3FXQA

Crystal structure of the lysr-type transcriptional regulator tsar
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
296
structure length
296
Chain Sequence
MLKLQTLQALICIEEVGSLRAAAQLLHLSQPALSAAIQQLEDELKAPLLVRTKRGVSLTSFGQAFMKHARLIVTESRRAQEEIGQLRGRWEGHITFAASPAIALAALPLALASFAREFPDVTVNVRDGMYPAVSPQLRDGTLDFALTAAHKHDIDTDLEAQPLYVSDVVIVGQRQHPMANATRLAELQECRWAFSSAPRGPGAIIRNAFARYGLPEPKLGLVCESFLALPGVVAHSDLLTTMPRTLYERNAFKDQLCSIPLQDALPNPTIYVLRRHDLPVTPAAAGLIRWIQHHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on the full-length LysR-type regulator TsaR from Comamonas testosteroni T-2 reveal a novel open conformation of the tetrameric LTTR fold
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Transcription regulator
molecule keywords LysR type regulator of tsaMBCD
total genus 95
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fxqA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxqA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxqA03
2ZYKA 4ZYEA 2OBPA 4R6HA 4U4SA 4QFOA 3SZPA 3BJAA 3M8UA 2HXWA 1R1VA 4G8HA 1B58A 4E0XA 4ESWA 1I27A 1HKSA 3GFJA 5KCJA 5AA2D 2MD5A 2F2EA 4KQPA 4JB7A 3IX1A 3DFGA 1KU7A 5K1YA 3QAXA 1AWCA 4N9HA 5H6QA 1MXZA 2ISYA 2W85A 2VHAA 4CDGA 5ITPA 1MY4A 2VXZA 5CBSA 1MQJA 5EEGA 5L3BA 2RQPA 4KFQA 2FRHA 3BWGA 5AIPA 3OXNA 2K4BA 3I59A 2QYOA 4ZZLA 4EJTA 1JW5A 1NMUA 3RI4A 3DLNA 4FATA 3OSQA 3I53A 4RJZA 1B51A 5BPIA 1DTZA 4NF6A 1MY0A 3H3ZA 2CMOA 3P9IA 1W7PB 5FTIA 2P7VB 2EV0A 4QSCA 4YB6A 4ZEKA 1B3EA 2E1NA 4DZ1A 5HS7A 2DVCA 1I69A 3MCZA 4LMYA 3GEZA 4ENJA 3IRRA 1J5YA 5CC2A 3E3KA 2RVCA 3T9VA 3FASA 3R6UA 1FQEA 3OEKA 2DTRA 4KDPA 1D8JA 1QZYA 1V4RA 3MJNA 1G3TA 3ZQ7A 5CM6A 3M9AA 2A3SA 4QSEA 5DEXB 4PGGA 2H09A 3IL2A 3F3XA 1TT1A 2OQGA 2F7CA 2VBYA 4A5NA 1Y3PA 4F39A 2ZFWA 1FLIA 2H5YA 1FYMA 4ZEDA 4BDMA 2QMXA 2XXVA 2BYVE 4R75A 3T1BA 5E1ZB 4LATA 2H25A 4F19A 1FNNA 3UGWA 3LWFA 3TUSA 2Q8JA 2DPUA 1B3GA 3TOBA 3EYYA 3ZKLA 3U93A 4AIKA 4B8XA 2KJBA 1ODDA 1PEBA 1DP7P 4O3BA 5LRSA 4EF1A 4IB2A 1MDMA 4UXNA 1RI7A 2ZBKA 4UUVA 3CSBA 3FVOA 4KCCA 2RC9A 3GUDA 2DWIA 2E7WA 1FOKA 4JBAA 3TQLA 1B6HA 3IB2A 3SXYA 5D5WB 3PMXA 4YFKF 1YTVA 4GCVA 1R00A 4EXKA 4KIGA 4F3BA 2JPCA 1XVXA 2UVJA 3IRQA 4UHTA 1TFAA 4DNCA 5DT6A 1OR7A 4ESFA 1Y1ZA 4U23A 4GGGA 4WKMA 4DXUA 4FAJA 1RKMA 5E8IA 1YW7A 1MG1A 5I59B 3TTLA 3N97A 3EUHA 3ONMA 3IB1A 2HEOA 4F2OA 1REPC 1H45A 1TNTA 1MQIA 3K2DA 2WC2A 1SQYA 1MJ9A 4HF1A 3S2WA 3SZTA 4U22A 2QJEA 2M30A 1TLHB 4GFRA 3MZBA 1N3XA 2DWJA 3R26A 2L01A 2NAZA 4BDLA 3MQ0A 4OIQF 1B4HA 2QQBA 4MHGA 3O29A 5CMCA 1O64A 3I0TA 5L3GA 3PUXE 1EV7A 1O63A 3OSRA 2MLGA 3S9LC 3R60A 1OYIA 1UTHB 3KFMA 4N0BA 3MAJA 2HZKA 2EFQA 2EFPA 3TFLA 4ZYHA 5I58A 4C0RA 3FUZA 4F31B 4GXSB 3L9FA 5A2QK 4BXUA 1P4WA 1US5A 2O7IA 3DPTA 3ERED 3FVGA 2P6SA 1JE8A 1P4XA 1NHAA 2BE5F 1S7OA 3MP6A 4KN7X 1F1ZA 2QENA 4Z7EA 2EK5A 3Q9SA 2RKMA 1A8EA 2KJCA 4L0YB 1Y4TA 2EFWA 1MM6A 3DQVC 1USTA 1ONVA 2Y0MA 3KEOA 3J80Z 5FLXZ 1ZLKA 2PT2A 4UVCA 2KKOA 1P99A 5J6XA 4X1DA 1FP2A 3CVGA 5HDNA 1OYWA 4MNUA 2XD2A 1TW3A 2OCUA 4NF5A 4NF5B 3ECHA 5KDTA 1S7YA 5CJ9A 1MH3A 3I5UA 3PQJA 1BIYA 4EJWA 3HYIA 5A2QZ 1G6NA 5TP9B 4WXCA 3KLNA 1HXDA 3HO7A 4BHPA 1Z9CA 1MS7A 2VE8A 1MPDA 5E1XA 2H6CA 3E6MA 3VXCA 2LDUA 2EJRA 4PCQA 5JR3A 3PD8A 3RGYA 3M3LA 1AIVA 1B9MA 2O61A 5E8GA 2O84X 1B3HA 2Z8FA 2DQVA 5CVVA 1Q35A 4P9UA 3O2PE 1VFEA 2QLZA 4TV7A 1XGOA 1FTOA 3MZ9A 3F23A 3KZZA 4H67A 1LNWA 2Q8KA 4GLIA 1IN4A 2L4AA 2VC0A 2VOOA 2V3TA 3QPTA 3FVNA 1TW2A 4ZS9A 4G68B 1XMKA 2QWWA 4Z2YA 1ELJA 2FA5A 1O3SA 1XD7A 3G3IA 4ONYA 3VDFA 1IXHA 4A0ZA 3WTUC 4H8IA 1RUOA 3E4RA 2MBFA 2F7BA 3W9VA 1ON2A 4EJVA 4IO4A 2DBBA 3E9XA 3IO6A 4R6KA 2PVUA 3HHGA 3VEPA 5KZTA 1B9NA 4GO1A 2H99A 3KP2A 5ERIA 3KGCA 4YKKA 2Z5UA 2ELHA 4BDNA 3V7RA 2HFBA 3AXFA 2O6AA 1XC1A 1DOTA 1EZ9A 4PFUA 3GXAA 3ROUA 3T9HB 1LFHA 4CICA 5FD5A 3IOTA 3RDIA 2PBIA 1DPUA 3IK6B 4X9TA 3PFIA 4IXAA 3J81Z 1XCVA 2XV4S 4I02A 4KIBA 2A5TA 4Z0IA 1B1XA 3V8LA 1SD3A 1MDP1 4EF2A 3PQKA 3U9GA 2M8EA 4IO5A 4AD9A 5DD8A 3H6TA 2CO5A 4PDKA 2OWTA 4LK0F 3LAJA 5DVFA 5H8NA 4ON0A 2DWHA 2H9BA 2O03A 3S4UA 3JSOA 4QSDA 4U7BA 2BGCA 1HSLA 2XX8A 3T66A 2D1VA 3RYRA 1TTYA 4P0GA 4IVNA 4LZ8A 1TQMA 1IXSB 4EXLA 1BBYA 3ABTA 3EHSA 1YTYA 1IZ1A 4ELQA 1NH8A 1O7TA 1QW0A 1BN5A 4G77A 3O97A 5FB2A 2V93A 4MQVA 1LEBA 3F6OA 1LDDA 3QU3A 5KVRA 4IHSA 4LA9A 2BEOA 1S7AA 2JRTA 3RJPA 1WDNA 3G3KA 2CSOA 5K2YA 5HLIA 2IJLA 3V4GA 1A8FA 4I09A 2HKOA 3MWBA 5BWJA 3GLXA 2I3WA 4OINF 3FM3A 2HYFA 2AXLA 4P11A 5CMBA 1FQFA 3GLBA 2Z9OA 3IJXB 5FD6A 2REGA 5HS9A 1FSHA 3EYIA 3Q28A 1FSEA 4AIJA 2Y84A 4BLAA 2O7UA 4PFWA 2J5PA 3EPEA 1XSVA 1R5HA 3PD9A 4LUBA 1A54A 2HS5A 1FX7A 2L3DA 2IA4A 4IO6A 4I1DA 5AA1A 4RK9A 4CHUA 1SW1A 3AAFA 3C36A 2ZKZA 5HDGA 1QNTA 4PZJA 3U1DA 3T5XA 2VBZA 5JTYA 4N13A 5JVTA 2JTVA 2R9JA 5ISUA 1FCKA 2DE4A 4EMSA 2YPNA 1XN7A 2FQ3A 1B32A 3QSLA 1SYIA 4F1VA 4PE5B 2OJTA 4KYEA 4F3GA 3JSPA 1DTGA 4GF8A 4K3FA 2L4MA 1ZTYA 1O7LA 4G7OF 4Y13A 1B6AA 2UVHA 2F5FA 2HFHA 1L5TA 2YSRA 5LGNA 3GW2A 4XLPF 4I7HA 1QKAA 5E20A 4R72A 1V3FA 3MZYA 5DCMB 2ZXTA 4U1ZA 1S8NA 4X1BA 5D8LB 3J80K 3IOVA 4G94A 4MQ9F 4QFPA 5LBQA 2EV5A 5JFRA 4U4XA 1B59A 1JGSA 4L9JA 2DK5A 3R0JA 3N6TA 1B4ZA 1ZG1A 2ONSA 1FTLA 3MFKA 2XKOA 5M2VA 2XXIA 3RKYA 3GFIA 4AQ4A 5A5XA 3FHZA 4ZYGA 1LB9A 3PV0E 1RUNA 4RAZA 2X7PA 3IJOB 1LVAA 1PC3A 2QL3A 5D4SA 1USYH 1ZJLA 1IUYA 2V84A 4L17A 1GXQA 1WODA 2A61A 2VT2A 3ZN1A 3ULQB 2Y7IA 1FP1D 4YKPA 4OZ9A 2K27A 3HHFA 4I0BA 1B5JA 3MVZA 3T22A 3USDA 1B4AA 4F1UA 2BBYA 2UXXA 2PX1A 1VE4A 4F2QA 5BUUA 3BZ6A 2ABHA 1XGSA 4OVJA 4DCXA 2XKPA 3SERA 3ZKKA 2Y7WA 5EYFA 4HDUA 1BP5A 2GHBA 2W25A 3W6JB 2IW5A 4RGXA 4AB5A 3MAMA 3EN3A 5D5UB 1K6OA 3FJ7A 1UCRA 3CUQC 2DI3A 3I64A 4ENNA 3C1DA 4GL0A 3TDZC 1W5SA 1A55A 1OIBA 3WU1B 2X0LA 5D6EA 3BJOA 1LB2A 4I2OA 4IGTA 1LDKB 2PN6A 3Q26A 3C3WA 4IRIA 1MQHA 4WXJA 4FT8A 2STWA 2PT1A 1RZ4A 3VVEA 1GR2A 3SHFA 2IT0A 2MH2A 1ZYRF 3QXMA 2O68A 4HLYA 2ZMBA 4PFYA 3K6UA 4PFTA 3ZMSA 3LC8A 4CGZA 4OMYA 1PDNC 4BDOA 1J0RA 2GHAA 5DEQA 1UHMA 1SYHA 1G3WA 1A04A 2XAHA 4QLCU 3ZMTA 2I58A 3U92A 4HTGA 1D8KA 1QUIA 3KETA 2F5EA 2ZJ2A 2Z33A 5H8HA 3CUQB 3DV8A 2DT5A 1JEVA 4RYAA 4R2FA 1KU3A 4XSXF 1QO0D 1MH4A 4Y15A 1SDXA 1YAEA 2H4IA 1YIOA 4OIRF 4IRGA 2F35A 1Z05A 2DPDA 4KICA 3SEXA 3GYHX 5FTHA 3L6GA 3IR1A 4KA4A 5DCFA 1HQCA 5EHSA 4HAMA 2DP8A 1IRGA 3T0YA 1SI0A 4R9FA 1NNFA 4N07A 4XKNA 2O51A 1O3TA 1YG2A 3TO6A 3S9MC 3J7AO 2V1DA 5F6FA 2FMYA 4ETSA 3A09A 3RYPA 2AL5A 4ND9A 5ILSA 3MZHA 4BDQA 5DUIA 2PBWA 1T0FA 2K02A 4RB3C 3ODBA 4YFNF 5ICQA 2W7YA 2B65A 1YS6A 1Y3NA 2UYFA 4YU0A 5AIQA 4C1TA 4KYSA 4LG0B 5FHNA 5AA2B 4S05A 4L0ZB 1K79A 2JPBA 4GD5A 1FC3A 3O3KA 2Y7RA 5A5XB 1AOVA 3R4KA 2F34A 4ENKA 3FV2A 1BI0A 5H8QA 4C1UA 1SVXB 2DK8A 2ZYMA 4OTEA 3MUQA 4HOBA 4A0XA 3ZMVA 1YYVA 2GZWA 1H0MA 1D9VA 2FA7A 1BJAA 3TPAA 1CF7B 2XXPA 1Z7NE 2HKXA 4U88A 1ZGAA 4G8XA 2K7LA 3B6TA 3FXQA 2BV6A 1R7JA 3FIRA 3D4CA 3GZGA 4IY6A 3TQNA 3GXOA 3G3JA 3JW4A 3RTRA 1NKXA 2G7UA 5HBCA 2P2AA 5KDTB 1I6XA 4UVAA 2H98A 3FJMA 1MXUA 2PYYA 1JHHA 4GXAA 4OEUA 4LB5A 3F8BA 2ZYOA 3V8XB 3F8CA 1AL3A 5H8FA 4CXFA 2IPQX 2M5WA 3DP7A 3EHUA 4FEDA 1NH7A 1LAXA 3MWMA 1F9BA 4QF9A 1UQWA 3GO5A 1PP7U 4NHJA 1LBCA 4MF3A 1LAGE 4L5IA 4JWXA 4WEPA 1US4A 4Q47A 3VLUA 3RKXA 1QPMA 4OEVA 2JZYA 4JSDA 3RNNA 3BJ6A 2IRFG 1N3WA 3PU5A 3HSEA 4HW0A 3DELB 2ZNSA 4OYVA 2RF1A 6PAXA 2X4HA 1TQIA 2HQRA 3RT8A 2A5TB 1MKMA 5E18F 5ILUA 2HQ0A 3SESA 3LA3A 4L5JA 2FMLA 1P4AA 4JWYA 1CE2A 1D4NA 1P92A 3EHTA 4KMFA 1JVYA 1MY3A 5DD4A 2F36A 2YJPA 4XKRA 5FFXA 3HIFA 2CZLA 4NMYA 1ZMGA 3KJ7A 2E1SA 2VOZA 2XASA 4LQ5A 2XD3A 1HKTA 4O6JA 2MA3A 3B6QA 2XROA 2Y48A 3VVDA 3TQWA 4G2ZA 5AA3A 3E5XA 4THIA 2DLLA 2F8DA 2B3BA 1YW8A 1PBPA 4CO8A 3HTSB 5F7VA 2ESHA 2QPQA 1LBBA 3DEUA 3EDPA 3WTVC 5DVIA 3VFZA 3G3FA 2ZYNA 3QP5A 1USSA 5CVJA 4OERA 5I2KA 2DOJA 2FF4A 4KFCA 1SW5A 3DP8A 4MH5A 2F7AA 2P8TA 1FBUA 3GF2A 1ON1A 5ITOA 1IIWA 2DO7A 3IHUA 2GFEA 1ZKBA 1Z1DA 4Q0CA 2YU3A 1Z7ME 2ALUA 3IWZA 5CYVA 2CW0F 1LFGA 4HV6A 4ISUA 3KSXA 3MC2A 5L3CA 2Z22A 1KQ8A 1MXWA 4H6DA 2UVIA 1D3KA 1QVSA 2XXUA 5FHMA 4RXLA 2R3SA 3HOTA 4RAYA 4XBFA 3HRTA 1D5VA 2RKHA 1NL5A 4XKQA 1A99A 4AB6A 1OMPA 5L8DA 4YAHX 1HSJA 4QFKA 4IRHA 2I4CA 3W6KB 1DPEA 1BLFA 3K6VA 2I0BA 4EJOA 1IN7A 3C7JA 1J9IA 4M72A 2HOEA 4A6DA 3H92A 3B7DA 4HA8A 3LQRA 1ZBMA 2RCAA 3A3CA 1W5TA 3TOAA 2IA0A 4KYDA 2QZ8A 3G73A 4XLNF 3OD7A 4EM1A 3PPPA 4E0WA 3MBPA 4H65A 3KP3A 3E13X 2VODA 2EV6A 1G4DA 1ZG5A 4GWOA 1E2XA 3K2ZA 4L9TA 4ZH4F 5LRRA 4E70A 4R74A 4FX0A 4R73A 3RY3A 3LFKA 4M9ZA 2HAUA 3E5QA 4OMBA 3PPOA 1OVTA 4YB7A 2W84A 4ZEFA 3HRMA 4LVQA 1FQBA 3M8FA 1FBQA 4I62A 1FZPB 3C4MA 2F6PA 1MZBA 4CZZA 5LHGA 2FYIA 3CUOA 3EQLF 4KYWA 3CJNA 3KOSA 3M1EA 3VODA 2Q89A 1IN5A 4U7DA 2BJJX 3OELA 4MEYF 4GYIA 3GVAA 3CFLA 1K7AA 2RNJA 2VONA 3C18A 2LSOA 1L0OC 4OXVA 4U0WA 1F4KA 4P9FA 3MP8A 3NEUA 3HRSA 3IB0A 1ZLJA 2Z23A 3QRFF 5LHIA 3H03A 5HPQA 3T96B 4AIHA 3BPVA 2XXWA 1FQDA 5AA4A 4WCGA 3GZ5A 1MXYA 3O6IA 3ML6A 4U21A 4XXUA 3SDFA 3K1NA 1F9NA 5L9MA 2ZO4A 4ELRA 4HCYA 5LHHA 4PETA 5DYMA 2FBKA 1HKQA 2O0YA 2XXXA 3TTNA 3MW0A 1XCBA 2B0LA 3N26A 3WTWC 4P0IA 2EFOA 4HCWA 4OQOA 4YZZA 2QUFA 3IKVA 4DXBA 4OU0A 1MJBA 3IWFA 4M6YA 2NNYA 1UTBB 3SEUA 1POTA 3VLVA 2XHKA 1UTBA 1BI1A 5TPAA 2QRYA 3UK4A 4HBLA 1D3YA 2EA2A 2NWJA 3K01A 2XRNA 4D0PA 2AL4A 3E6BA 2YR2A 3K1MA 2D21A 1BI3A 3RTFB 4G4PA 5J1DA 4NF8A 1T39A 1ZGJA 3RKWA 3BFTA 2H27A 3QIMA 3NQOA 1WI9A 2P6TA 2K4JA 2RCBA 4DDDA 1GTKA 5I57A 3QYTA 3RPQA 5L9OA 3SKPA 5H8FB 3ECRA 2FXAA 3N94A 3KJTA 3ZSFA 4BQAA 3I6VA 1U5TC 1XT8A 3FXRA 4M73A 4M74A 3C31A 1Q1KA 3C32A 2OBGA 4FORA 1B3LA 5AONA 2GXGA 4FECA 1JNFA 3I59B 2P7CB 5IT9K 2ZMEA 1MD0A 2VD2A 3NRVA 1P1OA 1ULYA 1II5A 3K6WA 1R9LA 4NE4A 1H44A 3GZ6A 3P7NA 2HCAA 3P7IA 2STTA 4ZEBA 3V8KA 1R9QA 4LONB 1AMFA 4O5VA 1JW1A 3EQ1A 5CVRA 2ACJA 2XUBA 1CB6A 1B7ZA 3THIA 4OENA 1J2XA 5TPAB 3V7SA 4WWCA 2QVOA 4KHZE 3MP1A 5H6RA 4AWXB 4IF4A 2PMUA 3IC7A 2OWSA 2QQAA 3TDJA 3VVFA 2HZLA 4P96A 4TLLB 3BY6A 1BC8C 1B52A 1N7WA 3LSXA 1BIAA 4EM0B 5IT9Z 3VV5A 2M1BA 2LF7A 5D6FA 3KP4A 1USYE 1N04A 3OV8A 1DSNA 4ZEIA 2CG4A 2X26A 3BFUA 1UFMA 1P6RA 4EDPA 2RGVA 3FMSA 3H3UA 3RPWA 4LLLA 3KP6A 1O57A 3CRBA 2F5CA 4LG0A 4QWQA 4EVIA 4H0EA 2UYEA 1R1UA 4WXHA 3IL1B 5IT3A 5J8FA 1NNKA 2VP1A 4M4GA 2XX9A 3FM5A 3ZMDA 1WQ2A 3PPRA 3QOPA 2A07F 3KCCA 2QS1A 4LLNA 1H43A 3GBAA 1DDNA 1SAXA 4A6EA 2W24A 4IY5A 1GVCA 2Q9TA 2XXTA 3R61A 2V3UA 3QUFA 5K5RA 2PMSA 3PMVA 3OOPA 2O8XA 4HQMA 1W7PD 4EGYA 3Q27A 3HHHA 4MBPA 5CLSA 5JEIA 5L9SA 2P1SA 1BI2A 2D2WA 1FQCA 4GQOA 2QM3A 1BM9A 1XHYA 3TMGA 2RV8A 2FEZA 1M5CA 5ELVA 3VXBA 2IA2A 3LA7A 1YO5C 2P5KA 4IJAA 1P1UA 2W57A 4HV5A 1IQ7A 4ASNA 2DE3A 3LUYA 5LLQA 3L00A 4GL8A 3MPLA 2LNBA 2Q0OA 2XXQA 4M9SA 5JHUA 1B7UA 3K0VA 1LEAA 1I6BA 2KRFA 4JXIA 1ZRCA 4YFXF 3KZGA 2XHDA 3O2AA 4MLVA 3PMWA 4JSOA 3WTXC 2DVZA 3U1OA 4RGRA 1LCFA 1I1SA 3PUWE 2F5DA 1SFUA 1PDAA 4G8MA 1WKMA 1B5HA 2OD5A 1JVXA 1SW4A 3TKYA 2EA4A 4RPNA 2YX4A 3PUYE 5HM4B 1M5FA 1Y1MA 3H3GA 2RINA 1F5TA 4H5FA 4KI0E 4RB2C 1TQPA 2NYXA 4ESBA 4DE8A 1IXRC 1MDQA 4M9XA 1HSEA 2RC4A 4OFOA 3WAEA 3JAMZ 4LLGF 2L54A 4YKJA 3I5OA 4OFLA 5BPDA 5L3EA 2VC1A 1N76A 3LSLA 3HCQA 3LR1A 2NRAC 2MLKA 2M8CA 2VOPA 2ZMEB 2ONKE 2CFXA 4NEDA 4TQUQ 2E1CA 3SEWA 3D0SA 4QFNA 4JQFA 4NF6B 1B1HA 3H6WA 3CI8A 2KIUA 2O3FA 1IW7F 4KR5A 3WGGA 1Y0UA 1R22A 5CVIA 4F1YA 4I8CA 4JBZA 4OMZA 4U2RA 2XAQA 4ZZDA 3HV1A 1STZA 3KEIA 5AA2A 3FVKA 5DEXA 3F21A 3N4MA 3TODA 3LSTA 2I0CA 4XRFA 3CLOA 3K9TA 1EU8A 3F6VA 3WTTC 2GA2A 1ZREA 1X3UA 4RNSA 1OPCA 5H8QB 1VR5A 3MZ1A 3SFZA 1T98A 2I48A 5DYHA 2IP2A 3K69A 1POY1 3M7GA 2CGPA 2ZNYA 5TJJA 2JT1A 2OLBA 2VD3A 4FX4A 3U72A 1GHCA 2K86A 3TYHA 3FXUA 2QMWA 1ZH5A 1LFIA 2E0SA 1FYKA 2A5YB 3H7MA 1YPNA 2M45A 3CIJA 1P1QA 1FY7A 4HS7A 3BDDA 2GWRA 4I01A 2XXHA 1MXVA 1DUXC 3TCFA 4KNYA 5AA4B 2A68F 1ZLQA 2DU9A 3B02A 3E6DA 1H9TA 1T2KA 4P55A 1BIBA 4OIPF 2V1XA 3SEYA 4MGRA 2KLFA 1FW0A 3IOUA 3O66A 3LA2A 3V8JA 5ED4A 2YLNA 2JSCA 1LAFE 4UA8A 3TO9A 1DMBA 1DPRA 3QPHA 3RPUA 3FGSA 4H5GA 3WTSC 2QSXA 1URDA 2M87A 5F1RA 3WODF 4TLMB 1RNLA 1SFXA 3ZN0A 3S2VA 4EQ7A 5I58B 2XAJA 3TGNA 1SD6A 1R23A 4DQ2A 1YFHA 3JV9A 1Z91A 3O28A 3LBSA 4ZECA 5L3FA 4RK2A 1EZOA 3OOAA 5B70A 4G68A 4GIZA 3E3VA 1LJ9A 2V25A 1SD5A 1P2FA 4MTEA 4I9DA 4DLDA 4WF2A 4LZ5A 1WWXA 2A69F 5ICFA 3G3GA 4M6XA 1EZPA 4ENMA 3BKIB 3KN7A 3R7XA 3F11A 4JWOA 3ISPA 3TCGA 1A40A 2DFIA 5HLHA 3KZYA 1R5GA 2VT3A 2HDCA 4A5MA 2C6YA 1SFEA 1AH5A 3T9XB 3WGIA 5IAIA 3PGFA 1HW2A 1T0KA 4HW8A 3TAJA 4OIOF 3KEQA 2UWMA 5LGUA 3KOTA 5TP9A 4LK1F 3KLOA 3EETA 4RB1A 2GIVA 4GOTA 1OVBA 4OETA 1RYXA 3GBBA 3OMBA 1ZN2A 2IEEA 4U0YA 3DM0A 3CO6C 4LB6B 3CG3A 2HTSA 1UHWA 2YX7A 4RB0A 2H6BA 3UN6A 1Q1HA 2AIXA 2QQ9A 3HSTA 3O9PA 4Q4ZF 4YMBA 2QBYB 4ESJA 2G9WA 2GRVA 4NF4B 2XAGA 3CG1A 3RLFE 5K2XA 4UACA 3QU6A 1YCJA 4M71A 1M5EA 5DVJA 3RT6B 1M5DA 2UVGA 3UORA 4WX9A 1XSXA 1O7FA 3V5AA 5CBRA 4BAYA 2FNCA 3MPKA 4UV8A 4QFLA 1MM7A 1XDUA 3WE3A 2ETHA 2P5VA 5BQTA 1IN8A 2NS0A 3DKWA 4EV0A 1GXPA 2FNPA 3H6UA 4POXA 1KGSA 4I0AA 1M5BA 3IO4A 5DUKA 1G3YA 2GXBA 5H8HB 1GVJA 3R6SA 5H8SA 3B6WA 1OQGA 5FFZA 1SD4A 2F5XA 3VLWA 1I6QA 2ZNTA 1J59A 2OZZA 4HYEA 5BS6A 4Q5SF 3OO9A 4OWDA 4YMAA 3KG2A 1NNTA 1QQIA 3GFLA 2G93A 3Q29A 1R6ZA 3DF8A 3V89B 1IEJA 2KIFA 1SI1A 4HF0A 2FSWA 4EM2A 3F8NA 1XVYA 1SMTA 4H8JA 4TOZA 2A6EF 4WXDA 1J1NA 2NNNA 4NTLA 1ZRFA 3ECOA 4HX7A 1U6GA 1OMIA 4G9YA 2R7DA 3DP6A 3M3KA 3RTWB 1GV8A 1S9TA 1JHFA 4GXOA 2R71A 2PEXA 2F6GA 4NQWA 4EJUA 2PQ8A 3CDHA 5CRYA 1I5ZA 4L18B 2RC8A 1SD7A 2DQRA 2I49A 1H3DA 1IXCA 2ZXJA 2O6GE 2OZ6A 4F3PA 2FOKA 3HSRA 2OA4A 1SBPA 2D1HA 2L02A 4IO7A 4KIFA 2VBWA 4A0YA 5LEKA 3QK6A 3ZS6A 1B46A 5HDKA 3WTYC 4OHNA 3FMRA 1ANFA 3G3ZA 3QP6A 1CGPA 5HLGA 1IN6A 1T6SA 1LCTA 4RPOA 3MVYA 1TBXA 1IXIA 4BNCA 1R58A 3M8EA 2ONRA 1GGGA 3ZP5A 4HF2A 4A12A 4IHTA 1JXSA 1LQ1A 5DTBA 3OO6A 1URGA 2I4BA 1TFDA 5HOOA 3EF7A 2AS5F 2WKYA 2O1MA 2A5SA 4RY1A 3W15C 3UP9A 1HBXG 3GFMA 3IOWA 3WTZA 2D3IA 1EH3A 3TO7A 2I3VA 2CYYA 2DAOA 4ZZEA 2HEUA 1FBSA 1BKAA 5JTYB 5DCMA 4LQ2A 3CO7C 3BP8A 2G7HA 3FWEA 4OOIA 2HGCA 3FD3A 3TDUC 5I59A 1FTMA 1J75A 1K78B 3KBRA 1KYWA 5ICTA 2PG4A 2XXYA 5LOMA 3CTAA 4AVPA 1Z6TA 3I71A 2ANJA 3J81K 4S04A 3DPLC 3WU0A 1N84A 4BHCA 1S50A 3TTRA 4QRZA 3WG9A 3TKDA 1WSUA 2VGQA 4KCDA 3ZPLA 5B7DA 1YLFA 1R1NA 1PB7A 3Q9VA 2IVMA 3SETA 1ZAOA 2ZNUA 3QUJA 4QHQA 4KN4X 1MRPA 1K78A 2VBXA 5TRDA 2THIA 5JK4A 1MQGA 1BTJA 1LDJA 3KE2A 1N0TA 1OYYA 4NWCA 2UXNA 1DPPA 1MY1A 2GH9A 4NF4A 4ECFA 2V1UA 1XDSA 4RGSA 3A3UA 1TXFA 3H06B 5ICGA 1R36A 2EFNA 1FPQA 1QBJA 2ADUA 5I56B 1MY2A 1MGTA 1XB4A 2D5WA 3JTHA 2FU4A 3L2CA 3W9WA 1KU2A 3HSFA 1B0HA 1FTKA 2V6CA 2NXOA 1OLAA 3VFJA 4UVBA 1Y3QA 2DQLA 3MQ9A 2HYGD 3H6VA 3ZMZA 2Q88A 3G7WA 1O3RA 4HDVA 3I54A 3BPXA 2O69A 4PP0A 4ZDMA 3DP4A 4IGRA 1UB9A 2D45A 4EQBA 2FNAA 5TU0A 1RIOH 1PB8A 2F78A 1U78A 3BROA 3MEXA 4L9VA 4KD5A 4G7HF 1H9GA 5ILVA 1BOAA 2R6GE 3PUZE 4B09A 3PPQA 2XX7A 2P0SA 2Y7PA 1AOYA 2DXYA 1U5TA 2G29A 2IA1A 4N9IA 4BHBA 1QUKA 1KYZA 2P5LC 2XVCA 2RDPA 3DXJF 1P1NA 2J5OA 4KUMA 2NUVA 4N6PA 2GA1A 3M3FA 4GYGA 2XXRA 1XGMA 3FMQA 5ICCA 2CWEA 1XS5A 3JZJA 2DS9A 4BDRA 2OZUA 5F1QA 2OU2A 3T93B 3B73A 4DCYA 2NVUB 2AYSA 1QUJA 1BC7C 4YICA 5LEJA 5BOXA 2DXRA 4LD5A 4ZE9A 2X7QA 3PPNA 4R2BA 5L3DA 2LAOA 2V79A 2QBYA 2FE3A 4O3CA 3F8MA 4ZE8A 3F72A 4FJPA 2QS2A 3Q5FA 3V7CA 1EH7A 1MPBA 4Q30B 2MH9A 1UIVA 3T8RA 1TWYA 1ZIUA 4HX4A 3Q25A 1PP8F 3FJGA 3F8FA 1LB8A 1O3QA 3E5UA 2DYXA 3O6BB 3TTMA 3KSJA 1U5TB 5H20A 4PQJA 1FT9A 2DSFA 1EH8A 1Z7UA 1MJAA 3I3VA 2CQKA 2PI0A 1J7KA 3TTKA 1XGNA 2OQRA 5FO5A 1YS7A 3FF5A 4EGZA 1MDMB 4MEXF 4ESXA 4DXCA 3HTUA 4LP2B 5K5OA 3REOA 2VE9A 4KPTA 4G7ZF 2DWAA 3RN8A 3I4PA 2WWYA 1PBQA 2HZTA 2ZCWA 3N5LA 3C34A 2H94A 1XMAA 3L7WA 3IORA 3FV1A 4F22A 3LSFB 3MVXA 1W4MA 3IKTA 4L9NA 2A6HF 3WE2A 3WAFA 4ELPA 4BH9A 4EQ9A 3K6XA 1FTJA 2OAZA 5LGTA 2PLYA 1WRJA 2NOOA 1OKRA 4F7ZA 2P4WA 2Z8DA 4M1VA 4F29A 2V9VA 3E97A 1KQ9A 2XAFA 3E6CC 2XIGA 1PB9A 3TEPA 1LGBC 1U8RA 1SW2A 3OO7A 1JETA 2Q2CA 4H0WA 1XOCA 2LF8A 2HTJA 3ELKA 1NFTA 4Q5TA 4LFUA 1ZRDA 3R0AA 4R1HA 2Y75A 1W7PA 4ELOA 1URSA 2Z99A 1WVJA 2V3QA 1HW5A 4YG2F 2FBHA 3P9KA 4I98B 1S6LA 2DE2A 2HWVA 2UZKA 2R7FA 4YKIA 3KP5A 3SQNA 1R1TA 1PUEE 2DW4A 4R79A 1QKBA 1B05A 4MLQA 1B5IA 3U94A 4FIMA 3BOQA 2EB7A 3COAC 2KIMA 2UXAA 5D4RA 1H76A 1U2WA 1KA8A 1QGPA 4MTDA 1IXGA 2PJPA 4DIGA 4RA1A 4FHTA 4U1OA 4BYYA 4IO3A 1LAHE 4WEDA 5F64A 1I1GA 1U3EM 4A2UA 1IITA 3C33A 3S9EA 1SMYF 4GVOA 1ZHFA 3VB2A 5EEHA 2F97A 4JK1X 1L3LA 4ZZAA 3K02A 1G3SA 4KMUX 3GX4X 1KWHA 4R8HA 5EHMA 3K1PA 3KN8A 4G8NA 4EQQA 5IKBA 1IRFA 3CFZA 5FHOA 2Z8EA 5ICEA 2ESNA 4O3AA 3L6HA 1KQ0A 1B0LA 3LQQA 4R9GA 2HR3A 5D5VB 4IO2A 2B3FA 4R6YA 3G3HA 1QZZA 1JW4A 3VOEA 4P5OA 4NWDA 3P9CA 2QS4A 4LZ7A 3VE1B 3H4ZA 5AE4A 4HZFA 1S3JA 1B2HA 3D4GA 4FEBA 3TELA 1I6AA 5HVQC 5KK1A 3U2RA 4F18A 4FE8A 1ZU0A 1B3FA 5E1WA 3QAHA 1VSOA 3OENA 1UIUA 4K2EA 3RIRA 2QS3A 1FWZA 2FBIA 5K5QA 1XSDA 4UV9A 4LGWA 1MXXA 2XGXA 3V83A 2GAUA 3KP7A 4Y17A 2ISZA 3LSWA 3MVWA 2I6EA 4HLXA 1N7XA 4POWA 1OQHA 5FGMA 3GWZA 3FX3A 4OFJA 1IF1A 5CVUA 1JQFA 3JTGA 4YIIA 3BBRA 1NNPA 4RS8A 1B9JA 1JEUA 2COMA 5D8KB 5DV5A 4NF8B 1MQDA 1KU9A 1QULA 3C35A 3WGHA 2VN2A 1D9YA 1P1WA 3I58A 4H1XA 3FZVA 1RYOA 1YQAA 5BMZA 3CSGA 4Q8RA 4CYDA 1YW9A 2WV0A 3HOSA 3K00A 4JDFA 2LKPA 5J8CA 3ILTB 3RQTA 5D5XB 4G6DA 1VFDA 5I56A 1TNSA 5I57B 1FYLA 3IAZA 3KFWX 1E17A 1S29A 1CF7A 3OEMA 4XIGQ 4U0VA 2Y7KA 2HAVA 3RUMA 3O6HA 4Q48A 5I84A 3ILUB 3K4UA 3TZAA 1ZARA 3JAMK 4NB5A 1HW1A 2TDXA 1LLSA 5I2NB 4HX8A 2YPRA 1B7HA 5E17F 2O1LA 3T8TA 4HQEA 2EWNA 5KCJB 3CFXA 4EUOA 2PFBA 2ZNZA 1Y4CA 3TCHA 3F22A 3HUGA 4XTCQ 1VTNC 3L09A 5CMKA 4G68C 2WTEA 3K0LA 2GQQA 5DDGA 1Z6RA 3S9NC 5H8NB 1IAWA 1OLCA 2Q2EA 2OK2A 1UTHA 5CMMA 4RGUA 2HQNA 4YIFA 4XSZF 5JI6A 1ATGA 5CI5A 3O6GA 3U8QA 4WK8F 1FQAA 2MC3A 3JYRA 1IUDA 3UIFA 3T9UA 3HRUA 4O3MA 4YB5A 4OESA 1HSTA 3UA8A 2Z3YA 4LJZF 3HN0A 2REJA 4GRKA 4ZYDA 5I2NA 4KT5C 1Y20A 2PMHA 4PGHA 3ZMUA 2RC7A 3LAPA 3CUQA 4X48A 1MPCA 4UNOA 2E7XA 5HS8A 3D5LA 3PUVE 2RN7A 3N6UA 3CR9A 3OO8A 4XKPA 3FATA 5FLXK 2Q2AA 5I2KB 1B1BA 1EH6A 1Y9UA 3ABUA 1C0WA 1ZG3A 3KN3A 4MFIA 1A7LA 1B40A 3SEVA 4F3SA 1LSTA 3HPIA 1QJMA 1T38A 4IPAA 3C9HA 4G6QA
chains in the Genus database with same CATH superfamily
2ZYKA 2AHQA 2OBPA 1D1CA 2IGNA 4ZYEA 4R6HA 4QFOA 4U4SA 3SZPA 3BJAA 3M8UA 3QYEA 2HXWA 4A3GJ 3PNVA 4NX1A 1R1VA 4G8HA 1B58A 4E0XA 4ESWA 5B66C 5M5XJ 1TT0A 1FPBA 1I27A 1HKSA 3GFJA 5KCJA 4RA2A 2RAEA 2XF6A 2MD5A 5AA2D 2F2EA 4KQPA 4JB7A 4AS4A 3DTKA 3DFGA 3IX1A 3S3NA 3RPLA 2XAUA 1KU7A 4AC0A 5K1YA 3QAXA 3ZQQA 2LR8A 1AWCA 4N9HA 2WX9A 5H6QA 1JGGA 1HCRA 1MXZA 2ISYA 2W85A 2KR0A 2VHAA 4CDGA 4C2UA 5ITPA 3C2BA 1MY4A 2VXZA 4FASD 5CBSA 1MQJA 5EEGA 4BQOA 2R0QC 2HDDA 1INPA 5L3BA 2RQPA 4KFQA 2KRCA 2FRHA 3BWGA 5AIPA 4B4CA 3OXNA 1XC5A 5E3OA 1RRJA 2K4BA 3D5RC 2RQQA 3I59A 4BQNA 2WAFA 2BY2A 2QYOA 4DZJA 1VI0A 4ZZLA 4EJTA 1JW5A 1NMUA 3RI4A 3DLNA 3M07A 4FATA 3OSQA 2CW7A 3I53A 4RJZA 3CCYA 5BPIA 1B51A 2VKVA 1DTZA 3NOHA 2ZFUA 1MY0A 4NF6A 4HE1A 3H3ZA 2DMQA 2CMOA 3P9IA 1W7PB 4FISA 5FTIA 2NOJB 2P7VB 1Q9DA 2I10A 2EV0A 2WAQA 4QSCA 4YB6A 3I4MJ 1V5FA 4ZEKA 1B3EA 3QWLA 2E1NA 4DZ1A 5HS7A 3BC8A 3WU2C 2DVCA 1U9NA 1WH7A 1I69A 3MCZA 1BR2A 4LMYA 4JVDA 3GEZA 3HOXJ 4ENJA 4NAPA 3IRRA 4P1LA 4ZS9A 1J5YA 5CC2A 3E3KA 2RVCA 3T9VA 3FASA 3R6UA 1D9QA 1FQEA 1N75A 4PAIA 3OEKA 2DTRA 4KDPA 2HXIA 1D8JA 1QZYA 1X3ZB 1V4RA 3MJNA 1G3TA 1R4NB 3ZQ7A 5CM6A 3M9AA 2A3SA 2CS3A 4QSEA 5DEXB 4JP0A 4PGGA 2H09A 3IL2A 2E2HJ 3F3XA 1TT1A 2OQGA 1R5ID 2MSYA 2F7CA 2VBYA 4A5NA 1Y3PA 4F39A 2ZFWA 3HB9A 1FLIA 1FYMA 2H5YA 3H5RA 4BDMA 2QMXA 4E4HA 2BYVE 4D5FA 2XXVA 4R75A 3T1BA 5E1ZB 1PUFB 5I3SA 4LATA 2H25A 4XICA 4F19A 3GZNB 1FNNA 2WAQN 3UGWA 2R7UA 3U65A 3LWFA 3AG3H 1XG1A 1K9ZA 4B44A 3TUSA 2Q8JA 2CUEA 2DPUA 2KIQA 1B3GA 3TOBA 5EG0B 3EYYA 3ZKLA 3D1RA 3U93A 4AIKA 4B8XA 3L2VA 2KJBA 1ODDA 1PEBA 1DP7P 5IYCJ 5LRSA 4MX6A 3OMYA 4O3BA 3ABLH 4EF1A 4IB2A 1MDMA 3J7YJ 4D1QA 4UUSA 4UXNA 1RI7A 2ZBKA 1T0FC 4UUVA 3CSBA 3FVOA 4KCCA 2RC9A 2KDZA 2EILH 3H1CA 2CUFA 3GUDA 2DWIA 2E7WA 1FOKA 4JBAA 1IDZA 1LBWA 2HOAA 3TQLA 1B6HA 3IB2A 3BTJA 3HGYA 2UV1A 3SXYA 5D5WB 3PMXA 1AA7A 4YFKF 2K85A 4GCVA 1YTVA 1R00A 3S2DJ 4EXKA 4KIGA 4F3BA 2JPCA 1XVXA 2L2OA 2UVJA 3IRQA 4UHTA 1TFAA 4DNCA 2JVGA 5DT6A 3TMOA 1OR7A 2GOXB 4ESFA 1Y1ZA 4U23A 4GGGA 1W0TA 4WKMA 4DXUA 4FAJA 1RKMA 5E8IA 1YW7A 2LY2A 2BZTA 3FDYA 1LFBA 1MG1A 5I59B 3FXLA 1WJCA 4AUXA 3K4NA 3N97A 3EUHA 3ONMA 1IMAA 3TTLA 1OCPA 2HEOA 1IRZA 2PFZA 3IB1A 1REPC 4F2OA 1H45A 1TNTA 1Y0NA 1MQIA 3K2DA 2WC2A 1SQYA 1MJ9A 4MEVA 3HBLA 4HF1A 3DTEA 3S2WA 3SZTA 4U22A 2QJEA 2M30A 1TLHB 4GFRA 3MZBA 1N3XA 2DWJA 3R26A 2L01A 2NAZA 2KZGA 4C3IJ 2VPNA 3KBZA 3MQ0A 5ET5A 4BDLA 4OIQF 1JT6A 2QSFX 1B4HA 2QQBA 4MHGA 3O29A 5CMCA 3CLQA 1O64A 3I0TA 2LTPA 5L3GA 3PUXE 1EV7A 2CJJA 4QIWN 3KPHA 4C3JJ 1O63A 3OSRA 2MLGA 3S9LC 3R60A 2H8WA 3VSKA 1OYIA 1UTHB 4PDDA 3KFMA 1X2MA 4N0BA 2B63J 1WJEA 3MAJA 3S16J 3C2GA 1OFCX 2HZKA 2VD3A 4O7MA 2EFQA 2EFPA 3TFLA 4CCOA 3VYTB 5C3EJ 4ZYHA 2E1MC 5I58A 4C0RA 2DOEA 2KDOA 5E3MA 3O66A 3FK7A 5IPAA 1OCZH 3FUZA 4F31B 2V9PA 4GXSB 1J09A 1W1WE 3L9FA 5A2QK 4BXUA 1P4WA 1US5A 2O7IA 4JVCA 3DPTA 3ERED 3RCOA 3FVGA 2KL4A 3H0GJ 1YJ9I 2P6SA 1JE8A 1P4XA 2M3AA 4MIMA 2M0MA 1NHAA 2OCCH 2BE5F 1S7OA 4XRMA 3MP6A 2KISA 4KN7X 1F1ZA 2F4OB 2QENA 4Z7EA 1TWAJ 2EK5A 3Q9SA 2RKMA 2M0CA 1A8EA 2KJCA 4L0YB 1Y4TA 4O94A 2EFWA 1MM6A 3DQVC 1USTA 4IHVA 4PE3A 1ONVA 4GWYA 1YIJI 4XIDA 2CV1A 2BXZA 2Y0MA 3KEOA 3J80Z 5FLXZ 1ZLKA 2PT2A 4UVCA 2WBDA 1NV5A 3IUOA 2KKOA 1P99A 2DA1A 4MJOA 5J6XA 4X1DA 1FP2A 3CVGA 5HDNA 2K3PA 1OYWA 4MNUA 2XD2A 1TW3A 2OCUA 5GTIC 4GDFA 4NF5A 3IAS2 4NF5B 3ECHA 3GLLA 1T8IA 5KDTA 1S7YA 2Y30A 5CJ9A 4FE7A 3TP3A 1MH3A 2L9VA 3I5UA 3PQJA 1BIYA 5FKOA 4EJWA 5B1AH 2BHZA 2O9LA 1ZK8A 3HYIA 5FKKA 1G6NA 2OV7A 5A2QZ 5TP9B 4WXCA 3KLNA 3G1MA 1AKHA 1HXDA 3HO7A 5DTDA 4BHPA 4IX7A 1Z9CA 3FVNA 1MS7A 2VE8A 1MPDA 2DFEA 5E1XA 2H6CA 3ROJA 3E6MA 3VXCA 4RLFA 2LDUA 2EJRA 4PCQA 5JR3A 1FTAA 4XKCA 1YJNI 3M3LA 1B9MA 3PD8A 3RGYA 1AIVA 2O61A 5E8GA 3M8JA 2O84X 4ZYAA 3GTJJ 1B3HA 2Z8FA 3K10A 3O8GA 2DQVA 5CVVA 1FEXA 1Q35A 4P9UA 3O2PE 1VFEA 2QLZA 4TV7A 2VQHA 1XGOA 2DA4A 1FTOA 3MZ9A 3F23A 2PX9A 5LD2C 4FE4A 2KHMA 4LITA 3K4LA 3KZZA 2M9HA 2YU9J 4H67A 2XPWA 2JVHA 1LNWA 1SAUA 1Y56A 2Q8KA 4GLIA 1IN4A 2JN6A 2L4AA 2VC0A 2W1OA 3QPTA 4AVZA 1TW2A 2VOOA 1FPEA 1NV7A 2V3TA 1XMKA 5H2FC 3PUVE 4G68B 1QRYA 2QWWA 2DMUA 4Z2YA 2BY1A 1ELJA 2FA5A 1MSEC 4CCJA 1O3SA 1XD7A 4OWRB 3G3IA 4ONYA 3BR1A 3Q0UA 1IXHA 3VDFA 4A0ZA 3WTUC 3JRAA 4H8IA 1RUOA 3E4RA 2MBFA 2F7BA 1HDDC 3HOVJ 3W9VA 1ON2A 4EJVA 4AIDA 4IO4A 2QF7A 2DBBA 2DA3A 3HM5A 3E9XA 3IO6A 4R6KA 2PVUA 3HHGA 5FRNA 3VEPA 5KZTA 3P5JA 1WJFA 1B9NA 4GO1A 2H99A 2B9SA 3FISA 3KP2A 5ERIA 5E3NA 3B8BA 2Z5UA 3KGCA 1BK4A 2ELHA 1DP3A 4YKKA 2K9SA 4BDNA 3V7RA 5J1UA 2HFBA 3LNQA 4MMPA 3AXFA 2O6AA 1XC1A 1DOTA 1EZ9A 1DBZA 3LSMA 2QKMB 4A3DJ 3GXAA 1OQYA 4PFUA 3VYSB 3ROUA 3T9HB 1LFHA 3FK6A 4CICA 5FD5A 3IOTA 3K7AJ 3RDIA 2PBIA 1DPUA 3IK6B 4X9TA 3PFIA 2OTLI 4IXAA 5F0HA 3J81Z 1UJ8A 1XCVA 2XV4S 4I02A 2BVMA 2VASA 4KIBA 2A5TA 2PJRA 4Z0IA 2XWVA 4DJAA 3V8LA 5M3MJ 1B1XA 5IZ3A 2LVSA 2W48A 1MDP1 1SD3A 3PQKA 3U9GA 2M8EA 4IO5A 4EF2A 4AD9A 3S1RJ 5DD8A 3H6TA 2CO5A 3FKIJ 4PDKA 3K2AA 4LK0F 2OWTA 3LAJA 5DVFA 5F27A 5H8NA 4ON0A 2DWHA 2H9BA 2O03A 4NHBA 2QVVA 3JSOA 4QSDA 5K7ZA 3S4UA 4U7BA 2BGCA 4F93B 1HSLA 2XX8A 3T66A 2D1VA 4YELA 3RYRA 1TTYA 4P0GA 1PVEA 4IO9F 4IVNA 4LZ8A 1TQMA 1IXSB 4EXLA 1BBYA 2FJ1A 3ABTA 3EHSA 1NG7A 4A3EJ 1YTYA 2CFOA 1IZ1A 3CJRB 3MKLA 4ELQA 1NH8A 1MMNA 1O7TA 2ID3A 5IOZA 1BN5A 1QW0A 2HQAA 4NUBA 4G77A 2L5VA 3O97A 5FB2A 2V93A 4MQVA 1LEBA 4F55A 3F6OA 3AFHA 1LDDA 3HZJA 3QU3A 5KVRA 4IHSA 4LA9A 2V9KA 1S7AA 2BEOA 2JRTA 3RJPA 1WDNA 3G3KA 2CSOA 5K2YA 4Y33A 5HLIA 2IJLA 1MBKA 3V4GA 3JRBA 1A8FA 4I09A 2HKOA 3MWBA 5CQEA 4NG7A 5BWJA 3GLXA 2I3WA 4OINF 3X2QH 2X9DA 3FM3A 2HYFA 2AXLA 3VYRB 1OJLA 2LOOA 4P11A 1MMAA 3LFUA 4JX6A 1FQFA 3GLBA 4GX3A 2VPRA 2Z9OA 5CMBA 4JX5A 1YX5A 1SEUA 3IJXB 5FD6A 1ZQ3P 2REGA 2M7AA 3L2WA 5HS9A 5KAFC 3EYIA 1FSHA 3Q28A 3RSNA 1FSEA 2P3NA 4AIJA 2HHMA 1XX5A 5EYRA 1X4OA 2Y84A 1IV6A 2O7UA 4BLAA 4PFWA 2Y31A 2J5PA 5JLXA 1D1BA 3FBNB 1XSVA 2IGMA 1R5HA 1ITYA 3EPEA 3PD9A 1FOWA 2ZJPF 4LUBA 1A54A 4PJNA 1LBZA 4I40A 1FSAA 2HS5A 4J19A 1FX7A 2L3DA 2JWTA 2IA4A 4IO6A 3RQIA 2R5ZA 4I1DA 1FTTA 5AA1A 2R5ZB 2BY3A 4XQFA 4CHUA 1SW1A 3AAFA 4RK9A 4A3FJ 2L9SA 2ZKZA 3MN2A 5HDGA 3C36A 1QNTA 4PZJA 3U1DA 3ZRGA 3T5XA 2VBZA 3B6AA 4N13A 5JVTA 2ECCA 3CD6I 2JTVA 5JTYA 1AWBA 2R9JA 5ISUA 4C30A 1FCKA 2DE4A 4EMSA 2YPNA 2M7BA 3G1LA 4CCLA 2VJJA 2UUZA 1XN7A 2FQ3A 4MO7A 3CCQI 1F43A 1B32A 1SYIA 3QSLA 4F1VA 2HVRA 4PE5B 2OJTA 2ZZWA 5M5YJ 4KYEA 4F3GA 2CH0A 3JSPA 4PAKA 1DTGA 4GF8A 4K3FA 4E7SA 2L4MA 1ZTYA 1O7LA 1MW7A 2H8RA 4G7OF 4Y13A 1X1PA 1B6AA 2UVHA 3B6CA 2F5FA 2HFHA 1L5TA 2YSRA 5LGNA 4UY8I 3GW2A 4I7HA 4XLPF 1QU3A 5E20A 1QKAA 4R72A 4BU2A 4B3XA 1V3FA 3MZYA 5DCMB 5IP9J 2ZXTA 2DFFA 1XPXA 1S8NA 4U1ZA 4X1BA 4GWSA 5D8LB 3H0DA 3H9QA 3J80K 4DIQA 3IOVA 2ZB9A 4G94A 4MQ9F 4QFPA 1XMXA 5LBQA 2EV5A 5JFRA 4NC8A 1B72B 4U4XA 1B59A 1JGSA 3FKJA 3JCUC 2DK5A 2LY1A 3R0JA 4L9JA 4HNTA 1ZG1A 1B4ZA 2ONSA 3PIPF 2X1DA 3N6TA 1FTLA 4JVIA 1V55H 2XKOA 3MFKA 2XXIA 5M2VA 2EIJH 3J7ZI 3RKYA 3GFIA 4AQ4A 5A5XA 3B50A 3FHZA 2KRHA 2MABA 4ZYGA 1RUNA 1LB9A 4RAZA 3PV0E 2X7PA 3IJOB 1LVAA 2WA0A 1PC3A 4OVQA 2QL3A 5D4SA 4ZDOA 1USYH 1IUYA 1ZJLA 2V84A 1GXQA 1WODA 1S5LC 2A61A 1FPLA 2VT2A 3ZN1A 3ULQB 1EYJA 2Y7IA 1FP1D 2HZDA 3DBRB 4XLCA 2K27A 1FJ6A 4OZ9A 4YKPA 3TEDA 3HHFA 3KEYA 4I0BA 5J1RA 3PL8A 1B5JA 3MVZA 3T22A 3USDA 1B4AA 1D1AA 4F1UA 3H9GA 4M3GA 2BBYA 4XM3A 2UXXA 3LSRA 4MIJA 3PFYA 1VE4A 2PX1A 4F2QA 5BUUA 3BZ6A 2ABHA 1XGSA 4OVJA 4DCXA 2XKPA 3SERA 3ZKKA 4NGUA 2Y7WA 1VQOI 5EYFA 3A0HC 4HDUA 1BP5A 2GHBA 4CSWA 2VQGA 2W25A 4KJZA 3W6JB 3CCSI 2IW5A 3ASNH 2LH9A 4RGXA 5FROA 4AB5A 3MAMA 3OIPA 3EN3A 1ENHA 5D5UB 4PCDA 1K6OA 3FJ7A 1UCRA 2KQRA 1JKPC 4D7MA 3CUQC 2DI3A 3I64A 2VPOA 5ET6A 3BZKA 4ENNA 3MSTA 3C1DA 4GL0A 4UABA 3TDZC 1W5SA 1A55A 1OIBA 3OWTA 3F0CA 3G6EI 3WU1B 5GPAA 3A01B 2X0LA 1MBFA 5D6EA 2AO9A 3BJOA 1LB2A 4I2OA 4IGTA 1K6YA 1LDKB 4A3JJ 2PN6A 3Q0VA 3Q26A 3C3WA 4IRIA 2P3VA 1MQHA 4WXJA 4FT8A 2STWA 2PT1A 1Y8QB 1RZ4A 4L17A 3VVEA 1GR2A 3SHFA 2VQCA 4B1RA 2IT0A 2MH2A 1ZYRF 3QXMA 4LIVA 2A6TA 1I6HJ 4HLYA 2O68A 2Q74A 2ZMBA 3K6UA 4PFTA 4PFYA 1QGXA 2CRGA 3ZMSA 3MZ8A 4A3LJ 3LC8A 3CMAI 4CGZA 1PDNC 4OMYA 4BDOA 1J0RA 2GHAA 5DEQA 1UHMA 3S15J 1SYHA 4LN5A 1G3WA 2GQ1A 1A04A 2R7VA 2XAHA 4QLCU 3ZMTA 2I58A 4ZC3A 3U92A 4HTGA 1D8KA 4II2A 1QUIA 3KETA 2F5EA 2ZJ2A 3JRCA 3VWBA 2Z33A 5H8HA 3CUQB 3DU6A 3DV8A 2DDKA 2DT5A 1OR7C 2KP6A 5LFAA 1JEVA 4RYAA 4R2FA 4XEQA 1KU3A 3HKZA 1MH4A 1QO0D 4XSXF 2DA5A 1NUZA 3ZQLA 5ET8A 4Y15A 1SDXA 1YAEA 2H4IA 1YIOA 4OIRF 4QTRA 4EATA 2P81A 4IRGA 2F35A 1Z05A 2DPDA 4KICA 3SEXA 5GAHJ 3FXMA 3GYHX 5FTHA 3FIWA 3L6GA 3IR1A 3RQ4A 1GLNA 1HF0A 4KA4A 5DCFA 1HQCA 5EHSA 4HAMA 2DP8A 1IRGA 3T0YA 1SI0A 4R9FA 1NNFA 4N07A 3HFUA 4XKNA 4XOTA 2O51A 4F92B 1O3TA 1VQKI 1IO2A 3K4MA 1YG2A 3TO6A 3S9MC 3J7AO 3QPLA 2V1DA 4ZEDA 5K7FA 3BTIA 2FMYA 1R4MB 3ESWB 4PFPA 5F6FA 3RYPA 4ETSA 2LK2A 3A09A 2AL5A 4P47A 2HNHA 4ND9A 5ILSA 3MZHA 4BDQA 5JVGF 5DUIA 2FIEA 2PBWA 1Z3XA 2QEXI 1T0FA 1SVLA 2K02A 4RB3C 3ODBA 4YFNF 5ICQA 4RLQA 2W7YA 2B65A 1VZ0A 4CZCA 1YS6A 4F3QA 4A3KJ 1YZ0A 5IP7J 4FTHA 2F4MB 2K9NA 1U8BA 4BE1A 1Y3NA 2UYFA 4YU0A 3NAUA 5AIQA 4C1TA 2W82A 4KYSA 2RNGA 4LG0B 5FHNA 2ZSHB 4S05A 3M4OJ 4PFBA 1VQMI 1FMWA 4L0ZB 5AA2B 1K79A 4PF6A 1WJAA 2JPBA 4GD5A 5F08A 1FC3A 3O3KA 2Y7RA 5A5XB 4PFOA 2Z16A 3DU5A 1AOVA 2CW8A 4X0GA 3R4KA 4KT6A 1RESA 2F34A 4ENKA 3GTQJ 1T33A 3MYUA 3FV2A 3HEFA 1BI0A 3PNTA 5H8QA 4C1UA 2V4JC 1SVXB 2DK8A 1NV1A 2ZYMA 4OTEA 3MUQA 4HOBA 4A0XA 3H3VK 3MKZA 1K9YA 2V26A 1A6QA 3ZMVA 1I3QJ 1YYVA 2GZWA 3G1OA 2ME6A 1H0MA 1D9VA 2FA7A 1BJAA 3TPAA 1CF7B 1JT0A 2XXPA 1Z7NE 5DM6F 2HKXA 4N4NB 4U88A 1ZGAA 4G8XA 2K7LA 4PUSA 3B6TA 3FXQA 2BV6A 1R7JA 2PFYA 3D4CA 3FIRA 3GZGA 2R7OA 3TQNA 4IY6A 1MBEA 3GXOA 3G3JA 3JW4A 2X48A 4MFDA 1ETYA 3RTRA 2A5WA 2M4KA 2G7UA 1NKXA 4MHFA 5HBCA 2XGDA 2P2AA 4TOZA 3CDIA 5KDTB 1I6XA 2HVQA 4UVAA 2H98A 3FJMA 1MXUA 1D5YA 2R7QA 2PYYA 1JHHA 4GXAA 4OEUA 4LB5A 3F8BA 2ZYOA 3V8XB 2PCRA 3I3LA 3F8CA 4E6KG 3EUAA 1AL3A 5H8FA 4CXFA 4P3LA 5FLMJ 2E19A 2IPQX 4OVRA 2M5WA 3DTIA 3DP7A 4BUPA 3EHUA 5IZ3B 3PIOF 1NH7A 1LAXA 4FEDA 3MWMA 3KYCB 1F9BA 1A6IA 1UQWA 2IGOA 4QF9A 3GO5A 1HLVA 1OLTA 3BR3A 1PP7U 3FXJA 4CCKA 2R93J 4NHJA 1LBCA 4MF3A 1LAGE 4L5IA 2XWKA 4IEJA 2QSHX 4JWXA 4WEPA 3C31A 4AYBN 3BR5A 3OYEA 4PFIA 1US4A 4Q47A 3VLUA 3LOCA 2DT7B 3LUZA 4NC7A 2GIZA 3RKXA 1QPMA 4BBSJ 2ID6A 3HOZJ 4OEVA 2JZYA 1E3OC 4JSDA 1ACIA 3RNNA 3BJ6A 5KNLA 2IRFG 1TWCJ 1N3WA 2K40A 3HSEA 4HW0A 3PU5A 3DELB 2ZNSA 4OYVA 3V42A 2EZIA 2RF1A 3CCUI 2X4HA 1OCCH 1W0UA 1TQIA 2HQRA 6PAXA 3MMYB 3RT8A 4AS5A 2A5TB 1MKMA 4JX4A 1I50J 3OSGA 5E18F 1GVDA 5ILUA 2ZJRF 1VQ9I 4Y52J 1VQ6I 2LKSA 3LA3A 3S32A 2HQ0A 4L5JA 3GTGJ 1EF4A 2OWZA 3SESA 2FMLA 1P4AA 4XFEA 4JWYA 1CE2A 1D4NA 4HE0A 1P92A 3EHTA 3SEQA 4KMFA 4IHYA 1JVYA 1MY3A 5DD4A 2F36A 2YJPA 4XKRA 2W00A 5FFXA 3HIFA 2JSPA 2CZLA 4NMYA 2X6OA 1ZMGA 3KJ7A 2IGKA 2E1SA 2VOZA 4GX6A 3RYDA 2XASA 2IS1A 4D5CA 4LQ5A 2XD3A 3CC7I 1FJLA 1SFOJ 1VDWA 2WAEA 4MCOA 3DLAA 4O6JA 2MA3A 2LBFB 5FKNA 4CCMA 1UAAA 2XROA 1H8AC 1ERDA 3M1CA 2Y48A 3B6QA 3VVDA 3TQWA 3C2HA 4G2ZA 1NH3A 4RM3A 5AA3A 3E5XA 3E79A 4THIA 2DLLA 2F8DA 2B3BA 1YW8A 2E1MB 1PBPA 4CO8A 3PTYA 4PGNA 3HTSB 2M4GA 3UNGC 4DYQA 5F7VA 2ESHA 2ZC2A 2X6XA 2QPQA 4AU7A 1LBBA 3DEUA 2KLOA 3EDPA 3WTVC 2NVQJ 5DVIA 3VFZA 3QQAA 3G3FA 4OVSA 1FOYA 2ZYNA 3LSIA 2EZKA 1PJRA 3QP5A 1USSA 5CVJA 4OERA 5I2KA 2DOJA 2CEXA 2FF4A 3DEEA 3OYAA 4KFCA 1SW5A 1IGNA 2R5YA 3KIOA 3DP8A 4MH5A 2F7AA 2P8TA 4C2TA 2RREA 1FBUA 3GF2A 1ON1A 4PBQA 5ITOA 1VFCA 1IIWA 2DO7A 3IHUA 1NV0A 2GFEA 1ZKBA 1Z1DA 4H4KC 3T0JA 4Q0CA 2YU3A 1Z7ME 2ELKA 2ALUA 3IWZA 5CYVA 3QYBA 2CW0F 1LFGA 4HV6A 3VSLA 3RZOJ 2X85A 3I9V2 1UG2A 2QKLB 4NDLA 3KSXA 3MC2A 4ISUA 4N15A 3H5AA 2X1EA 5L3CA 2Z22A 1KQ8A 3MD2A 1MXWA 4JYKA 2QVRA 4H6DA 1EA3A 2UVIA 1D3KA 1QVSA 2XXUA 5FHMA 4YRVA 2O8KA 2VXDA 4RXLA 2R3SA 3HG9A 3OYHA 3HOTA 3HDDA 4RAYA 4XBFA 1VQ4I 3HRTA 1D5VA 2DTZA 2RKHA 4XRSA 1NL5A 4XKQA 1A99A 4AB6A 1OMPA 2ZZXA 5L8DA 4YAHX 1HSJA 4QFKA 3BTCA 4IRHA 4CUGA 2F3DA 2I4CA 3K4BA 3W6KB 1DPEA 1BLFA 3K6VA 2I0BA 1NV6A 4EJOA 1IN7A 3C7JA 1S9HA 1J9IA 2DN0A 2HOEA 4M72A 3H92A 4A6DA 3B7DA 3E78A 2LYCA 4HA8A 3LQRA 4PSXA 1ZBMA 2RCAA 3A3CA 1W5TA 3TOAA 2IA0A 4A69C 2QZ8A 5B5EC 3G73A 4GWZA 2W4SA 2DA6A 4G12A 4XLNF 4KYDA 4MFEA 3OD7A 4EM1A 3PPPA 4E0WA 3MBPA 4H65A 3KP3A 4XKBA 3E13X 2VODA 2EV6A 1MBGA 3JRGA 1G4DA 1ZG5A 2GM4A 4GWOA 1N77A 3HOUJ 2Q8MA 1E2XA 4U87A 4I76A 1VQ5I 3K2ZA 4L9TA 4ZH4F 5LRRA 4IHXA 1VF9A 2R7WA 4E70A 4R74A 4FX0A 4R73A 3I55I 1X1BA 3RY3A 3LFKA 5DW8A 2EQRA 4M9ZA 2HAUA 3E5QA 2I8DA 4OMBA 5DS9A 3PPOA 1OVTA 4YB7A 2K9LA 2DMPA 2W84A 4ZEFA 3K70C 2FQ4A 3HRMA 4LVQA 2L5QA 1FQBA 3M8FA 1FBQA 4I62A 4ZTFA 1FZPB 5M5WJ 3C4MA 2BW3A 2DCEA 1MZBA 4CZZA 2F6PA 3ZXSA 2V6EA 5LHGA 2FYIA 4O8MA 4N17A 3CUOA 3U1KA 3EQLF 2BOLA 2LMDA 4A3IJ 1JUSA 1BR4A 3A1YA 3CJNA 4BY1J 3M1EA 3VODA 4KYWA 2Q89A 1IN5A 4U7DA 2BJJX 2FX0A 2P0WA 1WJ5A 4MEYF 3OELA 2NXNB 4GYIA 3GVAA 3CFLA 3M3YJ 1K7AA 2RNJA 2VONA 3C18A 2LSOA 1HC8A 1L0OC 4OXVA 4U0WA 1F4KA 1RDYA 1RR8C 4P9FA 3MP8A 5FRMA 3HJEA 2R7XA 3NEUA 5EEAA 3HRSA 3GTPJ 3IB0A 1ZLJA 2Z23A 1X3WB 3QRFF 1JKRC 5LHIA 2LBFA 3S93A 1P7IA 2IBDA 5GADJ 1ZR2A 3H03A 3T96B 4AIHA 3BPVA 5HPQA 2DA2A 2XXWA 1FQDA 5AA4A 4WCGA 3GZ5A 1MMDA 4DYRA 3PO3J 1MXYA 3O6IA 3ML6A 4FCYA 4U21A 4XXUA 3K1NA 1F9NA 4BS9A 3SDFA 3L2RA 1AU7A 5L9MA 2ZO4A 4ELRA 4HCYA 2DDAA 5LHHA 4PETA 5DYMA 1LFPA 2FBKA 4V19K 1HKQA 2O0YA 2XC7A 2WYKA 2XXXA 3TTNA 3MW0A 4DI3D 1V5EA 1X19A 1Y1WJ 1XCBA 1GV5A 1Y6IA 2B0LA 1NG6A 3SEZA 3WTWC 3N26A 4P0IA 2EFOA 4HCWA 4OQOA 4FETA 2QUFA 1G0HA 1VNDA 1FBPA 4YZZA 2ZXWH 3IKVA 4DXBA 4OU0A 1LVKA 4XN3A 4BACA 4YMAA 1SC7A 3GTKJ 1MJBA 2Y0SN 3IWFA 5J47A 4M6YA 2NNYA 3EPZA 1UTBB 3SEUA 2VB6A 1POTA 3VLVA 2XHKA 1UTBA 1BI1A 5TPAA 1FPKA 2QRYA 3UK4A 4HBLA 3KC1A 1D3YA 4IL6C 2EA2A 2NWJA 3K01A 2XRNA 4D0PA 2AL4A 3E6BA 2QGUA 2YR2A 3K1MA 4S0HB 3IP4B 2D21A 1BI3A 2Z1DA 1R9TJ 4G4PA 3RTFB 5FLVA 1XI6A 2EIKH 4NF8A 3CMMA 1T39A 4DI4B 5J1DA 2EBIA 1ZGJA 3ERMA 3RKWA 3BFTA 2H27A 3QIMA 2HOTA 3NQOA 1WI9A 2P6TA 2K4JA 2RCBA 4DDDA 1GTKA 3IH4A 5I57A 3QYTA 3RPQA 1A35A 5L9OA 3SKPA 4BJ6C 5H8FB 2M8GX 3ECRA 2FXAA 4C3HJ 2DMTA 3N94A 1Z3YA 1K4SA 3KJTA 2XA5A 3ZSFA 4C9YA 4BQAA 3I6VA 4XKVA 1U5TC 1XT8A 3FXRA 4M73A 4M74A 2TRTA 3KZIC 4X1EA 4CCNA 1Q1KA 2OBGA 3C32A 1SFKA 4FORA 3G4SI 1B3LA 4FQGA 3L1PA 1JP4A 2E36A 2GOMA 5AONA 1DGRM 2GXGA 4FECA 1JNFA 3GTOJ 3I59B 2P7CB 5IT9K 4OAZA 2K9MA 1MD0A 2ZMEA 3MVPA 2VD2A 3NRVA 1P1OA 1ULYA 1II5A 3K6WA 1R9LA 4NE4A 1YX3A 1H44A 1UZCA 5B3SH 3GZ6A 3P7NA 1ETWA 4B3AA 2HCAA 3P7IA 2STTA 2R7SA 3JRHA 4ZEBA 3V8KA 1NI9A 1R9QA 2BY0A 4LONB 5FKLA 2HQ5A 1EJ9A 1AMFA 4O5VA 1WHUA 5IY5H 5TISC 1JW1A 4A3BJ 4ABZA 3EQ1A 5CVRA 3GMEA 2XUBA 4OAYA 3JREA 2ACJA 1CB6A 4FBPA 4PFRA 3HOWJ 3OYDA 3JR9A 2LY9A 1B7ZA 3THIA 4QPOA 4OENA 1J2XA 5TPAB 5HNHA 3V7SA 4WWCA 2QVOA 2H1LA 3MP1A 4KHZE 4RMNA 3CJTB 5H6RA 4AWXB 4IF4A 2PMUA 3IC7A 2OWSA 2QQAA 3TDJA 3VVFA 1IMFA 2HZLA 3ZCOA 4P96A 4TLLB 2KZVA 1X1AA 4F91B 1FBHA 3BY6A 1BC8C 1GV2A 1B52A 3NWSA 1N7WA 3OY9A 2VJ5A 3S14J 3LSXA 1BIAA 2FOWA 3HKZN 2VIXA 2NS7A 4EM0B 5IT9Z 1YHQI 3VV5A 2M1BA 2LF7A 3SJMA 5D6FA 3KP4A 1USYE 1D0YA 1N04A 3OV8A 3W3CA 1DSNA 1MNEA 4ZEIA 2CG4A 2X26A 3BFUA 1UFMA 5ESYA 1P6RA 2CQQA 3ASOH 2BJIA 1AKHB 4IQJA 2CQNA 4EDPA 3FXBA 2RGVA 3FMSA 3H3UA 4OVPA 2L9RA 3RPWA 4LLLA 3K6GA 3KP6A 4IOAF 5IOYA 1O57A 1ORKA 3ZR8X 3PM1A 3CRBA 4UUTA 1X58A 2F5CA 2OF7A 4QWQA 4LG0A 4EVIA 1P7JA 4H0EA 2B4MA 1N25A 2UYEA 1R1UA 1TL8A 5FBPA 4GBWA 4WXHA 5B1BH 3IL1B 5IT3A 5J8FA 1ETOA 1NNKA 2VP1A 4BGDA 4M4GA 2XX9A 1TWFJ 1FPDA 3FM5A 3G71I 3ABMH 3ZMDA 1TWHJ 1WQ2A 3PPRA 3QOPA 1A36A 3KCCA 2A07F 2QS1A 2FHYA 4LLNA 1H43A 3VDXA 3GBAA 1DDNA 4I99C 1Z77A 4A6EA 1SAXA 2W24A 4IY5A 1GVCA 2Q9TA 2XXTA 3R61A 4RM2A 2V3UA 3QUFA 5K5RA 3MKWB 1IG7A 2E34A 4QPQA 2PMSA 4E7IA 3PMVA 4IKFA 3BIHA 1NK2P 3OOPA 2VI6A 2O8XA 4HQMA 1W7PD 4EGYA 3Q27A 3HHHA 2ZJQF 5CLSA 2IS4A 4MBPA 1D0XA 4UUSB 1YITI 1BI2A 2D2WA 2P1SA 4N81A 2HDWA 5L9SA 1FQCA 2HI3A 4GQOA 3BCAA 2QM3A 4AYBA 1BM9A 3PO2J 1XHYA 2CZKA 3TMGA 1OCOH 2FEZA 2JJ7A 2RV8A 1M5CA 5J4YA 2OX3A 1Y39A 1DU0A 5ELVA 3VXBA 3OYFA 1KZHA 2MYSA 2IA2A 3LA7A 3LSHA 4XF5A 5J40A 1YO5C 2EZHA 1H88C 2JMWA 2P5KA 4IJAA 5EDNA 2W57A 1P1UA 2MKZA 4HV5A 4XLHA 1IQ7A 4ASNA 2DE3A 3LUYA 5LLQA 1LBVA 3L00A 1B8IA 4PJLA 3JRIA 2CV2A 3EUKL 4GL8A 3MPLA 2LNBA 2PJRB 2Q0OA 3AKZA 2JJKA 2GBYA 2TCTA 2XXQA 4H46A 4M9SA 5JHUA 1B7UA 3TP0A 3AL0B 1LEAA 1I6BA 2KRFA 3K0VA 2F6CA 1IMEA 4JXIA 4MNIA 1ZRCA 4YFXF 1JKQC 3KZGA 3E7LA 4O7IA 2XHDA 3O2AA 2M34A 1IJWC 4MLVA 3PMWA 4G61A 4JSOA 3WTXC 2JA7J 1UMQA 2DVZA 2DFHA 2FBPA 3U1OA 4NNJA 4RGRA 2NVTJ 2JRMA 1LCFA 2HPMA 1ZELA 1I1SA 4PAFA 4N6KA 2QSGX 2F5DA 3PUWE 1XS9A 1SFUA 4BJ5C 1PDAA 4RAGA 4UB6C 4G8MA 4N4UA 1WKMA 1B5HA 2OD5A 4HPQA 4J00A 1JVXA 3GYYA 1SW4A 3TKYA 2EA4A 3CC2I 5J1YA 4RPNA 2YX4A 3PUYE 5HM4B 1M5FA 1Y1MA 3FXOA 3H3GA 2RINA 1F5TA 4H5FA 4KI0E 1TQPA 4RB2C 2NYXA 4ESBA 3FHNA 1R71A 4DE8A 1IXRC 1MDQA 4BE2A 4M9XA 2B4LA 2JQ7A 3NWTA 1HSEA 2RC4A 4OFOA 3WAEA 1VQNI 3JAMZ 4LLGF 3IH3A 2L54A 2FIXA 4YKJA 3I5OA 4OFLA 5BPDA 5L3EA 2YUSA 4XONA 1ZKGA 2XSJC 1WVRA 4BBRJ 2VC1A 4G6TB 3RPUD 4IOCF 1N76A 4BE0A 3HCQA 3LSLA 3LR1A 2NRAC 2MLKA 2BXYA 2M8CA 2CZHA 5ET7A 2VOPA 2ZMEB 4A93J 2ONKE 2CFXA 4NEDA 4TQUQ 2E1CA 1FRPA 3D0SA 3SEWA 4QFNA 4J01A 1WI3A 4JQFA 3NARA 2D5VA 4PK4A 4NF6B 1B1HA 3H6WA 3CI8A 2KIUA 2O3FA 1IW7F 2WY7Q 2VJ4A 4KR5A 1RKWA 4ANJA 4PF8A 2E1OA 3WGGA 3HL2A 1Y0UA 1KA0A 1R22A 5CVIA 4F1YA 4I8CA 2YS9A 4JBZA 4OMZA 4PJJA 1U9OA 4U2RA 2DYRH 2XAQA 4ZZDA 3HV1A 1STZA 3KEIA 5AA2A 2MGQA 4MLOA 4BL0B 3FVKA 5DEXA 3F21A 4E7JA 3N4MA 2XWIA 3TODA 4C2MJ 2JUCA 3LSTA 1MMGA 1NTCA 4ZDPA 2I0CA 3CF5F 4XRFA 3CLOA 3K9TA 1EU8A 2KQZA 3F6VA 4ZJZA 3AG1H 1KA1A 3WTTC 3HC7A 2ZZVA 4XLAA 4GWUA 3N05A 2GA2A 1ZREA 1X3UA 2L7FP 1CQTA 4RNSA 1OPCA 1JTYA 2IEKA 1VR5A 3MZ1A 5H8QB 3SFZA 1T98A 4X6AJ 3GTMJ 2I48A 2WY8Q 2OC6A 5DYHA 4A3MJ 2IP2A 3K69A 4X04A 1POY1 3M7GA 2CGPA 2ZNYA 5GP9A 2JT1A 2KMUA 5TJJA 3SDGA 4FX4A 2OLBA 4IHWA 3U72A 1GHCA 1SVOA 2K86A 5K7HA 1BR1A 2JK3A 3DPUA 3FXUA 1ZH5A 2QMWA 3TYHA 1LFIA 1YOVB 2B7EA 2E0SA 1FYKA 2A5YB 2CU7A 3H7MA 1YPNA 2DOFA 2M45A 3CIJA 2LLKA 1P1QA 1FY7A 4HS7A 1MMSA 3BDDA 2GWRA 4I01A 2XXHA 1K4TA 5EGOA 3DBHB 1MXVA 1DUXC 2QVUA 4PGPA 3TCFA 3S1MJ 4KNYA 5AA4B 1BJZA 2A68F 1IMDA 1ZLQA 2DU9A 3B02A 3E6DA 1H9TA 1T2KA 4P55A 1TC3C 1BIBA 2HU9A 4OIPF 2V1XA 2K9QA 3CHGA 3SEYA 4MGRA 2KLFA 3PUFA 1FW0A 2XRLA 2COBA 2ZXIA 3DEWA 3LA2A 3IOUA 1Q1VA 2V1NA 1FIPA 3V8JA 5ED4A 2YLNA 2JSCA 3OYIA 3D5SC 5GPCA 3HOYJ 1LAFE 3TO9A 1DMBA 1DPRA 3QPHA 2XSDC 4UA8A 3RPUA 3FGSA 4H5GA 3WTSC 2JA8J 2QSXA 1URDA 2M87A 5F1RA 3WODF 4TLMB 1RNLA 1SFXA 3ZN0A 1HKTA 3S2VA 4EQ7A 3LSPA 1FPIA 2XAJA 5I58B 3TGNA 1SD6A 1R23A 5F0CA 4DQ2A 1YFHA 4W1UA 3JV9A 1Z91A 1X4PA 3O28A 3LBSA 4ZECA 2O7OA 4P1WA 5L3FA 1FBCA 1IDYA 3S2HJ 2M2EA 4NQWB 4RK2A 1EZOA 3OOAA 5B70A 1IMCA 3ZOBA 4G68A 4GIZA 2MW8A 4Y4RA 3E3VA 1LJ9A 2ZSIB 2V25A 4N8YA 1SD5A 1P2FA 3IAM2 4MTEA 4I9DA 3BCBA 4RBOA 4DLDA 1QHHD 4WF2A 3OS2A 1BL0A 1WWXA 4LZ5A 5EQ9A 2A69F 3OS1A 5ICFA 3G3GA 2X51A 4P9KA 4M6XA 3QYFA 1EZPA 4ENMA 2CUJA 3BKIB 3KN7A 3R7XA 2VL8A 1IRXA 3F11A 1I3AA 4JWOA 3ISPA 3KOSA 3TCGA 1A40A 1E3PA 2DFIA 2K3FA 3E1SA 3OYJA 1RETA 1R49A 1JI8A 3BZCA 5HLHA 3KZYA 5DM7F 1YXIA 2MD0A 4PDHA 1M1EB 1R5GA 2VT3A 2HDCA 3I56I 4A5MA 2C6YA 1SFEA 1AH5A 3T9XB 3HPGA 4RDUA 3WGIA 3PGFA 5IAIA 1YYZA 3BR0A 2E71A 1HW2A 2IS6A 1T0KA 4HW8A 3MKYB 4DBRA 3EUHC 3TAJA 4OIOF 2DJNA 3KEQA 2UWMA 5LGUA 3KOTA 5TP9A 5EYGA 4LK1F 3KLOA 3EETA 2JA5J 5JEIA 3LV0A 2LRDA 4RB1A 2GIVA 2R7TA 4GOTA 1OVBA 2OTJI 4OETA 1RYXA 3GBBA 3OMBA 4BXFA 2XGEA 4XKWA 1ZN2A 3L2UA 2IEEA 4U0YA 5LTCA 1Z0XA 3DM0A 2R4GA 4N8GA 3CO6C 3K4KA 5IZ1A 4LG3A 4LB6B 3CG3A 4Y7NJ 1YI2I 2HTSA 1UHWA 2YX7A 2I5UA 4RB0A 2H6BA 1LUJB 3KC0A 2V4CA 1Q1HA 3OYNA 3UN6A 5IYBJ 2AIXA 4E7KA 3WHBA 2QQ9A 3HSTA 4NQ8A 3O9PA 3I4NJ 4Q4ZF 3FBIB 4YMBA 1WJBA 4AM3A 2CMPA 2QBYB 4ESJA 2G9WA 2AXTC 5GAEJ 1JUMA 2GRVA 4NF4B 2XAGA 1IMBA 3F9KA 2N8GA 3CG1A 4IZZA 1QZEA 3RLFE 5K2XA 4UACA 3CQZJ 3QU6A 1YCJA 4M71A 1M5EA 5DVJA 3RT6B 5C4XJ 1M5DA 1QVTA 2NVYJ 2UVGA 4N4OB 4WX9A 4GWXA 5CQGA 1XSXA 1O7FA 1FOXA 3UORA 2LG4A 4NC6A 3V5AA 5CBRA 4BAYA 2FNCA 5I5PA 3MPKA 4UV8A 2VPLA 4QFLA 1GUUA 1JKOC 3QOEA 1XDUA 3WE3A 2ETHA 2P5VA 1B8IB 1MM7A 4X8RA 3A0BC 5J4VA 1F36A 1DU6A 5BQTA 1B72A 2XF5A 2Y9ZA 1IN8A 4M6VA 2NS0A 3DKWA 4XLEA 4EV0A 1GXPA 2FNPA 3H6UA 4IR8A 2DA7A 2F48A 4POXA 1KGSA 4I0AA 1M5BA 1JJ6C 3IO4A 1I39A 2VJIA 1DCUA 5DUKA 1HOMA 1FPGA 1G3YA 2GXBA 2L7ZA 2E5ZA 5H8HB 1GVJA 4B43A 4V2GA 3R6SA 4E7ZA 1SVMA 3VPRA 3D1NI 5H8SA 3B6WA 1DGWY 5GAGJ 2HXRA 4H45A 1OQGA 2EINH 2DMNA 5FFZA 1FIAA 1SD4A 2F5XA 3HXLA 3VLWA 1I6QA 2ZNTA 1WJDA 1J59A 3O8HA 2XDVA 2OZZA 4HYEA 4LOCA 5BS6A 1MBHA 4CYCA 3JRFA 4Q5SF 3KG2A 1NNTA 4W97A 3OO9A 4OWDA 1QQIA 3GFLA 2G93A 3Q29A 1FBFA 5F04A 4UB8C 1V5GA 1R6ZA 3DF8A 3DCFA 2E5NA 1LE8A 1IEJA 3V89B 3SZGA 2KIFA 1LBYA 4HF0A 2FSWA 4EM2A 3F8NA 1SI1A 1SMTA 4DYCA 1XVYA 4H8JA 2A6EF 4MNPA 4WXDA 1J1NA 2NNNA 3CCMI 1ZRFA 4NF0A 3OYCA 4NTLA 3ECOA 4HX7A 1U6GA 2X6YA 1OMIA 4G9YA 2R7DA 4BKXA 1APLC 3DP6A 3M3KA 3RTWB 1GV8A 1S9TA 1JHFA 4GXOA 5CKTA 2R71A 2PEXA 4XL9A 3BG6A 2F6GA 4NBQA 4NQWA 4EJUA 2PQ8A 3CDHA 5EZHA 5CRYA 1I5ZA 4L18B 2RC8A 4PSWA 1BW6A 1RPWA 3BT9A 1SD7A 3OYGA 1WZ2A 2DQRA 2I49A 1QPIA 1H3DA 1IXCA 2ZXJA 1WGXA 2OZ6A 4CYCB 2O6GE 2EIMH 4F3PA 5KCMA 2FOKA 2LD5A 3HSRA 2OA4A 1QHGA 2D1HA 2L02A 1SBPA 4IO7A 4KIFA 2VBWA 4A0YA 5LEKA 3OYBA 3TBIA 3QK6A 1BA5A 3ZS6A 1B46A 5HDKA 4II3A 4B48A 2XF7A 3WTYC 4OHNA 1A5JA 3FMRA 1ANFA 3G3ZA 3QP6A 4LIUA 5HLGA 3RZDJ 1CGPA 1IN6A 2X1CA 3A02A 2XB5A 1T6SA 1LPQA 1LCTA 4GWWA 4RPOA 3MVYA 2F5VA 5HLTA 1VQLI 1WFXA 3LMMA 1TBXA 1IXIA 3DLLF 1CNQA 4EEFG 4BNCA 2CUZA 3HGGA 1R58A 3M8EA 2ONRA 1GGGA 2VKHA 3ZP5A 4HF2A 4A12A 1PUFA 3Q0WA 4IHTA 1JXSA 5C44J 1LQ1A 1NV4A 2XWOA 3CP8A 5DTBA 5FKMA 3OO6A 1URGA 2JA6J 3OIOA 1TFDA 2R7RA 5HOOA 2I4BA 3EF7A 2AS5F 3TW6A 2WKYA 2QA4I 2O1MA 2A5SA 4RY1A 3W15C 3WHCA 3UP9A 1HBXG 3GFMA 3TW7A 3WTZA 1VQ8I 3OS0A 2D3IA 3IOWA 4PTKA 1EH3A 3TO7A 2I3VA 5EQAA 4N91A 2CYYA 2DAOA 1MSFC 2HEUA 4ZZEA 1FBSA 1BKAA 5JTYB 5DCMA 4LQ2A 3BP8A 2ME0A 3CO7C 2G7HA 2GLOA 3OYKA 2BVLA 2WYPA 3FWEA 2WADA 4OOIA 1DK4A 5KHDA 2HGCA 3FD3A 1JTXA 3TDUC 1FTMA 5T3JA 1J75A 1K78B 5I59A 3KBRA 2LREA 1KYWA 5ICTA 2PG4A 5IP6A 2XXYA 3CTAA 4AVPA 1Z6TA 3I71A 2ANJA 5EJCA 5LOMA 4BQQA 3J81K 1E3HA 3DPLC 3WU0A 4S04A 1N84A 2MG4A 1U0JA 1ZTRA 4BHCA 2WEFA 4I6ZA 1LFUP 1ETQA 3PJRA 1S50A 3TTRA 1FBEA 4QRZA 3WG9A 3TKDA 1WSUA 2VKDA 2F3BA 2VGQA 4KCDA 3CMYA 3ZPLA 5B7DA 1YLFA 5TGTA 1R1NA 4XRSG 1PB7A 3Q9VA 2OCEA 2VKEA 2IVMA 3SETA 1ZAOA 2ZNUA 3OL3A 3QUJA 4QHQA 2MC4A 4KN4X 4HNUA 1MRPA 1K78A 2VBXA 3OSFA 4BJTA 2A05A 5TRDA 2THIA 5JK4A 4E7HA 1MQGA 1IC8A 1BTJA 1LDJA 3KE2A 1N0TA 1QA6A 1OYYA 2ICWG 5JHFA 3H35A 5LDZA 4NWCA 2UXNA 1DPPA 3L2QA 1MY1A 2GH9A 4NF4A 4ECFA 2V1UA 1XDSA 4RGSA 3A3UA 1TXFA 2KT0A 3H06B 5ICGA 1R36A 2QQ8A 2EFNA 1FPQA 1QBJA 3SYTA 2ADUA 5I56B 1G0IA 1MY2A 1MGTA 3KX2A 1XB4A 2D5WA 4GRKA 3JTHA 2FU4A 4QSHA 1T08B 3L2CA 3W9WA 3OYMA 1FBGA 1KU2A 3HSFA 1B0HA 1FTKA 3QMFA 2V6CA 2NXOA 1OLAA 3VFJA 5EF6A 4UVBA 1DQUA 2DQLA 1Y3QA 3MQ9A 2HYGD 3BQYA 3H6VA 3ZMZA 3BQZA 1G59A 2Q88A 3G7WA 1O3RA 4HDVA 1ZGWA 4HE2A 3I54A 3BPXA 2VT5A 3ZQIA 1OCTC 4HG2A 2E60A 4DW6A 2O69A <