3FXQA

Crystal structure of the lysr-type transcriptional regulator tsar
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
296
structure length
296
Chain Sequence
MLKLQTLQALICIEEVGSLRAAAQLLHLSQPALSAAIQQLEDELKAPLLVRTKRGVSLTSFGQAFMKHARLIVTESRRAQEEIGQLRGRWEGHITFAASPAIALAALPLALASFAREFPDVTVNVRDGMYPAVSPQLRDGTLDFALTAAHKHDIDTDLEAQPLYVSDVVIVGQRQHPMANATRLAELQECRWAFSSAPRGPGAIIRNAFARYGLPEPKLGLVCESFLALPGVVAHSDLLTTMPRTLYERNAFKDQLCSIPLQDALPNPTIYVLRRHDLPVTPAAAGLIRWIQHHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LysR type regulator of tsaMBCD
publication title Structural studies on the full-length LysR-type regulator TsaR from Comamonas testosteroni T-2 reveal a novel open conformation of the tetrameric LTTR fold
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Transcription regulator
total genus 95
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fxqA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxqA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxqA03
5E1XA 4YMBA 1YW9A 5AONA 2IP2A 2DWAA 1SD4A 2RN7A 1FYKA 2JT1A 2OZUA 4JSOA 4U2RA 5K2YA 3VV5A 3M3KA 1KWHA 5HLGA 5J8FA 3ELKA 1XSDA 3FV2A 3QPTA 4DIGA 5DEQA 3MVXA 1SD5A 3JSOA 2V9VA 4OTEA 5LLQA 1JETA 1OLAA 3U72A 2R9JA 3FMSA 3IRQA 2ZKZA 3O9PA 3F8FA 1LGBC 1YTVA 2BGCA 4MGRA 4ELOA 2JRTA 1XDUA 4ZE8A 3R26A 3TTMA 4UV8A 3M3LA 3NEUA 3EN3A 2P4WA 3P9CA 1ZJLA 3LSWA 2Z9OA 1PDAA 3EQ1A 5DCFA 3T96B 1JQFA 3GO5A 4XSXF 2F8DA 1O3TA 3IJXB 4QRZA 2RCBA 1F9BA 1Z7ME 4Z7EA 3TCGA 2VOZA 2P0SA 3S9LC 4WXJA 1XD7A 1IN5A 4TV7A 1NNPA 1YCJA 5D8KB 1RYXA 2TDXA 2R71A 1EH6A 4IF4A 1A8FA 4KUMA 2FNPA 5AA4B 2DWJA 3GZ6A 2VOPA 3FJGA 1KGSA 5AA4A 4KI0E 4LFUA 4H8IA 4O5VA 3I64A 5CMBA 2EV5A 4F3BA 4RAYA 5AA2D 2DPUA 3FIRA 2ADUA 5L8DA 2WWYA 1RKMA 2GHAA 5LOMA 2BV6A 2PMUA 3IK6B 3O2AA 5L3DA 2PLYA 2A69F 1PEBA 1M5EA 2QM3A 2VGQA 4TOZA 5HOOA 2FYIA 2D5WA 3ZKLA 4U22A 3K4UA 1HW2A 3ZMDA 2I6EA 3VLWA 3T0YA 4ESXA 4OHNA 2ZFWA 2D1VA 3FJ7A 1OYIA 3I6VA 3GFJA 2RC8A 3M3FA 3MZ1A 5M2VA 3FM3A 5HDNA 3NRVA 1R5HA 1OYWA 1EV7A 2QL3A 5CM6A 1O64A 2AIXA 3DV8A 4QFPA 4GYIA 4IJAA 1O63A 5ED4A 1T0FA 4QLCU 1FQFA 5TPAB 1ZLKA 3EHTA 1O7LA 4CDGA 1CB6A 1FQDA 1J0RA 4HV6A 3M8UA 1HW1A 5TPAA 3MVWA 1VTNC 4BLAA 4P55A 2M8EA 1YG2A 5E17F 3Q26A 3O6GA 4IGTA 4GYGA 2P6TA 2GH9A 4NF5B 1U2WA 2HTSA 3HN0A 1MXVA 2HYGD 1J9IA 5I2NB 4KQPA 1URDA 1R5GA 1SD7A 2FXAA 5JEIA 5I2NA 4OEUA 1D8JA 3ABTA 2P2AA 3A09A 2KIFA 3HHHA 2X26A 3GZGA 4HCWA 1IUYA 1B3EA 5LEKA 2DQLA 2OWTA 1RYOA 4U7DA 4S04A 4OETA 4JSDA 4F3GA 3EF7A 1NKXA 2IEEA 2OQGA 1MXXA 3W9WA 2DTRA 2DS9A 5LGTA 1M5CA 3Q9SA 1B3LA 1J7KA 2RV8A 1PDNC 1G3YA 2ONSA 4WXHA 1NNTA 1HXDA 3I58A 3I5OA 5F1QA 3I54A 4KD5A 2HR3A 5H8QB 4H0EA 2FSWA 5AE4A 3M8EA 3H6VA 3FZVA 4GXOA 5H8QA 2HOEA 5D4RA 5HS9A 1ZLQA 5L9MA 3KN3A 3IOWA 4GL0A 1KQ8A 2MLKA 3OD7A 1O7FA 2Z3YA 3KZYA 1G3SA 4AVPA 2HWVA 2JZYA 3PPNA 4PE5B 1RIOH 4IO4A 5CJ9A 4IO6A 3IKVA 5H8NB 1FQCA 3OOAA 4GF8A 3V83A 4I7HA 4OFLA 3OO6A 3GZ5A 5JI6A 1JGSA 5H8NA 2P1SA 2RINA 2ISYA 3LUYA 1JNFA 3RUMA 2FA7A 2V3UA 3LR1A 2XXVA 4JK1X 3BP8A 4JDFA 1XCBA 4L18B 4KYEA 3TDZC 1WRJA 4ZH4F 1H9TA 4GL8A 4F39A 3K69A 1KYZA 3MZBA 2Q2AA 1JEVA 2M87A 4AWXB 4P5OA 1REPC 4MQVA 5DDGA 1ZMGA 3Q29A 5BUUA 3WTVC 3MQ0A 3UIFA 1KU2A 2VXZA 1B6HA 1B05A 1VFEA 4UNOA 2G7UA 4L17A 2CFXA 1FW0A 4ZYHA 1J75A 4H65A 4HW8A 3VE1B 1MPBA 5BS6A 4LQ5A 4G4PA 2EA2A 4U0VA 4MTDA 4KNYA 4IO2A 3RPUA 1USTA 4M9XA 5HLIA 4G8MA 4KMFA 4POXA 2H6BA 2DWIA 2F6GA 2JPCA 3RLFE 2Q8KA 5EEHA 3E6CC 4Q8RA 3IL2A 4KFCA 4KYWA 5IT9Z 2LSOA 4HS7A 4Q4ZF 3ZS6A 3TOBA 1M5BA 4BHBA 4N07A 1N0TA 1XVXA 4BDLA 2A07F 2PJPA 2O6AA 4EVIA 4AIJA 5FLXZ 1XMAA 1TXFA 3DF8A 1R1UA 3G3HA 3IAZA 2G29A 1YW8A 3JAMK 2ZNTA 1RUOA 2DK5A 3KJTA 2O84X 3WTZA 4XKRA 5CYVA 1WVJA 2RQPA 2EFQA 2DLLA 3P7IA 4Z2YA 1IRGA 3L2CA 1H44A 2V6CA 2I0CA 1QQIA 4OENA 1ZKBA 1JEUA 3WG9A 1FPQA 2Q0OA 1FQBA 1UIUA 4ELRA 5LBQA 4P11A 4A0ZA 1OVBA 4RS8A 5DYHA 4CICA 1AOYA 3ZMSA 3U94A 4Z0IA 5JTYB 4F29A 4QFKA 1FSHA 1J5YA 3K01A 1ZHFA 3ECRA 3QYTA 4GIZA 2UXXA 3LAPA 1QJMA 5JTYA 1FBUA 4BDOA 4YIIA 3FXRA 5FFXA 3CSBA 1T6SA 4ELQA 3TQLA 2A68F 2XHKA 2PMHA 4OU0A 1O3RA 3S9EA 4WEPA 5H6QA 5ILSA 1HKSA 2ZCWA 3FXQA 3FASA 1BI3A 4ZEBA 2O3FA 3TO9A 1QVSA 1M5FA 2VBWA 3MFKA 5L9OA 3HSRA 4R6HA 2W84A 4HV5A 2DO7A 3GF2A 1BIAA 4F2QA 1ZU0A 3JV9A 2ONKE 2XXTA 3BJ6A 5JK4A 2V93A 4N0BA 1K78B 3VDFA 1TQPA 1TLHB 1MY0A 2QS2A 4I09A 1NMUA 2VOOA 4BDQA 1K78A 3CI8A 4HX8A 2IA1A 3GVAA 4NB5A 4I0AA 3C1DA 3F8BA 4ZEKA 3JAMZ 4NWDA 3FF5A 4UA8A 3T9XB 1J2XA 4KIFA 2ZNUA 4O6JA 4UVCA 5D6EA 4NHJA 5I56B 4ONYA 2WTEA 3FX3A 3A3UA 2GA2A 1FYLA 1QUIA 3SETA 2HXWA 3LA3A 1ODDA 2XXXA 3R60A 4E70A 5I56A 4M1VA 1WSUA 3DEUA 1A55A 4ECFA 3KP7A 4HW0A 1IN7A 2ZJ2A 3PQKA 4HCYA 5CBRA 5K5RA 4UUVA 2VBXA 2DE3A 2QZ8A 4RGXA 2XX8A 3M7GA 4X1BA 2H4IA 1H0MA 3HRSA 2YLNA 3L6GA 4XTCQ 1R23A 5CI5A 1OPCA 2HGCA 3FVKA 4BDMA 2QRYA 2HFBA 4G68B 4LB5A 3HUGA 5K1YA 2UYFA 3LWFA 5ICEA 2CSOA 4HQMA 4HZFA 1SW2A 1MKMA 2RC4A 4G68A 1FOKA 1QBJA 2STWA 1II5A 3TDUC 2XRNA 1GVJA 5A5XB 3MVYA 4A12A 2HDCA 4KN7X 3CUQB 2E1NA 5A5XA 1B9NA 3ZMVA 3T1BA 3C31A 1BP5A 4EJUA 2VT2A 3CUQA 1AWCA 1MY2A 4EV0A 1XGMA 1SYIA 3WTXC 5A2QK 4RXLA 3TTNA 1LCTA 4M4GA 3IL1B 1P2FA 2OBGA 1FT9A 5BPIA 1N3XA 2WV0A 2QSXA 1YW7A 3KN7A 2KKOA 1Q1KA 1KQ9A 1LCFA 3F22A 1P4XA 2XUBA 1VR5A 3I5UA 3KEQA 3R0JA 5J6XA 1EZOA 4RPOA 3ZN1A 1N04A 4A0XA 1ANFA 5E18F 1R1NA 3P9IA 4NEDA 4MEYF 1Y1MA 4HDVA 3RI4A 3LA7A 4ZYEA 4YKPA 2O03A 3S2WA 1URGA 1ZH5A 2LKPA 3S9NC 2LAOA 3GW2A 4YAHX 1ZG1A 1S29A 5DT6A 1B1HA 1LAGE 1XDSA 2F34A 3OXNA 1F1ZA 2ESNA 4IRHA 5DUIA 4A0YA 1B5IA 5JFRA 4BYYA 1SQYA 4GVOA 2XKPA 2P5VA 3S2VA 1D4NA 3TOAA 1P1QA 1Z91A 2O8XA 3VVFA 3C33A 1OIBA 3PPRA 3T9VA 4ZDMA 3V7SA 1OQGA 1J59A 1X3UA 3EYYA 4DDDA 1LDDA 3DPTA 4R9GA 2B0LA 4ELPA 3IWFA 1HQCA 1JW5A 3C34A 3TCFA 4F3PA 1O7TA 2P7CB 3FVGA 4U1OA 2EB7A 5K5OA 1WI9A 3CFXA 1R22A 4G7ZF 4RB2C 3I71A 2NUVA 4X9TA 3WTUC 3SHFA 1WDNA 2QWWA 2DVCA 5EYFA 2RNJA 4MQ9F 4FX4A 5A2QZ 3PMWA 5B7DA 3OO7A 3ILTB 2QPQA 2FNCA 5H6RA 2K86A 1N3WA 3COAC 3EHUA 3J7AO 1XC1A 4NTLA 2QYOA 5AIQA 4HTGA 3KE2A 1XOCA 1LDKB 1QGPA 5CVIA 1G6NA 1IW7F 4LVQA 3V7CA 2Q89A 3OSRA 2XXRA 3FWEA 3D4GA 1B46A 4BAYA 3HTSB 1I1SA 2AL4A 1A8EA 3HSFA 3WU1B 1IITA 4NF4B 3V8LA 2DBBA 5LHHA 3ERED 3V89B 1ATGA 1MY1A 1WQ2A 2ZYMA 3VFJA 2NAZA 4HF0A 1SW1A 1I6AA 4NF4A 3QAXA 3QOPA 1SI1A 3IHUA 2VODA 2UYEA 1FWZA 4UXNA 1USYH 4KHZE 3RTRA 3VVDA 4CGZA 3J80K 3EHSA 4G9YA 3FUZA 5CBSA 5DEXB 2W25A 3H3GA 3G3ZA 1N7WA 3R6SA 3EDPA 5DEXA 4MLVA 5LEJA 2UVJA 3ZKKA 3RKWA 5ICQA 1WWXA 2Q9TA 2OWSA 4EGZA 2L02A 3RJPA 2HTJA 4TLLB 2LF8A 2Y48A 1Y0UA 4ISUA 4I98B 1ON1A 4LK0F 4Q30B 4GFRA 1PP8F 2QUFA 5DUKA 2AS5F 3JZJA 3RKXA 4L0ZB 2DVZA 1MM7A 5CVVA 5BOXA 2I3WA 3TTRA 4PP0A 1GHCA 4N6PA 3CRBA 1ZGJA 2FBHA 1B6AA 1R6ZA 3CVGA 3LSFB 3O6BB 4EQQA 2OA4A 2P5KA 3KEOA 1UTHB 4TQUQ 4LLGF 1JW1A 1SVXB 4FIMA 2E0SA 1LEAA 4ENJA 2PBIA 2GXBA 1B32A 4S05A 1UTBB 4NQWA 4ND9A 2F2EA 1YAEA 3FD3A 2UZKA 5CMKA 2D3IA 1Q1HA 4L9VA 1MDP1 2J5OA 5HBCA 4ENKA 3P9KA 3Q5FA 1LBBA 2F5CA 1IXGA 1FZPB 4ESFA 2A5TB 4EJOA 3DXJF 1DMBA 1FQAA 1I69A 3G3JA 4XIGQ 4ON0A 1MJ9A 2QMXA 1BN5A 4GQOA 4YB6A 2A5TA 3J80Z 2XVCA 4OMYA 2UVGA 4Y15A 3BDDA 1OMIA 1OQHA 2O1MA 2X4HA 2DXRA 2ZYNA 4KT5C 1SD6A 1P4AA 2P8TA 3BJOA 4L0YB 3CR9A 1G3TA 1XN7A 4UVAA 1EZPA 1T0KA 3T9UA 4LMYA 4HLXA 1B9JA 4JWYA 1K6OA 1JXSA 4OOIA 2V79A 3ZMUA 3V5AA 1I6BA 3CO7C 3O2PE 3G3IA 5AA3A 2PQ8A 4ZS9A 2IVMA 3H6WA 4BHPA 2MBFA 4O3CA 2DXYA 4KIBA 2O7UA 2LF7A 2ZNYA 1B58A 3MEXA 1ON2A 1SMYF 3AAFA 3K6UA 4KA4A 3MZHA 3C9HA 3OMBA 2A5YB 1TNSA 1ZARA 5JR3A 2QQBA 3RT8A 4XSZF 2Y7RA 2XXIA 1U6GA 4XKPA 2H99A 3KP5A 2V1DA 1U5TC 1KU9A 3EUHA 1VE4A 2FQ3A 3LSXA 5D5VB 2QQAA 1F9NA 4IGRA 4NF5A 3C35A 1YLFA 2XKOA 1DSNA 4QHQA 3QXMA 1M5DA 2H94A 4EUOA 2W57A 3DP7A 4U88A 3KN8A 4R6YA 4M71A 5HM4B 2K4BA 5EEGA 1S7OA 3C32A 1MQIA 3TQWA 3PFIA 3PUWE 5D6FA 2H27A 2K4JA 4OIOF 3L09A 3KEIA 5FTIA 3V4GA 1B59A 3FXUA 3J81K 1D5VA 1R00A 1FTOA 4DZ1A 2H6CA 3T8TA 3F23A 2IRFG 2MH2A 3K2DA 4L5JA 1HSEA 2ZXTA 4DQ2A 4HAMA 1SW4A 4HBLA 4Y13A 5ICFA 5L3CA 1DPPA 4ZE9A 2XIGA 1T39A 2FE3A 3T66A 2M45A 1BM9A 1B1XA 2CZLA 3RQTA 4I8CA 3PPPA 1R9LA 4I1DA 3WTYC 1TT1A 1H45A 3BOQA 3HHFA 1PP7U 1YIOA 4LB6B 3H06B 3KOTA 1Z7NE 5EHSA 3OEKA 3C18A 2DW4A 1TQIA 1S9TA 2W24A 3JSPA 1NL5A 4LUBA 3VXBA 1FTLA 3LFKA 1LBCA 3FMRA 1LSTA 4AB6A 1DUXC 4ETSA 1QKBA 1WKMA 4X1DA 1MDMB 4EJWA 3TDJA 2DQVA 3Q28A 4WEDA 3PUZE 4A6DA 2ELHA 1MQJA 2QBYB 1MDMA 5F1RA 2V3QA 3ZSFA 3F8NA 4I02A 5HLHA 3KOSA 5BQTA 1ONVA 4YFXF 2QBYA 2A6HF 2CG4A 3QIMA 1GXQA 4UV9A 4JWXA 3ML6A 2V84A 2PVUA 1B52A 3H3ZA 2PYYA 2HCAA 4ZEIA 3G7WA 3TUSA 4U7BA 3LC8A 5LRSA 2VD2A 3V8KA 1FTKA 2PX1A 4G8HA 1OYYA 3E6BA 4RB3C 2O68A 1YYVA 2I48A 4C1UA 3TEPA 1TFDA 4PETA 4F1YA 3CG1A 3W15C 4KR5A 3J81Z 5H8HB 2NS0A 2NNYA 5K5QA 1TW2A 3N6UA 3QUJA 1S3JA 4ESWA 2FRHA 1MG1A 5CRYA 1B7UA 5H8HA 2XXYA 3PUXE 3CO6C 1ZG5A 3KFMA 4ENMA 2FBIA 3MWMA 2ZMEB 2RC7A 3CDHA 1MPCA 1LNWA 3WODF 1BC7C 3IOTA 4IPAA 4MEXF 4FHTA 5I59B 3TMGA 4WF2A 1AH5A 2Q8JA 1LVAA 1SI0A 1SBPA 1UFMA 2H25A 2FF4A 4YFKF 2ACJA 5I59A 1VFDA 5FO5A 5LGNA 3ISPA 3L6HA 4OFJA 3H4ZA 4LJZF 5J8CA 1FBQA 4EMSA 2YJPA 3H92A 3I53A 4L9TA 5E1ZB 1W4MA 2Y0MA 1F5TA 4F19A 3U93A 1LJ9A 5KK1A 2L54A 3GBBA 5L3BA 3ONMA 3KP2A 2EV6A 1S7YA 1R1TA 2YPRA 3E5XA 4MNUA 1XVYA 4BHCA 5HDKA 4G8NA 1DPEA 1MS7A 1QNTA 2Z99A 1ZLJA 3E3KA 3MP1A 1HW5A 1JHHA 2HZTA 2OD5A 2GZWA 3IOVA 2EWNA 4ZYDA 4JBZA 2XAHA 2KIMA 1B7ZA 4G8XA 1ZG3A 4GLIA 3D0SA 2DP8A 1QKAA 1FQEA 1BOAA 1XMKA 5E1WA 3TFLA 4HF2A 1BI2A 1I6XA 2IT0A 3O29A 3I4PA 2P5LC 2CGPA 3WGHA 4M6YA 2O6GE 1GR2A 2HAUA 3O28A 3RKYA 3PV0E 1MXUA 4GOTA 1B3GA 4A6EA 4LQ2A 1ZYRF 1I5ZA 3HRUA 3VXCA 2ABHA 2PN6A 4OYVA 2F5DA 1MY4A 1I1GA 2HEUA 4FATA 4I01A 4KICA 2E7XA 2GRVA 3E6DA 2DI3A 3U92A 2HZLA 1F4KA 1OLCA 1LAXA 3BROA 1FNNA 3MCZA 5CVJA 2F36A 3KJ7A 2L4AA 4MLQA 4U4XA 4F3SA 2HKXA 2NXOA 1A04A 1QZYA 3GYHX 1KU7A 3MPLA 4QFNA 3RN8A 4F1VA 2RCAA 3WTSC 3ZPLA 1DTGA 1LB8A 3SEWA 2Q2EA 2F78A 1GXPA 1B0HA 5CMMA 1Y3QA 2VC1A 1ZRFA 4YB7A 4YKJA 4LLNA 1XT8A 4YU0A 2R7FA 3BKIB 3KSJA 1KU3A 2A6EF 5AIPA 1FBSA 1Z05A 2QENA 3ECOA 3QRFF 4G77A 4AD9A 1G4DA 5ICGA 2W7YA 1LQ1A 2BJJX 2NOOA 3RIRA 3T8RA 3GFMA 1IF1A 2F5FA 2Y75A 3Q27A 4AB5A 1MJAA 2OAZA 2XX9A 2THIA 5ILUA 1BI1A 3IRRA 2F97A 3DLNA 5DCMB 2IW5A 4MF3A 2STTA 1IUDA 5LRRA 3KP3A 1T98A 5DCMA 2CQKA 1MM6A 1HKTA 2Z23A 1Z1DA 5KCJB 4EJVA 3KBRA 5D5XB 1IXSB 4OFOA 4M6XA 1DPUA 3E13X 1OR7A 3FMQA 3RYRA 2GHBA 5KCJA 2X7QA 4LATA 5CC2A 3Q9VA 3FM5A 1POY1 4NF6B 2NNNA 2XXPA 4CYDA 2QVOA 4N9HA 4PFUA 4I2OA 3QK6A 4H6DA 4G94A 4NF6A 2I3VA 1NFTA 3EQLF 3L00A 1BIBA 2IPQX 3E3VA 4BH9A 5ICCA 3SXYA 2R6GE 3CLOA 4JB7A 1HSLA 4DLDA 3D5LA 2RKMA 1Z6TA 5TRDA 1DPRA 2EFNA 4YZZA 2DE4A 1BC8C 3E9XA 1YS7A 2ZXJA 2XD2A 4OERA 3BZ6A 4YB5A 3KLNA 4HA8A 4F31B 3KSXA 4LD5A 3K1NA 4EQ7A 4KIGA 2QS3A 4C0RA 5LHGA 1YFHA 1B3FA 4EDPA 3Q25A 1MXWA 3W6JB 4LP2B 1FTJA 3DP8A 3RYPA 1R7JA 5E8GA 3FVOA 4IO3A 3WTTC 4UACA 1B5JA 1YTYA 4Q48A 1O3QA 4OXVA 3C7JA 5TJJA 1L5TA 5FTHA 1BIYA 1TWYA 4XLNF 2WC2A 3SEXA 1I6QA 3BFUA 3CJNA 1ZN2A 3TZAA 2GXGA 2EJRA 1QPMA 1YO5C 2AYSA 3PMVA 2JPBA 4PFTA 3SKPA 2PBWA 3I3VA 3PU5A 3N5LA 5DVFA 1B1BA 1LLSA 2V1XA 4PGGA 2Y7KA 3E5QA 2YX7A 3MW0A 3QPHA 4PQJA 5DD4A 2CYYA 3O66A 2XROA 4QSCA 3GFLA 1MJBA 4LZ8A 1CE2A 4LA9A 2FNAA 3F21A 4B8XA 1U3EM 5TU0A 1B40A 3C4MA 1GVCA 1A99A 4CZZA 2MLGA 2COMA 1IRFA 4HF1A 2L3DA 4IO7A 3TTLA 2HFHA 1Y9UA 3GLXA 5H8FB 3RY3A 2D1HA 5FB2A 3IO6A 3L7WA 1O3SA 1R9QA 1DP7P 2XAQA 2B65A 5H8FA 3E5UA 3GXOA 5KDTB 2BE5F 2HKOA 1KQ0A 3MAJA 4IB2A 2K02A 3VLUA 1SW5A 2X7PA 4A2UA 1AMFA 3IB0A 1POTA 2ZNZA 5DTBA 3O3KA 4OMBA 4ZEDA 1MH4A 4EXLA 4WK8F 3KFWX 1S6LA 3GEZA 2AL5A 2LDUA 1HSJA 2FU4A 4G6DA 4IXAA 2MC3A 1BI0A 3HRTA 3H03A 1QO0D 5JVTA 1LAHE 2VP1A 3EETA 1PB9A 4N9IA 4YFNF 3TQNA 3MZYA 5ERIA 4R72A 4ZZLA 5HDGA 4MH5A 4ASNA 3S4UA 1TBXA 3K2ZA 2UXNA 3N94A 5CVUA 4R8HA 3VFZA 5ITOA 3GXAA 2VE8A 2HQNA 4GO1A 2HEOA 1P4WA 2AXLA 3FJMA 1JHFA 3TODA 3O6HA 1FCKA 2O1LA 1BBYA 3SZPA 1R36A 5H8SA 4YMAA 3A3CA 3MP8A 4Y17A 3KETA 4UHTA 4R2FA 2DFIA 4IO5A 2OCUA 1B3HA 1SDXA 3MPKA 4OIRF 2M1BA 5ITPA 1N76A 2NVUB 2MD5A 2FMLA 3I59B 4LG0B 2NRAC 1MRPA 2XXUA 3DPLC 1W7PD 4RY1A 2JTVA 3DKWA 2EK5A 4LG0A 3I59A 4LLLA 3SZTA 5BMZA 3QU3A 3F11A 4OIPF 4R75A 2DK8A 2Y7WA 1VSOA 3IX1A 1U5TB 3F72A 5I57B 2XD3A 4FORA 3IKTA 2OJTA 3DP6A 4G68C 1CF7B 5I57A 2ZMBA 4M72A 2BBYA 2IA4A 1CF7A 3R61A 2H9BA 2Z8EA 4I0BA 3PUYE 2ESHA 4AQ4A 4XXUA 3CUQC 4IHTA 2H98A 1EH8A 2CO5A 5B70A 1OMPA 3UGWA 4QSEA 4MBPA 3KLOA 4EM2A 1USYE 4OEVA 4IY6A 5LGUA 5KVRA 4FJPA 4POWA 2VHAA 4B09A 3HCQA 3KP6A 4GRKA 5H20A 4I9DA 3KCCA 1NNKA 4EM0B 2GA1A 1G3WA 3CSGA 1GV8A 3VEPA 3RTFB 3WGIA 2OLBA 2EV0A 3R7XA 4RGUA 4EF1A 4H0WA 4GGGA 3U8QA 4R73A 2OZZA 1US5A 1STZA 4XBFA 3OV8A 2QMWA 1IIWA 2XX7A 2JSCA 3THIA 2C6YA 3BFTA 4ZECA 4HLYA 2A61A 1P6RA 1K7AA 3B73A 1W5TA 4P96A 2DSFA 2ZYKA 2LNBA 2YR2A 1UTHA 5AA1A 3L9FA 1B7HA 3R4KA 2F5XA 4R74A 3C36A 3TELA 1UTBA 4U4SA 3TCHA 4G7OF 5FGMA 4KDPA 3UP9A 2E1CA 2J5PA 2HQ0A 3M1EA 1L3LA 2REGA 2RF1A 1EH7A 1UQWA 2MA3A 3CG3A 4JXIA 4DXUA 4E0WA 3K9TA 4KCCA 4HX7A 3LSLA 5ILVA 3OO9A 3EPEA 1YPNA 1LDJA 4EJTA 1S8NA 5F64A 4F18A 4O3BA 3QP5A 4WKMA 4F1UA 4WCGA 1MQHA 4HX4A 2DYXA 4WX9A 3FV1A 3N97A 5BWJA 2ZYOA 4QSDA 3AXFA 1UHWA 3TTKA 2ZBKA 2L01A 4IRIA 4E0XA 4RK9A 1R58A 4BQAA 2PG4A 3QUFA 5HS8A 4IVNA 4Q5SF 2XHDA 4R9FA 1H43A 4D0PA 1P1WA 2CMOA 3P7NA 4OESA 2ZO4A 2D45A 3R0AA 3V7RA 2XXQA 2XAGA 3DQVC 1PBPA 3SEUA 2H09A 4HDUA 5DYMA 3M8FA 4ZZEA 3CUOA 2F7AA 3VLVA 2VN2A 5CLSA 2G7HA 3F3XA 3E6MA 4WXDA 3V8XB 1MDQA 1D3YA 4H5FA 3W9VA 2D21A 4FEBA 3HOTA 4ZEFA 3HHGA 2V25A 2NWJA 4HYEA 4PGHA 4FAJA 1IXHA 3U2RA 1Z7UA 4LZ5A 4H1XA 2YPNA 1B0LA 1PC3A 2Y84A 4RK2A 2F7CA 3UORA 3OELA 2UVHA 4FT8A 3EYIA 2F7BA 3T22A 3REOA 1UCRA 3CIJA 4K3FA 1SAXA 3DM0A 5IKBA 1UIVA 3SESA 4F22A 4G7HF 2B3BA 4QWQA 3TGNA 4ESBA 1MQDA 2Z8DA 5FHNA 5DVIA 3K6WA 1LB2A 2X0LA 1NH7A 1XHYA 4R79A 1BLFA 1Y4CA 3ZP5A 5I58B 4RB0A 4LK1F 3DELB 2O51A 4N13A 4EF2A 4GXSB 5I58A 4A5MA 1S50A 1HSTA 1ZAOA 1HBXG 4DXCA 2Z5UA 3GLBA 2M5WA 1USSA 4IHSA 2P7VB 3KZZA 3QAHA 4FEDA 3UN6A 5CVRA 1RNLA 5F6FA 3BWGA 4ZZDA 3MAMA 3K1MA 2PI0A 3VB2A 3F8CA 4NMYA 3RPQA 2DQRA 2I4CA 5LHIA 1PB7A 3PD8A 3LA2A 4QFLA 3T9HB 1ZGAA 2RDPA 1JVXA 1GTKA 2VE9A 6PAXA 4OWDA 3KG2A 2PEXA 4L9JA 4ESJA 5IT9K 5ISUA 2EFPA 3SERA 1D9YA 2GAUA 3UK4A 1XGNA 2GFEA 3SQNA 5FLXK 2F35A 2FEZA 1IN6A 1IN8A 3U1DA 1RUNA 4Q5TA 5HPQA 1D3KA 3K6XA 1ZTYA 1TNTA 2PT2A 3TAJA 3HSEA 2Y7PA 4YKKA 1U8RA 1FTMA 2PT1A 4AIHA 2BEOA 1FLIA 1Y20A 1P1UA 1H9GA 3E4RA 4FX0A 2EA4A 1MQGA 1QUKA 1P92A 2I0BA 1US4A 1B5HA 4PFYA 1W7PB 4CXFA 3KGCA 4H67A 1LAFE 3DP4A 4L9NA 1NH8A 3JYRA 3SEVA 3MZ9A 4G2ZA 1W7PA 1XCVA 2DAOA 3MVZA 2BYVE 3ILUB 2G9WA 1MXYA 3LQQA 2O61A 3USDA 1JE8A 2A5SA 4P9FA 2HQRA 2MH9A 4OMZA 3OO8A 4M9SA 2VBYA 4Q47A 3ZQ7A 3IB1A 4M9ZA 5L3EA 3IOUA 3CFLA 1K79A 2ALUA 1SFUA 4RB1A 2FA5A 2ZMEA 3B6WA 5I84A 4F7ZA 3QU6A 3G73A 1KYWA 1KA8A 3TYHA 4X48A 2UXAA 2FBKA 4P9UA 1J1NA 2I58A 4EQ9A 1SFXA 1Y4TA 4F2OA 2EFWA 4YICA 4PFWA 3BPVA 3KZGA 3F6VA 1SD3A 2ETHA 4LGWA 4NE4A 1W5SA 1HKQA 1MXZA 3GBAA 5ICTA 3BPXA 4QF9A 2VBZA 3ABUA 1ZBMA 1EU8A 4R1HA 4DNCA 3FHZA 2M30A 3IR1A 3OEMA 1LFGA 3H7MA 3ROUA 1OVTA 3O6IA 1FC3A 4FECA 4BNCA 1FYMA 3MUQA 1UHMA 4WWCA 4BDNA 4YG2F 1P99A 2HS5A 1TW3A 1FX7A 3FVNA 3T93B 1IZ1A 3B02A 4U0YA 3U9GA 3WTWC 4JQFA 1LFHA 3PMXA 2HZKA 1V4RA 3W6KB 2G93A 2ONRA 3B7DA 2YSRA 1B9MA 1H3DA 4BDRA 2M8CA 4ENNA 2XAJA 2HYFA 1E2XA 4HQEA 2O69A 1AIVA 2KJCA 1Q35A 5ELVA 5D5WB 3PGFA 1JVYA 4R6KA 3JTGA 2KJBA 4P0IA 2HAVA 1MH3A 2EFOA 2XV4S 3ULQB 2RVCA 5CMCA 3MWBA 1B51A 4U21A 4DXBA 3JTHA 5I2KB 4IY5A 4H8JA 1B4ZA 4AIKA 1SYHA 3K02A 3SDFA 5I2KA 4Q0CA 1PB8A 5KZTA 1MD0A 1IQ7A 2GQQA 2ZNSA 2XASA 1V3FA 5DD8A 5L3FA 2V3TA 2F6PA 4G6QA 5AA2B 3RT6B 4CO8A 2Z33A 3G3KA 3TPAA 4PDKA 1ZRDA 3IORA 2R7DA 4O3AA 5AA2A 4KN4X 4M74A 1D9VA 1NNFA 2OZ6A 2QJEA 4L5IA 2Q88A 1H76A 4K2EA 4RPNA 4XKQA 3K0LA 1IXRC 1TQMA 4A5NA 1B2HA 4DCXA 3V8JA 3H6UA 5FFZA 2KIUA 1BJAA 1URSA 1LB9A 4EXKA 3IO4A 2XXHA 4U1ZA 2I49A 3UA8A 1YQAA 4GXAA 4ZZAA 3HIFA 2ISZA 4OZ9A 3I0TA 3F6OA 3DFGA 1AL3A 2I4BA 2E7WA 3QP6A 3K0VA 4BXUA 4MTEA 5IAIA 3QSLA 5D4SA 1YS6A 2H5YA 1T2KA 3HV1A 2CWEA 3F8MA 3PD9A 3OSQA 4C1TA 1WODA 3GFIA 4NWCA 2Z8FA 2CW0F 4R2BA 1RZ4A 1LEBA 3HTUA 1XS5A 1XSVA 4GD5A 3HOSA 1DTZA 2XXWA 2VD3A 3IB2A 5BPDA 4LZ7A 2Q2CA 3ZMTA 3FATA 5TP9B 3G3FA 5HVQC 2K27A 3KP4A 1P1NA 2KLFA 2NYXA 1S7AA 1ZIUA 3BBRA 4DE8A 3B6QA 1IXIA 5TP9A 2FOKA 2REJA 4JWOA 1DDNA 4DCYA 2VC0A 3R6UA 1FY7A 5E8IA 2YU3A 4WXCA 2QS4A 3WE2A 1XB4A 5HS7A 4RGRA 1Y3NA 3WU0A 3WAFA 2VT3A 1E17A 1GGGA 2DE2A 3H3UA 2OQRA 1QULA 3ZN0A 2K7LA 2DT5A 3O97A 2IJLA 4KPTA 3D4CA 3SEYA 3RDIA 2DU9A 2ANJA 1UB9A 5J1DA 4OVJA 3MBPA 4TLMB 4RYAA 3N26A 2OK2A 1BKAA 2A3SA 3SFZA 3PPQA 2PMSA 4JBAA 4ZYGA 5D5UB 2VONA 4IRGA 3WGGA 4P0GA 2Z22A 1JW4A 1FSEA 1B4AA 2YX4A 3CTAA 4OIQF 3MP6A 3T5XA 3PPOA 4H5GA 5IT3A 1AOVA 5D8LB 1SMTA 4RGSA 3N6TA 3GX4X 3K00A 1Z6RA 1R1VA 2XAFA 4YIFA 3OENA 1XGOA 3GWZA 2QLZA 1TFAA 3HO7A 3TKDA 3TO6A 1Z9CA 4GWOA 4QFOA 4THIA 2O0YA 1ZRCA 1QUJA 4GCVA 1SFEA 1IN4A 1QZZA 4CHUA 3IJOB 5FHOA 3FGSA 1RI7A 2IA2A 3HSTA 4I62A 3E97A 4XKNA 1O57A 3BY6A 1PBQA 1XSXA 4RA1A 1ULYA 3TO7A 3WE3A 3K6VA 5KDTA 1LFIA 4KFQA 3S9MC 2R3SA 1QW0A 5JHUA 4NF8B 4U23A 3NQOA 4EM1A 3PUVE 4U0WA 2PFBA 1OKRA 1D8KA 2V1UA 2O7IA 5K2XA 1FP1D 1XGSA 3K1PA 4HOBA 4NF8A 2P6SA 1N84A 3RPWA 1N7XA 1I27A 3RGYA 1MY3A 5E20A 3IC7A 3ECHA 2XGXA 2GIVA 2L4MA 2RKHA 1MPDA 1A40A 5L3GA 1Y3PA 2GWRA 4OINF 3BJAA 5L9SA 2UWMA 1CGPA 2B3FA 3RTWB 4UVBA 3PQJA 3U1OA 2FMYA 3LBSA 1P1OA 1ZREA 4XLPF 3RNNA 3JW4A 3G3GA 1T38A 1A7LA 2QS1A 3ZMZA 3M9AA 5F7VA 1L0OC 3LAJA 5DVJA 1FP2A 4LONB 4RJZA 5EHMA 4YKIA 4OQOA 2DOJA 5FD6A 4MFIA 1B4HA 1BTJA 4EGYA 4EQBA 2OBPA 1DOTA 1A54A 4KMUX 3OOPA 4O3MA 1PUEE 2E1SA 2DWHA 1EZ9A 4XRFA 5DV5A 1Y1ZA 4MHGA 3VODA 3HYIA 3HPIA 2F5EA 3TKYA 2DPDA 3WAEA 1TTYA 3CFZA 3H6TA 4PCQA 1IXCA 1U5TA 4FE8A 4KYSA 2QQ9A 2WKYA 2Y7IA 3B6TA 3N4MA 3VOEA 4RNSA 2RC9A 3ODBA 3HRMA 5FD5A 3IWZA 3MJNA 2RGVA 1C0WA 1U78A 4KCDA 1MZBA 3C3WA 2UVIA 4KYDA 3VVEA 1IAWA 2W85A 3MQ9A 4M73A 1ELJA 4PZJA 1MGTA 2KRFA 1EH3A 1IEJA 2D2WA 1NHAA 3LQRA 3LSTA 3MC2A 5FHMA 2OU2A 3GUDA 4RAZA 2IA0A
chains in the Genus database with same CATH superfamily
3CESA 2V4JC 2D5VA 2KZVA 1JKOC 5E1XA 3LSIA 3W2WA 4YMBA 1AU7A 3HPHA 1YW9A 3EUKL 5F08A 1RKTA 1YITI 5AONA 2GOMA 2IP2A 2B9SA 2DWAA 1SD4A 2RN7A 4D7NA 1FYKA 2JT1A 2OZUA 2ZXIA 2AQEA 4JSOA 4U2RA 5K2YA 3VV5A 3M3KA 1KWHA 2VXDA 5HLGA 5J8FA 2F5VA 3ELKA 3RQIA 1YOVB 3CCRI 3QPTA 1XSDA 3FV2A 4DIGA 5DEQA 2P81A 2IGMA 3MVXA 1SD5A 3JSOA 2V9VA 1LBVA 4OTEA 5LLQA 2HOTA 1JETA 4XEQA 1LE8B 1YE9A 1OLAA 3U72A 2HYJA 3FMSA 2CW7A 4B1RA 2ZKZA 3IRQA 2R9JA 3F8FA 1LGBC 3O9PA 1YTVA 2BGCA 4MGRA 4ELOA 2LC2A 2JRTA 1XDUA 3DKXA 4Y4RA 4ZE8A 1Y1WJ 4UUSB 3J7YJ 1LE8A 4GFBA 3R26A 3TTMA 4UV8A 3M3LA 3GCMA 3NEUA 3GTQJ 3EN3A 1T08B 2P4WA 3P9CA 5HNHA 1MMNA 4UUSA 1ZR4A 2Z9OA 1PDAA 1ZJLA 3EQ1A 1LPQA 2JJKA 5DCFA 1FIPA 1MMSA 3T96B 1JQFA 1JGGA 1TT5B 3GO5A 4XSXF 2F8DA 1O3TA 3H3VK 3IJXB 4QRZA 2RCBA 1F9BA 2B4LA 1Z7ME 4Z7EA 5GPAA 3TCGA 2VOZA 2P0SA 3S9LC 1JT6A 1XD7A 1IN5A 3K4NA 3BLYA 4TV7A 3OS2A 1NNPA 5D8KB 1YCJA 1RYXA 4OVQA 2TDXA 2R71A 1EH6A 2K9QA 4IF4A 4KUMA 2FNPA 5E3MA 2IS4A 1A8FA 2DWJA 1JT0A 3GZ6A 2VOPA 1DGWY 2WY7Q 4PFPA 4PSXA 3FJGA 1WJBA 5LTCA 1KGSA 5AA4A 4GBVA 4LFUA 3RCOA 2X6WA 4KI0E 5DW8A 4NGUA 5K7HA 5F0FA 4H8IA 4O5VA 3DCFA 3I64A 5CMBA 1RPWA 2EV5A 2XGDA 4F3BA 4RAYA 1KZHA 3ERMA 5AA2D 2DPUA 3G4SI 2MC4A 2ADUA 3FIRA 2WBMA 2WWYA 1RKMA 1NK2P 1YI2I 2BV6A 3LSGA 2PMUA 2GHAA 3IK6B 4KT6A 3O2AA 5L3DA 2PLYA 2A69F 1PEBA 2MW8A 1M5EA 2KQZA 2QM3A 4OAZA 4YRVA 2VGQA 4TOZA 3HOXJ 5HOOA 2CZIA 2FYIA 2D5WA 3ZKLA 4U22A 3K4UA 4A3FJ 4KISA 1HW2A 3ZMDA 2LMDA 2I6EA 3VLWA 2NVXJ 4PJMA 3T0YA 5C44J 4OHNA 2ZFWA 2D1VA 1FPGA 1OYIA 3IH2A 3GFJA 2RC8A 3FJ7A 3I6VA 3M3FA 3MZ1A 1JTXA 3FM3A 3NRVA 1R5HA 5HDNA 2HHMA 1OYWA 3I4MJ 1EV7A 3OYJA 2QL3A 5CM6A 1O64A 2AIXA 3DV8A 4QFPA 2ZSIB 3OYGA 2CEYA 4GYIA 2YS9A 2ECCA 1D0XA 2I10A 4IJAA 1O63A 4X8RA 2R7TA 5ED4A 2ME6A 1BR1A 1T0FA 4QLCU 3U21A 1FQFA 5TPAB 1ZLKA 3EHTA 3TQWA 1O7LA 3S32A 4CDGA 1CB6A 3FXOA 1FQDA 4N6DA 1J0RA 4HV6A 3M8UA 1HW1A 4YELA 5TPAA 3MVWA 3MYUA 2KISA 1VTNC 4BLAA 4P55A 1V5GA 2M8EA 2UUZA 1YG2A 4DYCA 1FPDA 3KC0A 2UV1A 3HJEA 5E17F 3Q26A 5IOYA 3RYDA 3OYIA 3O6GA 3HOUJ 4GYGA 3S3NA 4IGTA 2P6TA 2GH9A 4NF5B 3OIOA 1FRPA 1U2WA 2HTSA 1WJAA 1MXVA 3HN0A 2HYGD 2F4OB 2XPUA 1J9IA 3GMEA 5I2NB 1J09A 4KQPA 1URDA 1YXIA 1R5GA 1SD7A 3CMYA 2CZHA 2FXAA 5JEIA 2L5QA 2BHYA 3JREA 4OEUA 1D8JA 5I2NA 3ABTA 2P2AA 3A09A 2KIFA 3HHHA 4BL0B 2QCOA 2X26A 3LSHA 3GZGA 3Q0VA 1IUYA 4ZDLA 4HCWA 1B3EA 5LEKA 1PYVA 2DQLA 2OWTA 3ZQGA 1RYOA 4U7DA 2LKSA 4S04A 4OETA 5GPCA 2X6YA 1R49A 3C2GA 4JSDA 3PNTA 4F3GA 1FBHA 3EF7A 1NKXA 2VQLA 2WA0A 2IEEA 2WY8Q 1OCOH 2OQGA 1MXXA 3OYAA 4AS5A 1Z0XA 2DTRA 3DBHB 1BJZA 1ETOA 3SZGA 2DS9A 1ETVA 2K85A 3W9WA 1TP4A 5LGTA 4X0GA 1M5CA 4OANA 3CCMI 3Q9SA 3TW6A 1B3LA 1J7KA 4V2GA 3PO2J 2RV8A 3I9V2 1PDNC 4NG7A 1G3YA 2ONSA 3AG3H 2VPNA 4WXHA 1NNTA 1WGXA 1HXDA 3I58A 3I5OA 3HGGA 5F1QA 3HZJA 3I54A 2DFFA 2HR3A 4H0EA 1X1BA 3AG1H 4KD5A 5H8QB 2FSWA 5AE4A 3M8EA 3H6VA 3FZVA 1WH5A 4DIQA 5FKKA 3UKGA 4GXOA 5H8QA 2HOEA 5D4RA 5FJ8J 3MKWB 1WH7A 5HS9A 1ZLQA 5L9MA 3KN3A 4ZTJA 3IOWA 4GL0A 1KQ8A 2MLKA 4BUPA 1O7FA 2Z3YA 3KZYA 1G3SA 3OD7A 4AVPA 2HWVA 2JZYA 3PPNA 4PE5B 1RIOH 4IO4A 2V9PA 5CJ9A 4IO6A 3IKVA 5H8NB 1FQCA 3NARA 3OOAA 4GF8A 3V83A 2LP0A 4I7HA 4XR6A 4OFLA 2FBPA 1ZQ3P 1LFBA 3OO6A 1RDYA 3GZ5A 1TT0A 1JGSA 5JI6A 2P1SA 2RINA 5H8NA 2ISYA 3E0JB 3CQZJ 2HXIA 1JNFA 2FA7A 3LUYA 3RUMA 3D5RC 4FCYA 1Y56A 2EBIA 2ME0A 2V3UA 4BKXA 4Y3OA 2FIXA 5B1AH 1NV0A 4PFOA 2XXVA 3LR1A 4JK1X 3BP8A 4JDFA 1XCBA 4L18B 4KYEA 3TDZC 1WRJA 1LFPA 1ZR2A 4ZH4F 1H9TA 4GL8A 4F39A 2R5YB 3K69A 1KYZA 3MZBA 5TGTA 2Q2AA 2KDOA 1JEVA 2M87A 4AWXB 4P5OA 2R5YA 3S1RJ 1REPC 1ZK8A 2M7AA 4MQVA 5DDGA 5J1YA 3ZQLA 1ZMGA 3Q29A 1FBCA 5BUUA 3WTVC 3MQ0A 2R4GA 3FXLA 2HXRA 3UIFA 2VQGA 1KU2A 2VXZA 4NUBA 2Y69H 2ECBA 1TL8A 3DBLB 1MBGA 1JI8A 1B05A 1B6HA 1VFEA 4UNOA 3BG5A 2G7UA 4HEA2 2CFXA 4L17A 4C30A 1VQ5I 1FW0A 4ZYHA 1Z67A 1J75A 4H65A 4I3YA 4HW8A 3VE1B 1MPBA 5BS6A 2JMWA 4CCNA 3OYEA 4G4PA 4LQ5A 2EA2A 5LDZA 2K9LA 4U0VA 4MTDA 2Z2SB 4KNYA 3GTKJ 4IO2A 1VNDA 3RPUA 3DLLF 5M5WJ 1USTA 1Y1VJ 4M9XA 5HLIA 4C2TA 3TAJA 4G8MA 2LD5A 4KMFA 4POXA 3PIOF 2VJ4A 3FK7A 3AKZA 2H6BA 2DWIA 2VL8A 4ANJA 2F6GA 2YU9J 3S93A 2JPCA 4LIUA 2Q8KA 3RLFE 2F3DA 5EEHA 3E6CC 4Q8RA 3IL2A 4KFCA 4XM3A 2JRMA 1W36C 4KYWA 3CDLA 5IT9Z 2LSOA 4HS7A 4Q4ZF 1NTCA 2R7VA 4MIJA 3ZS6A 3TOBA 1M5BA 4BHBA 4N07A 2O5RA 1N0TA 1XVXA 4BDLA 2A07F 3C2HA 2PJPA 2Y31A 3MMYB 4EVIA 2O6AA 1ETKA 5J1RA 4AIJA 5FLXZ 1IV6A 1XMAA 1TXFA 4A3KJ 3T0JA 3DF8A 1R1UA 2IBDA 3HFUA 3G3HA 3IAZA 5FRNA 4GWWA 2LVSA 1B7ZA 1YW8A 2G29A 2ID6A 3JAMK 2Y5LA 2HPIA 2ZNTA 3ZQCA 1RUOA 2DK5A 3KJTA 2O84X 3WTZA 4XKRA 5CYVA 4E7IA 1WVJA 2RQPA 2CV0A 2EFQA 2DLLA 2UVGA 3P7IA 3ZQQA 4Z2YA 1IRGA 4ZJZA 1E3PA 4CSWA 1TC3C 4S0HB 3L2CA 1H44A 2V6CA 2I0CA 1QQIA 2WX9A 1IMCA 3KC1A 1RRJA 1ZKBA 2HXOA 1JEUA 4OENA 3WG9A 1FPQA 2Q0OA 3A4CA 4E7ZA 3BG3A 5LBQA 1FQBA 1UIUA 4P11A 4ELRA 4A0ZA 1H89C 1OVBA 2E5ZA 4RA2A 4RS8A 4CICA 1EJ9A 1ETQA 2HI3A 3ZMSA 1AOYA 5DYHA 3U94A 4Z0IA 5JTYB 2L7ZA 4F29A 4P9KA 4QFKA 1FSHA 1J5YA 2Y9YA 2YUSA 3A1YA 3K01A 1ZHFA 3ECRA 3QYTA 4GIZA 2UXXA 4G6TB 3LAPA 1NV1A 4KJZA 1QJMA 5JTYA 1DBZA 1FBUA 2LY9A 4BDOA 4YIIA 1ZKGA 2O7OA 3FXRA 5LFAA 3W2VA 2GBYA 5FFXA 3CSBA 1T6SA 2XPVA 5B5EC 3ZQFA 2MFZA 4ELQA 5C3EJ 3TQLA 4E7JA 5IYBJ 2A68F 2XHKA 3CCVI 3K4BA 4A3IJ 3KBZA 3K4KA 2PMHA 4OU0A 1O3RA 4ZDPA 1K83J 3S9EA 4WEPA 1W1WE 4FISA 5EYRA 1UHSA 5H6QA 5ILSA 1HKSA 2ZCWA 3FXQA 3F9KA 2E1MB 3FASA 1Q1VA 1BI3A 1NG7A 2WEFA 2O3FA 4ZEBA 3TO9A 1QVSA 2QSHX 4PE3A 1M5FA 2VBWA 4RLQA 3MFKA 4J19A 3HSRA 4II2A 5L9OA 4R6HA 4RAGA 2W84A 3HG9A 4HV5A 2DO7A 3GF2A 4PJ0C 1BIAA 3FHNA 2VI6A 4RAFA 4F2QA 3O8HA 1ZU0A 3JV9A 2ONKE 2KR0A 2XXTA 3BJ6A 4BU2A 5JK4A 2V93A 4N0BA 4N8GA 1A6QA 1EKEA 1K78B 1TQPA 3KIOA 1FBFA 3E79A 3VDFA 1TLHB 2RAEA 3WG7H 1MY0A 2QS2A 4XKCA 4I09A 3E1SA 5FLMJ 1NMUA 2VOOA 4BDQA 1K78A 3CI8A 2CMPA 4HX8A 1SEUA 2IA1A 3GVAA 4NB5A 4I0AA 4HNVA 3C1DA 3F8BA 4C3HJ 1VQNI 4ZEKA 3JAMZ 2KZGA 4NWDA 3FF5A 5HNFA 4UA8A 1J2XA 3T9XB 4KIFA 3HOYJ 1JKPC 2ZNUA 2EQRA 4O6JA 5JLXA 4M3BA 4UVCA 5D6EA 4NHJA 1IMBA 2WYPA 2E36A 3FXJA 4MEVA 4ONYA 5I56B 1FBEA 2WTEA 3FX3A 3PUBA 1XI6A 3A3UA 2GA2A 3PL8A 1FYLA 1QUIA 3SETA 1LVKA 2HXWA 3LA3A 1ODDA 3H0DA 2XXXA 3R60A 4GWYA 4E70A 5I56A 2WV1A 2EIJH 1HOMA 4M1VA 1WSUA 3DEUA 2QFLA 1SAUA 4MFEA 1A55A 4ECFA 3KP7A 3CC7I 4HW0A 1IN7A 2ZJ2A 3H9GA 3PQKA 1XG1A 4HCYA 3VYRB 5CBRA 4X04A 5K5RA 4G12A 4UUVA 4MHFA 2VBXA 2DE3A 4PDHA 2QZ8A 2Y9ZA 4RGXA 3JRHA 2VPLA 2XX8A 3M7GA 1JJ6C 3BQZA 4X1BA 2H4IA 1H0MA 3HRSA 2YLNA 3L6GA 4XTCQ 4DZJA 1R23A 5CI5A 3HUGB 1OPCA 4DI4B 3G1OA 2Y0SN 2HGCA 5E3NA 3FVKA 4BDMA 2QRYA 1CNQA 1WHUA 2HFBA 4G68B 4LB5A 1YX5A 5IYDJ 3HUGA 5K1YA 2UYFA 3LWFA 5ICEA 2CSOA 4HQMA 4HZFA 1SW2A 2VPRA 2JUGA 1MKMA 2RC4A 4HNTA 4G68A 1FOKA 3K70C 1QBJA 2STWA 1II5A 4BY1J 3TDUC 2XRNA 3BT9A 1FSAA 1GVJA 2A6TA 5A5XB 3MVYA 4OVTA 2DMUA 1OJLA 4KITB 4A12A 4KN7X 2HDCA 1ACIA 3CUQB 2E1NA 5BNGA 5A5XA 1B9NA 3ZMVA 4NQ8A 3T1BA 3G71I 1LBWA 3C31A 1BP5A 4EJUA 2VT2A 3CUQA 2VKDA 1QZEA 1AWCA 1TWFJ 5KCMA 4EV0A 1MY2A 1XGMA 4GX6A 5K7FA 1SYIA 3WTXC 1HF0A 2QA4I 2KMUA 5A2QK 4RXLA 3TTNA 1LCTA 4M4GA 3IL1B 4DZPA 1P2FA 2OBGA 3ROJA 1FT9A 5BPIA 4MCOA 1N3XA 2WV0A 4QXDA 4A3MJ 2QSXA 1YW7A 3KN7A 2KKOA 1Q1KA 2W7NA 3SJMA 2K5CA 1KQ9A 5GP9A 1LCFA 3F22A 2VQCA 1P4XA 2XUBA 1KONA 2QKLB 1VR5A 3I5UA 4DYRA 3KEQA 3R0JA 2KT0A 5J6XA 1EZOA 4RPOA 4NBQA 3ZN1A 2BHZA 1N04A 4N8YA 2ZXWH 4UY8I 2LKXA 4A0XA 1ANFA 5E18F 1R1NA 3LFUA 3P9IA 4NEDA 4MEYF 4ESXA 4A69C 1Y1MA 5M3MJ 4HDVA 3RI4A 1X4PA 2GIZA 3LA7A 3EUAA 4ZYEA 1LUJB 3OYMA 3CC2I 2O03A 4YKPA 5KHDA 3S2WA 4IOCF 3I4NJ 1URGA 1ZH5A 4MNPA 2LKPA 3I3LA 3S9NC 1MMGA 4A3BJ 3GW2A 2LAOA 1KA0A 4YAHX 1SANA 4UB8C 1ZG1A 1S29A 5DT6A 1B1HA 1LAGE 2KRCA 3QPLA 2IS1A 1XDSA 2LBFB 4NDLA 2L7MP 1F1ZA 2R0QC 1NV3A 2ESNA 2K3FA 2F34A 3OXNA 2L9NA 4PK4A 5I58B 3CF2A 4IRHA 5DUIA 4A0YA 1B5IA 5JFRA 4BYYA 1SQYA 4GVOA 5EG0B 2LBFA 3LOCA 2XKPA 2P5VA 1FTZA 4EATA 2WAQA 3S2VA 2R93J 1D4NA 3TOAA 1P1QA 1Z91A 2O8XA 3VVFA 5EG0A 3C33A 1OIBA 3PPRA 1Y6IA 3T9VA 4Y33A 4ZDMA 2NVQJ 3BTIA 3V7SA 3GTJJ 1OQGA 1J59A 1X3UA 4ABZA 3HL2A 3EYYA 3M8JA 2X85A 4DDDA 2E60A 1LDDA 3DPTA 4R9GA 4MO7A 2B0LA 1TWHJ 4ELPA 3IWFA 1HQCA 2XSJC 1JW5A 4MFDA 3S1QJ 3C34A 3TCFA 4F3PA 1O7TA 2RQQA 2P7CB 2WYKA 3FVGA 4U1OA 4MX6A 2EB7A 5K5OA 1WI9A 3CFXA 1R22A 4G7ZF 3DBRB 4N4UA 4RB2C 3I71A 2NUVA 4X9TA 3WTUC 3SHFA 3X2QH 1WDNA 3IH3A 3NOHA 2QWWA 2DVCA 3FBIB 5EYFA 1IDZA 4HPQA 2DFEA 2RNJA 4MQ9F 3GTOJ 5LD2C 4FX4A 1YJWI 3Q0WA 4P8BA 3B6CA 5A2QZ 3PMWA 3OO7A 5B7DA 3CZ6A 1R5ID 3LNQA 3ILTB 2QPQA 2FNCA 2DYSH 2IGKA 2K86A 3CLQA 5H6RA 3ZCOA 1N3WA 2CRGA 3COAC 3EHUA 2Z16A 2ZJRF 3J7AO 1XC1A 4NTLA 2EINH 4IHXA 2QYOA 4XLEA 5AIQA 1R71A 2X6OA 4HTGA 3KE2A 4Y52J 3CCEI 3SEQA 1XOCA 1LDKB 1QGPA 5CVIA 1GV5A 4CCKA 3JRIA 1G6NA 1IW7F 3FDYA 3V7CA 4LVQA 2Q89A 3OSRA 2XXRA 1FOWA 3FWEA 3QWLA 4FASD 3D4GA 4HRIA 1B46A 4BAYA 2LTPA 4XN3A 3HTSB 1YRNB 1I1SA 2AL4A 1A8EA 3ABLH 5HODA 2W4SA 3A02A 3HSFA 2DYRH 3WU1B 1GV2A 2DT7B 1IITA 4NF4B 3V8LA 2DBBA 1GVDA 5LHHA 2Z1DA 1YRNA 3ERED 4N4OB 2EZHA 4PF8A 3V89B 1FPKA 1ATGA 1MY1A 1WQ2A 2ZYMA 3VFJA 2NAZA 4HF0A 1X3ZB 2FOWA 3RPUD 1I6AA 2HOSA 1SW1A 4B43A 4NF4A 3BTLA 3QAXA 1UG0A 3QOPA 2E2IJ 3IUOA 1SI1A 2Y2ZA 4JVIA 3T66A 2CQ7A 3IHUA 2VODA 2UYEA 3FXBA 1FWZA 4UXNA 1USYH 4KHZE 2JA6J 3RTRA 3TL4X 3VVDA 3PUFA 4CGZA 3B8BA 2OCCH 3J80K 3L2WA 3EHSA 4G9YA 1IO2A 1DGRM 2M3AA 3OY9A 5M2VA 2XXKA 4A3DJ 1IRZA 3FUZA 1FJLA 2IS6A 2PCRA 5CBSA 3E78A 5DEXB 2W25A 3K4JA 2CH0A 2KIQA 3G3ZA 1N7WA 3H3GA 3R6SA 2X6XA 3EDPA 1Z3XA 3RQ4A 1UAAA 1BK4A 4D7MA 5DEXA 4NNJA 5LEJA 2UVJA 4MLVA 3BR0A 3ZKKA 3RKWA 4V19K 5ICQA 1WWXA 2Q9TA 2OWSA 2X1DA 2OTJI 4M3FA 2F48A 2L02A 4AVZA 3RJPA 4EGZA 4A3EJ 2HTJA 1K9YA 2LFBA 1D1AA 4TLLB 2LF8A 2Y48A 1Y0UA 1G0IA 4ISUA 4I98B 1ON1A 4LK0F 4Q30B 1S9HA 1XS9A 3CP8A 2BY1A 1PP8F 2QUFA 5DUKA 2AS5F 3QYEA 4GFRA 3U65A 3PO3J 5M3FJ 3JZJA 3RKXA 4L0ZB 4XKVA 2DVZA 3FISA 4D9JA 1ITYA 1MM7A 5CVVA 2LLKA 5BOXA 2I3WA 3TTRA 1TWCJ 2V26A 1GHCA 4N6PA 4PP0A 3CRBA 1BW6A 1ZGJA 2FBHA 1B6AA 1R6ZA 5LOMA 3CVGA 1S5LC 3LSFB 4BJTA 4BQNA 3O6BB 4O94A 4PAKA 5FROA 4EQQA 1RESA 2HQ5A 4LN5A 2OA4A 2P5KA 3KEOA 1GDTA 1UTHB 4TQUQ 4LLGF 1JW1A 1SVXB 4FIMA 2E2HJ 4NQWB 3AL0C 1X1DA 1LEAA 4ENJA 2E0SA 2PBIA 4XRSG 2GXBA 2CUJA 2VJIA 1B32A 4S05A 4P47A 4AC0A 1UTBB 5F27A 4DYQA 3OL4A 4NQWA 5E3OA 4ND9A 2L9SA 2F2EA 1YAEA 3FD3A 2UZKA 2E19A 1SVLA 2X51A 5CMKA 1Y4CA 2D3IA 2ZXHA 1Q1HA 4L9VA 1NV2A 1MDP1 2J5OA 5JHFA 3HC7A 4BQQA 4LOCA 4ENKA 5HBCA 3P9KA 1VQ6I 3Q5FA 1LBBA 4GX3A 5GTHC 2F5CA 2BW3B 1IXGA 1FZPB 2NVYJ 4ESFA 2A5TB 4EJOA 3DXJF 1DMBA 1FQAA 1I69A 3G3JA 4XIGQ 2BW3A 3K2AA 4ON0A 2XWVA 1MJ9A 2QMXA 1BN5A 1EYJA 4GQOA 2ICWG 4YB6A 2A5TA 2IS2A 3J80Z 2XVCA 3DU6A 2F4IA 3VYUB 4OMYA 3K10A 3BDDA 4Y15A 1OMIA 2KFDA 1NV6A 1OQHA 2O1MA 2X4HA 2DXRA 2ZYNA 4KT5C 1SD6A 2IGOA 1P4AA 2P8TA 3BJOA 3JCUC 4L0YB 4RM3A 1FPLA 4N4NB 1G3TA 1XN7A 3HPGA 4UVAA 5E79C 4C2MJ 5ET7A 5EYHA 2K3PA 3T9UA 1T0KA 4LMYA 3OL3A 1IDYA 4HLXA 1DU6A 1B9JA 4JWYA 4E7SA 4N81A 4XF5A 1K6OA 1JXSA 4OOIA 2V79A 3ZMUA 2QSFX 4F91B 1I6BA 2PX9A 3CO7C 2DDKA 2JN6A 3DTIA 3O2PE 3PSIA 3G3IA 4OVRA 2IXSA 2PQ8A 5AA3A 4ZS9A 2IVMA 3H6WA 4BHPA 2MBFA 4O3CA 2DXYA 4KIBA 3TBIA 2O7UA 4MMPA 2LF7A 3Q0UA 2ZNYA 1B58A 2LREA 3MEXA 1WVRA 3UNGC 1ON2A 1SMYF 3AAFA 3K6UA 4PJJA 2HU9A 4KA4A 3MZHA 3S1MJ 3KEYA 3LSKA 4I40A 4I76A 1NUYA 3C9HA 3OMBA 2A5YB 1JP4A 1TNSA 2F4MB 1ZARA 2FUG2 2QQBA 5JR3A 4D1QA 3RT8A 4XSZF 3A01B 2Y7RA 2LY1A 4FE7A 1JUSA 2PFZA 2XXIA 1U6GA 4GDFA 3NWTA 2H99A 4XKPA 3KP5A 2V1DA 3A01A 1U5TC 5DM7F 1HLVA 4PJLA 1KU9A 3JRCA 3EUHA 1T56A 1N77A 1VE4A 2FQ3A 3LSXA 3QMFA 5D5VB 2QQAA 5EQ7A 1F9NA 4IGRA 2R92J 4NF5A 3CMEI 2F3BA 2QEXI 3C35A 2WAFA 1YLFA 1AKHB 2XKOA 1DP3A 4CYCB 1DSNA 4QHQA 3QXMA 1M5DA 3FK6A 2H94A 1K61A 4EUOA 2W57A 3DP7A 4U88A 4DOZA 2FIEA 4M71A 3KN8A 1AKHA 2K4BA 4R6YA 5HM4B 5EEGA 1S7OA 2VQHA 3H36A 4CYCA 3PFIA 4E7LA 1MQIA 3C32A 3PUWE 2QVUA 2I5UA 5D6FA 2H27A 3BQYA 2K4JA 4JYKA 5IP7J 5IZZA 4OIOF 1VQ7I 3L09A 2Y5KA 3KEIA 3TP0A 3V4GA 5FTIA 1B59A 2ZSHB 3FXUA 4ZYAA 3J81K 1D5VA 2DN0A 1R00A 1FTOA 4DZ1A 4QIWN 2H6CA 3T8TA 3F23A 2IRFG 3D1RA 2MH2A 3OOUA 3K2DA 4CCMA 4XL9A 4L5JA 1HSEA 2ZXTA 2QQ8A 3TW7A 3OYDA 4DQ2A 4HAMA 4XRSA 2B4MA 1SW4A 3BG7A 4HBLA 4Y13A 2G0EA 5ICFA 5L3CA 9ANTA 1DPPA 3V5AA 4ZE9A 2XIGA 1T39A 2FE3A 4P1LA 2M45A 1BM9A 4FQGA 5FKNA 3GTGJ 1B1XA 2CZLA 3MP1A 3RQTA 4L5EA 4I8CA 3PPPA 1CQTA 1IG7A 3KX2A 1R9LA 4I1DA 3H5RA 3WHBA 3WTYC 1TT1A 1H45A 3BOQA 3IP4B 1PP7U 1YIOA 4LB6B 3HHFA 4P3LA 1FMWA 4CCOA 1JJ8C 2R7UA 3H06B 3S15J 1FOXA 1Z7NE 3BR2A 4JP0A 3KOTA 5EHSA 3OEKA 5FLVA 3C18A 2DW4A 1TQIA 4XLAA 1S9TA 3OR2C 2OC6A 1IMAA 2W24A 3JSPA 1NL5A 4CA0A 1V54H 4LUBA 3VXBA 1FTLA 5E3LA 1VI0A 3LFKA 1PUFB 1LBCA 4EEFG 3FMRA 1DCUA 1LSTA 4JX4A 4AB6A 1DUXC 4ETSA 2L9RA 4D5FA 1QKBA 1WKMA 4X1DA 1MDMB 3KPHA 4EJWA 5I5PA 4LITA 1PUFA 1DQUA 2QKMB 1AHDP 4A3LJ 3TDJA 2DQVA 3Q28A 3CP2A 4WEDA 3PUZE 4A6DA 2ELHA 1MQJA 1RC9A 2R7OA 2QBYB 1MDMA 5F1RA 1IJWC 5EQ8A 2V3QA 2ID3A 3ZSFA 3F8NA 2Q8MA 4I02A 5HLHA 1NK3P 3KOSA 5GAGJ 5BQTA 1ONVA 1SC7A 2PMZA 4YFXF 2QBYA 4RLFA 2A6HF 2CG4A 2HZDA 1GXQA 4UV9A 3QIMA 4JWXA 3ML6A 4BDYA 2V84A 3H35A 2PVUA 1B52A 3H3ZA 1FPIA 2HCAA 2PYYA 1UMQA 4ZEIA 3G7WA 1B8IB 1X3WB 3TUSA 2BXYA 2DMPA 4U7BA 3BZKA 5LRSA 1K9ZA 1IUFA 2BZTA 3LC8A 2VD2A 3TODA 3V8KA 1FTKA 2PX1A 5KAFC 1IRXA 4G8HA 1B8IA 1OYYA 2EIMH 3E6BA 4RB3C 3D1NI 4NC7A 2NS8A 4QSHA 1QVUA 2O68A 4GWSA 1YYVA 2I48A 4C1UA 1WI3A 2MKZA 3LV0A 1O4XA 3OS1A 3TEPA 1TFDA 4PETA 4F1YA 1FPEA 2WAQN 2XAUA 3CG1A 2HDWA 3W15C 3J7ZI 3J81Z 1NV7A 2NS0A 5EEAA 4KR5A 5H8HB 2NNYA 3S3MA 5K5QA 1TW2A 3N6UA 3QUJA 1S3JA 4ESWA 2FRHA 1MG1A 1P7JA 5CRYA 5I3SA 3ABMH 1B7UA 4IEJA 5H8HA 2OF7A 2W82A 4J00A 2XXYA 3PUXE 4IR8A 1A6IA 4PBQA 3CO6C 1ZG5A 1EA3A 3KFMA 1OCZH 4ENMA 4HSTA 2FBIA 2LG4A 3RZDJ 4X1EA 3MWMA 3NAUA 2ZMEB 2RC7A 3CDHA 1MPCA 1LNWA 3WODF 3L2QA 1BC7C 3IOTA 3CCJI 1UELB 4IPAA 3QYBA 4MEXF 2WBDA 2M4KA 4FHTA 1T0FC 1YYZA 2MABA 3TMGA 4WF2A 1AH5A 5I59B 2Q8JA 1LVAA 2NOGA 3B6AA 1SI0A 1SBPA 4HE0A 1UFMA 2H25A 5B1BH 2FF4A 3HKZN 1WCMJ 4YFKF 2ACJA 5GAHJ 5I59A 1VFDA 5FO5A 3OYHA 2KQRA 5LGNA 4ZC3A 3ISPA 3L6HA 4OFJA 2OCEA 1BOBA 3H4ZA 4LJZF 5J8CA 1FBQA 3QYFA 4EMSA 2JQ7A 2YJPA 2QSGX 3H92A 3I53A 4L9TA 5E1ZB 4E4HA 1W4MA 2Y0MA 1F5TA 3EUHC 4J01A 4F19A 3U93A 2CQXA 1LJ9A 2JSPA 4XLHA 5KK1A 2L54A 1YJ9I 1LBXA 4NX1A 3GBBA 5L3BA 1E0EA 3ONMA 3KP2A 2EV6A 1S7YA 4FBPA 2OWZA 1R1TA 2YPRA 2OUMA 3E5XA 4MNUA 1XVYA 4BHCA 1VQPI 5HDKA 3ZGKA 4G8NA 1DPEA 1MS7A 1QNTA 2Z99A 1ZLJA 2BY2A 3E3KA 1HW5A 1JHHA 2HZTA 2OD5A 2GZWA 3M1CA 3KYDB 2EWNA 4ZYDA 3IOVA 4JBZA 2XAHA 2KIMA 1D0ZA 4HNUA 4MLOA 4G8XA 1ZG3A 2OTLI 1FTTA 3D0SA 1LBZA 2DP8A 4GLIA 1VQKI 3SFIA 1QKAA 1FQEA 1SVMA 1N78A 1BOAA 1XMKA 5E1WA 3TFLA 4HF2A 1BI2A 1I6XA 2IT0A 3O29A 3PNYA 4XRMA 3I4PA 2P5LC 1KZ8A 2TRTA 3WGHA 4M6YA 2K9NA 2CGPA 2O6GE 1GR2A 2HAUA 3RKYA 3QODA 2VPOA 2KLOA 3O28A 3PV0E 4N15A 4GX4A 1MXUA 4GOTA 1B3GA 4A6EA 2R8TA 4LQ2A 1ZYRF 1S72I 1I5ZA 3HRUA 2DXIA 3VXCA 1M1EB 2ABHA 2PN6A 3A03A 2JA2A 2V6EA 4OYVA 2F5DA 1MY4A 1I1GA 2HEUA 1Y39A 4FATA 4I01A 4KICA 4PUSA 4IO9F 2E7XA 3ONQA 3GTMJ 2GRVA 2PFYA 3E6DA 2DI3A 1N25A 3U92A 2HZLA 1F4KA 1OLCA 4LG3A 1LAXA 3PSFA 3BROA 1FNNA 3MCZA 5CVJA 2F36A 3KJ7A 2L4AA 2B63J 4MLQA 4U4XA 4F3SA 2HKXA 4BDZA 2NXOA 1A04A 1QZYA 3GYHX 2Q2EB 1KU7A 2XWKA 3MPLA 4QFNA 3RN8A 3ZQIA 4F1VA 4M3DA 3WTSC 2RCAA 3SDGA 3ZPLA 3SYTA 4BS9A 5FKMA 1DTGA 1LB8A 3SEWA 2EIKH 2Q2EA 2VKEA 2F78A 1GXPA 1A31A 1B0HA 5CMMA 1Y3QA 2VC1A 2EH3A 3CHGA 1ZRFA 4YB7A 4YKJA 4LLNA 2ZFUA 4B4CA 1X4OA 1XT8A 1OFCX 4YU0A 2R7FA 3GYYA 3BKIB 3KSJA 3MKLA 1KU3A 2EZIA 1GT0C 2A6EF 5AIPA 1FBSA 3VSLA 2M4GA 1QGXA 1Z05A 2QENA 1FBPA 3S3OA 3ECOA 3QRFF 4I99C 4G77A 2VJ5A 4AD9A 1G4DA 2L7FP 3JR9A 2M34A 4F92B 5ICGA 2W7YA 1LQ1A 2BJJX 2NOOA 2R7ZJ 3RIRA 3T8RA 3GFMA 2DA5A 1IF1A 4PDDA 2VIXA 1OLTA 2F5FA 2Y75A 3Q27A 1MJAA 2OAZA 5DTDA 4IQJA 2XX9A 2THIA 5ILUA 5EYGA 4AB5A 2VLAA 1BI1A 3IRRA 3TP3A 2F97A 4PSWA 4B47A 1A36A 3DLNA 5DCMB 2IW5A 4MF3A 4XQFA 2STTA 2E2JJ 1IUDA 2FVZA 5LRRA 4IKFA 1HA8A 4NHBA 3KP3A 1T98A 2M8GX 2CQKA 5DCMA 5J4YA 1HKTA 1MM6A 2Z23A 1Z1DA 1I3QJ 1G59A 4QPOA 4EJVA 1B72B 2F6CA 5KCJB 1IC8A 3KBRA 3OWTA 4RM2A 5D5XB 1IXSB 4OFOA 4M6XA 1DPUA 3E13X 1OR7A 3FMQA 3RYRA 1B72A 2GHBA 2AQFA 2X7QA 4LATA 5KCJA 2IAIA 1NUWA 3Q9VA 3FM5A 1POY1 4NF6B 2NNNA 5CC2A 2BY3A 2ELKA 2XXPA 4CYDA 2QVOA 1RDZA 4N9HA 4PFUA 4I2OA 5IP9J 5J47A 3QK6A 4G94A 4H6DA 1VQ8I 1NFTA 2I3VA 2BY0A 4NF6A 5FKLA 3EQLF 3L00A 1FBDA 1BIBA 1G2HA 2IPQX 3E3VA 3ZXSA 2E71A 2K9SA 4BH9A 4QPQA 5ICCA 3SXYA 5IPAA 2R6GE 3CLOA 4JB7A 4PFBA 1HSLA 4DLDA 3D5LA 3SDBA 2RKMA 1Z6TA 4PJNA 5TRDA 1DPRA 2DA6A 2OPTA 3OSGA 2EFNA 2DA3A 4YZZA 2DE4A 4CCJA 3OYLA 4FE4A 1BC8C 1U9OA 3DPUA 3E9XA 1NUXA 1YS7A 2ZXJA 2XD2A 4OERA 3BZ6A 4YB5A 3KLNA 4HA8A 1RR8C 4DI3D 4F31B 3KSXA 4LD5A 2DOEA 1SFKA 4XKBA 3K1NA 4EQ7A 4KIGA 2QS3A 2M9HA 4C0RA 5LHGA 2JUCA 1YFHA 1B3FA 2WB1A 4EDPA 4CZCA 3Q25A 3IV5A 1MXWA 3W6JB 4LP2B 5ET5A 4OVSA 1FTJA 3DP8A 3RYPA 1R7JA 5E8GA 3FVOA 3CJRB 1OQYA 3WTTC 4IHYA 1B5JA 1YTYA 4Q48A 4IO3A 2L2OA 3E7LA 1O3QA 4OXVA 3LSPA 2NOJB 2KDZA 3C7JA 5FKOA 5TJJA 1L5TA 5FTHA 4Z6YA 1BIYA 4XLNF 1TWYA 4P1EA 1YHQI 2WC2A 5IZ1A 4DBQA 3SEXA 1I6QA 2ZC2A 3BFUA 3CJNA 2HVSA 3RSNA 1ZN2A 3TZAA 2GXGA 2EJRA 4G61A 1QPMA 2VKVA 1YO5C 2AYSA 3PMVA 2JPBA 4PFTA 3SKPA 2PBWA 4XOPA 1SFOJ 3I3VA 3PU5A 2V4CA 4BE1A 3HB9A 1DU0A 1Z3YA 3N5LA 5DVFA 1B1BA 1V5FA 1LLSA 2V1XA 4PGGA 2Y7KA 3ABKH 3E5QA 3BCAA 2YX7A 3MW0A 3QPHA 4DJAA 2CQQA 5DD4A 3OYBA 1FIAA 4E7KA 4PQJA 2CYYA 3O66A 2XROA 3FIWA 1BL0A 4QSCA 3HEFA 3GFLA 1MJBA 4LZ8A 3H0GJ 2CU7A 3O8GA 2LH9A 1CE2A 4LA9A 2FNAA 5I7IA 3F21A 2XGCA 4B8XA 1U3EM 1B40A 3CJTB 3C4MA 3M07A 5TU0A 1GVCA 4A3GJ 1A99A 4CZZA 2AHQA 2MLGA 2COMA 1IRFA 2E34A 2X48A 4HF1A 2L3DA 4IO7A 3TTLA 2HFHA 1Y9UA 3GLXA 3FBPA 5H8FB 1RDXA 3RY3A 5IZ3B 2D1HA 5FB2A 1H8AC 3IO6A 3L7WA 1O3SA 2V7FA 1U9NA 1R9QA 4XONA 5F1JA 1DP7P 2XAQA 2W1OA 3BCBA 2B65A 5H8FA 5IZ3A 3E5UA 1WJFA 3GXOA 5KDTB 2BE5F 2HKOA 1WFXA 3LSJA 1KQ0A 3MAJA 4IB2A 3VDXA 2E1MC 2K02A 3VLUA 1QU3A 3PJRA 1SW5A 4A2UA 1AMFA 2X7PA 2A05A 3CJQB 3IB0A 1POTA 2ZNZA 4NN3A 3O3KA 4OMBA 2FJ1A 5DTBA 5T3JA 4ZEDA 1MH4A 4EXLA 1K6YA 4WK8F 3KFWX 4XFEA 1S6LA 3GEZA 2AL5A 3F0CA 4JOMA 1X2MA 2LDUA 1HSJA 1OISA 2FU4A 4G6DA 4IXAA 2MC3A 3I56I 4JX6A 3JRAA 1VFCA 2HPMA 1BI0A 3HRTA 3H03A 1QO0D 4XKNA 2DTZA 4DGWB 5JVTA 1LAHE 2VP1A 2NXNB 5KNLA 3EETA 2GXAA 3A2KA 1PB9A 2M0CA 4N9IA 4YFNF 3TQNA 3MZYA 1MNEA 5ERIA 1FTAA 2DJIA 4R72A 4ZZLA 3LSWA 5HDGA 4MH5A 4ASNA 3S4UA 1TBXA 2CW8A 5B66C 1RR7A 4ZDOA 3K2ZA 2UXNA 2XPWA 3N94A 2ZJPF 4BJ5C 5CVUA 4R8HA 4HSRA 3VFZA 4PBHA 1FJ6A 3DTEA 1QHHD 1G0HA 2H1LA 3H5NA 2VE8A 3BTCA 2VB6A 3GXAA 2KHMA 5ITOA 2HQNA 4GO1A 1X1AA 3L2RA 2HEOA 1P4WA 4C3IJ 2H8RA 1D0YA 2AXLA 1NH3A 1JHFA 2BOLA 3FJMA 2CZKA 2ZB9A 2Q74A 3O6HA 5J40A 1FCKA 1K4SA 2O1LA 1BBYA 4PFIA 1FPJA 3SZPA 1R36A 5H8SA 4YMAA 1A35A 3A3CA 3MP8A 4Y17A 3KETA 4UHTA 4R2FA 2DFIA 3CCUI 4IO5A 4GBWA 2OCUA 1B3HA 1MSEC 1SDXA 3MPKA 4OIRF 2M1BA 5M5XJ 4F55A 5ITPA 1N76A 4X6AJ 2NVUB 2MD5A 2FMLA 3I59B 4LG0B 2NRAC 1MRPA 2XXUA 3DPLC 1W7PD 4RY1A 1I50J 3EKIA 2JTVA 3DKWA 4FTHA 1MW7A 2EK5A 3HBLA 2XF5A 3I59A 4LG0A 1K4TA 1ERDA 4LLLA 3SZTA 5BMZA 3QU3A 4KXPA 1RKWA 4II3A 5EGOB 4OIPF 3F11A 3DWLE 3BZCA 2DK8A 2Y7WA 1VSOA 3IX1A 3S8PA 2H1KA 4R75A 1U5TB 3F72A 1U0JA 5I57B 2XD3A 4FORA 3IKTA 1KA1A 2OJTA 3DP6A 1X1PA 4G68C 1CF7B 2CV2A 3IAM2 2B7EA 5I57A 2ZMBA 4M72A 2BBYA 3OIQA 2IA4A 4PTKA 1CF7A 3R61A 2H9BA 1FJ9A 4I0BA 4XLFA 2Z8EA 4O7IA 2R7RA 4UACA 3PUYE 2ESHA 5EF6A 5IY5H 1EYIA 4AQ4A 4XXUA 3CUQC 2MGQA 3DLAA 4A93J 5IOZA 4M6VA 2VASA 4IHTA 1EH8A 2CO5A 2H98A 2XWOA 5ET8A 5B70A 2COBA 2XDVA 1OMPA 4H46A 3UGWA 4QSEA 4MBPA 3KLOA 4BY7J 4EM2A 1USYE 4OEVA 1TZLA 2E35A 4IY6A 1QA6A 3MSTA 5LGUA 5KVRA 4FJPA 1VQMI 3K4LA 4POWA 1ETXA 4B09A 2VHAA 2MD0A 3KP6A 5H20A 3HCQA 4GRKA 4I9DA 1VZ0A 3KCCA 3BR6A 4HE2A 2DOFA 1NNKA 4EM0B 2GA1A 1G3WA 3J7AY 3CSGA 3VEPA 5C4JJ 1GV8A 3RTFB 1YIJI 1JUMA 3WGIA 2OLBA 2EV0A 2XB0X 5F24A 3R7XA 4RGUA 4EF1A 4H0WA 4GGGA 3JRGA 3U8QA 5J3LA 2P3NA 4R73A 2OZZA 1US5A 1STZA 4XICA 4XORA 3LL7A 4AU7A 4XBFA 3OV8A 2QMWA 1UZCA 1IIWA 2NVTJ 1NI9A 4OA4A 5ESYA 2MSYA 2JSCA 2XX7A 3THIA 2C6YA 1IV8A 3BFTA 4ZECA 4XK4A 4HLYA 2A61A 1QPIA 1P6RA 1R4NB 3B73A 1K7AA 1W5TA 3BG9A 4P96A 3S1NJ 2DSFA 2ZYKA 2LNBA 2L0KA 2YR2A 3AG4H 1UTHA 4GWXA 5AA1A 3L9FA 1B7HA 2CFOA 1ETYA 3R4KA 2F5XA 2DA7A 1YZ0A 2W00A 2Y30A 4R74A 3C36A 3TELA 2CUEA 2DDAA 1UTBA 4G7OF 5FGMA 4U4SA 3TCHA 4KDPA 3UP9A 2ELJA 2E1CA 1ZGWA 2J5PA 4AIDA 2HQ0A 3M1EA 5GAEJ 1L3LA 3Q3SA 2REGA 2RF1A 1EH7A 4B44A 1QHGA 2MA3A 1UQWA 2K9MA 3CG3A 4JXIA 3ZQHA 4DXUA 4E0WA 3K9TA 3BIHA 2XF7A 4KCCA 4HX7A 4RBOA 2Q1ZB 3LSLA 2DODA 5ILVA 3OO9A 5JLWA 3EPEA 1X2NA 1LDJA 3ZOBA 4EJTA 4BBSJ 1YPNA 1S8NA 1R6RA 5F64A 4F18A 4O3BA 2BVLA 3QP5A 5GADJ 4WKMA 4F1UA 2LRDA 1APLC 4WCGA 1MQHA 4HX4A 4IL6C 2DYXA 4WX9A 4MAGA 3FV1A 3N97A 5BWJA 2ZYOA 5CQEA 3AXFA 1UHWA 2Y0SA 2ZBKA 2L01A 4QSDA 3TTKA 4IRIA 2CV1A 4RK9A 1R58A 4XKWA 4BQAA 4E0XA 3S2DJ 2WBBA 2PG4A 1OCTC 3QUFA 2ZJQF 1OCRH 1XMXA 5HS8A 4IVNA 4IHWA 4Q5SF 2XHDA 4R9FA 1H43A 3CMAI 4D0PA 4B3AA 1P1WA 2CMOA 3P7NA 3RZOJ 4OESA 4N6KA 2ZO4A 2D45A 1F36A 3R0AA 4CUGA 3V7RA 2XXQA 4FETA 2XAGA 3DQVC 2P3VA 1PBPA 3SEUA 4I6ZA 2H09A 1MIJA 5F0HA 3OYNA 4HDUA 5DYMA 1TWGJ 1T95A 3H9JA 3M8FA 4ZZEA 1E3HA 3CUOA 4BE0A 2F7AA 5ET6A 5EDNA 3VLVA 2VN2A 3ESWB 5CLSA 1HC8A 2G7HA 3F3XA 1H88C 4N91A 3E6MA 3H1CA 4WXDA 4IX7A 3V8XB 3GLLA 4C2UA 1MMAA 1MDQA 1D3YA 4H5FA 5HLTA 3G1LA 3W9VA 2XGEA 2D21A 4FEBA 3HOTA 4ZEFA 3ASOH 3HHGA 2V25A 5J4VA 4HYEA 4PGHA 2NWJA 2EPFA 4MNCA 4FAJA 1IXHA 3U2RA 1Z7UA 4C3JJ 4LZ5A 2GLOA 1MNDA 3CCSI 4H1XA 2YPNA 3IH4A 1B0LA 1PC3A 1MBJA 2Y84A 2F7CA 4RK2A 2XA5A 3UORA 3BTJA 3OELA 2UVHA 4FT8A 3EYIA 1EF4A 2F7BA 3REOA 1UCRA 3CIJA 4K3FA 3T22A 1LKXA 1SAXA 3OYCA 2BJIA 3DM0A 5IKBA 2BVMA 1UIVA 2GOXB 1Q9DA 3SESA 2ZZVA 4F22A 3DU5A 5DS9A 4UABA 4G7HF 2B3BA 4QWQA 3TGNA 4ESBA 4UUTA 1MQDA 3PM1A 4PGNA 2Z8DA 5FHNA 5DVIA 2JVHA 3V42A 2DDBA 3D5SC 3K6WA 1LB2A 2X0LA 3ZR8X 1NH7A 1XHYA 2RNGA 4R79A 1E3OC 2AXTC 3IAS2 1BLFA 2HQAA 3ZP5A 2DCEA 1ORKA 4RB0A 3I55I 1EYKA 4LK1F 3DELB 3L2UA 2O51A 4N13A 4EF2A 2KPMA 4GXSB 5L8DA 5I58A 3CMMA 4A5MA 2IEKA 1S50A 1HSTA 1ZAOA 3CDIA 1HBXG 4DXCA 2Z5UA 3CCYA 3GLBA 4PF6A 2M5WA 1USSA 4U87A 4IHSA 2P7VB 1WJ5A 3KZZA 3QAHA 4FEDA 3UN6A 2MYSA 1POGA 1RNLA 3BWGA 5CVRA 5F6FA 4ZZDA 3MAMA 3K1MA 2PI0A 3VB2A 3F8CA 4F93B 4BEHB 3RPQA 4NMYA 1LFUP 1T8IA 4H4KC 2DQRA 2I4CA 5LHIA 1PB7A 3PD8A 1OCCH 2WB1N 3LA2A 4BEHA 4QFLA 3T9HB 1ZGAA 2RDPA 1JVXA 1GTKA 4YIRX 2VE9A 5EJCA 6PAXA 4OWDA 2L5VA 4OVPA 3QQAA 2PEXA 3KG2A 1SPIA 4L9JA 4ESJA 5IT9K 5ISUA 2E1OA 2EFPA 1D9YA 3SERA 2GAUA 4PGPA 1XGNA 2XRLA 2LYCA 3QOEA 3LSRA 3SQNA 2GFEA 3UK4A 3OMYA 3B50A 1V55H 5FLXK 2F35A 1XC5A 2FEZA 1IN6A 1IN8A 3U1DA 1RUNA 4Q5TA 5HPQA 1D3KA 4M3EA 3K6XA 3ASNH 4V2FA 1ZTYA 5F0CA 1TNTA 1DK4A 2PT2A 4JVCA 2M7BA 3HSEA 3M4OJ 2Y7PA 1U8RA 1LEVA 3BR5A 1YJNI 4YKKA 5A5LA 5IYCJ 1FTMA 2JA5J 2PT1A 4AIHA 2BEOA 1FLIA 4XMYA 2GM4A 3GTPJ 1Y20A 1I3AA 1P1UA 1H9GA 2VJJA 2OX3A 3N05A 3L1PA 3E4RA 4FX0A 2EA4A 1MQGA 1QUKA 1P92A 2EILH 2DMQA 1US4A 2I0BA 1B5HA 4CCLA 4PFYA 1W7PB 2OV7A 2XF6A 4CXFA 3KGCA 4H67A 3KZIC 1LAFE 4L9NA 1NH8A 1JKQC 4XLCA 3DP4A 3JYRA 3SEVA 1XX5A 1VQ9I 3MZ9A 1X1CA 1QRYA 4G2ZA 1W7PA 1XCVA 2DAOA 2HPGA 3MVZA 2BYVE 1VQ4I 3ILUB 2G9WA 1MXYA 3LQQA