A 1X58A 5DVIA 1FOXA 3PD8A 4MNPA 3NRVA 5L3BA 1FPBA 5B1BH 3J81Z 1TL8A 2NXOA 2D1HA 2VXZA 4OVPA 5AIPA 4JX6A 1R00A 2QEXI 1GT0C 4XM3A 4IQJA 3M8UA 4RPOA 4Y52J 3BKIB 3GTMJ 2FBPA 3B6WA 4P0IA 2VD2A 2MD0A 2Y84A 4PGGA 1FJ6A 1ZK8A 1QO0D 5TPAA 1Y4TA 1IRFA 1Q1VA 3FKJA 3O6IA 3H1CA 4OEUA 2HQ0A 4HOBA 2QS4A 5F7VA 2OPTA 3EPZA 4L0ZB 2P5LC 3KP3A 2ZNUA 2X6OA 2Y5LA 3RT6B 2F5DA 2E60A 4TLMB 2K85A 4UB8C 1NV7A 3KETA 3TQLA 3QYEA 1JXSA 1KA1A 4UXNA 2F34A 1HOMA 1TLHB 3JRDA 1E3OC 4NF4B 2ELJA 1IMBA 3WTVC 2HAUA 1Y3NA 1VQNI 3QPSA 4OU0A 3VEPA 4B43A 2B7EA 2NAZA 2RNGA 3H36A 2JWTA 1VE4A 2FF4A 4ENMA 2E1SA 3FGSA 2UVGA 1U6GA 2CFXA 3LMMA 2CEYA 1ZREA 4CCMA 4LATA 4MQ9F 2XHDA 4A6DA 3A03A 1RKMA 2E2JJ 2LBFB 3W2VA 2HCAA 3TAJA 2DA3A 1WJCA 2LRDA 3HHHA 3PV0E 2GRVA 5AA4B 1UCRA 2GQQA 3BG5A 1ZJLA 3AAFA 4G7ZF 2CQNA 1J7KA 1KU3A 2LFBA 5J8CA 4RGSA 4HEA2 3RQ4A 5ERIA 3K70C 3RSNA 4PFBA 2A3SA 2JPBA 2OZUA 5JFRA 3WTUC 1KU2A 5I57A 4R2BA 5FD6A 1TZLA 1VFDA 3K9TA 5GPCA 5LEJA 5M3FJ 2XPWA 1AKHA 1EYJA 4U21A 1HW2A 3E78A 2FQ4A 4NF8B 3K1PA 1T6SA 2KR0A 4HXVA 4XFEA 3I56I 3TCGA 1RC9A 5CVJA 1B46A 2F8DA 1WHUA 4PJNA 4HF0A 3TDUC 2EZKA 4X1EA 4FCYA 4J19A 2P1SA 4XOTA 2GA1A 2CEXA 2HYGD 1HLVA 3LC8A 1SYHA 4LMYA 3JZJA 1LDDA 2BXZA 3KC1A 1K78A 4U23A 3DU5A 1O3TA 3IAS2 2BW3B 3EPEA 3F0CA 1F9BA 2XB0X 1HSEA 3A29A 4FX4A 3S16J 5LTCA 3VLUA 4AC0A 2PMHA 2BJIA 3VOEA 4EJVA 3Q0UA 5M5YJ 4HYEA 1VQLI 1N7XA 4N15A 2PMZA 1FMVA 4ELQA 2GHAA 4GWWA 2DWIA 3G6EI 5KDTA 2LKXA 1O4XA 3VFJA 1PJRA 2HFHA 2G0EA 2CZHA 4N81A 3IH3A 1D1CA 3X2QH 2E19A 2NOGA 3BDDA 3HPGA 3J7AO 1S7YA 2WEFA 4FEBA 1PDNC 4E70A 2R3SA 1WVJA 2R7WA 2CYYA 2JUCA 1OLAA 4PBHA 3Q0WA 4PFRA 5I2NA 1ZGAA 1B72B 1NNPA 4MIJA 2H27A 2E0SA 4X48A 5FTHA 3DTKA 5TPAB 1P2FA 4A3JJ 2P5KA 5CMBA 2OU2A 2DFIA 4DYQA 1F36A 1QGPA 2RAEA 1FP2A 2LNBA 1RUNA 1B5IA 1FTJA 4BNCA 2RV8A 1MXYA 1AU7A 3RUMA 3KZIC 5E3OA 5JI6A 1A31A 1ZBMA 4NBQA 3IFAA 4EJTA 4WXCA 4JWOA 1N7WA 2IGOA 2KL4A 3ZMDA 3DP8A 4TQUQ 5AA2B 1VI0A 2PEXA 3TOBA 2V4JC 3N4MA 4YIRX 1FTOA 1AL3A 2YJPA 3GO5A 4JBAA 3I5OA 2LSOA 1MW7A 2BE5F 2KIMA 2XAQA 4O94A 1EYKA 3HXLA 4M9ZA 4KFCA 1Y3PA 5H2FC 2MKZA 2QMXA 2TDXA 1PC3A 3CSGA 1P1WA 1XOCA 1NNTA 4G68C 4XKBA 1WKMA 5BMZA 4OETA 4FE7A 3B6CA 5J4YA 1YRNA 3OYNA 1MZBA 5M5WJ 5LBQA 3KGCA 5DUKA 4EJWA 4OOIA 1QZYA 1SD5A 5DCMB 2QL3A 5AA2D 2DP8A 4O7IA 3BG7A 3M1EA 1K4TA 3E4RA 1B6HA 1YS6A 1LBCA 2L7ZA 3OYLA 1B2HA 2IA1A 4TLLB 2QJEA 2XGXA 1JVXA 3FUZA 1YX5A 3MQ9A 2EINH 5CBSA 1RRJA 4P1LA 5LHIA 2D45A 1OVTA 2Z8EA 4G68B 4MO7A 2FEZA 2M2EA 3TGNA 5DYHA 1XX5A 1LBZA 3I59B 4K3FA 4X1DA 1OCZH 5J40A 1FYKA 1WI3A 3RQIA 1YAEA 3D5LA 1PVEA 1LB8A 3B6QA 1HKSA 2IGNA 1A99A 1B40A 4H1XA 3LSHA 4IEJA 4PE3A 2HYFA 2VIXA 5K5QA 4LB5A 4KYEA 4PCDA 4QSDA 3GFMA 2DK5A 1OQHA 3GMEA 1MH4A 4XLEA 3GXOA 1V5FA 4HQMA 1SANA 4RS8A 1KGSA 3QUJA 3SHFA 2OWTA 2Q9TA 5F04A 2CG4A 3VYTB 3O66A 1IV6A 3ERMA 2J5OA 1MBJA 4EATA 1MDQA 2M1BA 4KMFA 1XS5A 3TTMA 2KZGA 2VPRA 4EM2A 3JAMK 1LPQA 3M3YJ 4R72A 2Y9YA 5EYHA 3DEUA 2X1DA 4BDLA 2FA5A 1LFHA 4XKNA 4BHPA 1VDWA 2J5PA 1F43A 1OR7A 2MC4A 2ZJRF 4UUVA 4I40A 1K79A 4ANJA 2RNJA 1LBWA 4AS5A 5C44J 2D2WA 1OYIA 1X1BA 2FUG2 2IP2A 4P1EA 4ZEDA 2L4MA 3MVPA 1MS7A 4XXUA 1XCBA 3U9GA 3EUHC 2VQLA 2O8KA 2Y7RA 1VZ0A 4LIUA 1MDMB 1B59A 3PPQA 1N25A 2HOAA 2OC6A 2JA7J 1MKMA 1WJDA 3DP7A 4BQQA 9ANTA 2L2OA 1IV8A 2A6TA 5TGTA 4AYBN 5FLMJ 2X1CA 2KLOA 1FBHA 3ZQIA 3PPOA 3H9QA 4DXCA 1J09A 2W57A 2GXBA 2K3PA 3QQAA 4EGZA 3L2CA 3ILTB 3N5LA 4NGUA 2VJ5A 2OX3A 3P5JA 4GYGA 3L6HA 3IJXB 3P7IA 5IAIA 2XVCA 3C35A 4QTRA 2MSYA 1TWHJ 2WTEA 4C2MJ 4ESWA 3TDJA 3LSKA 1S9TA 2Y7WA 2PBWA 4MHGA 3LUYA 2Q8KA 2B4MA 4P0GA 1GR2A 5JVTA 2R93J 4F3QA 1K6OA 3H03A 1TQPA 1XHYA 2AQEA 1U9OA 2E7WA 3H06B 4ZDOA 4GO1A 5DS9A 3GCMA 4AU7A 4R74A 1FPIA 3FIRA 4PGHA 2BJJX 4LB6B 4F39A 3G1MA 2A69F 2ZO4A 3FHNA 5L3GA 2PJRA 2OQRA 2H98A 1AOVA 3LWFA 1J59A 4MQVA 1FBDA 4ESJA 3OIOA 5JVGF 4HW0A 4R79A 3CCMI 2G7UA 3R61A 2R7VA 4ND9A 4M3FA 4DYRA 2UV1A 1I1GA 4QIWN 3PIPF 1VQOI 2JK3A 3BFUA 4HNVA 4JVDA 3MZHA 1J9IA 2A5SA 2PMSA 2I0BA 3F22A 4U4XA 1VSOA 1JETA 4PSXA 5L9SA 4XK4A 3LBSA 2NS8A 3U92A 3K4JA 1B05A 3WGGA 4A2UA 3M7GA 3KSXA 1IMEA 1IRZA 1MDMA 2MH9A 4ZECA 1WWXA 4Q0CA 3RLFE 4WEPA 2JZYA 3H9GA 2CW0F 3QAHA 3TEPA 3W6JB 5F64A 3CI8A 3ZS6A 1WJFA 2OV7A 2ZYOA 4HF2A 1LAFE 4LZ7A 5LRRA 3WTXC 3BR6A 3MEXA 4HA8A 1KWHA 2F5FA 4V2GA 4DW6A 2M30A 4JVCA 4QSHA 4DZJA 2XIGA 5H8FB 2BY3A 1GUUA 4NQWB 1DSNA 2DXRA 3EN3A 3BCBA 3T0YA 3IL1B 2VE8A 3F3XA 1UHMA 2QSFX 4OFOA 2OK2A 1JTYA 3TFLA 4BLAA 2F5VA 5B1AH 5JLWA 5EYGA 1QZZA 2Z16A 1MY4A 1DMBA 4U1ZA 2W1OA 3ML6A 3O2PE 2ZXWH 5HLGA 2ESHA 4MTEA 1MBEA 5J4VA 3LFUA 4E0WA 2JSCA 4DYCA 5IY5H 3TO7A 1N78A 2FBKA 4KN7X 5D6FA 5CVUA 5HNHA 2LD5A 3HTSB 4RB0A 3PSFA 4RGXA 3FVKA 5H8QA 4XORA 1QA6A 1R9TJ 2QLZA 3KN8A 2X85A 1I69A 4M74A 4KIFA 1GVCA 2HYJA 4MBPA 1MXWA 3OSRA 1G3SA 1FLIA 3I59A 2BVLA 1QPMA 4I99C 1YIJI 1POGA 3FHZA 5DCFA 2R7RA 1Q35A 1ZH5A 1DU0A 1LKXA 1FPFA 3K2DA 1CQTA 4F1UA 4A93J 2DW4A 3A0BC 2QCOA 2BXYA 2ZB9A 3I4NJ 3IKTA 4BDYA 1XS9A 2VQGA 1O3QA 1Y0NA 2DYRH 5D8KB 1VTNC 1X4OA 3QAXA 1EU8A 3A0HC 5IYCJ 3OYCA 3A09A 1SVLA 2O9LA 2DTZA 1GGGA 1XC1A 2QBYB 1SW5A 4ECFA 3NARA 4XRSG 5FRMA 1YQAA 2VOOA 3HYIA 1VQ6I 3E7LA 3JAMZ 3DF8A 1YRNB 2VB6A 5CLSA 5JR3A 4WCGA 2DDBA 2NVUB 1KU7A 4M3EA 3DM0A 1BKAA 1BOBA 4U87A 3FMQA 1NV1A 3RY3A 1S6LA 3M3LA 3IRRA 2JRMA 1MSEC 2ZYNA 2UVHA 2IXSA 1HCRA 3MWBA 2O0YA 2OD5A 1CGPA 4F22A 5HPQA 4P55A 3GBAA 2KZVA 3HG9A 1Z7UA 4JVIA 2XF5A 2AIXA 2K9MA 2P3VA 2HXWA 1EH6A 1REPC 1D5VA 5IT3A 3DTIA 4Y4RA 4RAZA 2VP1A 4YIFA 1FBUA 4LG0A 3CCLI 1OPCA 3T8RA 2PJPA 2NS7A 4E6KG 3KBRA 3PIOF 2X0LA 1LFBA 1NG6A 3DQVC 5I5PA 5IGAA 4M9XA 4JX4A 1S72I 1PUFA 1L0OC 1SMYF 3W3CA 4G7HF 3UA8A 2BHYA 2Z3YA 2ZFUA 2XXXA 2Y9ZA 1LB9A 4RB1A 1DPPA 4UNOA 5J6XA 4U7DA 3HOUJ 4AUXA 1KU9A 3I3LA 5IZ1A 4OVJA 3WHBA 3PMXA 3KYLA 3RTWB 1HXDA 3B73A 2V7FA 4PGNA 1S7OA 1DBZA 5TISC 4F52A 4UUSA 3V8XB 1N04A 5GAHJ 3VXBA 4BHBA 1NH8A 4HF1A 1JEVA 4IO3A 4JX5A 5DT6A 3K0VA 3JREA 5L3CA 3Q26A 1ZELA 3ELKA 1RR8C 4A3CJ 5KDTB 2CJJA 1NV5A 4OVSA 2DWAA 3FXMA 1NH7A 3THIA 4ZJZA 1DU6A 3CP8A 3AL0B 3QP5A 4G61A 4HX7A 1KQ9A 1JHFA 3RKWA 4XNFA 3ONMA 2DODA 4BEHA 2P6TA 3I64A 4H8JA 5I59B 1FYLA 1AMFA 2D3IA 4PFWA 2X51A 4Q47A 4IOCF 1IMDA 2WV1A 3PL8A 3GLBA 2L3DA 5TJJA 2IJLA 2V1XA 3ULQB 2E1CA 3D4CA 4DI3D 1V5GA 4LZ5A 4WWCA 3K1NA 2HFBA 3OO9A 5ISUA 1NK2P 3LQRA 3CZ6A 2HQRA 3RKYA 4KICA 1P4AA 3SEZA 4CH7A 4DNCA 3ZPLA 2FIEA 4A5MA 3S2WA 3DP4A 3JRFA 3EQ1A 3IAZA 5A2QZ 3MZ1A 2P4WA 1JNFA 3H4ZA 1G3YA 1FBPA 2M0MA 4AVPA 1R5HA 5L8DA 3EUKL 2M45A 4NNJA 3L2QA 1OFCX 2XXIA 1Y1ZA 3PPNA 4N6KA 5IZ3A 2F7BA 4HSRA 3FJ7A 4ON0A 2W7NA 5I57B 1VFEA 4L0YB 1XG1A 3P9KA 4HNUA 4F2OA 2MC3A 4IO6A 4XLPF 1JJ6C 1B52A 2XXHA 5EQ9A 4AD9A 4A3DJ 3LFKA 4OAYA 1SYIA 3OD7A 1POY1 4RY1A 3RI4A 1D1BA 4ZYDA 1KZ8A 2DXYA 1GXQA 1Y39A 2UXXA 2LYCA 4DBQA 2VLAA 1LCTA 4N91A 1H8AC 1SMTA 4PZJA 2PG4A 5LLQA 3VYUB 3FASA 2JMWA 3KJTA 5D5WB 1W0UA 2Q89A 4FE4A 5HNFA 4CO8A 3KYCB 4E7HA 4RDUA 1TC3C 4PCQA 1D9YA 3T9HB 2X7QA 1S7EA 3CCJI 4AS4A 4N9IA 2Y69H 3J80K 1B9MA 4XRSA 4L5EA 1ZGWA 4F2QA 1WJ5A 3N05A 1BR4A 2VPOA 1T0KA 2R7OA 3WU0A 3GWZA 2VKHA 2I0CA 3ZSFA 1BL0A 2KRCA 4D9JA 1YIOA 4EF1A 3DKXA 2YU9J 5IZZA 4ZDPA 2DBBA 4HG2A 2GM4A 2V3QA 1MQIA 3FKIJ 2K4JA 2IS2A 2O7IA 1BW6A 3C18A 3JRBA 3KCCA 1B5HA 1K83J 1O7TA 1IXCA 2RGVA 1ZGJA 1QKAA 3RKXA 1PP7U 4L9VA 3PO3J 4KDPA 3MZBA 5K7HA 1PEBA 3MPLA 4PJLA 1MXXA 4I2OA 5FFXA 2EFOA 4JWYA 3PSIA 3C33A 4DXUA 5CBRA 3SDGA 4NMYA 2Z9OA 1JKPC 3UKGA 1RDYA 5CPRB 4PAIA 1KQ8A 2G7HA 3OYKA 2PCRA 3ZMZA 1U0JA 5GTIC 4GL8A 1USYH 4MNIA 1MMAA 2A68F 3AXFA 2PQ8A 4JDFA 5HODA 1E3HA 1A7LA 4KUMA 1DDNA 2WA0A 2XXYA 3HOYJ 2WBBA 1H88C 4EV0A 5LFAA 1SI1A 4P3LA 2X6XA 2XC7A 1U9NA 3FV2A 3IB2A 5CMMA 4F3SA 4A3FJ 2W84A 1V55H 1SPIA 1ZHFA 4G4PA 2CSOA 5IP7J 4GXAA 1TWAJ 3I9V2 3OWTA 1EJ9A 2WY8Q 2Q2AA 5I7IA 1IO2A 1EZPA 1B3GA 4NB5A 2CW7A 2WKYA 4IZZA 1MNMC 2ZMEA 2A6EF 4F93B 2R7SA 2ONSA 5JTYA 1N84A 3I58A 3MKWB 1FPQA 2RCAA 4RB2C 2M7AA 1ZRFA 3VDXA 3DFGA 1MY2A 2PMUA 1XDSA 4M6VA 2PX1A 2RDPA 4C30A 1NNKA 3L09A 3W2WA 5M3MJ 1P1QA 4BQOA 2BYVE 2L54A 3BR1A 2ACJA 2DOJA 3TKDA 2E35A 2M9HA 1NHAA 1FTZA 2OZZA 1QUJA 4NF8A 1S8NA 4I0AA 2VQHA 4EQQA 4LONB 3LL7A 1M5EA 2D21A 4U88A 1ZYRF 3L2UA 4CCLA 4POXA 2E5NA 1X4PA 4X6AJ 2X9DA 3M8JA 2E1OA 3VSLA 4OYVA 4GX4A 5L3DA 2E36A 3IP4B 4UHTA 4A6EA 4KXPA 3OS2A 4N4UA 5J47A 2HU9A 2W48A 2XF7A 5FHMA 2DLLA 4PFUA 3VE1B 1MJAA 1VQPI 3VV5A 2V6EA 5DEQA 2MYSA 3QODA 4HQEA 3CR9A 2Y7IA 3WG9A 1LBYA 1I6QA 5LHGA 1BBYA 1ETXA 4IVNA 2OAZA 4CZZA 2R9JA 2EJRA 4FASD 1TFAA 1JGGA 2V25A 4NF4A 3CDIA 1WPKA 5TRDA 3H6TA 4C2TA 4ZZLA 3C2HA 3O28A 3OEKA 1KA0A 4QSEA 4OMZA 4PDKA 4OHNA 3LSRA 1DPUA 1QU3A 2RC9A 1QVTA 1UTHA 4UA8A 1I5ZA 4H5FA 2PVUA 4Y3OA 1IRGA 3IR1A 3H9JA 4PJ0C 1FY7A 3RGYA 4FIMA 5IT9K 3BFTA 2WAFA 2JN6A 4HSTA 3S1RJ 1C0WA 2DSFA 4CYCA 3GTLJ 3S3MA 3S2VA 1BN5A 2HKOA 2STWA 4H0EA 3OELA 2I5UA 2L7FP 3CLOA 3H5NA 3LA2A 1J0RA 5EQ7A 3F72A 5FKMA 1N77A 4KT6A 4S04A 5H8HA 2F2EA 5EGOB 1DTZA 4ZTFA 2IEEA 2KDOA 3VVEA 4CCJA 2DS9A 1VF9A 1F4KA 1LSTA 2XXQA 3GTPJ 3L2VA 3H92A 4HTGA 5J3LA 3HKZA 2KPMA 1QKBA 3CMAI 4F1VA 1XSXA 1B1BA 1Y1WJ 2FA7A 4MFIA 4BDMA 1EKEA 3VPRA 2CV0A 2JQ7A 1JW4A 3H6UA 3S9EA 1U8BA 1Z9CA 2BZTA 2CUZA 2TCTA 5IOYA 3B8BA 2ONRA 4YKIA 1YW9A 1LBXA 4KA4A 1ORKA 1MMSA 2E1NA 1POTA 2JRTA 3J80Z 3RTFB 2D1VA 4OWRB 3M8FA 4P9FA 2DXIA 2K3FA 1TWFJ 4I62A 3QYTA 1NUWA 3BBRA 3IFCA 4JSOA 1BP5A 3FBIB 2WBMA 2OTLI 2KMUA 1DP7P 2QUFA 1WI9A 1ZG5A 4DBRA 4YFXF 1Y8RB 5KVRA 3S2HJ 3WAEA 4C1UA 5FO5A 4GXOA 1PYVA 3TW7A 1FBCA 3GBBA 1K4SA 4CSWA 1H9TA 3MUQA 4BXXJ 4UB6C 2H25A 4FATA 1YG2A 1Y1VJ 2R4GA 1SFUA 3CCRI 1B4ZA 1X1AA 3QUFA 3FXJA 3R6SA 3OR2C 5FLXZ 3V7SA 4MH5A 4P8BA 2DE3A 1D0XA 5H6RA 3B6TA 4O8MA 2VOZA 2O7UA 4QFPA 3UGWA 5BOXA 5EHMA 1XGOA 4B1RA 3E5QA 5J8FA 1QVUA 1VQ7I 1QUIA 3LUZA 4YKPA 3TCFA 4ELRA 1Y8QB 1ZTRA 2A61A 2JJ7A 5E1WA 1ZRDA 3E5UA 2HVSA 4XRFA 3G3IA 4YU0A 1MJBA 5H6QA 1B6AA 3HOVJ 3CCEI 1UAAA 1MXZA 5A2QK 4C3HJ 1YO5C 3CHGA 4BBSJ 2B3BA 4RGRA 4MLQA 5FHOA 1FIPA 3HOSA 3R0AA 5KCJB 4YAHX 2KDZA 3Q3SA 2XXRA 3GVAA 2IS1A 5I2KA 2R7FA 2QSGX 2DQRA 1YOVB 1X1DA 2B0LA 1G3TA 2FNAA 4LLGF 5EG0A 1VQ8I 1PBQA 3OO7A 3U93A 2V9VA 3MW0A 4PTKA 2ECBA 4PAFA 1OCRH 3EYYA 4LK1F 4ZYAA 1YI2I 4NHBA 2EBIA 3RJPA 2HHMA 3H7MA 1RPWA 2GXGA 1W5CC 4MEYF 3G3ZA 3W15C 5GAGJ 2XGEA 2VI6A 4DOZA 1GV2A 2EWNA 2O03A 4NG7A 3E1SA 1M1EB 4XN3A 5GP9A 4R8HA 1D4NA 2P2AA 5EEAA 1GLNA 1ZAOA 4I7HA 5J1UA 2NVXJ 3HTUA 1URDA 3B7DA 4HNTA 4NWDA 1Z7NE 4S0HB 2R7DA 1Z7ME 4RK9A 4F1YA 1CF7B 4CXFA 2KKOA 3MD2A <