3FXXA

Human epha3 kinase and juxtamembrane region bound to substrate kqwdnye[ptyr]iw
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
299
structure length
288
Chain Sequence
b'TQTVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITAARPSNLLLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-A receptor 3
publication title Structural recognition of an optimized substrate for the ephrin family of receptor tyrosine kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 288
sequence length 299
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fxxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fxxA01
4C3FA 4I6HA 1YWRA 3DJ6A 3OBJA 5CSPA 3E8NA 3SG8A 3FZPA 4JDIA 3SRVB 3QUEA 4RVTA 2VNYA 3V6RA 4PMMA 4F7NA 4TWPA 5DGZA 2IPXA 4U80A 3KRRA 4MXXA 4RIYA 3A7FA 3PIXA 4LGDA 3MY1A 4IM2A 3BHTA 3HKOA 3W2QA 4XV1A 3DLZA 1WAKA 5CQWA 3PXZA 5HLNA 3PA5A 4D4YA 3UOKA 2OJJA 5ETFA 1G8SA 3HUBA 5CAUA 1M17A 5CWZA 4AT3A 4XG9A 3VQHA 1OL5A 4FKOA 4ZTLA 4XG6A 1H0WA 3QTXA 4JDHA 2BAQA 3MN3A 2RSVA 3QHRA 1YHSA 2V0DA 4AFEA 5GINE 2BTRA 4A4OA 4TL0A 4TYGA 3G9LX 2W1ZA 4QMLA 4K9YA 5CZIA 2W9FB 3COKA 4FGBA 4RQVA 5AV4A 2UW4A 3SQQA 4I24A 3GU5A 3V8WA 3KB7A 3LVPA 3W33A 3ZH8A 3OT8A 4MWIA 4GU6A 3SHEA 4IJ9A 4ANQA 5JGBA 5IQEA 4L00A 2R9SA 3UNKA 3AGMA 3F66A 2G01A 3FLNC 4JVGA 5CU3A 2QI8A 4FSWA 3R00A 3NUAA 5HIBA 1OKYA 3DB8A 4KD1A 4PDYA 2OK1A 1A06A 5GIPE 2WQEA 2X7OA 2UV2A 4WSQA 4FTJA 5DHJA 3BU5A 4Y83A 1GIHA 4ERWA 1RQQA 2BRMA 2IVUA 4IMYA 2Z02A 5J8IA 1V0OA 1R1WA 3GOKA 3MW1A 4YHTA 2Y8OA 2P33A 2C3KA 5BUEA 3D5WA 5A6NA 3GU4A 5FDXA 4QQJA 4J95A 4DBXA 1KE7A 3BEAA 5KZ0A 1YXTA 3IK3A 5B2KA 3OCBA 4J97A 4K1BA 3AC1A 2EXMA 2BUJA 2FYSA 4YNOA 5HG9A 5L6WL 3EQPA 4ANNA 2VWWA 3OOGA 2JIUA 2VWVA 2W1CA 4OTIA 4F0IA 4MVFA 4AACA 2WQNA 3CE3A 2WTDA 3FV8A 3KN5A 4FTCA 4GJ3A 1R39A 4NIFA 4ZP5A 4HOKA 1Q41A 4L43A 2YIWA 3HMOA 1JLUE 1Z9XA 3PY0A 2F9GA 4IADA 4U81A 4FI1A 3F3ZA 4IFCA 4U3ZA 3OEZA 5ANEA 5FEDA 5I3OA 2JDSA 2QNJA 4WT6A 2PVJA 4YTCA 5IQDA 4EK3A 4KIKB 2AYPA 3UPZA 2YJRA 4WUAA 4CKRA 4ZMEA 3CJGA 2VO6A 4BDEA 2GDOA 5HNIX 3S2PA 5HG8A 4ENYA 2QURA 4JL9A 5M08A 4FSNA 5A3XA 1W83A 2FH9A 2V7OA 4AGWA 4QMPA 4LL0A 4I0RA 3IG7A 4C38A 2XS0A 1H24A 3KULA 2RFSA 5EI8A 2UZBA 2UVYA 3EN4A 4HNIA 4HYUA 4N4SA 4QD6A 4D2TA 1QPEA 1IG1A 2VX0A 1QPDA 3A4PA 4L3JA 5F1ZA 1LEWA 5IQIA 3GU6A 5JRSA 4BCQA 5CT7A 2ITNA 5CALA 2QLQA 2WQBA 1P2AA 3M1SA 4YSMA 3FXXA 3R71A 3VUDA 4YZBA 4EK4A 2HOGA 2PVKA 2W1IA 3EN5A 5G6VA 4ACDA 5KKRC 2PWLA 2Z60A 3V8TA 3F88A 2BROA 2WMSA 3CSVA 4AOTA 4E6QA 4ZSGA 3K3IA 4G6OA 5D41A 3GENA 2XBAA 5FBNC 2HW6A 3TNQB 3TKUA 4CXAA 3MH0A 5L2IA 5ACKA 1W84A 1YWVA 3MFSA 4QMYA 2W5HA 1RDQE 1ZYLA 3VBTA 3ZBXA 2OFVA 2HYYA 5L2WA 1T46A 3C51A 4CTCA 3MTFA 4ASEA 2OI4X 4BI0A 1RE8A 3NAXA 1OPKA 4YHJA 1OVEA 2WPAA 3Q32A 1KOBA 2CSNA 4XRLA 1NVQA 4YC6A 4GMYA 2XYNA 5IDNA 3POOA 2J51A 2QOKA 4F9YA 4CFFA 4CNHA 4DEHA 5HLPA 2QHNA 5M55A 4DYMA 2F2UA 3VNTA 3DDPA 3TDVA 1ZYJA 1S9IA 5FGKA 4QMMA 4IAZA 4JQ7A 3FXZA 3UQFA 4FTLA 4QOXA 2Y4IB 2PVRA 3GGFA 3V5WA 4WRGA 3T3VA 4KSPA 4BC6A 4D28A 2NP8A 3EN9A 4FOBA 1RJBA 4QNAA 4UMQA 3A2CA 2Z7RA 4IH8A 5HHWA 2C3JA 3RM6A 5CEMA 3GNIB 5I9WA 2JBOA 4FKGA 5FG8A 5T3QA 4BZDA 4DFYA 3ZM4A 3E5AA 3ZEWA 5LMAA 5AJQA 1WBTA 3QZFA 4AA5A 1Q61A 4BBEA 4EYMA 4YZMA 5TF9A 4AGDA 2EB3A 3PA4A 3GC8A 3I7BA 5AP2A 3BWJA 4O1OA 3Q60A 4FV5A 4G6LA 4X6RA 4OT5A 4IM0A 5BVEA 4AP7A 5IH5A 3AMBA 2R3HA 2A4LA 4EHEA 3KRJA 5HX6A 3D2KA 3LLAA 4FKWA 2YHVA 4JBVA 3DKCA 4MQ1A 2VWIA 5IH4A 3UOLA 1WMKA 2VTAA 3B8QA 4EORA 3BYSA 3LFDA 4DA5A 3HA6A 4I5PA 4X2NA 4DE4A 3PZEA 3LZBA 5EYDA 4L7SA 4HPUE 4XV9A 3IPHA 3VJNA 4IVBA 3S3IA 3SG9A 4CZYB 2VGOA 3MPMA 4BDIA 2WKMA 4DITA 3TZ9A 4FV0A 2W5BA 3RPOA 3BCEA 2R64A 3DOGA 3GC9A 2FSMX 1O6KA 3R7VA 3N4TA 2UW0A 2XIZA 4J52A 5GZ8A 3RALA 3BZ3A 1QMZA 3W2CA 4WRSA 3E62A 4OTRA 4RIWB 3UPXA 4MK0A 2PMLX 4CFVA 4MNEA 4NK9A 4RBLA 3CQEA 4O22A 5EHYA 3ULZA 2WTVA 4L53A 4Q9ZA 1WCCA 2Y6MA 3DQWA 3ZUVA 4Z3VA 2W1EA 5H8GA 5JFVA 3KC3A 1KV2A 1ZOGA 2FA2A 1H27A 4E5BA 3VW6A 4USFA 1XH4A 3EFWA 5KX8A 3EH9A 5E8ZA 4I94A 5CNNA 4NFMA 3PP0A 2R2PA 5AFVA 4DTKA 3GQIA 2W96B 4UMUA 4U97A 3VF8A 5EQEA 2C6LA 2UVZA 4FVRA 3OD6X 3OFMA 2O5KA 4XJ0A 3S4QA 1UA2A 4UWBA 4BZOA 4EK8A 3OWJA 4M68A 4IE9A 3ZBFA 1OL2A 3KXHA 4BWPA 4F65A 4QYGA 4C62A 3G90X 4ANMA 2BZIB 2ZAZA 3BEGA 4YTHA 1FGKA 3LPBA 4PL5A 1G8AA 3HECA 3WF7A 4GIIA 2XKEA 2WFYA 4XG8A 4DC2A 4B0GA 4U7ZA 1PMNA 5AV0A 3RCJA 3WZDA 3MJ2A 1M7NA 4DFNA 5JH6A 3Q5ZA 4YJOA 4KBCA 2PVHA 3KL8A 4QQCA 4OTPA 4YMJA 3CC6A 2OF4A 1J91A 5AUVA 3R0TA 1URWA 4U9AA 3R8UA 4HCUA 5I9ZA 2X7GA 3VC4A 3JVSA 4FZ6A 2VTRA 1SM2A 4FKSA 4FL2A 4PY1A 1G3NA 1PW2A 2XK4A 4WA9A 2YLEA 4QP3A 4RJ6A 4ZSEA 5GJDA 4BIBA 4E26A 5J1VA 3A7GA 3TCPA 4EH2A 3DY7A 3LFAA 1FMKA 3R8ZA 4DG3E 2I7QA 3V5QA 4NCTC 3QWJA 3RZBA 3C5UA 3TL8A 1CMKE 4MWHA 4ZZNA 5AUWA 4D2PA 4P5ZA 5H9BA 2BVAA 4EOJA 4DEIA 5C26A 5HBJA 5AR3A 3AT4A 2HY81 4ARKA 4BIDA 4IWPA 3GU8A 3KMMA 5CSWA 3VRZA 3ZC5A 3BQCA 5GIOE 4FKRA 4D2VA 4EC8A 3OG7A 4CGAA 3KULB 4FZFB 3ZFXA 4UYAA 2HY0A 5CU4A 3EQDA 2C47A 1LPUA 3EYGA 3ZC6A 4Y46A 3ZSIA 1OZ1A 3FY0A 4Y72A 5L4QA 3WIGA 2C0TA 4C0TA 5J7BA 4ZTQA 4YTIA 2JDRA 2UZVA 3FMMA 2PUPA 3U55A 3E63A 5DA3A 2ITVA 5AP6A 5E8VA 3BHUA 4ZJJA 1K9AA 4YURA 5KMOA 1TQIA 4BYIA 3O17A 2AC3A 5A4TA 4FICA 2YM6A 3EL8A 3W8QA 2JIIA 3OY3A 2ZVAA 2OFUA 4GFOA 4IJPA 3LXLA 3FYKX 4M97A 4OTGA 5TE0A 5J9LA 1R3CA 4KBKA 4C37A 3FMHA 3COMA 3PXKA 3GB2A 4WOVA 4NM5A 3LOKA 3VJOA 3IW5A 2XF0A 3MA3A 4G3GA 4E5AX 5L6PA 4M67A 1VYWA 1BKXA 1O9UA 1SNXA 2AUHA 2XRWA 3TV7A 3V04A 5BYYA 5E9EA 3QD3A 1NXKA 4QO9A 5IPJA 4CVAA 2EUFB 1J7IA 4NCTA 2YZAA 3K5VA 3BPRA 3U4UA 4BDKA 2VX3A 4D58A 2OJFE 5ANOA 2WTCA 3R63A 4JQEA 4BYJA 5C4KA 3O0GA 4TKSA 1ZOEA 2WMQA 3NNWA 3FWQA 2XCKA 5GJFA 3BGPA 5CI6A 2BFXA 3EL7A 3QGYA 4PL4A 5FP5A 1GZKA 5K3YA 4IB3A 4LI5A 5E1EA 3QUPA 4G6NA 2BKKA 4CG8A 3QF9A 4XOYA 3I5NA 3NRMA 3UIMA 2ZV2A 3PVBA 2B52A 4F1TA 2WTWA 3VRYA 2W1GA 2CGWA 5FRIA 3QTUA 3KVXA 2OLCA 3CY2A 3R21A 4M84A 3FHIA 3SV0A 1FGIA 4FTMA 4NH1A 5LCJA 2GQRA 3QC9A 1ZY5A 3FAAA 2GQGA 1XO2B 4GFMA 3PVWA 1GZOA 3WOWA 2P4IA 2I0HA 5LMKA 1MP8A 5JGDA 4BCGA 2PVLA 3DQXA 5FEEA 1BYGA 2XNPA 2WQMA 4MXYA 3V5LA 4EQMA 1OIUA 2ZMCA 4YGAA 4R5YA 4CFXA 3L8SA 4FIEA 4O96A 1JSUA 1XH6A 1SZMA 1JBPE 3KXXA 5DLSA 4JJRA 2LGCA 2HENA 4OTQA 5D1JA 1SVEA 3LKMA 2OH0E 1F0QA 2XIYA 3F7WA 4AWIA 2FVDA 2BMCA 2WOTA 4JG8A 5K4JA 4NEUA 3KF7A 2R5TA 3KFAA 1P4FA 3RINA 1AD5A 2ZB1A 4TY1A 3PE2A 4FKQA 1Q8TA 1KE8A 2XA4A 3TTJA 3K5UA 5C1QB 4DF3A 2IJMA 3LM5A 4IW0A 3PYYA 1R78A 2J2IB 3LFCA 4UZHA 3QRTA 4AN2A 4E4MA 2UZEA 5EDRA 2RGPA 5I9XA 3FPQA 5K0KA 1VR2A 2G2FA 2WB8A 3KRWA 3NIEA 4BCHA 2J6MA 5HIDA 4MNEB 1MUOA 1YDSE 4FV7A 5DR6A 4J7BA 4BDAA 4EQUA 3ORPA 3EIDA 4FOCA 3PJ1A 3EOCA 3KGAA 4U41A 3SRVA 4ITHA 4JBQA 4ZJVA 5CI7A 1PYXA 1WBPA 4PRJA 3PSBA 2A1AB 3MH1A 4M0YA 2X9EA 3MVLA 5EHOA 5LARA 4WNPA 4S33A 4FODA 4B6LA 1NVRA 4IDVA 2F2CB 3ID6C 4J1RA 1H28A 4I6FA 2Y6OA 4DAWA 2QCSA 2WELA 2WAJA 1JOWB 3PRIA 3AXWA 3SKCA 4U44A 4E7WA 4O84A 3QRUA 2W06A 3SDJA 3MTLA 3UVRA 4IB1A 4OBPA 1ZLTA 4EHVA 4EKKA 3I60A 3BYOA 3LJ1A 4NZWB 4PUZA 3EFKA 4AUAA 3E8DA 4EH3A 2B9FA 3MFUA 4R5SA 2Z8CA 1S9JA 3KMWA 3R2BA 4G9RA 5BNJA 1OGUA 3QAME 4G3DA 5IA0A 1FPUA 1U5RA 3Q4CA 4RGJA 4I0TA 5EW3A 3QQUA 5FDPA 5J9YA 1X8BA 1OKVA 2C0IA 2JC6A 3QTQA 4PDPA 4RFMA 5CNOA 3ZFYA 3KA0A 3KRLA 5EKNA 4O0VA 4RMZA 1YOLA 4KIPA 4G3FA 1QCFA 3TEIA 2CJMA 2GTNA 3KY2A 1LEZA 4RPVA 2ESMA 3QXOA 3TNIA 5BVNA 2P0CA 3DS6A 3KKVA 4JT3A 4V04A 3DCVA 3F2AA 3NR9A 4QRCA 4IAYA 4RJ4A 4C4IA 4O7NA 3PIZA 4M14A 3WF6A 3RAIA 4G34A 1DAYA 4LGHA 3HMNA 3VUKA 4ZK5A 2XH5A 3JS2A 4GVJA 5K4IA 1H25A 4RT7A 2O3PA 3EWHA 4XHKB 5A54A 5EI6A 5L2SA 2PK9A 3A7IA 2F7EE 3QD2B 3EB0A 4YLKA 5EH0A 5K9IA 3ACJA 3RHKA 1PY5A 5KMJA 1OM1A 4MTAA 3I79A 4AZWA 4IZ7A 3BHHA 4D9UA 3GVUA 2ETRA 3LCOA 4E1ZA 4GKIA 3GC7A 4PNKA 4YZ9A 3GEQA 4I0SA 2GQSA 3FLSA 3GBZA 4QPAA 5DVRA 2XIRA 2C6KA 3H9RA 1E1XA 4G3EA 3ORTA 5CQUA 4ANLA 3VN9A 3FPMA 4D4RA 1BX6A 4ANOA 3TV6A 3AD4A 4K0YA 2GU8A 4ZXTA 4F70A 5LVNA 2R3MA 4ALUA 5B2LA 4DH8A 3SD0A 4JI9A 4A7CA 4ITIA 3ANRA 4O7RA 4AF3A 2A27A 4R3PA 4KIKA 4LRMA 4DH7A 3TZ8A 3R9DA 5CU6A 4O0UA 2UZNA 5I5ZA 2YCSA 4O86A 4DT9A 4LV5A 4IACA 3FZOA 4U3YA 2UW5A 1JSTA 3UG1A 3ZTXA 4DH5A 4ZMFA 2I6LA 2Y4IC 4K2RA 4KINA 4WNMA 4XYFA 4TYJA 4BDDA 4UX9A 3GCUA 4FTRA 2QD9A 2ZV9A 3MGYA 4N70A 4XG7A 3U6JA 4O83A 4IAFA 4A9TA 3QA8A 1OIYA 3PLSA 3IKAA 4L42A 2JGZA 3AG9A 3KXMA 4YJQA 4OT6A 2QVSE 3VUGA 5M4IA 3NEWA 2IN6A 5K0XA 1OL7A 3T8OA 4PX6A 1W98A 2OIQA 3OTVA 5EG3A 4KSQA 3FI8A 5F95A 4AG8A 2XJ0A 3Q4UA 4IVAA 2BHHA 2X1NA 2HW7A 5BUJA 5E8XA 3C4XA 4H3QA 4QYHA 4C33A 2XNMA 5HX8A 3ZCLA 1XBAA 4UXLA 2F4JA 5CF8A 4G5JA 4Y5HA 3UO5A 3ZO3A 1WVWA 4ASZA 4WUNA 2XYUA 3IW4A 5M44A 4Q9SA 2YAAA 2W1DA 2G9XA 4C4JA 4RRVA 3CS9A 3V3VA 4J71A 3DAJA 4BHNA 4ZTRA 3JVRA 3QUDA 3L9NA 4D2RA 4AZFA 2XIKA 4TT7A 2XK7A 4FSQA 5CAPA 3Q9XA 4FC0A 3L9MA 1UU3A 4FTUA 4QPMA 2OZAB 1Q99A 4GK3A 4BDJA 1SMHA 2GNGA 4PWNA 2G1TA 5J87A 3V5JA 4DEGA 4ANSA 2X8DA 3ZXTA 4DEBA 4RWIA 4CSVA 3RTPA 2JDVA 3FQSA 4J53A 4B9DA 3AC3A 1SYKA 3DBFA 3FC1X 4AT4A 3FLQA 3TZ7A 1BMKA 2UZUE 4QMWA 1U5QA 5CF6A 5I9VA 5IU2A 4MEDA 3H30A 2BRBA 3DK7A 2CGVA 4AW0A 1M2PA 4FV4A 5AM7A 4EONA 3R1NA 3TACA 1BUHA 4BFMA 1M2RA 2JAVA 5I0BA 3Q6UA 4TNBA 3U8WA 4FKLA 3Q9WA 3FZTA 5ANIA 1TVOA 3CKXA 4UV0A 3ROYA 5IQCA 3QZIA 1M7QA 1OBGA 3RKBA 1UNHA 1WVXA 2UZOA 4YO4A 5A4QA 4MF0A 4O0XA 2G2IA 4V0GB 4G31A 3CJFA 5AP4A 4I1ZA 4UALA 4YNEA 4DTAA 3QRJA 1FMOE 3LMHA 2WD1A 4LOQA 3QKMA 3D15A 4PDSA 1PKDA 3F82A 3QLGA 1O6YA 3RPYA 5EQYA 5CT0A 4AW2A 4CEGA 1FVVA 3CGFA 4R7BA 1URCA 2NRYA 2BIKB 2BZJA 3KREA 4A9UA 3BE9A 3HUCA 1JPAA 3DKOA 3CD8A 1R0EA 4EZ3A 3VS4A 3WILA 3TZMA 1KUTA 3FQHA 2O63A 3OROA 3KCFA 2C1AA 4MXCA 4GRBA 4FSZA 4PDOA 3C0GA 5BUIA 1V0PA 4RIWA 3IW6A 4HGLA 2VUWA 5CS6A 4BDCA 4GT4A 3E88A 3THBA 5BMSA 1PXNA 3DXQA 1YVJA 1OKZA 4AZEA 3ELJA 4ZY6A 3NDMA 5IKWA 4ANBA 4F9CA 4RZVA 1PXPA 3V6SA 4PTEA 4ZAUA 3WZEA 4H36A 3CD3A 4JG6A 4FV9A 4A9SA 3DZQA 3LW0A 3LCDA 3OW3A 4D4SA 2DS1A 4AN9A 1FINA 3ZO1A 3H4JA 4I5CA 2UVXA 4QTAA 4LV8A 4QQTA 5CVGA 3FL5A 1H4LA 5JN2A 3IDBA 4BBMA 5DNRA 3V5TA 5JFXA 2EWAA 3E87A 3KCKA 4BDGA 1JNKA 1YRPA 2W1FA 3NAYA 3BI6A 1JQHA 3LFQA 3RHXA 4V05A 3HMMA 5BYZA 5BYLA 2XBJA 2B1PA 4F6WA 5AP7A 5GHVA 3BBTB 5DT0A 3W2RA 2RG6A 4GJ2A 3DLSA 4BL1A 4BRXA 2CNUA 5KE0A 4IZAA 4AT5A 3G9NA 4G2FA 1OUYA 3FZRA 1JSVA 4ZLYA 2ITZA 5CEQA 2EXEA 4AX8A 2X7FA 2J0KA 4ZOGA 1FVTA 3R7OA 4MX9A 5E8TA 5LXMA 1H08A 3BLHA 2WMBA 2YJSA 4BCJA 1XR1A 3MB7A 4AU8A 5B0XA 4YJNA 3TG1A 3RCDA 5CX9A 4TWCA 1Y91A 5ICPA 3I5ZA 4O7ZA 1L8TA 2DYLA 4GVAA 4OBOA 4C4HA 4EH6A 2CPKE 3I0OA 3G0FA 5CU2A 5AUXA 3FKOA 2XK8A 1YKRA 3RWQA 4L68A 4EOIA 1YXUA 4CG9A 5J95A 3ULIA 2PVFA 2W7XA 3SX9A 2OIBA 1DM2A 2IW8A 5A4LA 2PUUA 4FNWA 3IQ7A 3MDYA 4FKPA 3BE2A 5IQAA 2WU6A 2VNWA 3H0YA 3R30A 2I1MA 2XUUA 2VTNA 4GYGA 4X2JA 4AS0A 4IWQA 1Y6BA 5JEBA 1PKGA 5EYCA 2YABA 4FIJA 1OKWA 4NYEA 2PHKA 4KABA 3RMFA 2JKOA 2QOQA 2RL5A 4FEWA 4R6VA 4GK2A 2BRNA 4ASXA 4K18A 3ZLWA 3LCSA 5LWMA 3PJ3A 2CNQA 2UZTA 3KF4A 4FKJA 4MD7E 3NVKI 1CKPA 5DI1A 2XRUA 2W4JA 4EOMA 1OL1A 4W9WA 5I9UA 3PDTA 5AA9A 1MQ4A 1BI8A 3HMIA 4OAVB 3TNPC 5DBXA 4LRJA 4QP8A 2B9HA 1PJKA 3QTZA 4ZTHA 4JR3A 5HKMA 3RPVA 2QG7A 2H34A 2WMVA 4HZRA 4S30A 4M3QA 1KE9A 3P1AA 2OJIA 3DK6A 3QTRA 4BB4A 1BL6A 4EWQA 5CAVA 2W9ZB 4HCVA 4EJ7A 4E73A 4J96A 4GW8A 4A4LA 4CFUA 3C7QA 5CEIA 4DEAA 4E6CA 4F1OA 2VTTA 4GL9A 5BVKA 1WVYA 4HVHA 2CCIA 5EYKA 3WYYA 1B38A 5BX0A 2C69A 2WU7A 2PULA 4ZZMA 1UU7A 2IVVA 3NW6A 4F6SA 3VUTA 4EC9A 5HLWA 3MY5A 2QG5A 2YIYA 3PG1A 4W4VA 1RW8A 4QMZA 3OBGA 2WGJA 3CTJA 3NX8A 3SOCA 2XB7A 5DEYA 4QNYA 3VBVA 4UWYA 2B9IA 2IW9A 4L8MA 2ZV7A 2KTYA 3DGKA 3S0OA 1KSWA 3QCYA 1CTPE 2B9JA 5AA8A 2UUEA 3VBWA 2VTIA 3QKKA 2ZDTA 4MBIA 4UZDA 2VO0A 2C4GA 4BI1A 2VD5A 3BV2A 4CKJA 3A99A 2HZNA 3DBDA 4G17A 4E4LA 2WMTA 4JBPA 4JR7A 3KEXA 3JPVA 3UP2A 4WG4A 4FUXA 3O8PA 1U54A 3QCSA 4AN3A 4AZSA 3AC2A 1FOTA 3RGFA 3TIYA 4NM3A 2RG5A 4IXPA 4RIXB 1NW1A 1IR3A 4PPCA 4CFMA 5AAGA 3L8VA 4BZNA 3P79A 2YM4A 3E92A 2R0IA 4FIHA 1JKLA 5DG5A 5DT4A 5JFWA 3UZRA 5AX9A 4O27B 2V55A 1YOJA 4ALWA 1J1BA 4O6LA 2DUVA 3OEFX 4IAAA 3HA8A 4JNWA 4DFLA 4E3CA 4F4PA 3QYZA 4L44A 4CFNA 3II5A 5DR2A 3QYWA 3R1YA 2WMRA 3QC4A 4AA4A 1XKKA 2EVAA 3E93A 4PP7A 2V7AA 2X2KA 3WARA 4BI2A 3OUKA 2CCHA 3R1SA 3L8PA 4F64A 1HCKA 3RK7A 4IM3A 4QMVA 2ZM3A 3DBEA 4ALVA 2IWIA 4WD5A 2ZM4A 5HG7A 3O2MA 3QTWA 3UG2A 4M0ZA 5EOBA 3HP5A 4ASDA 2BDJA 4J8MA 4C02A 5IUIA 4ACGA 5JGAA 3ORKA 4FTKA 4U40A 4BVUA 1P4OA 4TYEA 3HZTA 4XMOA 4ACMA 3ENHA 3DZOA 4YU2A 5IQBA 3QFVA 3M2WA 1BL7A 3CKWA 5IA5A 2BZHB 4X2FA 3VUHA 5EM5A 3OS3A 3F6XA 2LAVA 3MH2A 4GG7A 3FMEA 3VUMA 5CAOA 5CEPA 1GZNA 1IRKA 1MRUA 2QLUA 2YN8A 5HBEA 4QYYA 5JRQA 1W8CA 3NLBA 3QL8A 2R3OA 4NW5A 5TKDA 4CD0A 5HORA 4GV1A 3QHWA 3B2TA 4CZUA 5DR9A 3LQ3A 3RAWA 1REJA 3UIBA 4KKEA 3ZSGA 2PYWA 2YCFA 2JKKA 2GNLA 3EKNA 1FBNA 2VU3A 4FTOA 4AA0A 4RVKA 3RK5A 3FDNA 3MPTA 4TYHB 3B8RA 1ATPE 1U59A 3D94A 2PE2A 5HEZA 3S95A 2OBJA 2VO3A 5LOHA 5CXHA 1DI8A 2HWPA 4YUQA 1YHWA 4B99A 2VRXA 4GG5A 3PXQA 1WBWA 1MRYA 4GYIA 4UMRA 1H0VA 5DOSA 4I20A 3LAUA 4Z9LA 5HQ0A 3SGCA 3Q6WA 4QMUA 3UNJA 4CMOA 5IG1A 3ZHPC 4GCJA 4KKHA 3F5UA 3ZO2A 4YBJA 1Y8YA 4KS7A 3DAKA 4JX7A 2QOFA 3TN8A 4AW5A 5M4FA 3RP9A 3IGOA 4HW7A 2Z7LA 2ETKA 4OTDA 3HMPA 4KIOA 4PP9A 1GY3A 3D9VA 3DA6A 3KXNA 4TRLA 4IX4A 1ZMUA 4BKJA 3OWPA 2UZDA 3UOJA 3UMWA 5HNBA 3C50A 3K54A 2C5NA 5HVJA 3NYVA 3EQGA 5K5NA 5HO6A 2XCHA 4F08A 2YFXA 2OG8A 3C4CA 3F5XA 3HV5A 4RG0A 3JUHA 4ZS4A 4FG7A 3P23A 4QMNA 4E6AA 4EYJA 2F49A 1OPJA 2PVYA 5KBQA 4CFWA 4H3PA 3G33A 2O64A 3NCZA 3QCXA 3LJ0A 3UIXA 3R28A 1YWNA 3N9XA 4D5KA 3ZDUA 4MD9E 2E9NA 5JZJA 2J5FA 4QMOA 3PLAE 3KU2A 2J0IA 3HAVA 3TJDA 2UW7A 3DBCA 1PYEA 1WBOA 1APME 2B54A 3BU3A 2PPQA 5I3RA 4UB7A 4G5PA 3EMGA 2J90A 5BVDA 4JBOA 4RFYA 5AMNA 3ZLSA 3A8WA 4FIFA 5LVLA 3A60A 2ITOA 4FG8A 5LMKC 4IANA 4HYSA 4LOPA 4XP3A 5J9ZA 1ZWSA 4IAKA 2B55A 1UU9A 2G15A 2WMXA 4K33A 3TI1A 3PSCA 3U51A 2GFSA 3OCTA 2VWBA 4L67A 3COHA 3OCGA 4JS8A 1PF8A 1W0XC 3PWDA 2QODA 2XNBA 3QGWA 3UODA 4JLCA 5F9EA 3OZ6A 1K2PA 3KVWA 1UKIA 3MH3A 3Q5IA 2XIXA 3OWKA 2GHGA 3QXPA 3R8PA 3RM7A 3ZEPA 4RWJA 3DFAA 3DAEA 4BCOA 3A7JA 1PXKA 3MI9A 4IVCA 4X6QC 2BZKB 3EQCA 4JRNA 2BAJA 4TW9A 5JMSA 2FGIA 4H1MA 2YIXA 4ACHA 4O7LA 4AOIA 3HV6A 2ZOQA 2UW8A 4MAOA 1F5QA 2BIYA 4L52A 4GKHA 3PZHA 2ERZE 2I0YA 3ZMMA 5M57A 4BTFA 3I4BA 5G1XA 2FSTX 3LM0A 3PFQA 4MCVA 4C61A 3L8XA 3QBNA 3ORXA 4UY9A 4ACCA 2GNIA 3ORNA 5KMMA 4DLIA 3W2OA 4FT3A 4W8EA 1QL6A 4EH4A 2CLXA 3MYGA 2QOHA 2XK9A 3VS0A 4MXAA 4EZ5A 2YWVA 4F7SA 4AZVA 2R0UA 3U9CA 3FMJA 3ZS5A 5L8LA 4LL5A 3ZZEA 2JKQA 3B2WA 3EZVA 1U54B 2ETMA 2P55A 2HZIA 3UIUA 5M51A 2QR7A 3WZJA 4FKVA 4O0RA 5HZNA 3JYAA 4CCBA 5B2MA 2YAKA 5AAFA 4QYEA 3MVHA 2OZAA 4DH3A 4M8TA 4HNFA 4V01A 3OMVA 2O2UA 4LMUA 4FT5A 5AIKA 3AOXA 3R7UA 4E4NA 1H00A 3E7VA 4PMPA 1IA9A 4HVGA 4H05A 3LQ5A 3ZFMA 3DKFA 3C4EA 5L2TA 4QTEA 3I1AA 3CIKA 4JXFA 1QPJA 4YZNA 5CSXA 3FI4A 4WO5A 5ANGA 5C03A 3LXKA 3M42A 4F9WA 4BTKA 3V8SA 4DFZE 5ETIA 4K11A 5A4CA 3AT3A 5DH3A 4DG0E 4KWPA 4BDBA 5CVHA 3R22A 3TT0A 3DNDA 4HYHA 4P4CA 1YXXA 4XV3A 2BAKA 4L01A 2PVNA 2OH4A 4O91A 4PMSA 3ZOSA 3LE6A 4YJUA 2J0LA 3DKGA 2C6DA 3QD4A 4FIGA 4V0GA 4YP8A 2W1HA 3UO6A 3UVQA 3ZLXA 5IUHA 2BILB 5EHLA 2O0UA 3W10A 4FTAA 4RC4A 4D1XA 4FTNA 2YZLA 4GK4A 3HRBA 5AP3A 3OXIA 4BCIA 2PMIA 3OY1A 3IDPA 4QPSA 4WBBB 4NL0A 2A19B 1HCLA 2E9UA 4FVPA 4NM0A 5J1WA 4YTFA 4MD8E 3TJCA 3OT3A 2UW6A 4EH5A 2BALA 2YM7A 3IO7A 3LCTA 4FV6A 2CDZA 4RFZA 1TKIA 4RZWA 5CAQA 2YEXA 3QZHA 3OCSA 3HGKA 1OECA 3LLTA 1EH4A 5HE1A 3SVVA 2IZTA 2QOLA 3HEGA 2NRUA 2WTIA 4NKAA 5ETCA 5JFSA 4FE2A 3QQFA 1H1QA 2PZRA 4TZRA 5JSMA 2WOUA 3VIDA 5KBRA 4ID7A 5EM7A 3FSFA 3ALOA 3F2RA 3QQJA 3EFJA 4R8QA 3E3BX 2RFNA 5AAEA 3P0MA 3KMUA 3HAMA 3CBLA 2P2HA 5LMBA 1Q8UA 1H1PA 3ZONA 3QA0A 3R7GA 5IMEA 3GCVA 4FEUA 1YXVA 5D7AA 3Q9YA 4X0MA 4BY9E 1J7LA 3BV3A 3EQHA 4R1YA 1LP4A 3UQCA 3ODZX 4O81A 4R7IA 4C4GA 5C27A 4DEDA 4I23A 5FP6A 4ZLOA 2RKUA 4KAOA 5HE0A 4GEOA 2HWOA 4D5HA 5HD4A 5AR5A 1AGWA 1JKSA 3MWUA 4YC3A 4EJNA 5CSVA 1OITA 2X8IA 4RSSA 3TNWA 2JFMA 4UMPA 2RFDA 4FX3A 5I9YA 4HGSA 4O0TA 4CRSA 4I3ZA 3DJ5A 4EOKA 2Z7QA 3OXTA 4FSTA 3ALNA 1NY3A 2WEIA 2VTJA 1M2QA 4WKQA 4ZTNA 5TT7A 3OW4A 3OVVA 5HBHA 3I7CA 3O96A 3H9FA 5CENA 4QYFA 3I6WA 2HELA 4RA5A 5GJGA 3W8LA 3NNUA 1AQ1A 2OKRA 3ORLA 4LGGA 4DGOA 4QMQA 5JT2A 2JDOA 3EQRA 3CTQA 5KHWA 4YJSA 3O51A 4CV8A 5KZIA 1K3AA 3F2NA 4DH1A 3VS2A 3TNHA 2X4ZA 3EQBA 3OC1A 3EZRA 4BGGA 2F7XE 2Z7SA 3CR0A 4RX9A 4U0IA 3PUPA 5M06A 2GTMA 4C57A 4Z7GA 5HU3A 3QX2A 3VHKA 4I92A 3QU0A 3OP5A 3C13A 4O0SA 4QMSA 5GZ9A 3SLSA 4OAUC 2VWZA 4USDA 3S00A 3GU7A 2X39A 3F5PA 2B4SB 5HCZA 3F3UA 4GUEA 3VWAA 3ZRMA 4I6QA 3UVPA 4F7JA 2PZIA 5EDQA 3AT2A 5AP1A 4L3LA 3OXZA 2P3GX 1Z5MA 2RF9A 3W16A 4IB0A 3FMLA 2IZUA 3GFWA 4IZ5A 4BKYA 2W99B 3ZXZA 2Y9QA 3U9NA 2BHEA 1J1CA 4Z7HA 4F63A 3BYMA 4EI4A 5A46A 1PXLA 4A4XA 2XNOA 2JLDA 2BR1A 1PMUA 3VULA 3SXRA 4ONAA 4PTGA 3DNEA 5KMKA 2DWBA 2QU5A 2FO0A 5DWRA 1YHVA 5C01A 3G51A 4O1PA 4WNKA 1WBSA 2ACXA 3FZ1A 2OWBA 4IWDA 1QPCA 1UNGA 3GT8A 1KWPA 3Q04A 4X7QA 5M4UA 4ZSAA 3HNGA 2CKPA 4YBKA 4C7TA 5IH6A 2UW9A 4PTCA 3O23A 4GUBA 3LXPA 4CTBA 3WZKA 3ZYAA 3G5DA 1IA8A 2REIA 4BDFA 1VYZA 5E4HA 2XNGA 5IQGA 3KN6A 3CP9A 3F61A 2I40A 1U4DA 3FBVA 3LFFA 5EYMA 3DK3A 3ODYX 4HPTE 3KK8A 4HGEA 3F3VA 4GT5A 4PPAA 5CF4A 2PU8A 1JKTA 3QCQA 1CSNA 3CQWA 4Y95A 3FKLA 4GS6A 2XZSA 3QQGA 4U79A 4FSYA 2C6MA 2PZPA 3HL7A 4OW8A 4M69A 4I93A 5CYIA 3FZSA 3VS1A 3CPCA 5E8UA 4HZSA 4MF1A 3RAHA 2VWYA 1ZXEA 3NNXA 2C5OA 3C0IA 4N6ZA 4YJVA 2CMWA 3DXNA 3UMXA 1YOMA 2YWPA 1UVRA 5IEXA 3D14A 2ITYA 5H8BA 3UBDA 3E7OA 4CV9A 2UZWE 2YIQA 3BBWA 4RX7A 3M11A 4KNBA 3LIJA 3UGCA 5IA1A 2XJ2A 1CM8A 1J3HA 4NFNA 3JR1A 4PF4A 4FEVA 2XK3A 5F94A 3ZZWA 3UZPA 3Q2JA 3P86A 4HVSA 4ZTSA 5EQPA 5IZFA 2E2BA 5HTIA 4XNEA 4I21A 5EFQA 1UU8A 3H10A 3BELA 3HLLA 3Q96A 4RIXA 2XM8A 4EOOA 2HCKA 3WIKA 4EBVA 2OSCA 2R3GA 4EH8A 3C0HA 4ZY5A 3ORIA 5F4NA 1UV5A 3S1HA 2CKOA 1PHKA 1IASA 4P5QA 5AP0A 3FMNA 4KRCA 4NJ3A 3SXSA 4HYIA 1I09A 5DE2A 3CXWA 4H58A 5L8KA 3I6UA 2VN9A 1M52A 4FTIA 1E1VA 2VTSA 3HVCA 4FT7A 3VS7A 5HIEA 3CTHA 4IVDA 4OBQA 2ZB0A 4BGQA 2OO8X 3R2YA 5CLPA 2NO3A 1GIJA 3WYXA 2PMNX 2H8HA 4WIHA 3UNZA 2GS7A 2W05A 4EH9A 3H3CA 2C30A 5DFPA 3OUNB 4ZS0A 3NUSA 4H3BA 3NYXA 2OXYA 4EK6A 3VS5A 5LVPA 3PP1A 4O2ZA 4AXAA 2WEVA 1F3MC 1P14A 1ZMWA 3FE3A 4FG9A 3POZA 4L3PA 5T6KA 4UYNA 3G15A 2PMOX 4FNYA 3ORMA 4J98A 2C6OA 4QT1A 4QP7A 4HVIA 5EM8A 5E92A 1UWHA 2GS2A 3GP0A 3Q4ZA 2F57A 3GQLA 5FD2A 5EW9A 3NYOA 5HTCA 2CHLA 2J0MB 2C3IB 3PTGA 3GFEA 4X3FA 5AR8A 1YDTE 2CGXA 4IAIA 1XBCA 4O7YA 2OJ9A 2V22A 3U87A 2VWXA 3G6HA 1G5SA 5A6OA 4FKUA 4JDJA 5HESA 5JKGA 4C2VA 2QOIA 2YM5A 2EU9A 5KNJA 5B7VA 2J4ZA 4DCEA 3UQGA 5M53A 2JD5A 2R3NA 5IA3A 4D9TA 3CLYA 5H3QA 5GNKA 2O65A 2VX1A 5HD7A 1DI9A 5AM6A 4W9XA 5L6OA 4KUJA 5FBOA 1MQBA 4I4EA 3V51A 1PXIA 5J5TA 5KMIA 3PJ2A 3KK9A 3LJ2A 3LHJA 4Q5EA 4BICA 2YDKA 2BPMA 2WHBA 3A8XA 4LYNA 2QOOA 1A9UA 2XMYA 4TYHA 2HXQA 3HP2A 2X6EA 3KRXA 3QKLA 4L45A 4Y73A 4KA3A 5D10A 4W4WA 1GZ8A 3HDNA 4X3JA 2EB2A 4KRDA 4BWXA 2ONLA 4CYIA 3VBQA 3R02A 4ZJIA 4E6DA 3DTCA 1Q5KA 2Q83A 4QTDA 3WI6A 3O7LD 4JG7A 4XG4A 5HO7A 1XQZA 2QQ7A 4MQ2A 3FC2A 1PXMA 5AX3A 5A14A 4DBNA 5M07A 4CCUA 1OPLA 4O2PA 4UMTA 4DFXE 3E8CA 5FTOA 5AV1A 3RK9A 2CLQA 2XNNA 4WNOA 5BPYA 4KBAA 3UP7A 1YI6A 4RVMA 5EK7A 3QALE 3R8MA 4H1JA 4XUFA 4M66A 4QMXA 4YJPA 4DINA 4R3RA 5AR7A 5DEWA 2JBPA 1LR4A 5HICA 2W4KA 5FEQA 5IMXA 2IG7A 5M56A 4Y85A 3HV7A 4NM7A 3P78A 5IF1A 2WTKB 4UBAA 2JDTA 1W82A 2YM3A 4IFGA 3VO3A 3D7TB 1PMEA 3F7ZA 3MBLA 3VAPA 3OF0A 4BHZA 3RNIA 3PE1A 4ZTMA 5I4NA 5BVWA 2PTKA 3QQHA 4JX3A 3ANQA 5T68A 3W1FA 3MA6A 4L6QA 2AC5A 3UC4A 4EQCA 4USEA 3D5UA 3G2FA 3MV5A 3IGGA 4MNFA 1GJOA 4RJ7A 3VW8A 4II5A 2XKCA 3HRCA 3TXOA 2OXXA 2OW3A 5CY3A 3CPBA 4IX5A 2VTMA 4IC7A 4GFGA 3MY0A 4U45A 2WO6A 1ZZ2A 1Z57A 4FUYA 5EOLA 4EHGA 3TUCA 2CN5A 4IBMA 2QC6A 3A61A 3GOPA 5AIRA 4G3CA 3IOPA 4FNZA 4NU1A 4MKCA 5C8KA 4FK6A 1B39A 4X2GA 4O21A 4RJ5A 4Q5HA 3EJ1A 4GIHA 3D5XA 2R4BA 3LFBA 3NS9A 3ZDIA 4ERKA 3DFCB 3E8EA 2IZSA 4L46A 1NT2A 2BDWA 4BR3A 3NVMB 1Q3DA 2PE1A 3A4OX 3C4FA 3UDBA 3BLQA 2PE0A 3LXNA 1P5EA 4DN5A 1BI7A 1UKHA 3R6XA 4O7WA 4FTTA 4NUSA 1KV1A 4JOAA 4M69B 3GI3A 4AQCA 5K5XA 2FB8A 1Y6AA 3HDMA 3RJCA 3ORZA 4JAJA 5CU0A 4FSMA 1IEPA 5D7VA 4A07A 4EKLA 4HGTA 3VS3A 1YDRE 1Y57A 2VTLA 3D4QA 4TWOA 2XP2A 3TM0A 3VQUA 3Q3BA 3PPKA 3FHRA 4XP2A 1OIQA 2QU6A 4F6UA 4ZZOA 5HE2A 2R3IA 5HGIA 5C4LA 2PZYA 4XBRA 3UYSA 2GMXA 2VTHA 1TQMA 3PY1A 4BDHA 1JVPP 3BHYA 5CVFA 2B53A 5E7RA 3VHEA 4YPSA 4FIIA 1Q97A 4TPTA 5CTPA 5F20A 2CNVA 3EHAA 3GXLA 4EHZA 1Q24A 4P7EA 4IX6A 2YCRA 3BU6A 4XBUA 4GSBA 3BGQA 2JITA 4D4VA 2PY3A 4F0FA 3PSDA 2X8EA 3L9LA 2R3RA 2XVDA 4KIQA 4EBWA 4I4FA 5FM3A 2PL0A 1T45A 4MBLA 3G6GA 2XK6A 2HZ0A 4QMTA 4L7FA 2C6IA 3FMDA 4M12A 4C8BA 4WG3A 1W7HA 4ZEGA 2FSOX 5E8SA 3AC8A 3TV4A 3ROCA 1FVRA 4NJDA 4OR5A 4MXOA 4XG2A 2JAMA 4D0XA 4YR8A 5DN3A 3COIA 5HCXA 4JDKA 1JWHA 4IWOA 1O6LA 3T3UA 3ZUUA 4NT4A 5LJJA 2X2MA 2SRCA 4YZDA 3AC4A 4P2KA 4XRJA 5KO1A 1U46A 4NW6A 4RJ8A 2J7TA 2XKDA 5HI2A 4C34A 1GNGA 4DGLC 1VJYA 4EH7A 2ZMDA 2IVTA 3P08A 5DPVA 4X3FB 1H01A 4FV1A 3W32A 4DGMA 4GH2A 3RZFA 3U54A 3U6IA 4EOQA 4YJTA 1YI3A 3RNYA 1H1SA 2UZLA 4TWNA 3UE4A 3UTOA 4XEYA 3E3PA 4KKGA 4RIYB 3DBQA 4RQKA 5TO8A 4D55A 5L8JA 4JAIA 3VS6A 3RBWA 4TYIA 4I41A 1PXOA 5E1SA 2JFLA 1BLXA 3UYTA 2VGPA 4W8DA 4J8NA 4K8AA 1ZMVA 3C9WA 1R0PA 2WXVA 3D5VA 4DFUA 5DT3A 3BYUA 4A06A 5CEKA 4FV3A 2GPHA 4ZSJA 1REKA 4E20A 5BVOA 3VVHA 3O8UA 3FEGA 3NUXA 5AR4A 3WF8A 4EWHA 2XNEA 3MSSA 3I81A 3SW4A 2VV9A 1CDKA 4B8MA 3EN7A 4YLLA 4JIKA 4CMTA 3H9OA 5C9CA 4EZ7A 3PJ8A 4RA4A 4A9YA 1OB3A 4FSRA 2C5XA 3MIYA 2QO7A 3ZO4A 2WTJA 4FZDB 3K2LA 4BCMA 2PUIA 3D7ZA 3FQEA 4U42A 2J50A 3SA0A 2QO2A 1MRVA 4FTQA 2OF2A 2WMAA 2OZOA 1Q62A 4CLJA 3ZUTA 3EFLA 2J5EA 2GFCA 3U6HA 3PPJA 3WZUA 5FXQA 2C3LA 2OICA 2YDJA 4OGRA 5HVYA 3WF5A 5IDPA 4AAAA 3F9NA 4RC3A 1NVSA 5DMZA 5IQHA 3HRFA 4DCAA 3FY2A 4K6ZA 2OGVA 2OU7A 4LMNA 4F9AA 2YA9A 5AUZA 1E9HA 2EXCX 3NPCA 3KXZA 4YPDA 4FBXA 3R7IA 4C59A 2KULA 4CT1A 3MIAA 4FR4A 4C2WA 5FXRA 1A48A 2PZ5A 4O0WA 3C4ZA 2J9MA 3NW5A 5IISA 3O50A 4FV2A 3F69A 4EL9A 5IUGA 4DLJA 5FUTA 3VUIA 4FKIA 2VO7A 3PWYA 4LG4A 5HG5A 4FT0A 2ITTA 3PJCA 5ANKA 4I22A 1KE6A 2OJGA 2HIWA 2Y0AA 3MVJA 4W4YA 5CEOA 2XEYA 1GAGA 2H9VA 4NIFB 2R7IA 3VF9A 4C36A 4UN0C 4S32A 5D11A 2Y7JA 4DFBA 2FUMA 1VZOA 3NWWA 2VTPA 3ZRLA 4BWKA 3FMKA 2VTOA 2YDIA 4LRKA 4F7LA 4NSTA 3FYJX 3RVGA 3D0EA 4XG3A 2A2AA 4TXCA 5FXSA 4BTJA 3LQ8A 3NUPA 2ITQA 3QTIA 2PSQA 2QONA 3DB6A 3PVGA 2GNHA 4ORKA 3IDCA 4RX5A 3MJ1A 1WFCA 4OUCA 2YCQA 2IZRA 5L3AA 3NMUF 1XH8A 3W2SA 4APCA 2R7BA 3F5GA 4XV2A 4RWLA 4YLJA 4JQ8A 4PMTA 3AMYA 5CASA 5CXZA 5FTGA 5JZNA 5M09A 1H1WA 3FL4A 4AOJA 1IAHA 3NSZA 4FKTA 3PXRA 1VEBA 3D83A 4A9RA 3P7CA 1NA7A 3G0EA 4NKSA 2ITUA 3NIZA 2DQ7X 3IOKA 4TNDA 1SNUA 3CGOA 5EI2A 4AE9A 4XLVA 3BYVA 5JQ5A 3O8TA 3MPAA 3FLYA 4D1SA 4ITJA 4ZY4A 4IZYA 3LCKA 3MESA 2CKEA 2HK5A 3K3JA 5ANJA 4O7TA 2GNJA 3PVUA 5H2UA 3RPRA 4AZTA 1CKIA 2H6DA 4OTWA 4CT2A 3D2IA 5LVOA 2BKZA 3FSKA 4CLIA 2I0VA 4BCKA 4C3RA 4E93A 4MYGA 3P7BA 4CRLA 1OL6A 2C5VA 4IB5A 4X21A 4QQ5A 5KMLA 5H8EA 2VWUA 3DU8A 1GOLA 2QOCA 4J99A 1XBBA 4CQGA 3QWKA 2XKFA 4XP0A 3RAKA 4RX8A 5AUYA 1STCE 2HZ4A 3PRFA 4EK5A 5HE3A 4PNIA 1IAJA 3IS5A 3ZU7A 1SVHA 4W4XA 3WE4A 5HTBA 2VTQA 2F7ZE 3TKIA 2YERA 4JIAA 3BHVA 4YJRA 5IA2A 2C5YA 5DYJA 3FXWA 4E8AA 3PPZA 2WQOA 2OIDA 1H07A 3R73A 2ZDUA 5DRDA 3GCQA 5FTQA 3NZ0A 5FLFA 4N57A 1TQPA 2BRHA 2R3FA 5JQ8A 3BQRA 5FQDC 2V5QA 3F3WA 4TTHB 1YW2A 3KQ7A 1H8FA 2Q0BA 5AADA 3LMGA 1L3RE 4U8ZA 3CY3A 5AP5A 4HVDA 4BF2A 3BX5A 4CZTA 2YM8A 4ZIMA 3ET7A 5BMMA 3QLFA 3NUUA 3R9RA 2GNFA 4F9BA 3W2PA 2W17A 5J79A 4BN1A 3R7YA 3TUBA 1XWSA 1SVGA 5E8YA 5EM6A 4YHFA 4QP2A 2R3KA 4PL3A 3VBYA 4N6YA 3PXYA 4G1WA 5L2QA 5KKRB 5JK3A 5EW8A 2PVMA 1DAWA 2H96A 3L9PA 3QRIA 4BCFA 1OUKA 1KOAA 2QKWB 5E91A 3R9OA 4DEEA 3ZSHA 3EN6A 4O0YA 4R77A 5EKOA 4Y8DA 3FLWA 2X6DA 1FQ1B 3A7HA 4IQ6A 5ACBC 4XX9A 2E9OA 4IIRA 4K77A 3OTUA 1Q8WA 2OXDA 3JXWA 5C8MA 3DTWA 2NPQA 3CEKA 3C1XA 2C6EA 3E64A 2WIPA 3QRKA 3FLZA 4X2KA 3ZRKA 2GHMA 4D0WA 1ZAOA 4XOZA 1PMVA 5DIAA 5IEYA 3UJGA 2E9PA 4UEUA 4LUEA 4RLLA 5AR2A 2R3QA 2X9FA 4DGGA 3LFEA 5FM2A 2UW3A 4AGCA 3EKKA 5TOZA 3HYHA 3QZGA 4FVQA 3GC0A 3WE8A 4FEXA 4C4EA 1XH7A 3MFTA 4RLKA 5EDPA 2ITXA 1ZYDA 4R7HA 4DGNA 3FUPA 4YO6A 3TIZA 4U43A 4EOSA 3RPSA 3O7LB 1XJDA 4RIOA 3MB6A 2ZYBA 4Y5QA 4DHFA 2NNWB 3ENMA 3SOAA 5CSHA 5BVFA 3TWJA 4FA2A 4DT8A 3ACKA 5AUTA 4MHAA 5J7HA 4IC8A 3PA3A 3AQVA 4ZLZA 3TDWA 4LOOA 3SC1A 3V01A 3NUNA 5ETAA 4ENXA 3DPKA 2ZM1A 4FGRA 3TUDA 2VZ6A 5IQFA 3RI1A 2QR8A 2E9VA 2G2HA 1OI9A 2WTKC 3IECA 3QTSA 4GU9A 5CZHA 1WBVA 4BGHA 4LFIA 3DXPA 4R1VA 2XJ1A 1M14A 4XLIA 3P9JA 4QTCA 4WBOA 2X2LA 2BCJA 2YACA 3NYNA 1GIIA 3WBLA 2J0JA 2VAGA 5HOAA 3UO4A 4YZCA 1OMWA 4RJ3A 4FNXA 1ZOHA 2CN8A 3TKHA 4D2WA 4D2SA 3T9TA 2PUNA 4LM5A 1B6CB 2CKQA 3MS9A 3OWLA 4WG5A 3Q53A 3UZTA 3R7EA 4R78A 4IEBA 4CQEA 4HJOA 1Q8ZA 1WZYA 4Z55A 2I0EA 3UC3A 4Z16A 4FEQA 2Q0NA 3DDQA 3HV3A 3I0QA 3Q9ZA 4QP9A 1XH5A 1J7UA 1ERKA 4CMUA 4XH6A 2HAKA 3H0ZA 5D9HA 5HVKA 5HO8A 4MBJA 5J5SA 3R83A 2B7AA 3WF9A 4F99A 4E5WA 2QHMA 5AV3A 1KE5A 4WHZA 4MH7A 3BGZA 4L9IA 4DTBA 3Q52A 5LQFA 1YQJA 4F1MA 4O82A 3AC5A 2IVSA 2Y4PA 3HV4A 3BRBA 3CQUA 4BCNA 3DJ7A 1Q8YA 3NCGA 4NWMA 4S2ZA 3R8VA 4C4FA 2W0JA 3PXFA 1DS5A 1WBNA 3ERKA 5E8WA 2X0GA 5ANDA 3LFSA 1Q3WA 4OTFA 5HCYA 4FZ7A 5HU9A 5IA4A 4TN6A 4OTHA 4AW1A 2WMUA 3AD6A 4UWCA 1Q4LA 5AUUA 1XH9A 4NTSA 3GCSA 3ITZA 2GHLA 3D7TA 4WSYA 2BTSA 4GT3A 3CCNA 3R9NA 4C3PA 2C68A 4FYOA 3SAYA 3EYHA 3IW8A 1YXSA 2R3JA 3OOMA 4BBFA 2YLFA 3SXFA 3QQKA 1OIRA 4QP1A 3R8LA 2ZJWA 4YC8A 3ATSA 2C1BA 3VBXA 4FK3A 5IEVA 3ATTA 3BLRA 3PG3A 5KMNA 3FI2A 4U5JA 5KUPA 4B4LA 2GSFA 1ZARA 2WNTA 4P90A 1Y8GA 2X4FA 4RVLA 2WZJA 5AWMA 3TTIA 5A4EA 1YI4A 1ZRZA 3FKNA 3AD5A 3PIYA 4XS2A 3JY0A 3V5PA 4QTBA 4F0GA 4IDTA 5CANA 5AEPA 1ZYSA 3A62A 4I6BA 2JKMA 2XM9A 2JEDA 2C0OA 3DV3A 1UNLA 3KXGA 4G16A 2ITPA 3QX4A 1HOWA 1JKKA 1H26A 2QOBA 3IONA 3R04A 3IW7A 4O7VA 2XEZA 3BKBA 4IHPA 4IX3A 3ETAA 2CGUA 2R3PA 2WMWA 4BIEA 5FWKK 4M7IA 3R01A 4EEVA 4NTTA 2C6TA 4C35A 5ITAA 2YISA 4Q2AA 1OBDA 3QD0A 3ZM9A 2IO6A 5KCVA 4U6RA 4BCPA 2FSLX 2BRGA 4M15A 4AGUA 3AGLA 4RC2A 4D1ZA 4CYJA 3GUBA 4OLIA 3NUYA 3C4WA 4CKIA 4EOLA 5C8NA 2O8YA 3AMAA 4F09A 3BIZA 3BWFA 4AFJA 4O38A 3UOHA 4I5MA 4PV0A 2RIOA 2X81A 4BKZA 4X3FC 3R9HA 2IW6A 1CKJA 4O7SA 4O6EA 3QQLA 2QKRA 5HNGA 2JIVA 3N4UA 5GZAA 2YIRA 1H1RA 4MXZA 5KHXA 1LUFA 4XCUA 1V0BA 2B0QA 4FMQA 3L1SA 4BTMA 3C5IA 2W4OA 3N4VA 3P4KA 3SW7A 2A0CX 4FL1A 2ZV8A 1I44A 4FF8A 3PY3A 4FSUA 4G9CA 1UWJA 2W5AA 2R3LA 3EQIA 3FJQE 3P5KA 4I5HA 3NW7A 4FT9A 4LQMA 4QP6A 5E90A 4UXQA 3LFNA 3GCPA 4EUUA 3W18A 2GS6A 2WIHA 3JY9A 4PPBA 4B8LA 1ZZLA 1PXJA 3DT1A 4R3CA 2BFYA 2YITA 4RWKA 2QO9A 2V62A 3OHTA 4ZSLA 1XHAA 3MVMA 5LWNA 5LCKA 1ND4A 3LMIA 4FV8A 5DRBA 2BDFA 3F3TA 4QP4A 4S31A 3HX4A 3REPA 2Z2WA 3T9IA 4APPA 4YSJA 2RFEA 4N0SA 2HXLA 4B7TA 3Q2MA 4KS8A 4E4XA 4PQNA 3ZLYA 4FYNA 3W55A 3NGAA 2ERKA 1JAMA 3U4WA 4FL3A 2ONLC 2ITWA 2P2IA 3N51A 3FI3A 4H39A 3NNVA 3O71A 4AE6A 4EOPA 3P7AA 4HCTA 5BQ0A 5LVMA 5TR6A 5AV2A 1ZYCA 4KB8A 2GCDA 5D12A 5M4CA 4DG2E 3Q4TA 5A9UA 1PRYA 1ZY4A 3RWPA 4M13A 4FZAB 4C58A 3R1QA 3EQFA 4LUDA 4S34A 4EUTA 1V1KA 5CF5A 4JRVA 3MFRA
chains in the Genus database with same CATH superfamily
4C3FA 4I6HA 1YWRA 3DJ6A 3OBJA 5CSPA 3E8NA 3SG8A 3FZPA 4JDIA 3SRVB 3QUEA 4RVTA 2VNYA 3V6RA 4PMMA 4F7NA 4TWPA 5DGZA 2IPXA 4U80A 3KRRA 4MXXA 4RIYA 3A7FA 3PIXA 4LGDA 3MY1A 4IM2A 3BHTA 3HKOA 3W2QA 4XV1A 3DLZA 1WAKA 5CQWA 3PXZA 5HLNA 3PA5A 4D4YA 3UOKA 2OJJA 5ETFA 1G8SA 3HUBA 5CAUA 1M17A 5CWZA 4AT3A 4XG9A 3VQHA 1OL5A 4FKOA 4ZTLA 4XG6A 1H0WA 3QTXA 4JDHA 2BAQA 3MN3A 2RSVA 3QHRA 1YHSA 2V0DA 4AFEA 5GINE 2BTRA 4A4OA 4TL0A 4TYGA 3G9LX 2W1ZA 4QMLA 4K9YA 5CZIA 2W9FB 3COKA 4FGBA 4RQVA 5AV4A 2UW4A 3SQQA 4I24A 3GU5A 3V8WA 3KB7A 3LVPA 3W33A 3ZH8A 3OT8A 4MWIA 1ST4A 4GU6A 3SHEA 4IJ9A 4ANQA 5JGBA 5IQEA 4L00A 2R9SA 3UNKA 3AGMA 3F66A 2G01A 3FLNC 4JVGA 5CU3A 2QI8A 4FSWA 3R00A 3NUAA 5HIBA 1OKYA 3DB8A 4KD1A 4PDYA 2OK1A 1A06A 5GIPE 2WQEA 2X7OA 2UV2A 4WSQA 4FTJA 5DHJA 3BU5A 4Y83A 1GIHA 4AXCA 4ERWA 1RQQA 2BRMA 2IVUA 4IMYA 2Z02A 5J8IA 1V0OA 1R1WA 3GOKA 3MW1A 4YHTA 2Y8OA 2P33A 3VONA 2C3KA 5BUEA 3D5WA 5A6NA 3GU4A 5FDXA 4QQJA 4J95A 4DBXA 1KE7A 3BEAA 5KZ0A 1YXTA 3IK3A 5B2KA 3OCBA 4J97A 4K1BA 3AC1A 2EXMA 2BUJA 2FYSA 4YNOA 5HG9A 5L6WL 3EQPA 4ANNA 2VWWA 3OOGA 2JIUA 2VWVA 2W1CA 4OTIA 4F0IA 4MVFA 4AACA 2WQNA 3CE3A 2WTDA 3FV8A 3KN5A 4FTCA 4GJ3A 1R39A 4NIFA 4ZP5A 4HOKA 1Q41A 4L43A 2YIWA 3HMOA 1JLUE 1Z9XA 3PY0A 2F9GA 4IADA 4U81A 4FI1A 3F3ZA 4IFCA 4U3ZA 3OEZA 5ANEA 5FEDA 5I3OA 2JDSA 2QNJA 4WT6A 2PVJA 4YTCA 5IQDA 4EK3A 4KIKB 4MUQA 2AYPA 3UPZA 2YJRA 4WUAA 4CKRA 4ZMEA 3CJGA 2VO6A 4BDEA 2GDOA 5HNIX 3S2PA 5HG8A 4ENYA 2QURA 4JL9A 5M08A 4FSNA 5A3XA 1W83A 2FH9A 2V7OA 4AGWA 4QMPA 4LL0A 3TMOA 4I0RA 3IG7A 4C38A 2XS0A 1H24A 3KULA 2RFSA 5EI8A 2UZBA 2UVYA 3EN4A 4HNIA 4HYUA 4N4SA 4QD6A 4D2TA 1QPEA 1IG1A 2VX0A 1QPDA 3A4PA 4L3JA 5F1ZA 1LEWA 5IQIA 3GU6A 5JRSA 4BCQA 5CT7A 2ITNA 5CALA 2QLQA 2WQBA 1P2AA 3M1SA 4YSMA 3FXXA 3R71A 3VUDA 4YZBA 4EK4A 2HOGA 2PVKA 2W1IA 3EN5A 5G6VA 4ACDA 5KKRC 2PWLA 2Z60A 3V8TA 3F88A 2BROA 2WMSA 3CSVA 4AOTA 4E6QA 4ZSGA 3K3IA 4G6OA 3UDSA 5D41A 3GENA 2XBAA 5FBNC 2HW6A 3TNQB 3TKUA 4CXAA 3MH0A 5L2IA 5ACKA 1W84A 1YWVA 3MFSA 4QMYA 2W5HA 1RDQE 1ZYLA 3VBTA 3ZBXA 2OFVA 2HYYA 5L2WA 1T46A 3C51A 4CTCA 3MTFA 4ASEA 1XMMA 2OI4X 4JMQA 4BI0A 1RE8A 3NAXA 1OPKA 4YHJA 1OVEA 2WPAA 1ST0A 3Q32A 1KOBA 2CSNA 4XRLA 1NVQA 4YC6A 4GMYA 2XYNA 5IDNA 3POOA 2J51A 2QOKA 4F9YA 4CFFA 4CNHA 4DEHA 5HLPA 2QHNA 5M55A 4DYMA 2F2UA 3VNTA 3DDPA 3TDVA 1ZYJA 1S9IA 5FGKA 4QMMA 4IAZA 4JQ7A 3FXZA 3UQFA 4FTLA 4QOXA 2Y4IB 2PVRA 3GGFA 3V5WA 4O4EA 4WRGA 3T3VA 4KSPA 4BC6A 4D28A 2NP8A 3EN9A 4FOBA 1RJBA 4QNAA 4UMQA 3A2CA 2Z7RA 4IH8A 5HHWA 2C3JA 3RM6A 5CEMA 3GNIB 5I9WA 2JBOA 4FKGA 5FG8A 5T3QA 4BZDA 4DFYA 3ZM4A 3E5AA 3ZEWA 5LMAA 5AJQA 1WBTA 3QZFA 4AA5A 1Q61A 4BBEA 4EYMA 4YZMA 5TF9A 4AGDA 2EB3A 3PA4A 3GC8A 3I7BA 5AP2A 3BWJA 4O1OA 3Q60A 4FV5A 4G6LA 4X6RA 4OT5A 4IM0A 5BVEA 4AP7A 5IH5A 3AMBA 2R3HA 2A4LA 4EHEA 3KRJA 5HX6A 3D2KA 3LLAA 4FKWA 2YHVA 4JBVA 3DKCA 4MQ1A 2VWIA 5IH4A 3UOLA 1WMKA 2VTAA 3B8QA 4EORA 3BYSA 3LFDA 4DA5A 3HA6A 4I5PA 4X2NA 4DE4A 3PZEA 3LZBA 5EYDA 4L7SA 4HPUE 4XV9A 3IPHA 3VJNA 4IVBA 3S3IA 3SG9A 4CZYB 2VGOA 3MPMA 4BDIA 2WKMA 4DITA 3TZ9A 4FV0A 2W5BA 3RPOA 3BCEA 2R64A 3DOGA 3GC9A 2FSMX 1O6KA 3R7VA 3N4TA 2UW0A 2XIZA 4J52A 5GZ8A 3RALA 3BZ3A 1QMZA 3W2CA 4WRSA 3E62A 4OTRA 4RIWB 3UPXA 4MK0A 2PMLX 4CFVA 4MNEA 4NK9A 4RBLA 3CQEA 4O22A 2A98A 5EHYA 2WTVA 4L53A 3ULZA 4Q9ZA 1WCCA 2Y6MA 3DQWA 3ZUVA 4Z3VA 2W1EA 5H8GA 5JFVA 3KC3A 1KV2A 1ZOGA 2FA2A 1H27A 4E5BA 3VW6A 4USFA 1XH4A 3EFWA 5KX8A 3EH9A 5E8ZA 4I94A 5CNNA 4NFMA 3PP0A 3AKJA 2R2PA 5AFVA 4DTKA 3GQIA 2W96B 4UMUA 4U97A 3VF8A 5EQEA 2C6LA 2UVZA 4FVRA 3OD6X 3OFMA 2O5KA 4XJ0A 3S4QA 1UA2A 4UWBA 4BZOA 4EK8A 3OWJA 4M68A 4IE9A 3ZBFA 3AKKA 1OL2A 3KXHA 4BWPA 4F65A 4QYGA 4C62A 3G90X 4ANMA 2BZIB 2ZAZA 3BEGA 4YTHA 1FGKA 3LPBA 4PL5A 1G8AA 3HECA 3WF7A 4GIIA 2XKEA 2WFYA 4XG8A 4DC2A 4B0GA 4U7ZA 1PMNA 5AV0A 3RCJA 3WZDA 3MJ2A 1M7NA 4DFNA 5JH6A 3Q5ZA 4YJOA 4KBCA 2PVHA 3KL8A 4QQCA 4OTPA 4YMJA 3CC6A 2OF4A 1J91A 5AUVA 3R0TA 1URWA 4U9AA 3R8UA 4HCUA 5I9ZA 1W2CA 2X7GA 3VC4A 3JVSA 4FZ6A 2VTRA 1SM2A 4FKSA 4FL2A 4PY1A 1G3NA 1PW2A 2XK4A 4WA9A 2YLEA 4QP3A 4RJ6A 4ZSEA 5GJDA 4BIBA 4E26A 5J1VA 3A7GA 3TCPA 4EH2A 3DY7A 3LFAA 1FMKA 3R8ZA 4DG3E 2I7QA 3V5QA 4NCTC 3QWJA 3RZBA 3C5UA 3TL8A 1CMKE 4MWHA 4ZZNA 5AUWA 4D2PA 4P5ZA 5H9BA 2BVAA 4EOJA 4DEIA 5C26A 5HBJA 5AR3A 3AT4A 2HY81 4ARKA 4BIDA 4IWPA 3GU8A 3KMMA 5CSWA 3VRZA 3ZC5A 3BQCA 5GIOE 4FKRA 4D2VA 4EC8A 3OG7A 4CGAA 3KULB 4FZFB 3ZFXA 4UYAA 2HY0A 5CU4A 3EQDA 2C47A 1LPUA 3EYGA 3ZC6A 4Y46A 3ZSIA 1OZ1A 3FY0A 4Y72A 5L4QA 3WIGA 2C0TA 4C0TA 5J7BA 4ZTQA 4YTIA 2JDRA 2UZVA 3FMMA 2PUPA 3U55A 3E63A 5DA3A 2ITVA 5AP6A 5E8VA 3BHUA 4ZJJA 1K9AA 4YURA 5KMOA 1TQIA 4BYIA 3O17A 2AC3A 5A4TA 4FICA 2YM6A 3EL8A 3W8QA 2JIIA 3OY3A 2ZVAA 2OFUA 4GFOA 4IJPA 3LXLA 3FYKX 4M97A 4OTGA 5TE0A 5J9LA 3W0QA 1R3CA 4KBKA 4C37A 3FMHA 3COMA 3PXKA 3GB2A 4WOVA 4NM5A 3LOKA 3VJOA 3IW5A 2XF0A 3MA3A 4G3GA 4E5AX 5L6PA 4M67A 1VYWA 1BKXA 1O9UA 1SNXA 2AUHA 2XRWA 4O4CA 3TV7A 3V04A 5BYYA 3QD3A 5E9EA 1NXKA 4QO9A 5IPJA 4CVAA 2EUFB 1J7IA 4NCTA 2YZAA 3K5VA 3BPRA 3U4UA 4BDKA 2VX3A 4D58A 2OJFE 5ANOA 2WTCA 3R63A 4JQEA 4BYJA 5C4KA 3O0GA 4TKSA 1ZOEA 3NFGB 2WMQA 3NNWA 3FWQA 2XCKA 5GJFA 3BGPA 5CI6A 2BFXA 3EL7A 3QGYA 4PL4A 5FP5A 1GZKA 5K3YA 4IB3A 4LI5A 5E1EA 3QUPA 4G6NA 2BKKA 4CG8A 3QF9A 4XOYA 3I5NA 3NRMA 3UIMA 2ZV2A 3PVBA 2B52A 4F1TA 2WTWA 3VRYA 2W1GA 2CGWA 5FRIA 3QTUA 3KVXA 2OLCA 3CY2A 3R21A 4M84A 3FHIA 3SV0A 1FGIA 4FTMA 4NH1A 5LCJA 2GQRA 3QC9A 1ZY5A 3FAAA 2GQGA 1XO2B 4GFMA 3PVWA 1GZOA 3WOWA 2P4IA 2I0HA 5LMKA 1MP8A 5JGDA 4BCGA 2PVLA 3DQXA 5FEEA 1BYGA 2XNPA 2WQMA 4MXYA 3V5LA 4EQMA 1OIUA 2ZMCA 4YGAA 4R5YA 4CFXA 3L8SA 4FIEA 4O96A 1JSUA 1XH6A 4DHZA 1SZMA 1JBPE 3KXXA 5DLSA 4JJRA 2LGCA 2HENA 4OTQA 5D1JA 1SVEA 3LKMA 2OH0E 1F0QA 2XIYA 3F7WA 4AWIA 2FVDA 2BMCA 2WOTA 4JG8A 5K4JA 4NEUA 3KF7A 2R5TA 3KFAA 1P4FA 3RINA 1AD5A 2ZB1A 4TY1A 3PE2A 4FKQA 1Q8TA 1KE8A 2XA4A 3TTJA 3K5UA 5C1QB 4DF3A 2IJMA 3LM5A 4IW0A 3PYYA 1R78A 2J2IB 3LFCA 4UZHA 3QRTA 4AN2A 4E4MA 2UZEA 5EDRA 2RGPA 5I9XA 3FPQA 3W0PA 5K0KA 1VR2A 2G2FA 2WB8A 3KRWA 3NIEA 4BCHA 2J6MA 5HIDA 4MNEB 1MUOA 1YDSE 4FV7A 5DR6A 4J7BA 4BDAA 4EQUA 3ORPA 3EIDA 4FOCA 3PJ1A 3EOCA 3KGAA 4U41A 3SRVA 4ITHA 4JBQA 4ZJVA 5CI7A 1PYXA 1WBPA 4PRJA 3PSBA 2A1AB 3MH1A 4M0YA 2X9EA 3MVLA 5EHOA 5LARA 4WNPA 4S33A 4FODA 4B6LA 1NVRA 4IDVA 2F2CB 3ID6C 4J1RA 1H28A 4I6FA 2Y6OA 4DAWA 2QCSA 2WELA 2WAJA 1JOWB 3PRIA 3AXWA 3SKCA 4U44A 4E7WA 4O84A 3QRUA 2W06A 3SDJA 3MTLA 3UVRA 4IB1A 4OBPA 1ZLTA 4EHVA 4EKKA 4AQKA 3I60A 3BYOA 3LJ1A 4NZWB 4PUZA 3EFKA 4AUAA 4AXFA 3E8DA 4EH3A 2B9FA 3MFUA 4R5SA 2Z8CA 1S9JA 2XANA 3KMWA 3R2BA 4G9RA 5BNJA 1OGUA 3QAME 4G3DA 5IA0A 1FPUA 1U5RA 3Q4CA 4RGJA 4I0TA 5EW3A 3QQUA 5FDPA 5J9YA 1X8BA 1OKVA 2C0IA 2JC6A 3QTQA 4PDPA 4RFMA 5CNOA 3ZFYA 3KA0A 3KRLA 5EKNA 4O0VA 4RMZA 1YOLA 4KIPA 4G3FA 1QCFA 3TEIA 2CJMA 2GTNA 3KY2A 1LEZA 4RPVA 2ESMA 3QXOA 3TNIA 5BVNA 2P0CA 3DS6A 3KKVA 4JT3A 4V04A 3DCVA 3F2AA 3NR9A 4QRCA 4IAYA 4RJ4A 4C4IA 4O7NA 3PIZA 4M14A 3WF6A 3RAIA 4G34A 1DAYA 4LGHA 3HMNA 3VUKA 4ZK5A 2XH5A 3JS2A 4GVJA 5K4IA 1H25A 4RT7A 2O3PA 3EWHA 4XHKB 5A54A 5EI6A 5L2SA 2PK9A 3A7IA 2F7EE 3QD2B 3EB0A 4YLKA 5EH0A 5K9IA 3ACJA 3RHKA 1PY5A 5KMJA 1OM1A 4MTAA 2AEGA 3I79A 4AZWA 4IZ7A 3BHHA 4D9UA 3GVUA 2ETRA 3LCOA 4E1ZA 4GKIA 3GC7A 4PNKA 4YZ9A 3GEQA 4I0SA 2GQSA 3FLSA 3GBZA 4QPAA 5DVRA 2XIRA 2C6KA 3H9RA 1E1XA 4G3EA 3ORTA 5CQUA 4ANLA 3VN9A 3FPMA 4D4RA 1BX6A 4ANOA 3TV6A 3AD4A 4K0YA 2GU8A 4ZXTA 4F70A 5LVNA 2XALA 2R3MA 4ALUA 5B2LA 4DH8A 3SD0A 4JI9A 4A7CA 4ITIA 3ANRA 4O7RA 4AF3A 2A27A 4R3PA 4KIKA 4LRMA 4DH7A 3TZ8A 3R9DA 5CU6A 4O0UA 2UZNA 5I5ZA 2YCSA 4O86A 4DT9A 4LV5A 4IACA 3FZOA 4O4FA 4U3YA 2UW5A 1JSTA 3UG1A 3ZTXA 4DH5A 4ZMFA 2I6LA 2Y4IC 4K2RA 4KINA 4WNMA 4XYFA 4TYJA 4BDDA 4UX9A 3GCUA 4FTRA 2QD9A 2ZV9A 3MGYA 4N70A 4XG7A 3U6JA 4O83A 4IAFA 4A9TA 3QA8A 1OIYA 3PLSA 3IKAA 4L42A 2JGZA 3AG9A 3KXMA 4YJQA 4OT6A 2QVSE 3VUGA 5M4IA 3NEWA 2IN6A 5K0XA 1OL7A 3T8OA 4PX6A 1W98A 2OIQA 3OTVA 5EG3A 4KSQA 3FI8A 5F95A 4AG8A 2XJ0A 3Q4UA 4IVAA 2BHHA 2X1NA 2HW7A 5BUJA 5E8XA 3C4XA 4H3QA 4QYHA 4C33A 2XNMA 5HX8A 3ZCLA 1XBAA 4UXLA 2F4JA 5CF8A 4G5JA 4Y5HA 3UO5A 3ZO3A 1WVWA 4ASZA 4WUNA 2XYUA 3IW4A 5M44A 4Q9SA 2YAAA 2W1DA 2G9XA 4C4JA 4RRVA 3CS9A 3V3VA 4J71A 3DAJA 4BHNA 4ZTRA 3JVRA 3QUDA 3L9NA 4D2RA 4AZFA 2XIKA 4TT7A 2XK7A 4FSQA 5CAPA 3Q9XA 4FC0A 3L9MA 1UU3A 4FTUA 4QPMA 2OZAB 1Q99A 4GK3A 4BDJA 1SMHA 2GNGA 4PWNA 2G1TA 5J87A 3V5JA 4DEGA 4ANSA 2X8DA 3ZXTA 4DEBA 4RWIA 4CSVA 4LDTA 3RTPA 2JDVA 3FQSA 4J53A 4B9DA 3AC3A 1SYKA 3DBFA 3FC1X 4AT4A 3FLQA 3TZ7A 1BMKA 2UZUE 4QMWA 1U5QA 5CF6A 5I9VA 5IU2A 4MEDA 3H30A 2BRBA 3DK7A 2CGVA 4AW0A 1M2PA 4FV4A 5AM7A 4EONA 3R1NA 3TACA 1BUHA 4BFMA 1M2RA 2JAVA 5I0BA 3Q6UA 4TNBA 3U8WA 4FKLA 3Q9WA 3FZTA 5ANIA 1TVOA 3CKXA 4UV0A 3ROYA 5IQCA 3QZIA 1M7QA 1OBGA 3RKBA 1UNHA 1WVXA 2UZOA 4YO4A 5A4QA 4MF0A 4O0XA 2G2IA 4V0GB 4G31A 3CJFA 5AP4A 4I1ZA 4UALA 4YNEA 4DTAA 3QRJA 1FMOE 3LMHA 2WD1A 4LOQA 3QKMA 3D15A 4PDSA 4AXEA 1PKDA 3F82A 3QLGA 1O6YA 3RPYA 5EQYA 5CT0A 4AW2A 4CEGA 1FVVA 3CGFA 4R7BA 1URCA 2NRYA 2BIKB 2BZJA 3KREA 4A9UA 3BE9A 3HUCA 1JPAA 3DKOA 3CD8A 1R0EA 4EZ3A 3VS4A 3WILA 3TZMA 1KUTA 3FQHA 2O63A 3OROA 3KCFA 2C1AA 4MXCA 3UDZA 4GRBA 4FSZA 4PDOA 3C0GA 5BUIA 1V0PA 4RIWA 3IW6A 4HGLA 2VUWA 5CS6A 4BDCA 4GT4A 3E88A 3THBA 5BMSA 1PXNA 3DXQA 1YVJA 1OKZA 4AZEA 3ELJA 4ZY6A 3NDMA 5IKWA 4ANBA 4F9CA 4RZVA 1PXPA 3V6SA 4PTEA 4ZAUA 3WZEA 4H36A 3CD3A 4JG6A 4FV9A 4A9SA 3DZQA 3LW0A 3LCDA 3OW3A 4D4SA 2DS1A 4AN9A 1FINA 3ZO1A 3H4JA 4I5CA 2UVXA 4QTAA 4LV8A 4QQTA 5CVGA 3FL5A 1H4LA 5JN2A 3IDBA 4BBMA 5DNRA 3V5TA 5JFXA 2EWAA 3E87A 3KCKA 4BDGA 1JNKA 1YRPA 2W1FA 3NAYA 3BI6A 1JQHA 3LFQA 3RHXA 4V05A 3HMMA 5BYZA 5BYLA 2XBJA 2B1PA 4F6WA 5AP7A 5GHVA 3BBTB 5DT0A 3W2RA 2RG6A 4GJ2A 3DLSA 4BL1A 4BRXA 2CNUA 5KE0A 4IZAA 4AT5A 3G9NA 4G2FA 1OUYA 3FZRA 1JSVA 4ZLYA 2ITZA 5CEQA 2EXEA 4AX8A 2X7FA 2J0KA 4ZOGA 1FVTA 3R7OA 4MX9A 5E8TA 5LXMA 1H08A 3BLHA 2WMBA 2YJSA 4BCJA 1XR1A 3MB7A 4AU8A 5B0XA 4YJNA 3TG1A 3RCDA 5CX9A 4TWCA 1Y91A 5ICPA 3I5ZA 4O7ZA 1L8TA 2DYLA 4GVAA 4OBOA 4C4HA 4EH6A 2CPKE 3I0OA 3G0FA 5CU2A 5AUXA 3FKOA 2XK8A 1YKRA 3RWQA 4L68A 4EOIA 1YXUA 4CG9A 5J95A 3ULIA 2PVFA 2W7XA 3SX9A 2OIBA 1DM2A 2IW8A 5A4LA 2PUUA 4FNWA 3IQ7A 3MDYA 4FKPA 3BE2A 5IQAA 2WU6A 2VNWA 3H0YA 3R30A 2I1MA 2XUUA 2VTNA 4GYGA 4X2JA 4AS0A 4IWQA 1Y6BA 5JEBA 1PKGA 5EYCA 2YABA 4FIJA 1OKWA 4NYEA 2PHKA 4KABA 3RMFA 2JKOA 2QOQA 2RL5A 4FEWA 4R6VA 4GK2A 2BRNA 4ASXA 4K18A 3ZLWA 3LCSA 5LWMA 3PJ3A 2CNQA 2UZTA 3KF4A 4FKJA 4MD7E 3NVKI 1CKPA 5DI1A 2XRUA 2W4JA 4EOMA 1OL1A 4W9WA 5I9UA 3PDTA 5AA9A 1MQ4A 1BI8A 3HMIA 4OAVB 3TNPC 5DBXA 4LRJA 4QP8A 2B9HA 1PJKA 3QTZA 4ZTHA 4JR3A 5HKMA 3RPVA 2QG7A 2H34A 2WMVA 4HZRA 4S30A 4M3QA 1KE9A 3P1AA 2OJIA 3DK6A 3QTRA 4BB4A 1BL6A 4EWQA 5CAVA 2W9ZB 4HCVA 4EJ7A 4E73A 4J96A 4GW8A 4A4LA 4CFUA 3C7QA 5CEIA 4DEAA 4E6CA 4F1OA 2VTTA 4GL9A 5BVKA 1WVYA 4HVHA 2CCIA 5EYKA 3WYYA 1B38A 5BX0A 2C69A 2WU7A 2PULA 4ZZMA 1UU7A 2IVVA 3NW6A 4F6SA 3VUTA 4EC9A 5HLWA 3MY5A 2QG5A 2YIYA 3PG1A 4W4VA 1RW8A 4QMZA 3OBGA 2WGJA 3CTJA 3NX8A 3SOCA 2XB7A 5DEYA 4QNYA 3VBVA 4UWYA 2B9IA 2IW9A 4L8MA 2ZV7A 2KTYA 3DGKA 3S0OA 1KSWA 3QCYA 1CTPE 2B9JA 5AA8A 2UUEA 3VBWA 2VTIA 3QKKA 2ZDTA 4MBIA 4UZDA 2VO0A 2C4GA 4BI1A 2VD5A 3BV2A 4CKJA 3A99A 2HZNA 3DBDA 4G17A 4E4LA 2WMTA 4JBPA 4JR7A 3KEXA 3JPVA 3UP2A 4WG4A 4FUXA 3O8PA 1U54A 3QCSA 4AN3A 4AZSA 3AC2A 4O4DA 1FOTA 3RGFA 3TIYA 4NM3A 2RG5A 4IXPA 4RIXB 1NW1A 1IR3A 4PPCA 4CFMA 5AAGA 3L8VA 4BZNA 3P79A 2YM4A 3E92A 2R0IA 4FIHA 1JKLA 5DG5A 5DT4A 5JFWA 3UZRA 5AX9A 4O27B 3W0MA 2V55A 1YOJA 4ALWA 1J1BA 4O6LA 2DUVA 3OEFX 4IAAA 3HA8A 4JNWA 4DFLA 4E3CA 4F4PA 3QYZA 4L44A 4CFNA 3II5A 5DR2A 3QYWA 3R1YA 2WMRA 3QC4A 4AA4A 1XKKA 2EVAA 3E93A 4PP7A 2V7AA 2X2KA 3WARA 4BI2A 3OUKA 2CCHA 3R1SA 3L8PA 4F64A 1HCKA 3RK7A 4IM3A 4QMVA 2ZM3A 3DBEA 4ALVA 2IWIA 4WD5A 2ZM4A 5HG7A 3O2MA 3QTWA 3UG2A 4M0ZA 5EOBA 3HP5A 4ASDA 2BDJA 4J8MA 4C02A 5IUIA 4ACGA 5JGAA 3ORKA 4FTKA 4U40A 4BVUA 1P4OA 4TYEA 3HZTA 4XMOA 4ACMA 3ENHA 3DZOA 4YU2A 5IQBA 3QFVA 3M2WA 1BL7A 3CKWA 5IA5A 2BZHB 4X2FA 3VUHA 5EM5A 3OS3A 3F6XA 2LAVA 3MH2A 4GG7A 3FMEA 3VUMA 5CAOA 5CEPA 1GZNA 1IRKA 1MRUA 2QLUA 2YN8A 5HBEA 4QYYA 5JRQA 1W8CA 3NLBA 3QL8A 2R3OA 4NW5A 5TKDA 4CD0A 5HORA 4GV1A 3QHWA 3B2TA 4CZUA 5DR9A 3LQ3A 3RAWA 1REJA 3UIBA 4KKEA 3ZSGA 2PYWA 2YCFA 2JKKA 2GNLA 3EKNA 1FBNA 2VU3A 4FTOA 4AA0A 4RVKA 2XARA 3RK5A 4QDVA 3FDNA 3MPTA 4TYHB 3B8RA 1ATPE 1U59A 3D94A 2PE2A 5HEZA 3S95A 2OBJA 2VO3A 5LOHA 5CXHA 1DI8A 2HWPA 4YUQA 1YHWA 4B99A 2VRXA 4GG5A 3PXQA 1WBWA 1MRYA 4GYIA 4UMRA 1H0VA 5DOSA 4I20A 3LAUA 4Z9LA 5HQ0A 3SGCA 3Q6WA 4QMUA 3UNJA 4CMOA 5IG1A 3ZHPC 4GCJA 4KKHA 3F5UA 3ZO2A 4YBJA 1Y8YA 4KS7A 3DAKA 4JX7A 2QOFA 3TN8A 4AW5A 5M4FA 3RP9A 3IGOA 4HW7A 2Z7LA 2ETKA 4OTDA 3HMPA 4KIOA 4PP9A 1GY3A 3D9VA 3DA6A 3KXNA 4TRLA 4IX4A 1ZMUA 4BKJA 3OWPA 2UZDA 3UOJA 3UMWA 5HNBA 3C50A 3K54A 2C5NA 5HVJA 3NYVA 3EQGA 5K5NA 5HO6A 2XCHA 4F08A 2YFXA 2OG8A 3C4CA 3F5XA 3HV5A 4RG0A 3JUHA 4ZS4A 4FG7A 3P23A 4QMNA 4E6AA 5BV3A 4EYJA 2F49A 1OPJA 2PVYA 5KBQA 4CFWA 4H3PA 3G33A 2O64A 3NCZA 3QCXA 3LJ0A 3UIXA 3R28A 1YWNA 3N9XA 4D5KA 3ZDUA 4MD9E 2E9NA 5JZJA 2J5FA 4QMOA 3PLAE 3KU2A 2J0IA 3HAVA 3TJDA 2UW7A 3DBCA 1PYEA 1WBOA 1APME 2B54A 3BU3A 2PPQA 5I3RA 4UB7A 4G5PA 3EMGA 2J90A 5BVDA 4JBOA 4RFYA 5AMNA 3ZLSA 3A8WA 4FIFA 5LVLA 3A60A 2ITOA 4FG8A 5LMKC 4IANA 4HYSA 4LOPA 4XP3A 5J9ZA 1ZWSA 4IAKA 2B55A 1UU9A 2G15A 2WMXA 4K33A 3TI1A 3PSCA 3U51A 2GFSA 3OCTA 2VWBA 4L67A 3COHA 3OCGA 4JS8A 1PF8A 1W0XC 3PWDA 2QODA 2XNBA 3QGWA 3UODA 4JLCA 5F9EA 3OZ6A 1K2PA 3KVWA 1UKIA 3MH3A 3Q5IA 2XIXA 3OWKA 2GHGA 3QXPA 3R8PA 3RM7A 3ZEPA 4RWJA 3DFAA 3DAEA 4BCOA 3A7JA 1PXKA 3MI9A 4IVCA 4X6QC 2BZKB 3EQCA 4JRNA 2BAJA 4TW9A 5JMSA 2FGIA 4H1MA 2YIXA 4ACHA 4O7LA 4AOIA 3HV6A 2ZOQA 2UW8A 2X0OA 4MAOA 1F5QA 2BIYA 4L52A 4GKHA 3PZHA 2ERZE 2I0YA 3ZMMA 5M57A