3FXQA

Crystal structure of the lysr-type transcriptional regulator tsar
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
296
structure length
296
Chain Sequence
b'MLKLQTLQALICIEEVGSLRAAAQLLHLSQPALSAAIQQLEDELKAPLLVRTKRGVSLTSFGQAFMKHARLIVTESRRAQEEIGQLRGRWEGHITFAASPAIALAALPLALASFAREFPDVTVNVRDGMYPAVSPQLRDGTLDFALTAAHKHDIDTDLEAQPLYVSDVVIVGQRQHPMANATRLAELQECRWAFSSAPRGPGAIIRNAFARYGLPEPKLGLVCESFLALPGVVAHSDLLTTMPRTLYERNAFKDQLCSIPLQDALPNPTIYVLRRHDLPVTPAAAGLIRWIQHHAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LysR type regulator of tsaMBCD
publication title Structural studies on the full-length LysR-type regulator TsaR from Comamonas testosteroni T-2 reveal a novel open conformation of the tetrameric LTTR fold
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Transcription regulator
total genus 95
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fxqA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxqA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxqA03
3IOVA 2UZKA 3TDJA 1Y3PA 5AIQA 1B5HA 4UVAA 4A6DA 3RPQA 4HAMA 4G68A 1BC7C 1KQ8A 4KDPA 3H6UA 5HS8A 1BLFA 1B1XA 1YLFA 4N13A 4NWCA 3HRSA 1OPCA 3KEQA 2VHAA 4LG0A 3U94A 2VP1A 5A2QK 4I62A 1WDNA 4NEDA 5FB2A 4NF5A 3U8QA 1GR2A 2IA1A 4X1BA 4IF4A 4H5GA 2W57A 4DE8A 1FC3A 3P9KA 4EJOA 2FA5A 3SZTA 3ULQB 4Q8RA 1D5VA 2J5PA 1VFDA 3KZYA 3EHSA 3FV1A 4QFPA 3TFLA 1U3EM 3FVGA 2F97A 5L9MA 4G8XA 2XAQA 3B7DA 3MVYA 2QENA 5I2NB 3CSGA 3HSEA 4AIHA 2XX8A 4ETSA 4UACA 4ZYDA 1USYE 1URGA 3G3GA 1WSUA 2O68A 4OHNA 2F34A 1R23A 2NNYA 1FSEA 2VOZA 1ZRCA 3ILTB 3HTSB 2VBWA 1YTVA 3CUOA 3WGIA 4PQJA 2ELHA 3GZGA 1ELJA 3H03A 2DO7A 3LC8A 4C1UA 1NH7A 4O3CA 2RC7A 1UCRA 1W7PB 1SI1A 3I71A 5H6QA 3VV5A 2WV0A 3T0YA 4M74A 1YYVA 2QQ9A 2A3SA 1RYXA 1SW2A 4ESFA 4FIMA 2H99A 3N4MA 2YR2A 1LB9A 3LAJA 1EV7A 3SZPA 3G73A 2THIA 5CMCA 4RPNA 3EHTA 2ONSA 2E0SA 4YIIA 4MHGA 4O3MA 5L8DA 3R6UA 3M8FA 3I5UA 1IIWA 3LR1A 5FD6A 3DEUA 4M9SA 3K6UA 1IW7F 2CQKA 1HW1A 2K7LA 3USDA 4F18A 4HX8A 1QO0D 2DW4A 1XSVA 3MQ0A 1B2HA 4I2OA 2L54A 2VC1A 4EGZA 1D9VA 1MQGA 3N6TA 4HZFA 1R7JA 4MF3A 1FQAA 1LVAA 1A55A 1DOTA 1WVJA 3JZJA 1TTYA 2L3DA 2Y7KA 2HQNA 5E8GA 2MC3A 5L3CA 1O64A 3MVWA 4FX4A 4R73A 3FJGA 3KP3A 1OQHA 1B51A 4RNSA 4ZECA 1I5ZA 2F7CA 1MM7A 1QUKA 3RTFB 2P6TA 3O28A 2HZKA 2G9WA 1JXSA 2QPQA 3MP1A 3WTZA 3RDIA 1B9NA 5CMMA 3CUQA 5H6RA 1MDQA 2REJA 1UHMA 2O7IA 3C33A 4FHTA 3M1EA 1T2KA 1P1UA 3WTVC 4NMYA 3O3KA 2DWHA 3JAMZ 3QAXA 1Y9UA 1OYYA 2XXHA 4G8MA 3SEUA 1MPDA 3HOSA 3QK6A 5DUIA 3TEPA 3PUZE 2KIFA 2LKPA 1O57A 5JTYB 1YAEA 2CO5A 4EJVA 2DLLA 2FNCA 1XCBA 1JVYA 5D5VB 2COMA 2O03A 1L3LA 3I3VA 1R36A 1F4KA 3VODA 2O1LA 4I01A 2HEUA 1Y1MA 5BPIA 5L3GA 2QS3A 5CVRA 3F22A 1A40A 3PUVE 2PMUA 3MAMA 2ZXJA 4IO4A 1X3UA 1FP1D 3K1PA 4RK2A 4K3FA 1RUNA 2JPCA 3FV2A 2DWAA 4PP0A 3I59B 3H4ZA 4RGUA 3TTNA 4P5OA 4UVBA 3KP7A 4O3AA 3HHGA 3A3CA 2FOKA 3DP4A 4NF4A 1ZAOA 4FE8A 4Q30B 1XVXA 1LJ9A 2V1DA 4I7HA 4WXJA 3QRFF 4ND9A 3IK6B 1EZ9A 2VD2A 5CMBA 2JPBA 2JRTA 1LCTA 4WXHA 4F31B 3H3ZA 3IJOB 3MZYA 4HBLA 5FHNA 5L3EA 3RQTA 4LZ5A 3GFMA 5DYMA 4BDOA 3RT6B 3S2WA 1DMBA 1PB7A 2PLYA 4FECA 4JSOA 5CYVA 1DTZA 3Q9VA 3MUQA 1ZGJA 1LQ1A 2A6HF 3IB2A 1BI0A 3IB0A 3KP2A 3O6BB 1USTA 3FIRA 4PFYA 2QZ8A 1BM9A 2OZUA 5D5WB 4IO5A 3Q28A 2OD5A 4L17A 4NF8B 3V8KA 3OOAA 3O6HA 1LB8A 1SD6A 2W25A 2VC0A 4UXNA 1MKMA 3BROA 4HYEA 2PN6A 4P9FA 4XKQA 4U0VA 4EV0A 2PFBA 1XN7A 3SFZA 2HAUA 3PGFA 1ANFA 4PGGA 2A61A 2DI3A 5F1QA 3RT8A 4ZS9A 1RZ4A 5ILSA 3KN8A 1LLSA 4P11A 4GOTA 4ELOA 2KJBA 1QUIA 4HCWA 4RJZA 1U78A 4P0IA 5H8FA 2Z9OA 3I64A 4ELPA 5LGNA 2NYXA 3FJMA 3L9FA 1URDA 2REGA 4ZE8A 1YW7A 3T5XA 1NNFA 5JFRA 1QZZA 4KYEA 1BI2A 1H9GA 2ZMBA 1B7ZA 1FSHA 1S6LA 2GXGA 1P4WA 1PB8A 2A6EF 1XHYA 1K78A 3IRRA 3CIJA 3M3KA 4WK8F 3UORA 2OQRA 2HQ0A 3DP6A 3C9HA 4XLPF 4IGTA 2G7UA 1FQCA 2O0YA 1RYOA 2XV4S 1G4DA 4R2BA 4OFJA 4KMUX 3FM3A 3ROUA 2H27A 1LBCA 1QQIA 1N3WA 4MTEA 4ZYHA 3ELKA 1O3SA 3QU3A 1YG2A 4L5JA 5I2KA 2XASA 3TPAA 3E6CC 3PV0E 3IL1B 1S29A 1H3DA 5BOXA 3GO5A 2I0CA 4HF0A 3W6JB 2QMXA 1EH8A 3HV1A 5AA4B 4BH9A 4BDRA 1LNWA 5CM6A 2PMSA 2V6CA 2V9VA 1IF1A 3C36A 2Q8JA 1DSNA 2RF1A 3LA2A 2RN7A 3KLOA 4F39A 4F1VA 1BIYA 4ZEFA 4N0BA 1I6BA 2HCAA 3E5UA 3H6WA 1D3KA 4Q48A 3UK4A 2OWSA 4LLLA 4G4PA 3K9TA 3E97A 1HW2A 3K01A 3PUWE 4LD5A 3WE3A 1N84A 2HXWA 3MZBA 2W84A 3WU1B 2EV0A 3CO6C 2VOOA 3IJXB 1OYWA 4ZYEA 4XIGQ 2KIMA 2BYVE 1JEUA 1ONVA 2HWVA 2Y7RA 2WWYA 4R6KA 2YLNA 2ZKZA 3MBPA 1J59A 1BJAA 2VONA 3TCFA 4MQ9F 1BI1A 3T1BA 4G8NA 1EH3A 2YX7A 4DXUA 4A0XA 4WKMA 3ZPLA 1QUJA 4CGZA 4KYDA 3QYTA 4YB5A 1GVCA 1XGNA 2F5DA 2XRNA 5H8QB 4MTDA 4H1XA 2WKYA 2Q8KA 4LB5A 2XAHA 1BI3A 4OQOA 2XVCA 5ICFA 3EETA 2XHKA 2OBPA 4K2EA 1B46A 1LEAA 3VXCA 3ZSFA 3FVKA 2RDPA 4IRIA 2VBZA 5IT3A 1GVJA 3KN3A 1ZYRF 2CWEA 4G9YA 3IO4A 3TCHA 3BBRA 2FU4A 1XOCA 3C3WA 1BIBA 5BPDA 5H8NA 4ZE9A 2ALUA 3VEPA 4OIQF 2BE5F 3GFIA 3TTRA 2BJJX 5CI5A 4GVOA 1PBQA 3F8CA 4BHCA 1AOVA 1DPPA 1XGOA 4JQFA 1E17A 1M5FA 3ERED 4S04A 1YFHA 1R5GA 1MXZA 2HGCA 3OO6A 2Z3YA 1SFEA 2PYYA 2EJRA 3UGWA 3V4GA 2EA4A 2I49A 1HQCA 4X9TA 1WI9A 1NL5A 2UWMA 3MC2A 1HW5A 2P8TA 2H09A 5FFXA 1DDNA 1ZARA 4E0WA 5K5RA 3LQRA 1UTBB 1FP2A 1B3FA 4IY5A 1OR7A 3MAJA 3WODF 3WAEA 5I57B 1ZTYA 4ESWA 3RPWA 3M8UA 4LZ8A 2J5OA 2BBYA 1MJAA 3CFZA 1AOYA 4X1DA 3KETA 3K1NA 4N07A 4G94A 2Y7WA 3ZQ7A 2CFXA 1TFAA 1FW0A 2ZYMA 5K2XA 4MEXF 3PQJA 3KFMA 1FX7A 2ZFWA 3GX4X 5AA2B 3MW0A 4RPOA 3U9GA 1OMPA 2GA2A 2F6PA 2ZNYA 2DQLA 2GH9A 4RA1A 4WXCA 2XD3A 5TRDA 5L9OA 4BQAA 1MXVA 3ECRA 3IL2A 5HVQC 2PT1A 1MQJA 2DFIA 1HSTA 3LSTA 5DT6A 2XIGA 4U22A 3LA3A 5I56B 3IX1A 4XBFA 1ZIUA 3ZN0A 4IHSA 4R72A 2DP8A 1DPRA 3IAZA 4AQ4A 5KCJA 2E1CA 2DTRA 4G68B 1IN4A 4KICA 2Z5UA 2R7DA 1FCKA 2Z23A 2RC9A 4U4SA 2DBBA 4XKRA 3Q5FA 1SW4A 4GRKA 1P4AA 4U23A 3TGNA 3ONMA 4YFXF 3FX3A 3V8LA 4RGSA 3ZN1A 2XGXA 4NF5B 2GRVA 4KYSA 4KN7X 4N6PA 3O6IA 3O6GA 4M71A 2A5TA 4WWCA 4IXAA 3QSLA 3GBAA 4P9UA 5ELVA 1IN8A 5FTIA 4EVIA 5LGUA 2QMWA 3Q27A 2V84A 4HTGA 1T39A 3J7AO 1PC3A 4OFOA 3HSFA 3HCQA 3J81Z 1ZREA 2RVCA 2Z8EA 3I5OA 3E3VA 5HLGA 4MLQA 1MDMA 2GIVA 2RKHA 1T0KA 3R0AA 3VB2A 1II5A 4C1TA 3OO7A 2O84X 1USSA 2FNAA 4BHBA 2OWTA 5H8HA 4H8JA 3KGCA 3N6UA 3V5AA 4GF8A 2B3BA 3DF8A 1IZ1A 3KZGA 4LVQA 2DU9A 4BYYA 3ZP5A 3HIFA 3BPVA 2O51A 3L00A 3HHHA 1YW8A 3WGGA 2QJEA 3UIFA 2I3WA 1TXFA 2HTSA 3E6MA 3T9VA 4ENJA 2PQ8A 4PCQA 4FEDA 5L3FA 3QIMA 1SI0A 2QBYA 2A07F 1ZLJA 2WTEA 2UXNA 3U72A 4KCDA 2Y48A 5TPAA 5HOOA 1IXHA 5L3DA 2H6BA 1SQYA 3VLWA 1MY1A 1JVXA 1OLAA 2PBWA 1XDSA 4RY1A 3VLVA 3KSJA 2I3VA 1U5TA 1NH8A 1VR5A 3FGSA 2ZYOA 5EYFA 4YIFA 1OIBA 2YPNA 3KEOA 2XXRA 2ZO4A 4FORA 4DLDA 1KQ9A 3IRQA 4KFQA 2EFQA 5FO5A 1RNLA 1UTHA 1SAXA 1Z91A 1O3TA 3C18A 4QLCU 3F6OA 4FEBA 2I4CA 4ENKA 2PEXA 5FHMA 4KIFA 3PPPA 4L9JA 2O1MA 1IRFA 2XAJA 1KYZA 2OZ6A 1EU8A 1YS6A 1J2XA 3C1DA 1B4HA 1J1NA 3GLXA 4U88A 2HAVA 1Y20A 3ISPA 1T0FA 5BQTA 2LDUA 2FF4A 2DK5A 5AONA 2ONKE 3KN7A 2EV6A 3G3ZA 3D5LA 3Q29A 4IVNA 4H0EA 3FXUA 2P7CB 4HV5A 4M72A 4DIGA 4HQMA 4M6YA 2QLZA 5I59A 1FYMA 4EQQA 5D8LB 1POY1 4POXA 4XSXF 1R1NA 4QRZA 3V8JA 2K27A 2DOJA 4C0RA 3LA7A 3OMBA 2YU3A 2UVHA 1S9TA 1RKMA 4GL0A 3LSFB 3CUQC 2O69A 4L9VA 3Q26A 1H9TA 5JVTA 1HBXG 1RUOA 2PJPA 3RKYA 3FF5A 2HEOA 3KOTA 3V8XB 3QPTA 2CZLA 5LLQA 4JDFA 4R9GA 3CFXA 1PDNC 4QFKA 1NMUA 4ZZDA 3MPLA 4M4GA 2EFOA 1AL3A 1T98A 5DEXA 2QL3A 3SQNA 4HA8A 1I1SA 5DD4A 2QUFA 4A5MA 2Z33A 4ELQA 1YS7A 2Y0MA 2ZNTA 4AIJA 4HCYA 5FTHA 3R0JA 3BPXA 3GLBA 3PU5A 4F3SA 3T22A 4E70A 1XCVA 1HKQA 1WWXA 3E3KA 4GL8A 4YB6A 1A8EA 2ABHA 3C34A 2I6EA 1B32A 1F9BA 5HDGA 4MFIA 5E1XA 3ECOA 3QAHA 3WG9A 2ACJA 4NF6A 4NF4B 2A5YB 4WX9A 3T8TA 4OTEA 3RIRA 1LAXA 1R5HA 2AL5A 3B6TA 1SW1A 3DXJF 4HLYA 3K1MA 4EM1A 2IPQX 4FJPA 1HKTA 2Y84A 5K2YA 4S05A 1VSOA 3TTLA 3UN6A 2D5WA 4QSDA 1LFGA 2V25A 3MZHA 1BOAA 2VBXA 3R60A 4Z2YA 2MLGA 1OKRA 1R22A 3I4PA 3WGHA 3VXBA 2STWA 5KVRA 1LCFA 5IT9K 4M9ZA 2H6CA 2TDXA 2OA4A 4IGRA 4RXLA 4O5VA 3W9WA 3IWFA 3SEYA 3RTWB 3U2RA 1UIVA 1MPCA 2K02A 3BFUA 2VT2A 4UA8A 1FTKA 1STZA 1SDXA 1N0TA 3PPOA 2HDCA 1ZRDA 4OIOF 1IUDA 3UP9A 2XXXA 4OEUA 3GFLA 1B5JA 1A04A 3IC7A 3L6GA 4KHZE 3CTAA 3PPNA 3ODBA 3JTHA 2O6GE 2DYXA 1B4ZA 2K4JA 3K6XA 3IOUA 2D21A 3RNNA 3WTUC 2ZMEB 5H8FB 3SESA 4ENMA 4JK1X 3LSXA 3JSOA 4IHTA 1XVYA 4HDUA 3DV8A 1PDAA 5ERIA 1ON1A 3E6BA 1T6SA 2XAGA 1RIOH 1B9JA 4KYWA 3FXRA 1POTA 4RK9A 1QGPA 2H94A 4LLNA 2EFPA 4U1ZA 3W9VA 1V4RA 2XXIA 1OYIA 1A8FA 1DP7P 3U92A 3KEIA 2K86A 5KZTA 4P0GA 1R00A 4KPTA 4NTLA 1OLCA 1VE4A 3TDZC 4GQOA 4TV7A 3BJAA 1K78B 4OMYA 3K2DA 5E20A 3RJPA 4OENA 4ZEKA 1IN6A 3KCCA 4ECFA 4TLMB 1O3QA 3MFKA 1B9MA 1KU2A 5DDGA 2Q2CA 1N76A 3FATA 5BMZA 4EQBA 3OSRA 2A69F 1D8KA 3O97A 5IAIA 4OWDA 3PMWA 4Q4ZF 1UFMA 3TCGA 3M8EA 2R9JA 4ONYA 1M5CA 4DCYA 1D9YA 3TTMA 3V89B 4IRHA 4OERA 3EQ1A 5I2KB 2YJPA 4MEYF 2H98A 2NNNA 3QPHA 1AH5A 1OVTA 2F35A 4OMBA 1O7LA 3IKTA 1Z6TA 2L02A 3HN0A 1IITA 3GXAA 2RV8A 2DSFA 4YFNF 3WTWC 2DVZA 3VVDA 1FLIA 2HOEA 2I48A 5I58B 5HBCA 3K0LA 1PB9A 2ZYKA 4UV8A 4Y17A 4ISUA 1LGBC 1SD3A 4OETA 3K02A 4EF1A 1D8JA 5I84A 4KIGA 3VE1B 3THIA 5CMKA 2UVGA 3CFLA 1XSDA 1JHFA 4KIBA 2AXLA 4U1OA 2AL4A 1B1HA 2XHDA 3CO7C 2XKPA 3VOEA 4HDVA 2W7YA 4GLIA 3FHZA 3QUFA 4IO7A 2GXBA 5CVUA 1FTOA 1G3SA 1XS5A 4YKPA 3GZ5A 4EM2A 2QS4A 2OBGA 3EYYA 2JTVA 4GO1A 2IW5A 5LOMA 1B3HA 3TKDA 4BLAA 3ABUA 4OIRF 5KK1A 1DUXC 1MQHA 3CDHA 4DDDA 3ZKLA 2V3UA 2HKXA 1MQIA 1GTKA 2XKOA 2FSWA 3J80K 1KA8A 5D4RA 1Q1KA 3TO6A 4OIPF 3F8NA 5A2QZ 3TO9A 3VVEA 3CRBA 2LAOA 5CLSA 2M5WA 1HSJA 4HX4A 1MQDA 1N7WA 1MRPA 1MJBA 4F29A 2RCAA 5FLXK 4Z0IA 2M8CA 3HTUA 5DYHA 2A68F 2R3SA 3V83A 5ILUA 5H8NB 3F72A 4R9FA 2EFNA 5JTYA 2RQPA 1HSEA 4GD5A 4EUOA 3TOAA 3HHFA 3R4KA 2IP2A 3RYPA 4U0YA 1ZG1A 3HO7A 3R26A 2JT1A 4O3BA 3BDDA 4LGWA 3C32A 2YPRA 4D0PA 4YKIA 3OXNA 4A0ZA 1JETA 5DEQA 3QP6A 1JE8A 1J75A 3V7RA 1T38A 2VE8A 1EZOA 2ZXTA 3OEKA 3SHFA 3OO9A 3KJ7A 3PPRA 4UNOA 2F6GA 3N26A 4UHTA 5LBQA 2HR3A 4KN4X 4OVJA 3U1DA 2CGPA 1VFEA 4HV6A 3H6VA 5ICEA 4RB1A 3I59A 5DVJA 3T93B 5DV5A 2IT0A 1B58A 1DPUA 3G3IA 1FQFA 4KQPA 3MP8A 3ML6A 3G3KA 4EDPA 2ADUA 1LB2A 3R6SA 1TNSA 4L9NA 2DE4A 5CJ9A 3JSPA 4WXDA 3RN8A 4H65A 5BWJA 1SW5A 4TQUQ 4OYVA 1GHCA 1ZG5A 3I6VA 4LZ7A 3OO8A 4CICA 4ON0A 1IN7A 4R79A 3IKVA 1OMIA 4Y15A 3PMVA 2PMHA 5F6FA 3I53A 1A7LA 5H20A 4ENNA 1B0HA 5FFZA 2ANJA 3COAC 3G3FA 4L0YB 3IR1A 1SBPA 3DP7A 2QSXA 4QFNA 4F1UA 5TP9A 1WQ2A 3FVOA 3TZAA 1LFIA 4OMZA 2KRFA 5CBRA 5DVFA 1PUEE 1B4AA 4F7ZA 1KQ0A 2O3FA 4HS7A 5TU0A 2B3FA 2UVIA 4AIKA 5KCJB 2EFWA 4RGXA 1MY2A 3IOTA 4XTCQ 2YX4A 1SD4A 2V1XA 1PEBA 1IQ7A 1JGSA 3HOTA 1MS7A 3DM0A 5A5XA 1L0OC 3FMQA 2VE9A 2P0SA 1AMFA 4G77A 1H76A 2EA2A 3IOWA 5DCFA 2CMOA 3RGYA 1MY0A 1JEVA 3S4UA 1XMAA 3PD9A 1UB9A 2GQQA 4FATA 2HYFA 4RB3C 3CJNA 1R1UA 4JBAA 2A5TB 4A5NA 1ZN2A 1F5TA 4U0WA 4CZZA 4L0ZB 4F3BA 3WE2A 3Q25A 3MQ9A 1FWZA 2Y7IA 4GWOA 2Q9TA 3KOSA 2UXXA 3H7MA 2P1SA 1MDMB 2FMLA 5HS9A 4YU0A 1BP5A 2YSRA 2D1HA 2R6GE 2UXAA 3HYIA 4KUMA 3QP5A 3DPTA 3B6QA 3EHUA 3FJ7A 4G2ZA 4LP2B 1JW5A 1SD5A 1MXXA 3KLNA 1ZLKA 3FZVA 5HDKA 1CGPA 1BKAA 1FNNA 4KI0E 4U4XA 4MBPA 4G6DA 2W85A 4A6EA 1FOKA 1LFHA 1ON2A 3TYHA 5E1ZB 4ZH4F 2F5CA 3W15C 4M1VA 4R2FA 4YZZA 2XXVA 2EB7A 5TPAB 2DE2A 3T96B 1JQFA 1J7KA 3MPKA 2DE3A 5HLIA 3FVNA 3EUHA 3F11A 3CG1A 3IWZA 3C4MA 4G7OF 4XRFA 2Q88A 1YTYA 2V3QA 4NWDA 2X7QA 2BV6A 1FBUA 3ZMTA 4LQ2A 1U5TC 3TQWA 2VOPA 3NEUA 2D2WA 3HRUA 1LBBA 4HQEA 2DT5A 3DQVC 3FUZA 1H0MA 3F8BA 2NVUB 4DQ2A 4DXCA 5EHMA 3ZKKA 3RKXA 5CVIA 1LAFE 1L5TA 3MZ1A 5EEGA 3H6TA 1KU9A 1QZYA 3P9IA 4E0XA 3ZMZA 2GAUA 4YG2F 4LLGF 4CHUA 5ICQA 2D3IA 4WEPA 2B0LA 3QUJA 4HF2A 4M6XA 4I0BA 5LRSA 4LG0B 4TLLB 4ZZEA 2Y75A 1UHWA 2G7HA 2VT3A 3KE2A 3FXQA 4TOZA 3RUMA 2O8XA 3EYIA 2F5EA 3D4GA 1U2WA 4OFLA 2ESNA 4I0AA 4ESXA 4MGRA 4MQVA 2OCUA 1JNFA 2ZJ2A 4HLXA 3JAMK 1ZMGA 5ITPA 4WF2A 1US4A 5I59B 2KKOA 1MZBA 4PGHA 4LK0F 3TKYA 5ITOA 1MY4A 2DQVA 5F64A 2AYSA 4F1YA 1XB4A 4MH5A 3FWEA 1SYIA 1P4XA 3L7WA 1FQBA 4OOIA 2DQRA 2KJCA 1EH6A 4RGRA 1A99A 3T66A 3HUGA 4DNCA 2B65A 2LNBA 3WTSC 3PFIA 3B73A 4PETA 4PFWA 2UYFA 2HKOA 2FBKA 1B40A 3BOQA 3WU0A 5J8CA 1NNKA 4IO6A 1JW1A 4EXLA 3OEMA 5ICTA 4IRGA 4BAYA 4GXSB 3SERA 2H25A 1W5TA 1B3GA 3K4UA 5DEXB 4YICA 1TLHB 3GWZA 5L3BA 3VVFA 3R61A 1MY3A 2RCBA 5I57A 2KIUA 2AIXA 4QHQA 4BXUA 2E7XA 3F23A 2Q89A 3R7XA 3VFJA 3FM5A 3ZMUA 3KG2A 5CVVA 4IO2A 3T8RA 1U6GA 4QFLA 1IXGA 5CRYA 3EPEA 3QXMA 1PBPA 1FY7A 4NF6B 2QVOA 4LK1F 2F36A 4U21A 1S7AA 4KT5C 5ICCA 1MJ9A 4LFUA 1LDDA 2AS5F 4UV9A 1S50A 3T9HB 5KDTA 2HS5A 1BN5A 4F22A 1OVBA 4I02A 4BDNA 4ZZAA 3F21A 1S8NA 1ZH5A 4H6DA 2WC2A 2P2AA 5JHUA 5I56A 1CF7A 2X4HA 2P4WA 3JV9A 4PDKA 1WKMA 4AD9A 3N5LA 1P1NA 1FYLA 1CE2A 2Z22A 2M45A 3MP6A 4YMAA 3CVGA 2NRAC 1W7PD 2NXOA 4OINF 1B3LA 3B02A 2F5XA 1BBYA 3ZS6A 1S7OA 5LHHA 1M5BA 2FE3A 4JWYA 1KWHA 5M2VA 4FX0A 5F1RA 1KYWA 2QQBA 2FBIA 2F7AA 3RTRA 1MXYA 4AVPA 4FT8A 1ZLQA 3CUQB 5J8FA 2IJLA 4Q0CA 5AIPA 2OK2A 3BP8A 3T9UA 2FEZA 3F8MA 3WAFA 3M7GA 4R8HA 4B09A 1GV8A 1B05A 2ZNUA 2RNJA 2HQRA 1Q1HA 2IA0A 1J9IA 1GGGA 1LAGE 2GHAA 1JW4A 3PUYE 2K4BA 3ZMDA 3O29A 2PT2A 1KU3A 1XMKA 4HW0A 5HS7A 5EEHA 1O7FA 2X7PA 1Y3QA 2Y7PA 4XLNF 3Q9SA 4RAYA 1R9LA 2DWJA 1TT1A 4KCCA 1ULYA 3FD3A 3LAPA 3S9EA 5J1DA 4GCVA 2QS1A 1A54A 4LUBA 1R6ZA 3A09A 4GXAA 4BDLA 3GXOA 2L4AA 2D1VA 3WTYC 1BC8C 3MEXA 4EJWA 4I98B 2PI0A 3H92A 2FQ3A 4I9DA 3K2ZA 2QWWA 2DXYA 5HDNA 4KA4A 5DUKA 2Q2AA 2I0BA 5ISUA 5DCMA 3M3FA 4U2RA 4EXKA 4ELRA 4P96A 2V3TA 4Q47A 2NS0A 1QULA 2QS2A 3NRVA 1UQWA 2UYEA 4HX7A 2O61A 1B59A 1J5YA 1Z6RA 1ZJLA 2F5FA 3BY6A 1FZPB 4R75A 4LMYA 2ZBKA 4DZ1A 3HRTA 2GFEA 1I6AA 4JWOA 4FAJA 2ZNZA 3QU6A 1EH7A 1J0RA 5AA1A 5DD8A 1I69A 3DELB 1YIOA 1Y4TA 1XC1A 3TO7A 1ZRFA 1MH4A 1MD0A 1XGSA 1GXPA 2RGVA 2QM3A 2VBYA 5CVJA 4EGYA 3I0TA 2Z8DA 3LSLA 1YO5C 2IA2A 5LEJA 3BJ6A 3OD7A 3S2VA 1JHHA 3H3GA 1USYH 4L5IA 1Y4CA 1F1ZA 4U7DA 3GYHX 2OU2A 4JBZA 2M87A 2O7UA 4KD5A 5L9SA 4YKKA 2EK5A 5JK4A 3EN3A 4JB7A 2VXZA 3BJOA 3P7NA 3DPLC 4ESBA 4B8XA 4AWXB 2VD3A 3C7JA 4A12A 3U93A 1YQAA 4RYAA 4EQ9A 1I6QA 1LDKB 1N3XA 4XKPA 3TMGA 1R9QA 3A3UA 4R6YA 5EHSA 3S9NC 5I2NA 3KP5A 2I58A 4ZZLA 3W6KB 3O2AA 4G6QA 2E1SA 2FXAA 3HRMA 1P2FA 4IPAA 2ZNSA 3PMXA 2CSOA 1ZGAA 4H5FA 4THIA 3EDPA 3LWFA 4JSDA 5LHIA 1H45A 3KBRA 5LGTA 2KLFA 5CBSA 4ZEDA 1P92A 5ILVA 2DK8A 2M8EA 2FA7A 4LB6B 4BHPA 3MZ9A 3DLNA 1W7PA 2VGQA 4Q5TA 2NAZA 4Y13A 4JXIA 1G6NA 3F6VA 3GFJA 4QFOA 3TTKA 1MPBA 3K0VA 5FHOA 2XUBA 2P7VB 2OAZA 1O63A 5J6XA 2ISZA 3LSWA 3P7IA 4LA9A 1G3TA 2H9BA 4H8IA 4I8CA 1K79A 2MLKA 4IY6A 1B52A 3F8FA 3TDUC 1H43A 2XD2A 5JR3A 1Z1DA 4F3GA 4JWXA 1AIVA 3F3XA 2L4MA 2O6AA 5BS6A 3D0SA 3VLUA 4N9IA 2VODA 2XROA 1NKXA 1P1OA 1FPQA 4RS8A 1OQGA 4A2UA 1QKAA 4EM0B 1Z7NE 4HOBA 3MVXA 1NNTA 1ZHFA 4EQ7A 2RC4A 1S3JA 2MH9A 1TQMA 3BZ6A 1QBJA 1I1GA 2OLBA 4YAHX 3G7WA 5DVIA 1ZKBA 2DAOA 5D6EA 2JZYA 3LFKA 5ED4A 3IORA 2H4IA 2HZLA 1CB6A 2MA3A 1MG1A 4QSEA 4X48A 4M73A 1QPMA 2LF7A 2X0LA 5D8KB 5D5UB 3GUDA 3TELA 1Z05A 3D4CA 1TBXA 5TP9B 1R58A 3REOA 3C31A 3ZMVA 4KR5A 1K6OA 1B7UA 4H67A 1BTJA 2OJTA 1P6RA 1H44A 2ZMEA 1W5SA 1FTLA 1N04A 4MLVA 3TAJA 2MD5A 5A5XB 1S7YA 2LF8A 4KNYA 2STTA 1SMYF 1E2XA 2R7FA 2VN2A 4AB5A 4L18B 3VFZA 3DFGA 2DS9A 5TJJA 2FYIA 1EZPA 1QNTA 2XXTA 1WRJA 2UVJA 1Y0UA 3J81K 3TQLA 3RI4A 4LONB 4F3PA 5CC2A 3ILUB 1AWCA 1O7TA 1WODA 1PP7U 1TFDA 3K6VA 3BKIB 1XDUA 3G3JA 4G7ZF 3GVAA 3PUXE 3KSXA 4G7HF 3OOPA 4NQWA 5BUUA 3BFTA 1SD7A 1D3YA 4CDGA 3IHUA 4EMSA 4P55A 2CYYA 1MH3A 1B3EA 4PE5B 2V79A 3CG3A 3IB1A 4F19A 2NWJA 1Z7ME 1HSLA 3SEVA 1B6HA 2C6YA 3OV8A 3KZZA 2QYOA 1XD7A 2E7WA 3MWMA 3K00A 3CSBA 4I1DA 4F2QA 1VTNC 2XAFA 1IXRC 4WCGA 3WTTC 4GGGA 3L2CA 3EF7A 3PQKA 4NHJA 4OESA 1W4MA 4CXFA 3N97A 2HTJA 3FASA 2XXPA 3RKWA 3RYRA 1V3FA 3E6DA 1LDJA 1K7AA 4POWA 1ZBMA 3IO6A 4KFCA 5I58A 3RLFE 2E1NA 1QW0A 4QSCA 4BDMA 1IUYA 4PFUA 5HM4B 1HXDA 2ESHA 5LHGA 1ATGA 1IXSB 4O6JA 2XXWA 4F2OA 5JEIA 1TW3A 1SVXB 4NF8A 4L9TA 2ZCWA 4G8HA 3JYRA 1IXIA 1Z9CA 4IB2A 2Z8FA 1KU7A 1FBQA 2F2EA 1ODDA 2CW0F 4EJTA 1Q35A 5B7DA 4HW8A 5IT9Z 2PVUA 4CO8A 3OSQA 1MDP1 4BDQA 3KP4A 3ZMSA 2IRFG 2CG4A 4HF1A 1Z7UA 4RB0A 3M9AA 3SETA 1B7HA 2DPUA 1SYHA 4WEDA 2V93A 1ZG3A 2XX9A 1QVSA 3RY3A 4BNCA 1URSA 2NOOA 3JW4A 4H0WA 2W24A 3GBBA 5E1WA 2XX7A 1IAWA 4DXBA 3LUYA 1TQPA 2MH2A 3TOBA 4M9XA 3VDFA 2ONRA 2HFHA 1US5A 3PPQA 3CI8A 3H06B 5F7VA 3FMRA 1C0WA 4XSZF 1LSTA 2FNPA 1Y3NA 4RB2C 5IKBA 2PBIA 1XGMA 4CYDA 2Z99A 2LSOA 3BWGA 2L01A 4DCXA 3QOPA 1B0LA 3KP6A 1YCJA 5AA2D 4R1HA 4OZ9A 3EQLF 1RI7A 2ISYA 2DVCA 2F7BA 3GF2A 2RC8A 4GIZA 2M1BA 2R71A 5D4SA 2IVMA 3V7SA 4A0YA 1IEJA 4ZYGA 4YMBA 5K5QA 3FMSA 5B70A 5LEKA 1M5DA 2P5VA 1ZU0A 2GHBA 5D6FA 2P5LC 1KGSA 4QF9A 4LJZF 4ZDMA 1D4NA 1Y1ZA 4GYGA 1MM6A 5H8HB 4XXUA 3T9XB 4EF2A 1I27A 2V1UA 3HSRA 2HZTA 2P5KA 2NUVA 1XSXA 5AA4A 3UA8A 1QKBA 2G29A 3N94A 5HPQA 1FQDA 3SKPA 2QBYB 1FQEA 1PP8F 1FBSA 4ASNA 1SMTA 3AAFA 4EJUA 4U7BA 3V7CA 2IEEA 1FT9A 3SEXA 1TQIA 5LRRA 3TQNA 2MBFA 1BIAA 4LATA 3KJTA 1U5TB 1YPNA 5E18F 2F8DA 2IA4A 3I58A 2D45A 2RKMA 4YB7A 3JTGA 5HLHA 2GA1A 5AE4A 2F78A 1MGTA 5K5OA 2X26A 4OEVA 2OZZA 3MWBA 1IN5A 3DP8A 3SDFA 3U1OA 5K1YA 4MNUA 3ABTA 1N7XA 2BEOA 1UTHB 2H5YA 3B6WA 5KDTB 1SFUA 1MXUA 3TUSA 2EV5A 3G3HA 2HFBA 1M5EA 1P1WA 2BGCA 1TNTA 3LQQA 4UUVA 2FBHA 2OQGA 3K69A 1R1VA 1B5IA 2ZYNA 4GXOA 5H8QA 1CF7B 5ICGA 4YKJA 1SFXA 2XXUA 4N9HA 3PD8A 2RINA 2DWIA 4Z7EA 1P99A 4NB5A 1O3RA 3TODA 1XT8A 3OENA 2M30A 4GFRA 3ECHA 3J80Z 6PAXA 2GZWA 3MCZA 3E5QA 2XXYA 1TW2A 4R74A 4G68C 2FRHA 3O9PA 2EWNA 1G3WA 2A5SA 1UIUA 3L6HA 3DKWA 1DPEA 3CR9A 2P6SA 2DPDA 1U8RA 5FLXZ 2ETHA 3K6WA 2Q2EA 4LQ5A 1I6XA 3O66A 4UVCA 1NHAA 2FMYA 3HPIA 5AA3A 1R1TA 4R6HA 5E17F 1NFTA 5E8IA 3E4RA 4ZEIA 1YW9A 3GEZA 4IJAA 4PFTA 1GXQA 3S9MC 1LEBA 2QQAA 5FGMA 3I54A 3O2PE 2JSCA 1FTJA 1FYKA 3H3UA 2HYGD 3KFWX 1UTBA 3S9LC 1MXWA 1B6AA 5DTBA 1DTGA 4AB6A 3CLOA 3SXYA 1TWYA 4QWQA 3MJNA 4OU0A 1IRGA 2Q0OA 4Q5SF 3HSTA 1QJMA 4GYIA 4NE4A 3MVZA 1IXCA 3E9XA 1FTMA 3RPUA 2GWRA 4PZJA 3L09A 1B1BA 3P9CA 5JI6A 2PX1A 5D5XB 3E5XA 3E13X 5FD5A 2I4BA 1REPC 3SEWA 5DCMB 4OXVA 1NNPA 2PG4A 1HKSA 2XXQA 3M3LA 3LBSA 4ZEBA 3NQOA 5AA2A 2QRYA 3GW2A 4XKNA 1F9NA 5H8SA 3GZ6A 3WTXC 1P1QA 4YFKF 2DXRA 4I09A 3C35A 4IO3A 1LAHE 1G3YA 4KMFA 3AXFA 4RAZA 4ESJA 2G93A 3OELA
chains in the Genus database with same CATH superfamily
3IOVA 2UZKA 3TDJA 1Y3PA 5AIQA 1S5LC 4BEHA 1B5HA 2DXIA 4UVAA 1ZELA 4N4NB 4A6DA 3RPQA 4HAMA 3DBHB 2XSDC 1BC7C 4G68A 2EBIA 4PFTA 1KQ8A 3KIOA 4KDPA 2PFYA 5J4VA 5HS8A 1BLFA 5F0HA 3H6UA 4LUBA 1B1XA 4IQJA 2CW8A 1YLFA 4N13A 4NWCA 3HRSA 3PNYA 3L1PA 3AG2H 1OPCA 4BQQA 3KEQA 2P3VA 2VHAA 4LG0A 5TGTA 4ZDOA 2VP1A 5A2QK 4ABZA 1YITI 3U94A 4I62A 1WDNA 4NEDA 4F92B 5FB2A 4E7JA 4H46A 4NF0A 1S9HA 2LBFA 1TWAJ 4NF5A 3U8QA 1GR2A 2IA1A 4X1BA 4IF4A 4H5GA 2KLOA 3BG6A 1MBEA 2W57A 4DE8A 1FC3A 3P9KA 3L2WA 4EJOA 2FA5A 3SZTA 3ULQB 5LDZA 3NAUA 4Q8RA 1D5VA 5CQEA 4IZZA 2J5PA 4A3KJ 1IMFA 1B8IA 3KZYA 5K7HA 1VFDA 3EHSA 3FV1A 5JLWA 5DM7F 4QFPA 3TFLA 1U3EM 3FVGA 1FBEA 1SC7A 5KAFC 2F97A 5L9MA 1QPIA 2E2HJ 2R92J 4G8XA 2BHZA 2XAQA 2K3PA 1FBHA 3B7DA 3MVYA 2KDOA 2QENA 5C4XJ 2DN0A 3CSGA 3ABMH 3HSEA 4AIHA 5I2NB 2XX8A 4ETSA 4UACA 4ZYDA 2EPFA 4A3JJ 1USYE 1URGA 3G3GA 3E7LA 3H0GJ 1WSUA 2CW7A 2O68A 4OHNA 2F34A 1SFOJ 4PDHA 2F48A 1FMVA 4DI3D 3GTOJ 1R23A 2NNYA 1FSEA 2VOZA 1ZRCA 3ILTB 2A5WA 3HTSB 2VBWA 1YTVA 4CCOA 4N6DA 3CUOA 2VPRA 3WGIA 1HDDC 1RDXA 1QVTA 2ZJQF 1IMEA 3LL7A 4PQJA 2ELHA 3AL0C 3GZGA 1ELJA 3H03A 2GXAA 2X6YA 4FBPA 3LSRA 2DO7A 3Q0VA 3LC8A 3MYUA 4C1UA 5J16A 1DU6A 1NH7A 4O3CA 4NAPA 1XX5A 3SEUA 5IZ1A 4BXFA 1UCRA 1W7PB 2Y9ZA 1SI1A 2Q74A 3I71A 2RC7A 5H6QA 3QQAA 3VV5A 4DGWB 3HG9A 4GWWA 4N81A 2WV0A 3T0YA 1XS9A 4M74A 1YYVA 2QQ9A 3HM5A 2VB6A 2A3SA 2G0EA 1RYXA 2PJRA 3CLQA 1SW2A 2DFFA 4GRIA 2WADA 3K10A 1FMWA 1T08B 4ESFA 3N4MA 1RR8C 3W2AA 2H99A 2YR2A 4XRSG 1LB9A 3LAJA 1EV7A 4E7LA 2AQFA 3SZPA 3G73A 2THIA 5T3JA 5CMCA 5C3EJ 2CEYA 4RPNA 3EHTA 2ONSA 3K70D 1FTTA 2E0SA 4YIIA 4MHGA 4O3MA 5L8DA 3R6UA 3OYDA 1MNDA 1LFPA 2K3FA 3M8FA 1JGGA 3I5UA 1IIWA 3LR1A 5FD6A 3DEUA 4M9SA 5EZHA 3ZR8X 3JR9A 1INPA 5ET6A 3K6UA 1IW7F 4C2TA 2CQKA 1HW1A 2K7LA 4XONA 3SEQA 4HSRA 4L5EA 3USDA 4F18A 4HX8A 5JLXA 1QO0D 3K2AA 5GP9A 4XIDA 2DW4A 1XSVA 3MQ0A 2E2JJ 1B2HA 2V9PA 4KJZA 4I2OA 2L54A 2VC1A 4EGZA 3AG3H 1D9VA 1MQGA 3FBPA 3N6TA 4HZFA 1N78A 2WY8Q 4HE2A 1R7JA 5HNFA 3FBIB 4MF3A 1WJEA 1FQAA 1LVAA 3KC1A 1A55A 1FPIA 2DA3A 1DOTA 1WVJA 3JZJA 1TTYA 4XF5A 2L3DA 5FKLA 2Y7KA 2HQNA 5E8GA 3KYLA 2MC3A 5L3CA 1O64A 4BE0A 4A3GJ 4FX4A 3MVWA 4O7MA 4A93J 2FVZA 3FJGA 4R73A 3KP3A 1OQHA 1WI3A 1B51A 4BBSJ 4RNSA 4ZECA 2M9HA 1I5ZA 2F7CA 1E3OC 1MM7A 2L9VA 1QUKA 4CZCA 3RTFB 2P6TA 3O28A 3KYDB 2HZKA 4F55A 2G9WA 1JXSA 2QPQA 3MP1A 3WTZA 3RDIA 1B9NA 5CMMA 3CUQA 5H6RA 4PAKA 2HPIA 4M3FA 1MDQA 2V4JC 2REJA 1UHMA 2O7IA 3C33A 4FHTA 2L9RA 1FSAA 3M1EA 1T2KA 1P1UA 3WTVC 4NMYA 5IOZA 3O3KA 2DWHA 3JAMZ 1JJ8C 3QAXA 1Y9UA 2CQNA 4ZYAA 1OYYA 2ZMEC 2XXHA 4DYQA 3TW7A 1MPDA 3HOSA 3LUZA 5DUIA 3QK6A 4AS5A 3TEPA 3PUZE 2KIFA 2LKPA 1O57A 2MYSA 2X85A 1YAEA 5JTYB 2CO5A 4EJVA 2DLLA 2FNCA 4QTRA 1XCBA 1JVYA 3FXOA 2MG4A 5D5VB 3L2VA 2COMA 3K70C 1OJLA 2LTPA 2O03A 1L3LA 3I3VA 1R36A 2DA5A 1F4KA 4XM3A 3VODA 5M5YJ 2DMQA 3ESWB 4UY8I 3E1SA 4BY1J 2R7TA 2O1LA 4CCNA 4I01A 2HEUA 1R71A 5EDNA 4PJJA 5BPIA 1Y1MA 5L3GA 2QS3A 2V1NA 5CVRA 3F22A 1A40A 2Q8MA 4D7NA 5EGOB 2DCEA 4NQWB 3BIHA 3PUVE 2PMUA 4S0HB 3MAMA 2R7SA 2ZXJA 3VSKA 4IO4A 4D5CA 2GOXB 1X3UA 1FP1D 2BXYA 3K1PA 1JKQC 4RK2A 4K3FA 1OCOH 1RUNA 5IY5H 2JPCA 4DBRA 3FV2A 3VYSB 2DWAA 4PP0A 3I59B 5I5PA 2DA2A 3H4ZA 4RGUA 3TTNA 4P5OA 3HGGA 4UVBA 3KP7A 1MMNA 2JA2A 3A01B 4O3AA 2ZSIB 3HHGA 4IHWA 3A3CA 2FOKA 3DP4A 2MD0A 4NF4A 1ZAOA 2M3AA 4NC6A 4FE8A 4Q30B 3IV5A 4IHYA 1XVXA 1LJ9A 1DGRM 2V1DA 4I7HA 4WXJA 3QRFF 4ND9A 3IK6B 3CJTB 1EZ9A 2VD2A 5CMBA 2JPBA 2JRTA 1LCTA 4WXHA 4F31B 3H3ZA 3IJOB 3MZYA 4HBLA 2L2OA 5L3EA 5FHNA 3RQTA 4LZ5A 2H1KA 3GFMA 2XWVA 3PM1A 1SFKA 4Y4RA 3DEWA 5DYMA 4BDOA 3UKGA 2WA0A 2K9SA 3RT6B 3NARA 1NV6A 3S2WA 1DMBA 3T9VA 1PB7A 2PLYA 4FECA 4JSOA 5E3MA 2RQQA 5CYVA 1DTZA 3Q9VA 3MUQA 1AWBA 4NHBA 1ZGJA 1LQ1A 2A6HF 3IB2A 2VQGA 1BI0A 3OSGA 3KP2A 3O6BB 3IB0A 1USTA 4RAFA 3FIRA 4FIMA 4YEJA 2QZ8A 1BM9A 2OZUA 5D5WB 4IO5A 4PFYA 3Q28A 2OD5A 1GUUA 4L17A 2BJIA 4NF8B 3V8KA 2R7ZJ 3O8HA 1W0TA 3OOAA 3O6HA 1LB8A 3TL4X 1SD6A 2W25A 2WYPA 2Y0SA 2ZB9A 2VC0A 3CCYA 3H1CA 4UXNA 4CCLA 4P56A 1MKMA 1FOYA 3BROA 4HYEA 1BW5A 2PN6A 4FCYA 1VDWA 2CQXA 4P9FA 4XKQA 2CFOA 4U0VA 2E1MB 3PUFA 4EATA 4EV0A 5IZZA 2K9NA 2PFBA 1XN7A 3SFZA 2HAUA 3PGFA 1ANFA 5EJCA 3CC2I 4PGGA 2A61A 2DI3A 5F1QA 3RT8A 2KFDA 3KX2A 4ZS9A 1RZ4A 4B47A 3I3LA 2MSYA 5F0FA 5ILSA 1LLSA 3KN8A 5KHDA 4P11A 4GOTA 1POGA 1N25A 4ELOA 2KJBA 1QUIA 4HCWA 2CZIA 1U78A 4P0IA 4RJZA 3SFIA 3PFYA 2Z9OA 5H8FA 2Y0SN 3I64A 1YRNB 4ELPA 3CMYA 5LGNA 2K9QA 2LH9A 1Z3YA 2NYXA 3FJMA 1X2MA 3CJRB 3L9FA 1URDA 3EPZA 2REGA 4ZE8A 1YW7A 3T5XA 3QWLA 4HG2A 1NNFA 5JFRA 2FHYA 1QZZA 4KYEA 1B72B 1BI2A 1D0YA 1H9GA 3OR1C 2ZMBA 1B7ZA 1FSHA 1S6LA 2GXGA 2W82A 1P4WA 3BTIA 1PB8A 2A6EF 1XHYA 2K40A 1IRZA 4P9KA 3OYBA 3IRRA 1K78A 3CIJA 4WK8F 3HOVJ 3M3KA 3UORA 2OQRA 2OCEA 2HQ0A 3DP6A 3C9HA 4XLPF 4IGTA 2G7UA 1J09A 1K83J 3CCUI 1FQCA 2O0YA 1RYOA 3D1RA 2XV4S 1G4DA 4R2BA 4OFJA 2LY1A 4KMUX 3FM3A 3ROUA 1TWFJ 3QYBA 2H27A 1LBCA 2HPMA 1QQIA 1FBCA 2NVQJ 1N3WA 5J1RA 1NV0A 4MTEA 1ZR2A 3LOCA 4ZYHA 3ELKA 2W7NA 3QU3A 1YG2A 2BHYA 1O3SA 2PMZA 4L5JA 4LOCA 5I2KA 2XASA 3TPAA 3E6CC 5HLTA 3PV0E 3IL1B 1S29A 2FJ1A 4JYKA 3JRFA 1H3DA 5BOXA 3GO5A 3S93A 4HF0A 2I0CA 3W6JB 3OS0A 2QMXA 3CDIA 4I3EA 1EH8A 3S3OA 3HV1A 1IJWC 3GTLJ 3K4JA 5AA4B 1G0IA 2HVQA 4BH9A 3B6CA 1LNWA 3GTQJ 2PMSA 4N4UA 4BDRA 5CM6A 2V6CA 2EZLA 2V9VA 1IF1A 2B4LA 4N15A 3C36A 2Q8JA 1DSNA 2RF1A 4CYCB 1BR1A 3LA2A 2RN7A 3KLOA 3H5RA 4F39A 4F1VA 4O94A 2ECCA 1BIYA 3H36A 4ZEFA 1KONA 2L5QA 2PMZN 1FPFA 2CV1A 3BIGA 4N0BA 4M6VA 1I6BA 2HCAA 3E5UA 4BL0B 1OR7C 3BG7A 3W2VA 2EIMH 4Q48A 5JHFA 1D3KA 2OWSA 4LLLA 3H6WA 1MMAA 3K9TA 3PIPF 4G4PA 3E97A 1HW2A 3K01A 3PUWE 5IPAA 2GLOA 1WGXA 4LD5A 3WE3A 1N84A 2HXWA 3MZBA 2W84A 2KRCA 2EV0A 3WU1B 1G8XA 3CO6C 2VOOA 3IJXB 3CD6I 1OYWA 4GBVA 3HJEA 4ZYEA 2IS2A 2QQ8A 4XIGQ 2KIMA 2BYVE 2BY3A 2R5YA 1JEUA 1ONVA 2HWVA 1LBZA 2Y7RA 2WWYA 3PIOF 3DBRB 4R6KA 2YLNA 2ZKZA 4A3FJ 1J59A 2O8KA 3MBPA 1BJAA 4MNPA 2VONA 3TCFA 4MQ9F 1BI1A 4B3XA 2LRDA 3CJQB 3OYHA 3T1BA 4G8NA 1X1BA 1I50J 1EH3A 2YX7A 2LFBA 4DXUA 4A0XA 2LVSA 4WKMA 1OLTA 3ZPLA 1QUJA 4CGZA 4KYDA 2DMUA 3QYTA 4YB5A 3FXKA 5EYRA 1GVCA 3ROJA 1XGNA 1Y6IA 1MBJA 2F5DA 2XRNA 5H8QB 4MTDA 4G12A 5J47A 4H1XA 4PF6A 1A6QA 3S1NJ 2WKYA 2Q8KA 2DDBA 1IDYA 1WZ2A 4LB5A 2XAHA 1BI3A 4YELA 4OQOA 2XVCA 5ICFA 3EETA 1YX5A 2OBPA 2XHKA 3U1KA 4K2EA 1B46A 1LEAA 2B9SA 3VXCA 3ZSFA 2CS3A 3FVKA 2RDPA 4IRIA 2VBZA 2QEXI 2R0QC 4X8RA 5IT3A 1GVJA 3KN3A 3ABLH 1ZYRF 2CWEA 1NTCA 4G9YA 2XAUA 3IO4A 3TCHA 3TW6A 2QSFX 3BBRA 2FU4A 1XOCA 3D5RC 3C3WA 1BIBA 5BPDA 2IS1A 4P1LA 5H8NA 4ZE9A 2ALUA 3VEPA 4OIQF 3A2KA 4D1QA 1MIJA 2BE5F 3GFIA 3TTRA 4PTKA 2BJJX 4PGNA 2NS7A 2RAEA 2R8TA 1LFBA 5CI5A 4GVOA 1PBQA 1LE8B 3KYCB 3F8CA 4BHCA 1AOVA 1DPPA 2KZVA 1XGOA 2XXKA 2Q2EB 3Q0WA 1ZQ3P 4CUGA 1E3HA 4JQFA 1E17A 1M5FA 1PYVA 3ERED 5IP6A 4H4KC 4S04A 1YFHA 2ME6A 2R4GA 3BZKA 4A3EJ 1R5GA 1MXZA 2HGCA 3OO6A 2Z3YA 3BG5A 5GPAA 1SFEA 2PYYA 3A02A 2EJRA 3UGWA 3V4GA 5F27A 3GTPJ 2EA4A 4JVIA 2I49A 1HQCA 3S1QJ 2ZXWH 4GX4A 3FHNA 4X9TA 1VZ0A 4C3HJ 2COBA 1WI9A 1NL5A 2UWMA 3MC2A 1HW5A 3A0BC 2H09A 2P8TA 5FFXA 1ZARA 1DDNA 4E0WA 2HI3A 3LQRA 4OAYA 5K5RA 1UTBB 1FP2A 1B3FA 1ETQA 3B6AA 4IY5A 1Y1VJ 1U9OA 1OR7A 3MAJA 4NGUA 1X3ZB 3WODF 3WAEA 3V42A 5I57B 1ZTYA 4ESWA 4XKCA 3RPWA 3M8UA 4LZ8A 2J5OA 2BBYA 1JKRC 1MJAA 3OWTA 2IS6A 1D0ZA 3CFZA 1AOYA 1UAAA 3KETA 3K1NA 4N07A 4X1DA 4G94A 2Y7WA 4AYBA 3ZQ7A 4A3CJ 2CFXA 2DDAA 1TFAA 1FW0A 2ZYMA 5K2XA 4MNCA 3KZIC 1Y39A 4MEXF 3PQJA 3KFMA 3EUKL 3K7AJ 1GV2A 1FX7A 3GZNB 4G6TB 3IAS2 3M1CA 2ZFWA 3GX4X 4UB6C 5AA2B 2I8DA 3MW0A 4RPOA 2L7KA 3U9GA 1OMPA 2GA2A 1JKOC 4B44A 2ZNYA 2DQLA 1X4OA 3MKLA 3S14J 2F6PA 2GH9A 4RA1A 4WXCA 2XD3A 5TRDA 5L9OA 2H1LA 4BQAA 2R7VA 1YI2I 1MXVA 3ECRA 2R7RA 3IL2A 1QVUA 5HVQC 2PT1A 1MQJA 2DFIA 5HODA 1HSTA 3LSTA 4AYBN 5DT6A 4D5FA 2XIGA 1QU3A 2FX0A 2QCOA 3LA3A 4U22A 5I56B 3BZCA 2JA8J 3G71I 3IX1A 1A36A 4XBFA 1ZIUA 4DJAA 3ZN0A 4IHSA 2PFZA 4R72A 1GDTA 1NUYA 2DP8A 1DPRA 2FOWA 3IAZA 4AQ4A 1JKPC 5KCJA 4MMPA 2E1CA 2DTRA 4PE3A 4G68B 1IN4A 4KICA 1IG7A 3CCMI 2Z5UA 4MNIA 2R7DA 1FCKA 3DLAA 2Z23A 3H5NA 2RC9A 1MBKA 1YHQI 4U4SA 1RETA 2DBBA 2ICWG 3IAM2 4XKRA 1IUFA 4PFPA 4BQOA 3Q5FA 1SW4A 4BS9A 4GRKA 1P4AA 3FK7A 3KPHA 3TGNA 3BG3A 4YFXF 3ONMA 4U23A 3FX3A 3FKIJ 4Y7NJ 3V8LA 2HHMA 4RGSA 1WJCA 3ZN1A 2XGXA 4NF5B 2GRVA 5B5EC 4KN7X 2KDZA 4KYSA 4QPOA 1K61A 4N6PA 3O6IA 3O6GA 4M71A 1OCRH 2A5TA 4WWCA 4IXAA 4F3QA 1ETVA 3GBAA 4P9UA 3QSLA 5ELVA 1IN8A 4GWSA 3LSHA 5FTIA 4EVIA 2XA5A 2XF6A 4MO7A 5LGUA 2QMWA 3Q27A 2V84A 1Y56A 4M3DA 4HTGA 1T39A 3J7AO 1PC3A 4OFOA 3HSFA 3HCQA 3J81Z 1ZREA 2RVCA 2Z8EA 3I5OA 3E3VA 5HLGA 4MLQA 1MDMA 2GIVA 1FEXA 1LFUP 2RKHA 1FBFA 3DKYA 1XPXA 1T0KA 3OYCA 3IH4A 3R0AA 4II2A 3VB2A 5JVGF 1II5A 4C1TA 3OO7A 2O84X 2DYRH 1USSA 2HZDA 2FNAA 4BHBA 4X6AJ 2OWTA 2Q1ZB 5H8HA 4H8JA 3KGCA 3N6UA 4P47A 4MIMA 3V5AA 4GF8A 2QVUA 2B3BA 3DF8A 1IZ1A 3KZGA 2DA6A 4C2MJ 3TEDA 4LVQA 2DU9A 4BYYA 3OS2A 3HIFA 3BPVA 3ZP5A 3L00A 2O51A 3HHHA 1X2NA 1YW8A 4I99C 4LG3A 2IGKA 3WGGA 2QJEA 3UIFA 3I56I 4FE4A 3G6EI 1IDZA 1TXFA 5DTDA 2I3WA 5CKTA 2HTSA 3E6MA 5B1BH 5FROA 2PQ8A 3NWSA 4PCQA 4ENJA 5L3FA 3QIMA 4FEDA 1SI0A 3BR1A 2GBYA 2QBYA 2A07F 1ZLJA 2WTEA 2UXNA 2R7XA 3U72A 4KCDA 2Y48A 5TPAA 2CUFA 3HPHA 4O7IA 5HOOA 1IXHA 5L3DA 3HC7A 2H6BA 3MKYB 4GWYA 1SQYA 1UELB 2VQLA 3VLWA 2R7OA 1I3AA 1MY1A 3U65A 1JVXA 1OLAA 4XEQA 2PBWA 1XDSA 4D9JA 4RY1A 3KSJA 3VLVA 2PJRB 2I3VA 1U5TA 1NH8A 1VR5A 3FGSA 3OMYA 3C2BA 2ZYOA 5EYFA 4YIFA 2TCTA 3GTGJ 3BC8A 1OIBA 2YPNA 2NOGA 3KEOA 2XXRA 1ITYA 3JRIA 2LD5A 3I4MJ 2ZO4A 4FORA 1AKHA 1KQ9A 3CMAI 4DLDA 2DA7A 3IRQA 4KFQA 2EFQA 2XGEA 5FO5A 4I8CA 1RNLA 4QIWN 1UTHA 2DJNA 2WB1A 1SAXA 2EIKH 1Z91A 1O3TA 4MX6A 1IV8A 3FK6A 3C18A 4QLCU 3CC7I 3F6OA 4FEBA 2I4CA 4ENKA 2PEXA 5FHMA 4KIFA 3PPPA 4L9JA 2B63J 2O1MA 1JT0A 2HDDA 1IRFA 5ET5A 2XAJA 4HSTA 2P0WA 1KYZA 2OZ6A 1EU8A 1I6HJ 1YS6A 1J2XA 3C1DA 1B4HA 4UUSA 1J1NA 3GLXA 4U88A 3D1NI 5EYHA 2HAVA 1Y20A 3ISPA 1T0FA 2KPMA 2XDVA 5BQTA 4Y3OA 3OYKA 2LDUA 2FF4A 4I3YA 4BBRJ 2DYSH 2DK5A 5AONA 4X0GA 1X3WB 2ONKE 1BA5A 3KN7A 4BJ5C 2WB1N 2EV6A 3G3ZA 3D5LA 2IXSA 2XGDA 4IVNA 4H0EA 3Q29A 3FXUA 4E7IA 2KRHA 2P7CB 4HV5A 4M72A 4DIGA 4HQMA 4M6YA 2QLZA 1S72I 2JMWA 1QA6A 4E7KA 4FQGA 5I59A 2X9DA 1OQYA 2ELKA 4EQQA 1FYMA 3ZQHA 5D8LB 2V6EA 1POY1 2V4CA 4LIUA 4XSXF 1R1NA 4NC8A 4POXA 2XPUA 4QRZA 3V8JA 1D1AA 2K27A 4OANA 3RYDA 1OFCX 2DOJA 4C0RA 1I39A 3LA7A 3OMBA 1K9YA 2YU3A 2UVHA 1S9TA 1RKMA 3C2HA 1M1EB 4GL0A 3ZQLA 3LSFB 3CUQC 2O69A 4L9VA 3Q26A 2HPGA 1H9TA 1FJ9A 5JVTA 1HBXG 1H8AC 1RUOA 3RKYA 3FF5A 2HEOA 2PJPA 3KOTA 3V8XB 2K9LA 1EYKA 3P5JA 3QPTA 2CZLA 4B43A 5LLQA 5IYDJ 1NG6A 2BW3B 5J4YA 4JDFA 4R9GA 3CFXA 1PDNC 4W97A 4QFKA 3AL0B 2YUSA 1NMUA 4ZZDA 3MPLA 2VXDA 4XOPA 4M4GA 2EFOA 3CCVI 1YJ9I 3FIWA 1AL3A 4MJOA 1T98A 5DEXA 2QL3A 3BQZA 1U8BA 2BY2A 3QYEA 3OSFA 3SQNA 2QF7A 4HA8A 2V26A 1RRJA 1I1SA 1EJ9A 5DD4A 2QUFA 1VF9A 5J3LA 4A5MA 3KBZA 1KZ8A 2Z33A 4ELQA 1YS7A 2Y0MA 4XL9A 3SZGA 5IP9J 2ZNTA 4AIJA 4HCYA 2EINH 5FTHA 3G2BA 4Y33A 3R0JA 3BPXA 3GLBA 3PU5A 3ERMA 4F3SA 2QVVA 1UG0A 3T22A 4E70A 1XCVA 1HKQA 1WWXA 2WEFA 3E3KA 4GL8A 1BW6A 3FBNB 2BVMA 5FJ8J 1A8EA 2ABHA 3C34A 4YB6A 2I6EA 1B32A 1BK4A 1F9BA 5HDGA 2PCRA 4MFIA 5E1XA 1IC8A 3ECOA 3QAHA 3WG9A 1IV6A 2ACJA 4NF6A 1BJZA 4NF4B 2A5YB 4WX9A 3QMFA 4PFOA 3T8TA 3RIRA 4OTEA 1XTAA 5GTHC 1LBXA 1LAXA 1JUMA 1R5HA 2AL5A 1SW1A 3DXJF 4HLYA 3K1MA 4EM1A 2IPQX 4FJPA 3A0HC 5M5WJ 1HKTA 1HOMA 4S05A 2Y84A 5K2YA 1PVEA 2N8GA 1VSOA 3TTLA 3UN6A 3DU5A 3HFUA 1K9ZA 2YU9J 2D5WA 4QSDA 1LFGA 2V25A 3MZHA 1CQTA 1BOAA 2VBXA 3R60A 4II3A 4Z2YA 2MLGA 1OKRA 2MFZA 1R22A 3I4PA 3WGHA 3VXBA 2STWA 4MLOA 1RDZA 5KVRA 4ZTFA 1LCFA 1MBGA 5IT9K 4M9ZA 2H6CA 2TDXA 2OA4A 5KAIC 4IGRA 4RXLA 4O5VA 3W9WA 3IWFA 1UMQA 3SEYA 4C3IJ 3HXLA 4LITA 3OIPA 3RTWB 3U2RA 2IBDA 1UIVA 3QPSA 1MPCA 2K02A 2XPVA 3BFUA 2VT2A 4UA8A 1FTKA 1GVDA 1STZA 2FQ4A 5FKNA 1N0TA 1NI9A 1SDXA 2HDCA 3E79A 3PPOA 2CUJA 1ZRDA 4OIOF 4GX3A 3GCMA 1IUDA 2DTZA 3UP9A 2KISA 3PJRA 2XXXA 3GFLA 4OEUA 1B5JA 3HDDA 1A04A 3IC7A 3L6GA 3QPLA 4KHZE 3CTAA 1V5FA 1U9NA 4AUXA 1AA7A 3HPGA 3PL8A 3ODBA 3JTHA 2O6GE 2DYXA 3PPNA 1H88C 3RCOA 2D5VA 1B4ZA 2XRLA 3HOXJ 5E3OA 4YRVA 2K4JA 3K6XA 3IOUA 2E34A 2D21A 1EYJA 4XLFA 3RNNA 4MAGA 3WTUC 2ZMEB 5H8FB 4FTHA 1HCRA 3SESA 4ENMA 4JK1X 3LSXA 3JSOA 4IHTA 2MABA 1XVYA 4NUBA 5M5XJ 2M34A 4HDUA 3DV8A 1PDAA 1VQ9I 1ON1A 5ERIA 3E6BA 3ZGKA 1T6SA 2XAGA 1RIOH 1B9JA 4KYWA 3FXRA 2IAIA 1LPQA 1POTA 4BUPA 4RK9A 1OCZH 1QGPA 2H94A 4LLNA 4N8YA 2EFPA 1RKTA 4U1ZA 3W9VA 3H0DA 1V4RA 2YS9A 2XXIA 1OYIA 1A8FA 1DP7P 3U92A 3KEIA 2K86A 1PUFA 3OYIA 5KZTA 4P0GA 1R00A 1WCMJ 4KPTA 3ZQQA 4NTLA 2VKEA 1ETYA 1ERDA 1OLCA 1VE4A 3SDBA 3TDZC 4GQOA 4TV7A 2F3DA 3BJAA 5E79C 2X1EA 1K78B 4OMYA 2CU7A 3HBLA 2KT0A 5E20A 3RJPA 5IOYA 3K2DA 4OENA 4ZEKA 2LY2A 1IN6A 4PDDA 3KCCA 4ECFA 5KCMA 4TLMB 1O3QA 3MFKA 1B9MA 1KU2A 5DDGA 2Q2CA 1N76A 3FATA 5BMZA 4EQBA 3DU6A 3BT9A 3OSRA 2A69F 1D8KA 3O97A 4DYCA 5KNLA 5IAIA 4OWDA 3PMWA 3HZJA 4Q4ZF 1UFMA 3TCGA 1YZ0A 3M8EA 2R9JA 2Z2SB 4ONYA 1M5CA 4DCYA 1D9YA 2DOEA 1JUSA 3TTMA 3V89B 4IRHA 4OERA 3EQ1A 5I2KB 1Y8QB 2YJPA 2E36A 4MEYF 2H98A 2NNNA 3QPHA 3AKZA 4PCDA 1AH5A 1OVTA 5EG0A 2F35A 4OMBA 3A1YA 1O7LA 3IKTA 1Z6TA 4RM3A 2L02A 3EKIA 4BE2A 4XICA 3HN0A 1IITA 4G8MA 3GXAA 2RV8A 2DSFA 4YFNF 3WTWC 2DVZA 3VVDA 1FLIA 2HOEA 2I48A 5I58B 2LMDA 5IP7J 5I7IA 1MSFC 5HBCA 3K0LA 4F52A 4HE0A 3HGYA 1TWCJ 1PB9A 2ZYKA 4UV8A 4Y17A 3SYTA 4NQ8A 4ISUA 5GPCA 1LGBC 1SD3A 2XWKA 4OETA 3K02A 4EF1A 2K5CA 1RC9A 1DU0A 1D8JA 5I84A 4KIGA 3VE1B 3QYFA 3THIA 5CMKA 2UVGA 3MZ8A 3CFLA 4CCKA 1XSDA 1JP4A 4B1RA 3MD2A 3RQ4A 4DW6A 1ETKA 1JHFA 2QGUA 4KIBA 1HC8A 2AXLA 2R7QA 3S32A 4U1OA 2AL4A 1B1HA 2XHDA 3CO7C 2XKPA 2W1OA 3BLYA 2XB0X 3W3CA 3VOEA 4HDVA 2W7YA 4GLIA 1YJWI 3FHZA 3QUFA 4IO7A 2GXBA 3LSMA 5I3SA 5CVUA 2R5YB 1G3SA 1FTOA 4XNFA 1XS5A 2BVLA 3GZ5A 4EM2A 2QS4A 2OBGA 4YKPA 3PSFA 2NVYJ 2JTVA 3EYYA 2IW5A 3H9GA 4GO1A 4NDLA 1B3HA 4MHFA 3TKDA 5LOMA 1X19A 4BLAA 1NUXA 3ABUA 4OIRF 4C3JJ 4DZPA 4N8GA 3GBGA 3ZQCA 3L2RA 5KK1A 1DUXC 2VASA 1MQHA 3A29A 3CDHA 4DDDA 2WV1A 3OYMA 3H35A 3ZKLA 2V3UA 2HKXA 1MQIA 1GTKA 5J1YA 2XKOA 2FSWA 3J80K 1KA8A 5D4RA 5FLMJ 4IX7A 1Q1KA 3TO6A 4OIPF 4BXXJ 3F8NA 5A2QZ 5EQ9A 3TO9A 3VVEA 2Y5KA 2K85A 3CRBA 4JX5A 2LAOA 5LFAA 2HVRA 5CLSA 2M5WA 1HSJA 4HX4A 1IO2A 1VQLI 1MQDA 1MRPA 3CMMA 1N7WA 5C4JJ 1MJBA 4F29A 2RCAA 3PNVA 5FLXK 4A3BJ 3J7AY 4Z0IA 1NK2P 3HTUA 2M8CA 2A68F 2IGOA 2JA6J 5DYHA 1AIVA 2DJIA 2X48A 2R3SA 2L5VA 5ILUA 5H8NB 3V83A 3F72A 3M8JA 1R9TJ 2EFNA 4R9FA 5JTYA 2RQPA 2O7OA 1HSEA 4GD5A 4EUOA 3TOAA 1FPGA 3R4KA 3HHFA 2IP2A 3RYPA 4U0YA 1ZG1A 1FPKA 1BR4A 3HO7A 5FRMA 3R26A 2JT1A 4O3BA 3BDDA 4LGWA 1VFCA 3DEEA 3C32A 2YPRA 1GT0C 4D0PA 1FTZA 4YKIA 3OXNA 4ANJA 1ETXA 4A0ZA 1JETA 3F0CA 5DEQA 3QP6A 2XPWA 1JE8A 1LVKA 4P1WA 1J75A 3V7RA 1T38A 2ZJPF 2VE8A 1EZOA 5EGOA 2ZXTA 2JJ7A 1WFXA 3OEKA 3SHFA 3OO9A 1OISA 3LSIA 3B50A 1K6YA 3KJ7A 3PPRA 3SJMA 4BU2A 4UNOA 2F6GA 1APLC 3J7ZI 3N26A 4UHTA 5LBQA 2HR3A 2FIXA 2HXIA 4KN4X 4B4CA 4OVJA 3U1DA 2CGPA 1VFEA 4HV6A 4DOZA 3H6VA 5ICEA 4RB1A 3I59A 5DVJA 3T93B 2JVGA 5DV5A 2IT0A 5IGAA 1WJFA 1B58A 1DPUA 3G3IA 1FQFA 4KQPA 3A01A 4BDYA 3MP8A 2VKVA 2E35A 3ML6A 3G3KA 3S1RJ 4EDPA 2ADUA 1LB2A 4IHXA 3R6SA 1TNSA 4L9NA 2DE4A 5CJ9A 3JSPA 4WXDA 3RN8A 1KA0A 5EQ7A 3CMEI 4H65A 2M7AA 4I40A 2NXNB 2XSJC 4BE1A 5BWJA 2AQEA 4PAFA 1SW5A 4TQUQ 4OYVA 3RKQA 5IYBJ 4D7MA 1ZG5A 1GHCA 3I6VA 2OC6A 4LZ7A 3OO8A 5FBPA 2R5ZA 2DFHA 4CICA 1E3PA 4ON0A 1IN7A 4R79A 3IKVA 2KQRA 2LYCA 1OMIA 3DCFA 4Y15A 5J40A 3PMVA 2PMHA 2KIQA 5F6FA 1VQNI 5FKOA 3I53A 2ZJRF 1A7LA 4HXVA 1D1CA 5H20A 4ENNA 1B0HA 1UZCA 2QFLA 2XWIA 5FFZA 2ANJA 4W1UA 2Y31A 3COAC 3EUAA 3EUHC 1KZHA 2VPNA 3G3FA 2Y2ZA 4L0YB 4OA4A 3IR1A 2OX3A 3CCRI 2ZZVA 1SBPA 2M0MA 3DP7A 2QSXA 4QFNA 4F1UA 5TP9A 1WQ2A 3FVOA 3TZAA 1LFIA 3HKZA 4OMZA 2DA1A 2KRFA 5CBRA 1X1DA 4DZJA 5DVFA 1PUEE 4MEVA 1NUZA 1B4AA 4F7ZA 1KQ0A 2O3FA 4HS7A 2JA5J 5TU0A 2B3FA 2UVIA 4AIKA 3K4BA 4PAIA 5KCJB 3K00A 3AFHA 2EFWA 4RGXA 1MY2A 3IOTA 4XTCQ 2YX4A 5EF6A 3O8GA 1SD4A 1TWGJ 2V1XA 1PEBA 1IQ7A 4UABA 1JGSA 3HOTA 1TC3C 1DK4A 1MS7A 3DM0A 5A5XA 1L0OC 1ZR4A 3FMQA 4FE7A 5IZ3A 2VE9A 2X6OA 4XLAA 2P0SA 4OVTA 2CUZA 1AMFA 4G77A 1H76A 2EA2A 3IOWA 1Z21A 5DCFA 3HKZN 3HL2A 2CMOA 1MY0A 3RGYA 2DT7B 4BY7J 1JEVA 3S4UA 1XMAA 1D9QA 1B72A 3PD9A 2DA4A 1UB9A 2GQQA 4FATA 2HYFA 4KT6A 1V54H 5A5LA 4RB3C 3CJNA 1R1UA 3OOUA 1DP3A 4JBAA 2VPOA 2DMPA 1FJ6A 4CH7A 4A5NA 1ZN2A 3FXLA 3HOWJ 1FPDA 1F5TA 2A5TB 3D5SC 4ZTJA 4U0WA 4CZZA 4L0ZB 4F3BA 3WE2A 2BY1A 3Q25A 4V19K 2DODA 3MQ9A 4IOAF 4OAZA 1FWZA 2Y7IA 4GWOA 2Q9TA 5F24A 2OUMA 1LEVA 1IMDA 3KOSA 1R4MB 1ORKA 2UXXA 2P1SA 3H7MA 4A69C 1MDMB 2FMLA 2FBPA 5HS9A 4YU0A 3CDLA 1BP5A 3FXJA 2YSRA 2D1HA 2CMPA 3S16J 2R6GE 1SEUA 3FKJA 3HYIA 2UXAA 4KUMA 4GDFA 2LOOA 2CEXA 3QP5A 3OS1A 3DPTA 3B6QA 3NOHA 3EHUA 3FJ7A 1T56A 1OCTC 4G2ZA 4LP2B 1JW5A 4E4HA 1SD5A 1MXXA 5ET8A 3KLNA 1ZLKA 3FZVA 2ME0A 5HDKA 1JI8A 3CCLI 1CGPA 1BKAA 2PX9A 1FNNA 4KI0E 4U4XA 4MBPA 4G6DA 2W85A 4A6EA 4CYCA 3JRBA 1FOKA 2JVHA 3AG1H 1LFHA 1ON2A 2JUGA 3TYHA 5E1ZB 4ZH4F 2F5CA 3W15C 2DOFA 4M1VA 3IP4B 4R2FA 1G59A 4XORA 1OCCH 2XF7A 1ETOA 2EB7A 2FD5A 2XXVA 4YZZA 5TPAB 2DE2A 3T96B 1W36D 4MCOA 3W2WA 1JQFA 1J7KA 3MPKA 2DE3A 5HLIA 3FVNA 3IFAA 3EUHA 2XGCA 1NV3A 3CG1A 3F11A 3L2UA 3GYYA 2VJ4A 1FBPA 3WG7H 3IWZA 2LLKA 5EQAA 3C4MA 3G1LA 4G7OF 4XRFA 2Q88A 1YTYA 2V3QA 4NWDA 2KMUA 4JVDA 2X7QA 2BV6A 2JWTA 1FBUA 3ZMTA 2VI6A 5K7ZA 1U5TC 3CCJI 4LQ2A 2VOPA 2VQCA 3TQWA 1PJRA 3NEUA 2D2WA 3HRUA 1LBBA 1VQ4I 3OYGA 5J1UA 4V2FA 3CCEI 3RPLA 4HQEA 1AKHB 2DT5A 3DQVC 3FUZA 3VWBA 1H0MA 4B48A 3F8BA 2NVUB 4DQ2A 4DXCA 3WHBA 5EHMA 2F3BA 3ZKKA 1JUPA 5CVIA 3RKXA 4BEHB 4OVSA 1LAFE 1L5TA 2M7BA 3MZ1A 3TMOA 3IH3A 5EEGA 4A3LJ 3H6TA 1KU9A 3OYAA 5IM2A 1QZYA 2KHMA 3P9IA 1NUWA 2XXUA 4E0XA 4JOMA 3ZMZA 2GAUA 4YG2F 4LLGF 1JJ6C 4CHUA 4P1EA 5ICQA 4QBAA 4IEJA 4UUSB 3ZXSA 2D3IA 4WEPA 2B0LA 3QUJA 4HF2A 4M6XA 4I0BA 5LRSA 4LG0B 4TLLB 4ZZEA 3ABKH 1A6IA 2L7FP 4LN5A 1UJ8A 2Y75A 1EA3A 1UHWA 2GOMA 4NC7A 2G7HA 2VT3A 3KE2A 3FXQA 5GAEJ 3B8BA 2LBFB 4TOZA 2O8XA 1T0FC 1G0HA 3RUMA 3LSJA 4FETA 3EYIA 2F5EA 3D4GA 4PJ0C 1U2WA 4OFLA 2ESNA 4I0AA 4J01A 4RDUA 4ESXA 4LIVA 2CQQA 4MGRA 4MQVA 2OCUA 4RAGA 1JNFA 1MNMC 2IGMA 2ZJ2A 4X04A 4HLXA 3JAMK 1ZMGA 5ITPA 4WF2A 1B8IB 1US4A 5I59B 5GTIC 2KKOA 1MZBA 4PGHA 2NOJB 4LK0F 3TKYA 5ITOA 1MY4A 2DQVA 5F64A 2AYSA 2DOAA 4F1YA 1Y0NA 1XB4A 4MH5A 3FWEA 1SYIA 1P4XA 3L7WA 1RR7A 2F4IA 3X2QH 1FQBA 3PO3J 4DIQA 1D5YA 2R7UA 5EYGA 3B6TA 2EZIA 3QODA 2JN6A 4OOIA 1W36C 9ANTA 2DQRA 2OWZA 2KJCA 1EH6A 4RGRA 2LK2A 1A99A 3BR0A 3T66A 4XRMA 3HUGA 4DNCA 2B65A 2LNBA 3WTSC 3PFIA 3B73A 2C6YA 4PETA 4PFWA 4M3EA 2HKOA 2UYFA 2FBKA 1B40A 3BOQA 3WU0A 5J8CA 1NNKA 3OYEA 3OL4A 4IO6A 3BR6A 1JW1A 3OEMA 4EXLA 5ICTA 4IRGA 4BAYA 1DGWY 4GXSB 3SERA 2H25A 3S15J 3ZQGA 1W5TA 1B3GA 3K4UA 1ZK8A 2HXRA 1X4PA 3TBIA 3OY9A 5DEXB 4AU7A 1TLHB 3JRHA 4YICA 1W1WE 3GWZA 4FISA 5L3BA 3VVFA 4XMYA 1SVMA 1X58A 3ASNH 3R61A 2XC7A 2HOTA 3IUOA 1MY3A 2RCBA 5I57A 2KIUA 2AIXA 4QHQA 4BXUA 3OYJA 2E7XA 3F23A 1TT0A 2Q89A 3R7XA 3VFJA 3FM5A 3ZMUA 1G2HA 3KG2A 5CVVA 4GWZA 4IO2A 1LKXA 4NG7A 2QSHX 4A3MJ 3T8RA 1U6GA 1EYIA 4QFLA 1IXGA 2RREA 4XFEA 5CRYA 3EPEA 3QXMA 4RA2A 1PBPA 1FY7A 2Y9YA 4I6ZA 4NF6B 1WPKA 3OL3A 2QVOA 4LK1F 2F36A 4XQFA 4U21A 2F5VA 1S7AA 2X1DA 4KT5C 2P3NA 5ICCA 1MJ9A 4LFUA 4N17A 1LDDA 4V2GA 1K4TA 2AS5F 3F9KA 4UV9A 3M3YJ 1S50A 3IFCA 3T9HB 2WAEA 5KDTA 2HS5A 5F0CA 1BN5A 4F22A 1OVBA 2GM4A 3UK4A 4I02A 3IH2A 3A03A 4BDNA 3U21A 4Y52J 4ZZAA 3F21A 1S8NA 1ZH5A 4H6DA 2WC2A 3Q3SA 2VPLA 1P7JA 3JREA 1YIJI 2P2AA 5JHUA 5I56A 2KP6A 1CF7A 2QKMB 2X4HA 2P4WA 3JV9A 4PDKA 1WH7A 1WKMA 2I5UA 4AD9A 3I9V2 3K4MA 1T33A 3N5LA 1P1NA 4M3GA 1FYLA 1CE2A 2Z22A 2M45A 3MP6A 3HOYJ 1MBHA 3CVGA 4YMAA 2E5ZA 4ZDPA 1W7PD 2NRAC 2NXOA 4OINF 1B3LA 3DTKA 2MW8A 3T0JA 3B02A 3H9QA 2F5XA 1JTXA 1BBYA 3ZS6A 1S7OA 5LHHA 2V7FA 1M5BA 2FE3A 4XLHA 1S7EA 1KWHA 4JWYA 2X1CA 4FX0A 5M2VA 5F1RA 1KYWA 2QQBA 2FBIA 3UR3C 1FBDA 3RTRA 2F7AA 1TZLA 1MXYA 4AVPA 4FT8A 4RM2A 1ZLQA 4PBHA 3CUQB 1V55H 2IJLA 5J8FA 4N6KA 4Q0CA 5AIPA 1VQ7I 4PC9A 2CQ7A 2OK2A 3BP8A 3T9UA 5E3NA 2HOSA 2FEZA 2AHQA 3F8MA 3HB9A 3WAFA 3M7GA 2OPTA 1RPWA 2OCCH 4PFIA 4R8HA 4B09A 1GV8A 1B05A 2CJJA 2ZNUA 2RNJA 2HQRA 1Q1HA 2IA0A 4OWRB 1J9IA 2W4SA 1GGGA 1LAGE 2GHAA 1JW4A 3PUYE 2K4BA 3ZMDA 3O29A 3S2DJ 5FLVA 1FBGA 2PT2A 3PNTA 1KU3A 5LTCA 1XMKA 1PUFB 4HW0A 5HS7A 5EEHA 1NV1A 1MMDA 1O7FA 1E0EA 2X7PA 1Y3QA 3RZDJ 2Y7PA 1VQKI 2HVSA 4GX6A 4XLNF 3Q9SA 4RAYA 4CSWA 1X1PA 2EZHA 4M3BA 2UUZA 1R9LA 1TT1A 3GMEA 1YYZA 2DWJA 4KCCA 1ULYA 1WH5A 4RMNA 3LAPA 3FD3A 3L2QA 1LBWA 5J1DA 4GCVA 3S9EA 2QS1A 5TISC 2EH3A 1A54A 2M2EA 3K4LA 3NWTA 4AM3A 1R6ZA 2X51A 3GXOA 2XWOA 1WVRA 2L4AA 3A09A 4GXAA 2D1VA 3HOUJ 4BDLA 1OCPA 1LUJB 3WTYC 1BC8C 2JK3A 3BR3A 3FXMA 4C30A 2ZFUA 2NS8A 3MEXA 3HEFA 4I98B 4EJWA 2PI0A 3H92A 1YXIA 2CUEA 1UG2A 2FQ3A 2QWWA 3K2ZA 4PJNA 4I9DA 1QGXA 1P7IA 2DXYA 3OIQA 5HDNA 3K4CA 4KA4A 3CCSI 4ZJZA 5DUKA 2Q2AA 2I0BA 3OR2C 4HPQA 5ISUA 5DCMA 3M3FA 4U2RA 4EXKA 4ELRA 4P96A 1XG1A 4H45A 5EQ8A 2HNHA 2V3TA 5EG0B 4Q47A 4PJLA 2NS0A 1QULA 2QS2A 2F4OB 3CP8A 2L9SA 3NRVA 1UQWA 4IHVA 2UYEA 2WY7Q 5DM6F 4HX7A 2O61A 1B59A 2DDKA 2CZKA 1J5YA 1Z6RA 1ZJLA 2F5FA 3BY6A 3MKZA 4PJMA 1FZPB 4R75A 3K6GA 4RBOA 5ESYA 2EQRA 4LMYA 2ID3A 4C9YA 2ZBKA 4PGPA 4DZ1A 3BR2A 3HRTA 2GFEA 1I6AA 1DBZA 1D1BA 2VJJA 4JWOA 2OTLI 4FAJA 2AO9A 2KL4A 2ZNZA 1EH7A 2LC2A 3QU6A 1J0RA 5AA1A 2MKZA 5DD8A 1I69A 3DELB 4PFBA 2EILH 1YIOA 3CF5F 1Y4TA 1XC1A 3TO7A 1ZRFA 4KITB 1MH4A 1MD0A 5GAHJ 3CP2A 4C2UA 2LKSA 4MIJA 1XGSA 1P9QC 2O9LA 3FXBA 1GXPA 2RGVA 2QM3A 2VLAA 2VBYA 5CVJA 2VUMJ 1IRXA 3OYFA 4EGYA 3I0TA 2Z8DA 1O4XA 3LSLA 1YO5C 2IA2A 2W00A 3BR5A 1Z77A 3BJ6A 5LEJA 1SVOA 3OD7A 3S2VA 1JHHA 4JX4A 3H3GA 1USYH 4L5IA 1Y4CA 1F1ZA 4U7DA 2QSGX 3GYHX 2OU2A 4I76A 1V5EA 2M87A 2O7UA 4JBZA 4KD5A 4YKKA 2EK5A 5L9SA 5JK4A 5E3LA 3DKXA 2A6TA 3EN3A 4JB7A 2VXZA 4A3IJ 2EZKA 3BJOA 3P7NA 3DPLC 4ESBA 4B8XA 4AWXB 1KA1A 2VD3A 3C7JA 4A12A 3U93A 1YQAA 2VKDA 4RYAA 4EQ9A 4CCMA 5K7FA 3KC0A 1I6QA 1LDKB 1FTAA 1N3XA 4XKPA 4A3DJ 3TMGA 2Y30A 1R9QA 3A4CA 2E2IJ 3H9JA 1WJAA 2GIZA 3A3UA 4R6YA 3KP5A 5EHSA 5I2NA 3S9NC 1R4NB 1T95A 2I58A 4ZZLA 3ONQA 3W6KB 3O2AA 4G6QA 2E1SA 2FXAA 3HRMA 1AHDP 1P2FA 1TT5B 2L9NA 4IPAA 2ZNSA 4UUTA 3PMXA 4BJ6C 2CSOA 4N91A 1ZGAA 2BW3A 4H5FA 4THIA 3EDPA 2RNGA 3LWFA 4JSDA 1F36A 5LHIA 1H45A 3KBRA 5LGTA 2KLFA 5CBSA 4ZEDA 1P92A 5ILVA 3SDGA 2DK8A 2M8EA 3H5AA 2FA7A 2O5RA 4JX6A 4LB6B 4BHPA 4IOCF 2JQ7A 3MZ9A 2JA7J 3DLNA 3DLLF 3OIOA 1Y1WJ 1W7PA 2VGQA 2LREA 1HA8A 4Q5TA 2NAZA 4Y13A 3VYTB 4JXIA 1G6NA 4MFDA 3F6VA 3GFJA 2WYKA 1D0XA 3I55I 1MPBA 4QFOA 3K0VA 3TTKA 4XLCA 5FHOA 2XUBA 1W5CC 2P7VB 2OAZA 1WHUA 1H89C 4IQ4A 5J6XA 2ISZA 1O63A 2E19A 2LG4A 3LSWA 3P7IA 2B4MA 4LA9A 1G3TA 2H9BA 4H8IA 4P3LA 3S3MA 2LR8A 2MLKA 1ZTRA 1MW7A 3F8FA 3TDUC 1K79A 1B52A 5JR3A 1Z1DA 1H43A 3HOZJ 2XD2A 2F4MB 4JWXA 4HRIA 4F3GA 1GV5A 2Z1DA 4BACA 3F3XA 2JRMA 2L4MA 2O6AA 5BS6A 2LKXA 1WJDA 3AG4H 2ZC2A 4G61A 3DWLE 3D0SA 5FRNA 3E78A 3VLUA 4N9IA 2VODA 2XROA 1NKXA 1P1OA 3LMMA 3BTLA 2V9KA 1FPQA 4RS8A 1OQGA 4A2UA 1QKAA 2ID6A 4EM0B 1Z7NE 4HOBA 2JSPA 3MVXA 4NBQA 1NNTA 1ZHFA 4EQ7A 4XK4A 1ENHA 3LFUA 2RC4A 3TP0A 1S3JA 2MH9A 3I4NJ 2VL8A 1F43A 2M4KA 1TQMA 2R5ZB