3FXXA

Human epha3 kinase and juxtamembrane region bound to substrate kqwdnye[ptyr]iw
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
299
structure length
288
Chain Sequence
TQTVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITAARPSNLLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural recognition of an optimized substrate for the ephrin family of receptor tyrosine kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ephrin type-A receptor 3
total genus 96
structure length 288
sequence length 299
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fxxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fxxA01
2XRUA 2R3GA 3DB8A 4N4SA 3O8PA 4QYYA 2G9XA 5A4LA 1A48A 4NJDA 3G2FA 4JBVA 3C4EA 4UY9A 4BIDA 3FSKA 4JG8A 3Q5IA 4NK9A 3ODZX 5E92A 3MDYA 3ZRKA 4AW5A 2IVUA 4I5HA 1Q8YA 4O0VA 4CG8A 4YBKA 4ZY6A 3DFAA 2WHBA 5KNJA 1J7LA 3AD4A 5F4NA 3D2IA 5A9UA 3D5UA 2W99B 4GV1A 3TV4A 4ACHA 4G3CA 2CN5A 4FYOA 3LFSA 4BICA 4ZXTA 2WTJA 4UMTA 3FI3A 3TI1A 3UOHA 4RA5A 3OXIA 3DBDA 5JN2A 3PXZA 3CC6A 4FOBA 4IWPA 4CSVA 2RSVA 4FV6A 5CVHA 2OG8A 3HMNA 4KBCA 4DA5A 4BCOA 2C6DA 4QMNA 2BAJA 3NUXA 4C33A 2UZBA 2WD1A 2G2HA 3GB2A 4GIIA 4PTEA 4ANQA 3NUPA 4MYGA 1WBVA 4Y85A 3A7FA 3UC4A 3D15A 4CG9A 3UNJA 5AAGA 5AX9A 2W1IA 4DYMA 2PVFA 3EN5A 3FMDA 5AR5A 4B7TA 4EJNA 4M69B 3U9NA 2C69A 5KHXA 2QOIA 4O27B 3BQCA 5DPVA 4ERKA 1XKKA 5F95A 1W98A 4E6AA 2GDOA 3CQUA 1CMKE 4NFMA 2QC6A 5IUIA 4AF3A 3LM0A 1REJA 1OB3A 4IFCA 3HP2A 5LVOA 1MRVA 3NNWA 4X2FA 5BVWA 3U87A 4BKYA 2FO0A 2ZDUA 4W9WA 2YIRA 4KKGA 5HCYA 4AZSA 1FGKA 4RIWA 5EM6A 4O6EA 3FXWA 5LWMA 3BYOA 4G5JA 4NUSA 4EOSA 4BCJA 3QHRA 1DS5A 3PJ1A 3QCSA 2OJGA 5CAPA 5JFWA 3ROYA 2VD5A 2IZUA 4I20A 2RFNA 2J4ZA 5EW8A 3RK7A 3RWQA 3K5VA 3WZEA 4BIBA 5GHVA 1O6LA 3CTQA 4FV1A 2C5YA 3Q2JA 2Y4IB 3MWUA 2GPHA 4R3PA 5CEPA 2C6MA 3W33A 2PUIA 4TYJA 2GNIA 5AP5A 4NM7A 3NYNA 4RRVA 3LLTA 3KKVA 4BCNA 4E3CA 2UW9A 3EFWA 2CNVA 4BGHA 5M4FA 3W2OA 4QMXA 3PE1A 1XH7A 4LGDA 2PMOX 4KINA 2G15A 4IAAA 4Y83A 1NVSA 4DEIA 5EH0A 3SDJA 2P0CA 5KMKA 1VR2A 3PE2A 4I93A 4DG0E 5AJQA 3Q4UA 3Q96A 2ITUA 2UZLA 4FKLA 5H2UA 5E9EA 2B0QA 2X6DA 4KNBA 4DG2E 2QLQA 2W05A 2XS0A 4XLVA 2VN9A 1W8CA 3LZBA 4IMYA 3DOGA 4OUCA 1Q8WA 3DKGA 3MFSA 3ZBXA 5M44A 4BYIA 2R4BA 2ZOQA 4JL9A 2JIUA 3NDMA 2PU8A 3QWJA 2C6TA 4EK4A 3MIYA 4X2NA 5HE1A 3QUPA 5FBNC 4ACCA 2RIOA 3U6IA 2JBPA 2BKKA 5FXQA 3RAKA 2CGWA 3QUEA 4UZHA 2J5EA 5EYKA 4NL0A 3ZU7A 2YLFA 2BRBA 4EK6A 3FWQA 3R71A 5HESA 4M3QA 2V7AA 4O22A 4RX7A 3C0GA 4IVBA 2X1NA 3PZEA 5JSMA 1PMNA 3DBQA 3R9NA 5IMXA 5JFXA 5IQIA 3FXXA 4UMRA 3BKBA 2XK9A 2I1MA 2JDSA 5EHOA 4EBVA 2YAKA 4EQUA 5L2WA 3CBLA 3HMIA 1YXXA 4H39A 3B2TA 1PXMA 3PPKA 5CU2A 1JVPP 3S00A 4XG3A 3SC1A 1JLUE 2WMBA 4QPMA 5C27A 2WQEA 4A4LA 4DEDA 5A54A 4BDCA 5KBQA 4H3QA 3N4UA 4AXAA 3C7QA 4Y5HA 5ANDA 3II5A 3KY2A 5CSVA 3LFAA 4QMOA 1ZWSA 3JR1A 4NM0A 1PKGA 5D10A 3IW8A 4C35A 4DEGA 4F7LA 4HPUE 1PHKA 4I0SA 1SM2A 1ZY5A 3CPBA 5CZIA 1KE5A 3OOMA 4I6QA 4QPSA 4DH8A 4LMUA 2WOTA 3QXPA 3QD2B 2X2KA 3R7EA 2CKQA 2P33A 4QP7A 3TNIA 3COHA 5F9EA 3AGLA 3JXWA 4DFYA 1J91A 1B38A 1PY5A 4FSYA 4IX4A 4CMUA 2C30A 2OW3A 4ZSLA 3CJGA 2RL5A 3R7GA 3WF5A 5CASA 4EL9A 2X39A 1M2PA 3FHRA 4GKHA 3DZQA 2YA9A 3HGKA 3BE9A 5I4NA 4H1MA 4V04A 3VUMA 3ANRA 1CDKA 3WZDA 2IN6A 4QMPA 3PYYA 3V5LA 1R0PA 4QMUA 3G9NA 2VTPA 3GCVA 2I40A 3GC9A 3R2YA 2O3PA 4M0ZA 4I6BA 3W10A 4FKOA 1YDTE 2OIQA 4TY1A 2J0IA 4ANNA 3OT3A 3TDVA 4PMTA 4FG9A 4AZWA 3BEGA 2RG6A 3DK6A 4BBMA 4L53A 4EOQA 1KOAA 1OKVA 3ITZA 4E5BA 4D5HA 5CX9A 4EH4A 1HCLA 4EK5A 5DMZA 3S4QA 4E6DA 3RAIA 1XQZA 3FLZA 2XK6A 5CZHA 4EWHA 5KHWA 4G5PA 3RP9A 2BZIB 2XUUA 1YOMA 3KXGA 5EHYA 2JKQA 3F5PA 2YM7A 5ITAA 1OL6A 2OU7A 3FPMA 4K0YA 4APCA 1OL1A 4BTKA 1DI8A 3QKMA 5AEPA 2CGXA 3G0FA 1KV1A 4JQ7A 5BVKA 5BQ0A 2GU8A 3W18A 4O21A 5M51A 5BUEA 2FA2A 3SLSA 2C1AA 1XH4A 1W0XC 4D2VA 4W4YA 4L00A 4FSMA 3OW3A 4X3FA 4ZLZA 3TUBA 1MRUA 2PZPA 1OL5A 4M84A 5I3RA 2PVJA 4W9XA 4X3JA 2A1AB 1Y6AA 2PVLA 1G5SA 1W83A 3FI4A 3FLNC 3H3CA 3W8QA 2XK7A 3V8SA 4JQEA 3O51A 3L9NA 1OZ1A 3R9DA 4EOOA 2ITOA 4I5PA 3P79A 1WVYA 2XYUA 1YXVA 4AT4A 3VNTA 1NT2A 1ZYJA 4TWCA 3H9RA 4UXLA 2IWIA 3ACKA 2ERZE 2FH9A 2F7EE 3IQ7A 4RVMA 2KULA 4HVSA 3UIXA 5CALA 3SXFA 2W96B 5M4CA 3Q2MA 3ZM9A 5EQEA 3RHXA 3CY3A 3PLSA 4PP7A 4DT8A 3MJ2A 3MTLA 2AYPA 3K2LA 3BYSA 5GZAA 3RAHA 3JUHA 5BMSA 4ZJJA 4G9CA 1RW8A 3E62A 4A9YA 2QCSA 4C4GA 4UMUA 2YACA 1MRYA 4QP3A 5AV2A 4NYEA 2B9JA 4JNWA 5FTOA 2O0UA 4U5JA 4BZDA 4MAOA 2PZYA 2W0JA 4TZRA 4GFGA 4GYGA 4X21A 3V8WA 4DEAA 4B99A 4LRJA 4I92A 5HLPA 5DOSA 1ZYDA 5IEYA 2BZJA 2W5BA 3UGCA 5IUHA 3KEXA 4WA9A 2RF9A 3OFMA 4P5QA 5IPJA 3EQFA 2BRHA 2JAMA 3T9IA 5TKDA 4F09A 3VBWA 4BCIA 2GNFA 2HENA 4RSSA 3WF7A 3RTPA 2ZM1A 3DXQA 2GS6A 2V62A 2WTIA 1PXIA 3GCUA 3GU4A 3QQLA 2AC3A 2C3LA 4LUEA 4FG8A 4PUZA 3BWJA 3NUNA 4KS8A 4F1MA 2FYSA 3LJ1A 3FSFA 5IMEA 2EXCX 1PXKA 3EL7A 1YHWA 3IW6A 3KRLA 1CSNA 3CIKA 4P2KA 4WOVA 3VUGA 4AGDA 1F3MC 2FSLX 3QLGA 5GIOE 3CPCA 5EOLA 2V5QA 3OT8A 3KN6A 2OJFE 2PZRA 3MYGA 3HECA 5E8UA 3ZLXA 5J79A 4O7WA 4HVGA 4FGRA 4O0XA 1ZMUA 5D7AA 4DH5A 3MY1A 4EYMA 4C2VA 2Z7RA 1JBPE 2G2FA 4CXAA 4W4XA 5JQ8A 4E4XA 3EFKA 5AX3A 4ZS4A 1M17A 1OBDA 1WBWA 4UMQA 5TF9A 4M7IA 3ZH8A 4TYHA 3ZO3A 4DGGA 5IZFA 5BVEA 5DNRA 5DWRA 2X9FA 3ORTA 5K0KA 5KO1A 4RZWA 4L3LA 4G1WA 3THBA 4E26A 3JVSA 4NIFA 1J1BA 3BE2A 4C62A 4MQ2A 4QTAA 2C6IA 4TWOA 1OUKA 3UZPA 2XCKA 4K11A 4ZJIA 2Y7JA 5HX8A 5J7HA 5LMKA 3KRWA 1YXTA 4F6WA 3R04A 4LUDA 5M09A 3HRFA 2UVXA 2X8DA 4X6QC 4MXYA 4G6NA 3R7YA 3O7LD 2GNLA 3QD3A 4I6HA 1WBOA 4JBOA 5HICA 5J95A 2O5KA 4ZP5A 5K5NA 4YHFA 4EZ7A 3UZRA 1WMKA 5LVLA 1Q3DA 4GJ2A 4RPVA 4ZTNA 4DE4A 1NXKA 2B7AA 2B53A 2VTTA 3BHTA 4G3DA 3R83A 4ZIMA 5IKWA 2WMWA 2BILB 1G3NA 4FV3A 4D2PA 4FYNA 1T46A 4YO6A 4QOXA 4BI1A 4FICA 1KWPA 3SG8A 5LVNA 3WE4A 3RWPA 1PXOA 3WOWA 1VYZA 5H8BA 4F0IA 5HVYA 4MCVA 3GFWA 2WXVA 3HL7A 5HNGA 2OF4A 2VX3A 3F66A 3ERKA 3PSBA 1J3HA 3F3VA 4RVTA 2CGUA 2PPQA 2CKOA 1QPDA 4AT3A 1XH9A 2J50A 3QKKA 4FUXA 4Q5HA 4EUTA 1JPAA 2OBJA 2QOOA 2XMYA 3HV6A 2GTNA 2JDVA 2JC6A 3KU2A 3MPAA 3P5KA 3MVLA 3QUDA 3R6XA 4G3EA 4AS0A 3UG1A 4F9AA 2DYLA 2R0IA 3FZRA 3RNIA 5HE3A 3UTOA 3WF6A 5D9HA 4CQGA 2A2AA 1O6YA 5M55A 3DXPA 3AXWA 2BTSA 3GI3A 3I81A 2CMWA 4QP2A 4A4XA 4Q9ZA 2QG7A 1JWHA 3FI8A 5EM5A 5IDPA 3WARA 4ZMEA 3RPYA 4O83A 4C58A 4AGUA 1UKHA 3S3IA 3UDBA 2HY0A 2R9SA 4RJ7A 2C1BA 3RKBA 3ENHA 1M2RA 3ZZEA 4QYHA 4ITIA 2WAJA 3LM5A 3QD0A 5CI6A 2WQBA 1QPEA 2BAKA 4QNYA 4MQ1A 5IUGA 2YLEA 4PDPA 3PRIA 4FNZA 4USDA 2VTLA 5A14A 1VYWA 4PRJA 1WBSA 1ZLTA 3TXOA 5HO8A 1GIIA 2QKRA 3MVMA 3D5XA 5E8VA 3R8PA 4KWPA 2C6OA 4G9RA 3OWJA 2YM5A 4YZ9A 4BI2A 3RPSA 1S9IA 3C5IA 4D9TA 3NNXA 3MTFA 4O7LA 3GQIA 2DS1A 4YGAA 1OITA 1UKIA 4IX6A 3ZFYA 2SRCA 2PHKA 3OWLA 4YNOA 1BKXA 4KUJA 4D2SA 4OW8A 3IPHA 3W1FA 2BZKB 3V04A 3MGYA 1BL7A 2CCIA 2BCJA 2JIIA 1WFCA 4BDHA 4BDDA 4DFUA 5FRIA 3D9VA 1H27A 1Z57A 4YZBA 3JS2A 3ORPA 3I7BA 3SW4A 2F57A 3NUUA 3NW6A 4GT3A 5L6PA 1XH8A 4LGGA 3LJ2A 2BMCA 3KCFA 3MIAA 1AD5A 2VO6A 5K5XA 3QGWA 2F4JA 3FQHA 5FD2A 4Z7HA 3P7AA 3QGYA 3NIZA 2E9VA 3QBNA 3P08A 5E8YA 2E9OA 3E8DA 4FX3A 3DBCA 1B6CB 4LOPA 4CMTA 2OH0E 4R6VA 4E20A 5C03A 5IG1A 2XBJA 3CGFA 4XCUA 5CQUA 4AG8A 4EKKA 2Y8OA 3IW7A 5DR2A 4DLJA 4FA2A 4YUQA 3LMIA 4OBOA 4O7RA 3F3ZA 2VO7A 4F08A 4QTEA 4EH9A 3PXFA 4B9DA 4D5KA 4XJ0A 4Y73A 4EZ3A 2XKFA 4AU8A 5I9VA 5FGKA 4PF4A 2WOUA 4ONAA 1Q8UA 4E6QA 2XNNA 3BHHA 1I09A 4GEOA 5LCJA 2QONA 4YTCA 4APPA 3A8WA 2J0MB 3PXQA 5EHLA 5B2KA 1WVWA 3R7OA 3OY1A 4M67A 4ACDA 5AA9A 5HG8A 5G1XA 3PA4A 4HCVA 2R3HA 4MF1A 3D14A 4HVIA 1ERKA 4GUEA 4P90A 4O7VA 3E5AA 4KSPA 3G9LX 2QO2A 1H1RA 3R7IA 3EN6A 3L8PA 2X7FA 4RWIA 3RPRA 5K4JA 3PLAE 4FTIA 4CLIA 4MNEB 3OBGA 2FSOX 5AV0A 1GNGA 5KMIA 3EYGA 4S34A 2CNQA 4L43A 3BU3A 2PULA 4L7FA 2ITZA 4LOOA 2GHGA 4AOJA 3CEKA 1UWHA 4CYIA 4MXXA 5BYZA 4BFMA 3ZSHA 2JIVA 3MPTA 5AAFA 4YHJA 4IAZA 1U54A 3HRBA 2GQSA 4NW5A 3VBXA 1FQ1B 4PPBA 4BWXA 1K9AA 1CTPE 2PL0A 2YZAA 4U80A 5CU3A 4O7TA 5HG7A 5BYLA 3E7VA 2YM6A 1V1KA 1IR3A 4Y5QA 3PVUA 2WIHA 3VUDA 3QQKA 1YHVA 4GU6A 5EDRA 5EM8A 5IQBA 3TKUA 1G8AA 5HIDA 4JQ8A 2X8IA 4M0YA 1XJDA 4BVUA 5HZNA 3KXZA 3GC7A 3ZFXA 4BWKA 5EK7A 1JSUA 1Y91A 2PWLA 3H9OA 1JNKA 1H08A 3EYHA 3CSVA 3IGOA 5M08A 4E73A 1YHSA 3B8RA 2HIWA 3MB6A 2FSMX 3O17A 5HE0A 5L8JA 2QVSE 2YITA 1DAWA 1YDSE 3R73A 2FGIA 2IW9A 4MHAA 4JOAA 5FDXA 4FSNA 4RC2A 4GKIA 2NNWB 2GS7A 3OEFX 4DTAA 3Q9WA 2YJRA 2R64A 5EQPA 4FTCA 4PWNA 3IONA 4YR8A 3KRJA 3N9XA 3TKIA 2ETKA 2WPAA 4AW1A 3NX8A 5IQEA 3Q53A 4D1ZA 3UBDA 3C9WA 2JKKA 3IOPA 3IO7A 3DPKA 1UA2A 4EK3A 2UZOA 2FUMA 3P7BA 5HIEA 2F7XE 2OI4X 3MVJA 3VJOA 3AGMA 3RNYA 3A99A 3G15A 3QHWA 4QO9A 5M4IA 4CCUA 4G6LA 5AP3A 3KVXA 4DITA 5K9IA 2VV9A 4DCEA 4FOCA 4E5WA 5DRDA 4QMZA 4FK6A 3WE8A 3IK3A 2WMQA 3G6GA 4IZAA 4M15A 4DN5A 3NCGA 4FUYA 4JLCA 3R1YA 5IA0A 4RWKA 1M52A 2WB8A 3DAJA 4Z7GA 1OIUA 3HVCA 3NPCA 5DEYA 4E7WA 1BI7A 1MQ4A 2BVAA 2OWBA 2PSQA 4IW0A 4IX5A 5GINE 4LYNA 3AC8A 1KUTA 4EEVA 5CSHA 4ZTSA 1H4LA 3PTGA 3F7WA 3VS6A 4ARKA 4ALUA 1B39A 2WEIA 2UZNA 4XOYA 4DGLC 3CD3A 3QWKA 3DKOA 4GYIA 4OTFA 1IAJA 2VTAA 2J0LA 3TJCA 5AP2A 3CTJA 1UU7A 4FT3A 1JSVA 4JDIA 4MD8E 3R8UA 5FTQA 4FKUA 3L8SA 5L2IA 1DAYA 2EB3A 2WMAA 4NM5A 2BTRA 3VS7A 3E87A 4ID7A 4MEDA 3RM6A 2PZIA 3I5ZA 2H6DA 3MFUA 3MS9A 2YFXA 3PP1A 4D4YA 3VUTA 4KRDA 4GG7A 4U3ZA 3SXRA 5FWKK 3RHKA 2VWUA 3BBWA 4RX8A 1E1XA 5AUYA 3ZC6A 2PUUA 3ATTA 5AUZA 5GIPE 1G8SA 3W2PA 4ANSA 4IJ9A 5LWNA 2VWIA 4CRSA 5DE2A 3VUHA 5HBHA 3VUKA 3MV5A 3R7UA 3SKCA 2YCRA 2ESMA 4HNFA 4LI5A 4YC8A 5I0BA 4FKJA 4XMOA 5HU9A 1Y6BA 5L4QA 3U6JA 5J5SA 3LKMA 2J6MA 4FTKA 4N57A 4FZFB 4D1XA 4U44A 5E8TA 2QNJA 4AX8A 3QC9A 4EOKA 3LCTA 3PWYA 4BF2A 3NGAA 2YCSA 3OF0A 4FNWA 3OY3A 5TE0A 3W2QA 5L6OA 4GT5A 3DNDA 3POZA 4FIHA 2WQMA 4BCGA 4GSBA 5KMJA 3SRVA 3I6WA 1JAMA 2OZAB 4NWMA 4FTMA 2EVAA 2REIA 5ACKA 4BCQA 2C6EA 3RCDA 5JEBA 4YMJA 3LFCA 3OEZA 4DF3A 5CYIA 4NTTA 3EZRA 4IC8A 4EC8A 4AZVA 4JG7A 4U6RA 2GMXA 1ZZLA 2W9FB 4CYJA 4M12A 4FR4A 5LMBA 4U97A 4O0WA 3NAYA 5EI2A 5L3AA 2FB8A 2G1TA 4JAIA 3KXXA 3GBZA 3LXNA 3SXSA 3C4ZA 2C3KA 4BDGA 4D2WA 4RQKA 4FIFA 4AUAA 4EOPA 1H28A 3DLSA 4ZTHA 5JRSA 3FHIA 4BC6A 4BHNA 1SMHA 5HX6A 5FQDC 3V6SA 3BPRA 4O86A 3LXPA 4QD6A 3F3UA 1GZOA 2OXDA 2C6KA 2WMTA 1Y8GA 3EN9A 3H10A 4NFNA 5FXSA 2ZMDA 3PY3A 2Z2WA 4MD9E 3NYXA 3Q04A 3TEIA 3ZLSA 1AQ1A 3TCPA 4L01A 3DJ6A 2GNHA 3KC3A 1UU9A 4U40A 3ZO1A 4IBMA 3ALOA 2ITYA 3VF9A 5L6WL 3EQCA 3FLYA 4ACMA 4CVAA 3HAVA 2GS2A 1J7UA 3CCNA 2JDTA 4FV4A 3R7VA 1F5QA 4FSRA 4F0FA 4EH5A 1OKWA 4L67A 2WTKC 1ZYLA 3QTQA 3R1NA 1NW1A 4RC3A 4XV2A 3Q4TA 1GIJA 1ZMWA 4AN3A 2NPQA 4FZDB 2XNBA 4JDHA 4D1SA 5HEZA 3U4WA 2YM3A 5E90A 4QPAA 4PY1A 4IIRA 2XM9A 3ZTXA 4FVQA 4EQMA 3PP0A 3RPOA 1RJBA 5EKNA 1ZOHA 3NAXA 4FVRA 4RWLA 2Z8CA 4IM2A 3ORXA 3Q6UA 2LAVA 4I24A 4EI4A 4ZTLA 3VBQA 1VZOA 3MY0A 4CFUA 4MH7A 1QPCA 4U9AA 5A4QA 2HAKA 4YO4A 4MWIA 1OKYA 1YKRA 1UNHA 4WUNA 3RJCA 2V22A 4HCUA 4YZNA 4FL2A 3LXKA 4IZ5A 1YW2A 3FMLA 4K9YA 3FAAA 3FLSA 4BDIA 4EH2A 3O96A 3QRIA 5FUTA 2R3OA 1SYKA 3HV3A 3U51A 3F2RA 4WSYA 3PIXA 3ZC5A 2YERA 2OJIA 3FMNA 3QZHA 4O2ZA 4ERWA 5EKOA 4QTBA 4GT4A 4L42A 3D83A 3LAUA 4Z3VA 4UB7A 5FBOA 4D4SA 5FEQA 4D55A 5J7BA 4UWCA 3ZSGA 3R0TA 4FV0A 4Z9LA 3ZUTA 3ZRMA 5BUIA 1CM8A 5DHJA 4EWQA 2X2LA 4IXPA 2Z60A 3SGCA 4QYFA 4BCPA 2IJMA 1XR1A 3K3JA 4FODA 2C5OA 4QRCA 4I3ZA 2JKMA 3VHEA 1GAGA 4RVKA 3TZMA 5IQGA 4IACA 3Q9YA 2V7OA 2E9NA 3QKLA 1WBNA 4IB5A 5DFPA 4B6LA 4AOTA 2YDJA 1Q62A 3QA8A 5D41A 3WIGA 4AACA 2FSTX 3KK9A 3A7IA 4GCJA 4YJSA 4U81A 5E8SA 3FMEA 1PMUA 4IM3A 4YPDA 4AE6A 4B0GA 2BRMA 4X3FB 4DH7A 3TKHA 1H8FA 2WMRA 3JVRA 2RFEA 1UU8A 4O1OA 3FUPA 2QOHA 4O2PA 2J9MA 1F0QA 3UO4A 3DZOA 2YZLA 4QT1A 5CNNA 5AUWA 2W1CA 2YM4A 4TYIA 2VAGA 4C36A 2OLCA 3ID6C 4R3CA 1WVXA 3EFLA 3R21A 3ACJA 3CS9A 3ZHPC 1OI9A 2PYWA 3NVMB 2VWZA 3FBVA 4G6OA 4R5YA 4GMYA 1IAHA 5IH5A 1ZARA 4IE9A 4S30A 2NRUA 4D58A 3PDTA 1ZAOA 4C3RA 1CKPA 3DJ7A 5HNBA 4A4OA 3RINA 4N70A 3RZBA 3TL8A 4CFXA 4XP2A 4ACGA 4CGAA 1KE6A 2WTKB 5IU2A 3MN3A 5CENA 3FC2A 3KGAA 4C4JA 5CS6A 3E3BX 1Q8ZA 3G90X 4ZEGA 3F61A 5JMSA 2VTJA 4EK8A 3OOGA 5JK3A 4U45A 3ZLYA 3F9NA 4W4VA 5CWZA 3Q3BA 4ZSGA 5H3QA 4O7SA 2VGOA 3LFNA 4BDAA 3FQEA 3VW8A 4FF8A 3UQGA 1Z9XA 1Q97A 2UZTA 2VO3A 3MFRA 3QTRA 4D9UA 4EH6A 2ITPA 4CCBA 4IADA 5IQAA 4F4PA 2PTKA 4FIGA 4I41A 4ANMA 3OROA 2BDJA 3DTCA 4GW8A 1MUOA 4HW7A 5M4UA 5AIRA 4DCAA 2PZ5A 4S32A 4ZY5A 3QX2A 5CSXA 3QLFA 4FTAA 5HVJA 1H1QA 1YOLA 3C1XA 3PUPA 4CV9A 2OGVA 2R3RA 3KVWA 4PPCA 2B9HA 2O64A 3BEAA 3HMMA 3N51A 4QTDA 2WMVA 2IVTA 3RGFA 4CFVA 4TL0A 3KULB 5T3QA 2YCFA 4P5ZA 3NWWA 5DT0A 2YJSA 3UZTA 1YWVA 1H0WA 3ZCLA 3BGQA 2R3FA 3PJ8A 4K2RA 3VS2A 3QTIA 4FV8A 5KKRC 3O50A 2I7QA 4C3FA 3HDMA 3NZ0A 2ZM4A 4II5A 5J9YA 2ERKA 4RJ6A 5FM2A 5CF6A 1E1VA 4S2ZA 4FTQA 4KS7A 3OCGA 3R8ZA 5LCKA 3HA8A 1H1SA 2R3JA 4LL0A 3CKXA 3U9CA 4PNIA 5CSPA 1KOBA 2B4SB 5E8ZA 4WNMA 3H30A 4I4EA 4E4NA 3ZFMA 3MH2A 3A60A 2R3PA 4QYEA 5AR8A 5HE2A 3CTHA 3NW7A 4CT1A 4OGRA 4R1VA 4FGBA 2F2UA 4PTGA 4F70A 4OTWA 4PPAA 4AA5A 4CFMA 4RQVA 3C4CA 4IX3A 3VBYA 2C5XA 4AZTA 3BGZA 4CZTA 3BV3A 2B9FA 3ELJA 3PWDA 5HO6A 1H1WA 2XB7A 1HOWA 2WFYA 4FSWA 4OT6A 4TTHB 3UOKA 2XK8A 2XZSA 3FJQE 2F49A 2X7OA 3PZHA 4XOZA 1LP4A 2HXQA 3CQEA 3PFQA 4XX9A 5D7VA 4IAYA 4M68A 3LCDA 1M7QA 3RK5A 3KMMA 4ANOA 4K6ZA 3RK9A 1LR4A 4HGEA 5KZ0A 4BGQA 5BVDA 4J97A 3B2WA 5DLSA 4DBNA 5ANIA 4ALWA 4YU2A 1PRYA 2H34A 2O63A 2XM8A 3E3PA 3QAME 3U54A 1TQIA 2O8YA 2QKWB 2YIQA 4CRLA 4O91A 3ORMA 4PNKA 3L9LA 5HORA 3ZBFA 4IAKA 2QO7A 5HBEA 2QOBA 4AZEA 3HKOA 4YJVA 3P1AA 3TTJA 1PYEA 4OBPA 5CEQA 1ZOEA 2C5NA 3L8XA 2WU6A 3BYVA 2WU7A 3HX4A 3HV4A 4ANLA 4NCTC 3G5DA 3REPA 1UVRA 4FNXA 5LVMA 4DGNA 3OWKA 4C57A 4RJ3A 1PXLA 3UMWA 4F9CA 3C4WA 4Y8DA 2UV2A 2CSNA 3VHKA 2BIKB 2W4KA 3ULIA 4BYJA 1NY3A 3V01A 2HW6A 3OCBA 3UP2A 5JFSA 2F9GA 2YDIA 3DQXA 2GNGA 2OF2A 3PY0A 4QMSA 4TRLA 4AGWA 4HCTA 1BMKA 3IECA 3EN4A 4F7SA 5HGIA 1GIHA 3UMXA 1XBBA 4HZSA 3Q32A 2F2CB 4OTIA 4CQEA 4HVHA 5JZNA 1Q3WA 4O0UA 4OAVB 3WYYA 4L9IA 3EZVA 3EKNA 3FZ1A 3PSDA 2WGJA 3AD6A 4HGLA 4NCTA 3VIDA 3CKWA 1YQJA 4RBLA 3VO3A 5HG5A 2JDOA 5AP0A 4XBUA 4FT5A 4OTQA 2XK4A 4FZAB 5AADA 4XLIA 1WAKA 2QR7A 2PK9A 3IG7A 4QP1A 5ETIA 4ALVA 2HZ0A 4MKCA 2XIYA 1OIQA 3EKKA 5CF8A 5FDPA 3KF7A 4WHZA 4XP3A 4GH2A 2OXYA 4FKTA 2ITXA 2R3KA 3LFEA 4H3PA 2WMXA 2XIRA 3HUBA 3R63A 3QQFA 4O81A 1ATPE 2ZM3A 4FTOA 3VBTA 4FEQA 3LCOA 4BTJA 4XG8A 4XP0A 4JBQA 1FOTA 2VTMA 3NEWA 5IA2A 4KIOA 2J5FA 3PRFA 4RFYA 4FSTA 3ZUVA 5I9ZA 1IA8A 3QTWA 2V0DA 3EQDA 3KULA 2XEYA 1PF8A 3S0OA 5C4LA 5GNKA 4RIXB 5K3YA 4XH6A 2RKUA 3R30A 4LM5A 4GK2A 4Z55A 4PMMA 1LEWA 4GVJA 2XNMA 4MXZA 2EU9A 4X3FC 3R9OA 1QPJA 4JVGA 2XCHA 4ITHA 4UZDA 3HUCA 4WUAA 4D0WA 3UNKA 3GVUA 4EYJA 5HHWA 3RMFA 4I4FA 2VTSA 2UW8A 3W8LA 4E6CA 4IQ6A 4BHZA 3PPJA 3Q4ZA 3NYOA 4GFOA 5HBJA 4PTCA 2WTWA 2B55A 1BX6A 5JGBA 2VZ6A 3DKCA 4MX9A 5A3XA 2XJ1A 3NUAA 4YTHA 5C1QB 4RJ8A 5LARA 4QP6A 3F69A 3E88A 3PXKA 4RFZA 3TUCA 5C4KA 1U4DA 3D94A 4WBOA 2X0GA 2BALA 4KIKB 4ZTMA 2VWXA 4MK0A 5AFVA 5JH6A 4C4IA 4BCKA 4ZTRA 3ULZA 5IISA 3DQWA 2IZTA 5CXZA 4DAWA 2IZRA 3PA3A 2W06A 3OMVA 3ZLWA 4BZOA 5LMKC 2VNWA 5CXHA 4FEVA 4QTCA 1VEBA 1U59A 3BHYA 4BDBA 4CZUA 4QQTA 4KKHA 2CKPA 1OPKA 3DS6A 5BVFA 3C4FA 4FKIA 2Z02A 4O7YA 3OVVA 4IH8A 4G3GA 3DFCB 4XHKB 2HZNA 4E93A 2OH4A 4CEGA 5AP4A 1OPLA 4OTDA 4DGMA 4R5SA 4FV2A 2BFXA 4ZLYA 1T45A 5KX8A 4KABA 2WTDA 5AV3A 3RAWA 2GFCA 1XWSA 4V01A 3A4PA 4Q5EA 3ZXZA 3OCTA 2BPMA 5AR2A 4DH3A 3V51A 2C0OA 1NVQA 3EIDA 3FC1X 3MESA 5FEEA 1CKJA 3COMA 3I7CA 4H58A 3WBLA 3K54A 1SVGA 4F7NA 4XG2A 4F7JA 4FTLA 4YC6A 4E5AX 5I5ZA 1BUHA 3LQ5A 4FI1A 2C68A 4PMSA 4NU1A 1QL6A 4DFBA 1JKKA 1SZMA 1Y8YA 2R7BA 3ZO4A 4FMQA 4P7EA 1R3CA 2J0JA 2P55A 3UP7A 3EFJA 4ITJA 1LEZA 4ZTQA 3I0OA 4U7ZA 2XJ0A 1OECA 5IDNA 1Q99A 4ASDA 3TN8A 1OBGA 4JIKA 4YJTA 1H0VA 1KV2A 2XK3A 2J2IB 3LFDA 4UWYA 5E7RA 3PJ3A 1YI4A 2UW3A 3FKOA 5HCXA 3ZMMA 3C13A 3I60A 1JQHA 1Q61A 3NUSA 4XUFA 3C0IA 5EM7A 2B54A 4QQCA 3RPVA 1Q5KA 1KSWA 4PP9A 3SAYA 3SOAA 4DEEA 3IW4A 4XEYA 2I0HA 5A4EA 3H0YA 4HVDA 3FKLA 5IQFA 4ZS0A 2A19B 4FKGA 1ZZ2A 2WMSA 4O96A 4EHZA 4G3FA 3HAMA 1MQBA 1U54B 3PG3A 1YOJA 2WQNA 3CXWA 5CI7A 5IA1A 3D0EA 3LQ3A 4J96A 4DTBA 4KBAA 3PY1A 3WZJA 4CMOA 1ZY4A 5CU4A 4D0XA 5EFQA 4RVLA 4AWIA 3I79A 2CKEA 4X2JA 4C7TA 3CJFA 4FG7A 3W55A 3T9TA 2GQGA 5GZ8A 2QO9A 3UG2A 3TZ7A 3PXRA 4QMMA 2PE2A 4LV8A 3R01A 4RMZA 5KCVA 5C26A 2IPXA 4IB1A 4FIIA 4OT5A 3OTVA 2GSFA 4OAUC 4IHPA 2PMNX 3F6XA 1YXSA 3NNVA 2XVDA 2Z7LA 4FKQA 1PMEA 3FPQA 3NUYA 1XBCA 3D7TA 5HO7A 1Q4LA 3V3VA 3W2CA 4FEXA 3NVKI 4FKSA 4CKIA 1FVTA 4PQNA 1UV5A 1YVJA 2HWOA 5DR9A 4DFNA 2R3IA 4ORKA 4O38A 2R3NA 4FKPA 3LMHA 4F65A 4DC2A 3D5VA 3GUBA 4FL1A 4LOQA 4LQMA 4DBXA 5CEMA 3NSZA 4KIPA 1OPJA 2DUVA 5AMNA 2XNOA 5AUVA 2R3MA 4FIEA 3VBVA 4ASEA 1W82A 2UUEA 2A0CX 1PYXA 3I4BA 5DT4A 4DFZE 2R3QA 2EB2A 4FTRA 5M07A 3BELA 1P4OA 5HTCA 3GU8A 3G0EA 5KMMA 4U0IA 4UN0C 5ACBC 1LPUA 1ZRZA 4FIJA 4MBJA 4G34A 3DK7A 1SNXA 4JRNA 1URCA 5ANEA 2ETMA 5IA4A 1R39A 4X2KA 3VN9A 2A4LA 5FP5A 4F1TA 1OVEA 3T8OA 2XH5A 3AC4A 4IWQA 4ZZNA 2QU5A 3GU7A 2J0KA 4E4LA 4KA3A 5BYYA 2BRGA 4FK3A 5H8EA 5AUUA 2WNTA 4EH3A 5ETCA 3BYUA 3GXLA 3IDCA 1EH4A 4J95A 1S9JA 4RC4A 5HVKA 4M97A 3R28A 3OC1A 4Q2AA 4WG5A 3OBJA 3QZFA 4CKJA 3IKAA 1W7HA 2YHVA 3E8CA 2PVNA 3L1SA 4CV8A 5HIBA 5FEDA 2E9UA 1BYGA 3L9MA 3ORNA 5CEOA 3NIEA 1YWNA 5AA8A 2CPKE 4D2RA 4QMYA 4ZLOA 5F1ZA 4EZ5A 2I0EA 2BIYA 3HMPA 2ITTA 3LFFA 5C8KA 4EH8A 3P4KA 1JKTA 4GG5A 1Y57A 2VRXA 4HOKA 2PE1A 3QFVA 5L8KA 2ZAZA 4AOIA 4B8LA 4OR5A 4K18A 3ZDUA 4RJ5A 5I3OA 2EWAA 3QA0A 4V0GB 4AW0A 4HJOA 2RFDA 5KBRA 4BDFA 3GU6A 1HCKA 2XEZA 3VVHA 2CLXA 2QU6A 1Q24A 4NSTA 3DKFA 4FZ6A 3QCQA 2QI8A 1PXJA 3HNGA 5HNIX 2W1DA 3GFEA 4CTBA 3QRTA 3DB6A 4XNEA 4XV1A 4BTMA 3ALNA 3LFBA 3FYKX 1XH6A 5E1SA 3R22A 3LCKA 4RJ4A 4DT9A 2CLQA 2EXMA 4BCHA 2XIZA 4C4HA 3FV8A 4TKSA 1PXPA 3A8XA 5F20A 3F7ZA 4E1ZA 4PV0A 4PL4A 4FT7A 1K3AA 1OM1A 4D28A 1H25A 4TYGA 4YJOA 5EW9A 4IZYA 3QU0A 4N0SA 4NTSA 3UYSA 2QOLA 3VAPA 5M56A 3A61A 4ZAUA 3O23A 4J52A 3ET7A 3DDPA 4HZRA 3EL8A 4CT2A 3NR9A 2Z7QA 3BLQA 1OKZA 4L45A 2DWBA 5CY3A 5IQHA 4XS2A 2XIKA 2CJMA 4YHTA 5DGZA 2GTMA 4CD0A 1AGWA 3AC1A 2YM8A 3CD8A 2W5HA 3OG7A 4DH1A 4C38A 5J1WA 4USFA 3KREA 3TNPC 4MXOA 3KRXA 4BN1A 3Q9XA 4G16A 2X8EA 4YURA 4IWOA 5CU0A 3DAKA 5AV4A 4F9YA 2X9EA 4IZ7A 4IAFA 3PA5A 3DTWA 2H9VA 5G6VA 4J71A 4AT5A 3MY5A 1QMZA 3PVWA 2VTQA 3MI9A 1GZNA 4YC3A 2W4JA 3D7TB 4O1PA 5EYDA 5F94A 3MH1A 3O7LB 3D2KA 1KE9A 1I44A 4UXQA 1MP8A 1LUFA 4FTTA 3LXLA 3TIZA 3RZFA 5HTBA 3SVVA 5J1VA 3F82A 1FGIA 4EOLA 4TYHB 4DINA 5CVGA 2XIXA 3M42A 3R02A 4HNIA 5DG5A 3VC4A 4YJNA 3ZO2A 4BGGA 3P9JA 4IVAA 1GOLA 2DQ7X 2I0VA 2OO8X 4NW6A 2X2MA 3OHTA 3VJNA 2V55A 3QQJA 3ZZWA 4UEUA 3NNUA 3DLZA 5CVFA 3DAEA 3BYMA 5H9BA 2W1HA 4IB3A 1RDQE 3ZEPA 4BKJA 4RLKA 5JFVA 5JQ5A 5EDQA 4R3RA 5KKRB 3FZPA 2PY3A 3K3IA 4NM3A 3UIMA 5CAOA 3Q9ZA 4A9SA 5ANJA 4ZSAA 5IQDA 5IA3A 3LJ0A 4BBEA 3DK3A 5BNJA 2W1GA 4M14A 1M2QA 2BRNA 4GIHA 4YZDA 2ITWA 3E63A 5EW3A 3C51A 3FE3A 4OTHA 3L8VA 4J8MA 4XRLA 2F7ZE 4IVCA 2W5AA 3OUKA 4UYNA 3ORKA 2E2BA 3TNQB 2XNGA 4U43A 3H0ZA 3RALA 2W17A 4L68A 3GP0A 5KMOA 4QMTA 3UO6A 3DCVA 4KBKA 3HMOA 3B8QA 1URWA 1GJOA 3IW5A 2A27A 3QYZA 4EOIA 5KUPA 2BHHA 4EOMA 4BCFA 3HZTA 4WT6A 4DLIA 2ZV7A 1Z5MA 4O0RA 4FT9A 2ETRA 2OICA 2C0TA 2R2PA 3MJ1A 3TM0A 4PX6A 4S31A 4A06A 4DGOA 3OWPA 3A62A 3AD5A 4O0SA 3BGPA 3S1HA 3UIUA 3C0HA 4IWDA 2BROA 4Y46A 4D2TA 5EI8A 4FE2A 2UVZA 5DEWA 1YI6A 2BKZA 3GC8A 3FY0A 4L3PA 4O82A 4A9UA 4EJ7A 4U41A 3S2PA 4EHVA 4BKZA 4FTUA 3FI2A 3WIKA 4C61A 1PW2A 4YTFA 3NMUF 4RIYB 5A46A 1GY3A 3KXHA 3PIZA 2C5VA 4D4VA 4AA4A 4EH7A 2BFYA 3I1AA 1YDRE 4ZK5A 4I5MA 4TXCA 2IZSA 3A7JA 1R1WA 2Q0NA 4R8QA 4RLLA 2ONLC 4R78A 4IANA 5IA5A 2XKEA 5DA3A 3OD6X 3UJGA 1ZOGA 4FZ7A 3UYTA 3M2WA 2VU3A 4YNEA 3EHAA 1JKLA 1XH5A 3R8VA 2XF0A 3P86A 4C37A 3GOPA 1OMWA 2PE0A 1O6KA 3ZRLA 3UOLA 2BUJA 5HD4A 3GT8A 4RIOA 4WSQA 3FLQA 3SG9A 3KRRA 1PMVA 4DEHA 2JFLA 5DI1A 3TACA 3KMUA 2X4ZA 3OXTA 4RX5A 2PMIA 3QXOA 5E8WA 4HGTA 3UNZA 4YBJA 2UVYA 4A7CA 4W4WA 1YXUA 3DJ5A 3VRYA 4EKLA 4C4FA 1FPUA 4F6UA 3FQSA 4OTGA 3CR0A 1DM2A 2QD9A 2UW0A 2WTCA 2RFSA 4DFLA 1XHAA 2YEXA 5GZ9A 3DNEA 4WD5A 3QCYA 4XV3A 2BHEA 3QF9A 3JPVA 3V5JA 4PDYA 1E9HA 1OL7A 2PVKA 3F5XA 3HEGA 4FV5A 4K1BA 1PJKA 4ZZMA 2OFVA 3UVRA 5JRQA 1UNLA 2RG5A 5I9YA 2QURA 2CCHA 4EOJA 2CHLA 3EH9A 3H9FA 4A9RA 4GS6A 4X0MA 2BR1A 3FDNA 4PL5A 4YLKA 3W2RA 3UOJA 4JBPA 2NO3A 3R2BA 3PIYA 4WO5A 3R8MA 3R8LA 3CQWA 2HXLA 3E64A 5IH4A 2Z7SA 4K8AA 2VTIA 5IH6A 3NYVA 4WIHA 3KA0A 3PVGA 4KSQA 2OSCA 5DIAA 5AAEA 2BAQA 2UZDA 2XNEA 4MXAA 3UQFA 4NH1A 4EBWA 2R5TA 3R00A 3BU5A 4FTNA 4B8MA 3LLAA 4I0RA 4TWPA 3ZOSA 3MPMA 3R9HA 3AMAA 3FZSA 3LHJA 3C5UA 4M69A 4O6LA 3VS0A 4BTFA 2CDZA 1ND4A 2W1ZA 5AM7A 2BDWA 5EOBA 4EQCA 2PVHA 4F9WA 4UWBA 5EYCA 4GL9A 2OXXA 3U4UA 2AC5A 4AFJA 4Q9SA 4NJ3A 3WYXA 2IVVA 4AW2A 5HG9A 3Q6WA 5T6KA 2HWPA 2Y4PA 4M66A 3UPZA 5BPYA 2W9ZB 3W16A 2ZVAA 3RVGA 4L7SA 1H01A 1FVRA 4TW9A 5L2QA 4FSQA 4FKRA 3VQHA 4TN6A 4E4MA 3GCSA 4MNEA 4Y95A 1YI3A 3COKA 4M8TA 4CFNA 2P2HA 3FMJA 2Y9QA 4YZCA 3DGKA 1RE8A 4G31A 4OTPA 3UIBA 3TZ9A 5K4IA 4YP8A 3FXZA 4EC9A 2YISA 5LXMA 1IG1A 2VGPA 5ETFA 5KE0A 3NW5A 1IA9A 2X81A 4FEUA 5CNOA 3V5PA 1W84A 4WNPA 3F5GA 4JX3A 3T3VA 3GC0A 3VW6A 3A4OX 3QRUA 4H05A 4C4EA 4H3BA 3FZTA 5AP1A 5FM3A 4R7BA 4R77A 4MWHA 4FT0A 5AV1A 3KB7A 3BRBA 4ZMFA 3TG1A 4QP4A 3DBFA 3QCXA 4FL3A 2HY81 4AZFA 1P5EA 2HYYA 4QQJA 3QTSA 4FNYA 4GK4A 4QQ5A 3TDWA 2R0UA 3HV7A 2IW6A 2WZJA 4RIXA 4S33A 4CKRA 2ZB1A 4FVPA 5ETAA 1BLXA 4ENXA 2LGCA 3QQGA 3QQHA 5AR4A 4YTIA 3CY2A 2IVSA 4I1ZA 3EQRA 5DRBA 3O0GA 2VO0A 2KTYA 2YN8A 3LFQA 3ORZA 4WNKA 5TOZA 3ZEWA 4BDEA 5E91A 2I0YA 4WNOA 5IQCA 4PMPA 3EOCA 2GCDA 4PL3A 3W2SA 3IS5A 3ENMA 3HRCA 2W1FA 2XP2A 3PVBA 5H8GA 3RI1A 4ZJVA 5CF5A 3Q4CA 4W8DA 2VTHA 4XG9A 5CQWA 4F6SA 2XA4A 4L44A 5CAQA 4A07A 5CAVA 3SD0A 3V5TA 2QHMA 3E7OA 3LQ8A 1FMKA 1TQMA 3BLHA 2HZIA 3F3TA 1X8BA 2QOFA 4LL5A 4U3YA 2JAVA 4C02A 2Y0AA 3A7GA 3PJ2A 2B9IA 4LV5A 3M1SA 3V5WA 3IDPA 3BQRA 4CNHA 5A4CA 4QP9A 3GEQA 5GJGA 5JZJA 2VX0A 3V5QA 3CE3A 4CLJA 3KCKA 4BBFA 5AR3A 2ZV2A 2H8HA 4FTJA 1TVOA 2ITNA 2VTRA 3FL5A 3KQ7A 3KL8A 5DVRA 4RGJA 4I21A 1H26A 3D7ZA 5L2TA 3H4JA 4AA0A 3EQHA 4BDKA 3LE6A 4F9BA 3UPXA 4D4RA 3R9RA 3ZONA 3TTIA 2QHNA 4JT3A 3SRVB 4KIQA 2OZAA 2IO6A 4I5CA 5T68A 4P4CA 3UVPA 4KKEA 2JLDA 3FLWA 4ENYA 2R3LA 2WIPA 3O8TA 3O2MA 3HA6A 3RM7A 4PDSA 5AIKA 4FV7A 2W4OA 4MBLA 3KXMA 5CSWA 2JKOA 3KXNA 4ANBA 3POOA 5KMNA 2QQ7A 5L8LA 4NKAA 4I0TA 3FEGA 3MB7A 4HGSA 4N6YA 5CLPA 2JITA 2OFUA 2UZUE 5HU3A 3C50A 1UNGA 4DTKA 2CGVA 4J53A 2WEVA 2YIWA 4A9TA 1YRPA 3AMBA 3ORIA 3QZIA 1ZMVA 4QMVA 4R7HA 3EJ1A 4FBXA 2YABA 4IC7A 4L3JA 2BZHB 4CFWA 2ONLA 3VS5A 2P3GX 3A2CA 3QYWA 4V05A 4U42A 1J1CA 3VULA 3ZDIA 4F64A 4XYFA 4AFEA 3TIYA 3EQGA 5CEKA 3NLBA 3GU5A 3AT2A 3NS9A 5AUTA 2PVYA 5JGDA 4J7BA 2OKRA 2BDFA 4MD7E 4L6QA 1U5QA 4JAJA 5D12A 5CT0A 4BY9E 5AP6A 1APME 1H24A 3OTUA 4J8NA 3VWAA 3WZKA 3PSCA 4C34A 3ATSA 3SV0A 5BUJA 5BVOA 4C8BA 4JDKA 5L2SA 4IFGA 4R7IA 3AG9A 4OTRA 2Y6OA 2IW8A 4AN9A 4O0TA 4GRBA 4G17A 5EI6A 4MBIA 5J9ZA 4X2GA 4IVDA 2Y4IC 1CKIA 4BCMA 1P4FA 3AQVA 3VQUA 5ANGA 3MW1A 4J1RA 5J9LA 3TT0A 3RBWA 4LMNA 5EQYA 4J98A 2HW7A 3TUDA 5GJFA 1SNUA 5EYMA 3BCEA 4J99A 4N6ZA 3TV6A 2QLUA 3BIZA 1Q8TA 2C0IA 3QTZA 3AC2A 2JFMA 4RZVA 3MBLA 3FMMA 4UYAA 3BWFA 4RG0A 3VS4A 3BBTB 5E4HA 2CN8A 3FKNA 3C4XA 4WG4A 1VJYA 2VTNA 3DV3A 3UO5A 5B0XA 1V0PA 4BRXA 1ZYSA 3P0MA 4AE9A 4TNBA 2XBAA 3TJDA 1P14A 4ZY4A 3U55A 1FINA 5DYJA 5AR7A 4HYSA 4XBRA 1R0EA 3LCSA 2P4IA 2WELA 4H1JA 5A6NA 4MNFA 1WCCA 4EHGA 5GJDA 4CTCA 5LQFA 1PKDA 4I23A 3AC3A 4BWPA 5JGAA 2PUPA 4EORA 3MH3A 2EUFB 2HOGA 4RA4A 3SW7A 2X6EA 3FY2A 3AOXA 3UE4A 5HLNA 3F5UA 1PXNA 2UW5A 2OZOA 4GJ3A 4JX7A 3MSSA 3S95A 2YIXA 1NA7A 1V0BA 2OIDA 1H1PA 3PXYA 3Q5ZA 3ZS5A 4BL1A 4BDJA 3JYAA 3UODA 3GQLA 3SHEA 3OP5A 4EUUA 5A6OA 3BHUA 1OIRA 2Y6MA 4RWJA 3SA0A 4QMQA 3EMGA 2ZV9A 1QCFA 4XG7A 3EWHA 4BIEA 1A06A 4PDOA 5J5TA 4R1YA 4V0GA 5HI2A 3BZ3A 2UZWE 5K0XA 1GZKA 3QQUA 3V8TA 4HYHA 3O8UA 3QX4A 5HLWA 3ETAA 2C4GA 2VWWA 4DG3E 3QTXA 2QG5A 2ZJWA 1IASA 3WF9A 3NRMA 3GENA 5HKMA 3KF4A 4FC0A 3AC5A 3D4QA 5E8XA 1ZXEA 3BI6A 2ITVA 1BI8A 4RIYA 5JKGA 4YLLA 3MVHA 4O7ZA 1UWJA 3LMGA 5CF4A 4NZWB 5D11A 4JIAA 1JSTA 2YCQA 4MF0A 3TNWA 1XO2B 2QOKA 1L8TA 4UBAA 1M14A 3OUNB 1ZYCA 3PG1A 3LVPA 3CGOA 4GUBA 4JDJA 1OL2A 4ZZOA 5M53A 3TNHA 4F99A 2PMLX 4M13A 1R78A 2JDRA 4XV9A 5C8MA 4F1OA 4UMPA 3I0QA 4WBBB 4DEBA 4QMLA 3F2AA 4ZOGA 3M11A 3DXNA 4KD1A 4H36A 3PPZA 2W1EA 1STCE 2O65A 3UVQA 3V6RA 2ACXA 2QODA 3OZ6A 3WI6A 2WQOA 2ZB0A 3W32A 4YPSA 1V0OA 2XJ2A 2XRWA 5AP7A 2HELA 3QTUA 2C47A 5I9XA 4JJRA 5BX0A 2C3IB 4TNDA 3ZXTA 2WTVA 5KMLA 2GHMA 2VNYA 3UQCA 2C3JA 3AMYA 3FZOA 3HYHA 3PJCA 3G6HA 4WRGA 3U8WA 3QL8A 3ODYX 4BR3A 2XKCA 2E9PA 4USEA 2AUHA 1SVHA 5LJJA 3KFAA 4O0YA 3TWJA 4MXCA 2XYNA 4IEBA 5HTIA 2JBOA 5B7VA 3BV2A 4UX9A 4DHFA 3WZUA 3EQBA 3NCZA 2XKDA 2XNPA 4IDTA 5IEVA 2UW6A 5B2MA 5C8NA 3DU8A 3WILA 5CTPA 2G2IA 2OJJA 3VS1A 2C6LA 3SOCA 4QMWA 2VWYA 2B52A 4BB4A 2UZEA 3E8EA 2RGPA 3EB0A 3A7HA 3R1QA 4TT7A 4DFXE 5M57A 4F0GA 5M06A 1TKIA 4JG6A 4NEUA 4TYEA 4G2FA 2Q0BA 4GU9A 1WZYA 3MH0A 4L8MA 4C59A 1Q41A 2YIYA 2NRYA 4TWNA 5EDPA 4XRJA 3I5NA 3GCPA 4E8AA 4OLIA 5TT7A 4WRSA 2UZVA 4JRVA 3P7CA 4ASXA 3BHVA 2YWPA 4MVFA 3FYJX 4I6FA 5FP6A 4Z16A 3ZM4A 1FBNA 3TV7A 4UV0A 1FVVA 3HLLA 3CP9A 4YSJA 4TPTA 5KZIA 1H00A 3HDNA 5EG3A 1U46A 4JXFA 1H07A 4L52A 1RQQA 3QD4A 4FSZA 5BMMA 3SQQA 5ICPA 2Q83A 2PVRA 2GQRA 3P23A 1KE8A 2HZ4A 5LVPA 3ORLA 3E92A 3N4VA 2VTOA 3Q60A 4JR3A 3CLYA 3WF8A 4FKWA 2CNUA 4FSUA 4ZSEA 1M7NA 3AT4A 4KAOA 4RT7A 3KK8A 2J51A 1JOWB 3MFTA 4FEWA 3ROCA 4ZSJA 3HV5A 3TZ8A 5DT3A 4MTAA 3BLRA 3IGGA 4IDVA 3T3UA 1IEPA 3OXZA 2R7IA 4CZYB 2O2UA 1FMOE 4LG4A 5CANA 2FVDA 4FV9A 3BX5A 5FXRA 2IG7A 4I94A 3I6UA 5C9CA 5HCZA 3VRZA 1K2PA 4IAIA 4EHEA 2VX1A 2GFSA 5DH3A 3LOKA 2JGZA 3OS3A 3LW0A 3FMHA 2OIBA 5ANKA 3IOKA 4AQCA 2QOCA 4CFFA 1BL6A 3E8NA 1WBTA 4Y72A 5HD7A 3N4TA 3D5WA 1UU3A 3MA3A 4AAAA 4BI0A 4O7NA 3JY9A 3HP5A 1SVEA 2JD5A 3LIJA 4LFIA 3EQIA 4LRKA 5HOAA 4QYGA 4K33A 1O9UA 3AT3A 3R1SA 4WKQA 3GGFA 1OGUA 3KMWA 2JEDA 4QNAA 2OK1A 3QC4A 1P2AA 3QRJA 4RFMA 2ZV8A 2H96A 4IJPA 2GHLA 3ZSIA 3F88A 4GK3A 4KB8A 4X6RA 2VWBA 5DR6A 2I6LA 2UW4A 5AWMA 5C01A 3SX9A 3U6HA 2GNJA 3GOKA 3K5UA 5I9UA 4C2WA 3VF8A 4OBQA 4YJPA 4RIWB 5CEIA 3ZYAA 2WMUA 2P2IA 4GFMA 1REKA 2ZMCA 5D1JA 1IRKA 2WKMA 4JS8A 4YZMA 2HK5A 3VUIA 1OIYA 4W8EA 1KE7A 3DBEA 4LRMA 5AM6A 3KN5A 2NP8A 3DT1A 5J87A 4O84A 4AN2A 4F63A 5J8IA 4XG6A 3QALE 3EQPA 3VS3A 3FL4A 5CU6A 3LPBA 1DI9A 4YJQA 2YDKA 1GZ8A 4RX9A 2PUNA 2VUWA 4NT4A 3EN7A 2QOQA 1U5RA 4JR7A 3OW4A 4BZNA 5LOHA 3G33A 3P78A 4JI9A 4UALA 1OUYA 4B4LA 1J7IA 4XG4A 5TO8A 3DA6A 3O71A 1TQPA 2EXEA 4GVAA 5CT7A 3DY7A 4ASZA 1JKSA 3L9PA 3COIA 4IM0A 5ANOA 3UC3A 5AUXA 4HPTE 4EONA 1XBAA 3DDQA 2B1PA 3GNIB 4U8ZA 5B2LA 2PVMA 2G01A 4LGHA 2ZDTA 2YAAA 3IDBA 3QRKA 4YJUA 5FG8A 2QR8A 5FLFA 4NKSA 5I9WA 5DN3A 5FTGA 4AGCA 2VWVA 2ZYBA 4L46A 4AP7A 2X7GA 5DBXA 2OJ9A 3QZGA 3JY0A 3GCQA 4FKVA 2HCKA 2UW7A 3F2NA 4QP8A 1WBPA 5CAUA 2X4FA 3MA6A 4HYUA 4KRCA 3E93A 4K77A 5E1EA 5IEXA 1L3RE 3Q52A 3OCSA 3ZUUA 1A9UA 3BU6A 3G51A 1YWRA 3ANQA 4YSMA 5HQ0A 3F3WA 2WO6A 5TR6A 3FMKA 3RCJA 4I22A 4IB0A 5IF1A 2J90A 5BVNA 5LMAA 1NVRA 4NIFB 4HYIA 4C3PA 4YLJA 5JT2A 4KIKA 2J7TA 4WG3A 2W7XA 4X7QA 4C0TA 4U79A 2YWVA 5A4TA 2ITQA 4YJRA
chains in the Genus database with same CATH superfamily
2XRUA 2R3GA 3DB8A 4N4SA 3O8PA 4QYYA 2G9XA 5A4LA 1A48A 3BL9A 4NJDA 3G2FA 4JBVA 3C4EA 4UY9A 4BIDA 3FSKA 4JG8A 3Q5IA 4NK9A 3ODZX 5E92A 3MDYA 3ZRKA 4AW5A 2IVUA 4I5HA 1Q8YA 4O0VA 4CG8A 4YBKA 4ZY6A 3DFAA 2WHBA 5KNJA 1J7LA 3AD4A 5F4NA 2XALA 3D2IA 5A9UA 3D5UA 2W99B 4GV1A 3TV4A 4ACHA 4G3CA 2CN5A 4FYOA 3LFSA 4BICA 4ZXTA 2WTJA 4UMTA 3FI3A 3TI1A 3UOHA 4RA5A 3OXIA 3DBDA 5JN2A 3PXZA 3CC6A 4FOBA 4IWPA 4CSVA 2RSVA 4FV6A 5CVHA 2OG8A 3HMNA 4KBCA 4DA5A 4BCOA 2C6DA 4QMNA 2BAJA 3NUXA 4C33A 2UZBA 2WD1A 2G2HA 3GB2A 4GIIA 4PTEA 4ANQA 3NUPA 4MYGA 3NFFB 1WBVA 4Y85A 3A7FA 3UC4A 3D15A 4CG9A 3UNJA 5AAGA 5AX9A 2W1IA 4DYMA 2PVFA 3EN5A 3FMDA 5AR5A 4B7TA 4EJNA 4M69B 3U9NA 2C69A 5KHXA 2QOIA 4O27B 3BQCA 5DPVA 4ERKA 1XKKA 5F95A 1W98A 4E6AA 2GDOA 3CQUA 1CMKE 4NFMA 2QC6A 5IUIA 4AF3A 3LM0A 1REJA 1OB3A 4IFCA 3HP2A 5LVOA 1MRVA 3NNWA 4X2FA 5BVWA 3U87A 4BKYA 2FO0A 2ZDUA 4W9WA 2YIRA 4KKGA 5HCYA 4AZSA 4MUQA 1FGKA 4RIWA 5EM6A 4O6EA 3FXWA 5LWMA 3BYOA 4G5JA 4NUSA 4EOSA 4BCJA 3QHRA 1DS5A 3PJ1A 3QCSA 2OJGA 5CAPA 5JFWA 3ROYA 2VD5A 2IZUA 4I20A 2RFNA 2J4ZA 5EW8A 3RK7A 3RWQA 3K5VA 3WZEA 4BIBA 5GHVA 1O6LA 3CTQA 4FV1A 2C5YA 3Q2JA 2Y4IB 3KIOC 3MWUA 2GPHA 4R3PA 5CEPA 2C6MA 3W33A 2PUIA 4TYJA 2GNIA 5AP5A 4NM7A 3NYNA 4RRVA 3LLTA 3KKVA 4BCNA 4E3CA 2UW9A 3EFWA 2CNVA 4BGHA 5M4FA 3W2OA 4QMXA 3PE1A 1XH7A 4LGDA 2PMOX 4KINA 2G15A 4IAAA 4Y83A 1NVSA 4DEIA 5EH0A 3SDJA 2P0CA 5KMKA 1VR2A 3PE2A 4I93A 4DG0E 5AJQA 3Q4UA 3Q96A 2ITUA 2UZLA 4FKLA 5H2UA 5E9EA 2B0QA 2X6DA 4KNBA 4DG2E 2QLQA 2W05A 2XS0A 4XLVA 2VN9A 1W8CA 3LZBA 4IMYA 3DOGA 4OUCA 1Q8WA 3DKGA 3MFSA 3ZBXA 5M44A 4BYIA 2R4BA 2ZOQA 4JL9A 2JIUA 3NDMA 2PU8A 3QWJA 2C6TA 4EK4A 3MIYA 4X2NA 5HE1A 3QUPA 5FBNC 4ACCA 2RIOA 3U6IA 2JBPA 2BKKA 5FXQA 3RAKA 2CGWA 3QUEA 4UZHA 2J5EA 5EYKA 4NL0A 3ZU7A 2YLFA 2BRBA 4EK6A 3FWQA 3R71A 5HESA 4M3QA 2V7AA 4O22A 4RX7A 3C0GA 4IVBA 2X1NA 3PZEA 5JSMA 1PMNA 3DBQA 3R9NA 5IMXA 5JFXA 5IQIA 3FXXA 4UMRA 3BKBA 2XK9A 2I1MA 2JDSA 5EHOA 4EBVA 2YAKA 4EQUA 5L2WA 3CBLA 3HMIA 1YXXA 4H39A 3B2TA 1PXMA 3PPKA 5CU2A 1JVPP 3S00A 4XG3A 3SC1A 1JLUE 2WMBA 4QPMA 5C27A 2WQEA 4A4LA 4DEDA 5A54A 4BDCA 5KBQA 4H3QA 3N4UA 4AXAA 3C7QA 4Y5HA 5ANDA 3II5A 3KY2A 5CSVA 3LFAA 4QMOA 1ZWSA 3JR1A 4NM0A 1PKGA 5D10A 3IW8A 4C35A 4DEGA 4F7LA 4HPUE 1PHKA 4I0SA 1SM2A 1ZY5A 3CPBA 5CZIA 1KE5A 3OOMA 4I6QA 4QPSA 4DH8A 4LMUA 2WOTA 3QXPA 3QD2B 2X2KA 3R7EA 2CKQA 2P33A 4QP7A 3TNIA 3COHA 5F9EA 3AGLA 3JXWA 4DFYA 1J91A 1B38A 1PY5A 4FSYA 4IX4A 4CMUA 2C30A 2OW3A 4ZSLA 3CJGA 2RL5A 3R7GA 3WF5A 5CASA 4EL9A 2X39A 1M2PA 3FHRA 4GKHA 3DZQA 2YA9A 3HGKA 3BE9A 5I4NA 4H1MA 4V04A 3VUMA 3ANRA 1CDKA 3WZDA 2IN6A 4QMPA 3PYYA 3V5LA 1R0PA 4QMUA 3G9NA 1G8JA 2VTPA 3GCVA 2I40A 3GC9A 3R2YA 2O3PA 4M0ZA 4I6BA 3W10A 4FKOA 1YDTE 2OIQA 4TY1A 2J0IA 4ANNA 3OT3A 3TDVA 4PMTA 4FG9A 4AZWA 3BEGA 2RG6A 3DK6A 4BBMA 4L53A 4EOQA 1KOAA 1OKVA 3ITZA 4E5BA 4D5HA 5CX9A 4EH4A 1HCLA 4EK5A 5DMZA 3S4QA 4E6DA 3RAIA 1XQZA 3FLZA 2XK6A 5CZHA 4EWHA 5KHWA 4G5PA 3RP9A 2BZIB 2XUUA 1YOMA 3KXGA 5EHYA 2JKQA 3F5PA 2YM7A 5ITAA 1OL6A 2OU7A 3FPMA 4K0YA 4APCA 1OL1A 4BTKA 1DI8A 3QKMA 5AEPA 2CGXA 3G0FA 1KV1A 4JQ7A 5BVKA 5BQ0A 2GU8A 3W18A 4O21A 5M51A 5BUEA 2FA2A 3SLSA 2C1AA 1XH4A 1W0XC 4D2VA 4W4YA 4L00A 4FSMA 3OW3A 4X3FA 4ZLZA 3TUBA 1MRUA 2PZPA 1OL5A 4M84A 5I3RA 2PVJA 4W9XA 4X3JA 2A1AB 1Y6AA 2PVLA 1G5SA 1W83A 3FI4A 3FLNC 3H3CA 3W8QA 2XK7A 3V8SA 3PFYA 4JQEA 3O51A 3L9NA 1OZ1A 3R9DA 4EOOA 2ITOA 4I5PA 3P79A 1WVYA 2XYUA 1YXVA 4AT4A 3VNTA 1NT2A 1ZYJA 4TWCA 3H9RA 4UXLA 2IWIA 3ACKA 2ERZE 2FH9A 2F7EE 3IQ7A 4RVMA 2KULA 4HVSA 3UIXA 5CALA 3SXFA 2W96B 5M4CA 3Q2MA 3ZM9A 5EQEA 3RHXA 3CY3A 3PLSA 4PP7A 4DT8A 3MJ2A 3MTLA 2AYPA 3K2LA 3BYSA 5GZAA 3RAHA 3JUHA 5BMSA 4ZJJA 4G9CA 1RW8A 3E62A 4A9YA 2QCSA 4C4GA 4UMUA 2YACA 1MRYA 4QP3A 5AV2A 4NYEA 2B9JA 4JNWA 5FTOA 2O0UA 4U5JA 4BZDA 4MAOA 2PZYA 2W0JA 4TZRA 4GFGA 4GYGA 4X21A 3V8WA 4DEAA 4B99A 4LRJA 4I92A 5HLPA 5DOSA 1ZYDA 5IEYA 2BZJA 2X0PA 2W5BA 3UGCA 5IUHA 3KEXA 4WA9A 2RF9A 3OFMA 4P5QA 5IPJA 3EQFA 2BRHA 2JAMA 3T9IA 5TKDA 4F09A 3VBWA 4BCIA 2GNFA 2HENA 4RSSA 3WF7A 3RTPA 2ZM1A 3DXQA 2GS6A 2V62A 2WTIA 1PXIA 3GCUA 3GU4A 3QQLA 2AC3A 2C3LA 4LUEA 4FG8A 4PUZA 3BWJA 3NUNA 4KS8A 4F1MA 2FYSA 3LJ1A 3FSFA 5IMEA 2EXCX 1PXKA 3EL7A 1YHWA 3IW6A 3KRLA 1CSNA 3CIKA 4P2KA 4WOVA 3VUGA 4AGDA 1F3MC 2FSLX 3QLGA 5GIOE 3CPCA 5EOLA 2V5QA 3OT8A 3KN6A 2OJFE 2PZRA 3MYGA 3HECA 5E8UA 3ZLXA 5J79A 4O7WA 4HVGA 4FGRA 4O0XA 1ZMUA 5D7AA 4DH5A 3MY1A 4EYMA 4C2VA 2Z7RA 1JBPE 2G2FA 4CXAA 4W4XA 5JQ8A 4E4XA 3EFKA 5AX3A 4ZS4A 1M17A 1OBDA 1WBWA 4UMQA 5TF9A 4M7IA 3ZH8A 4TYHA 3ZO3A 4DGGA 5IZFA 5BVEA 5DNRA 2X0OA 5DWRA 2X9FA 3ORTA 5K0KA 4AQKA 5KO1A 4RZWA 4L3LA 4G1WA 3UDZA 3THBA 4E26A 3JVSA 4NIFA 1J1BA 3BE2A 4C62A 4MQ2A 4QTAA 2C6IA 4TWOA 1OUKA 3UZPA 2XCKA 4K11A 4ZJIA 2Y7JA 5HX8A 5J7HA 5LMKA 3KRWA 1YXTA 4F6WA 3R04A 4LUDA 5M09A 3HRFA 2UVXA 2X8DA 4X6QC 4MXYA 4G6NA 3R7YA 3O7LD 2GNLA 3QD3A 4I6HA 1WBOA 4JBOA 5HICA 5J95A 2O5KA 4ZP5A 5K5NA 4YHFA 4EZ7A 3UZRA 1WMKA 5LVLA 1Q3DA 4GJ2A 4RPVA 4ZTNA 4DE4A 1NXKA 2B7AA 2B53A 2VTTA 3BHTA 4G3DA 3R83A 4ZIMA 5IKWA 2WMWA 2BILB 1G3NA 4FV3A 4D2PA 4FYNA 1T46A 4YO6A 4QOXA 4BI1A 2NYAA 4FICA 1KWPA 3SG8A 5LVNA 3WE4A 3RWPA 1PXOA 3WOWA 1VYZA 5H8BA 4F0IA 5HVYA 4MCVA 3GFWA 2WXVA 3HL7A 5HNGA 2OF4A 2VX3A 3F66A 3ERKA 3PSBA 1J3HA 3F3VA 4F78A 4RVTA 2CGUA 2PPQA 2CKOA 1QPDA 4AT3A 1XH9A 2J50A 3QKKA 4FUXA 4Q5HA 4EUTA 1JPAA 2OBJA 2QOOA 2XMYA 3HV6A 2GTNA 2JDVA 2JC6A 3KU2A 3MPAA 3P5KA 3MVLA 3QUDA 3R6XA 4G3EA 4AS0A 3UG1A 4F9AA 2DYLA 2R0IA 3FZRA 3RNIA 5HE3A 3UTOA 3WF6A 5D9HA 4CQGA 2A2AA 4DHJA 1O6YA 5M55A 3DXPA 3AXWA 2BTSA 3GI3A 3I81A 2CMWA 4QP2A 4A4XA 4Q9ZA 2QG7A 1JWHA 3FI8A 5EM5A 5IDPA 3WARA 4ZMEA 3RPYA 4O83A 4C58A 4AGUA 1UKHA 3S3IA 3UDBA 2HY0A 2R9SA 4RJ7A 2C1BA 3RKBA 3W0SA 3ENHA 1M2RA 3ZZEA 4QYHA 4ITIA 2WAJA 3LM5A 3QD0A 5CI6A 2WQBA 1QPEA 2BAKA 4QNYA 4MQ1A 5IUGA 2YLEA 4PDPA 3PRIA 4FNZA 3W0OA 4USDA 2VTLA 5A14A 1VYWA 4PRJA 1WBSA 1ZLTA 3TXOA 5HO8A 1GIIA 2QKRA 3MVMA 3D5XA 5E8VA 3R8PA 4KWPA 2C6OA 4G9RA 3OWJA 2YM5A 4YZ9A 4BI2A 3RPSA 1S9IA 3C5IA 4D9TA 3NNXA 3MTFA 4O7LA 3GQIA 2DS1A 4YGAA 1OITA 1UKIA 4IX6A 3ZFYA 2SRCA 2PHKA 3OWLA 4YNOA 1BKXA 4KUJA 4D2SA 4OW8A 3IPHA 3W1FA 2BZKB 3V04A 3MGYA 1BL7A 2CCIA 2BCJA 2JIIA 1WFCA 4BDHA 4BDDA 4DFUA 5FRIA 3D9VA 1H27A 1Z57A 4YZBA 3JS2A 3ORPA 3I7BA 3SW4A 2F57A 3NUUA 3NW6A 4GT3A 5L6PA 1XH8A 4LGGA 3LJ2A 2BMCA 3KCFA 3MIAA 1AD5A 2VO6A 5K5XA 3QGWA 2F4JA 3FQHA 5FD2A 4Z7HA 3P7AA 3QGYA 3NIZA 2E9VA 3QBNA 3P08A 5E8YA 2E9OA 3E8DA 4FX3A 3DBCA 1B6CB 4LOPA 4CMTA 2OH0E 4R6VA 4E20A 5C03A 5IG1A 2XBJA 3CGFA 4XCUA 5CQUA 4AG8A 4EKKA 3BLAA 2Y8OA 3IW7A 5DR2A 4DLJA 4FA2A 4YUQA 3LMIA 4OBOA 4O7RA 3F3ZA 2VO7A 4F08A 4QTEA 4EH9A 3PXFA 4B9DA 4D5KA 4XJ0A 4Y73A 4EZ3A 2XKFA 4AU8A 5I9VA 5FGKA 4PF4A 2WOUA 4ONAA 1Q8UA 4E6QA 2XNNA 3BHHA 1I09A 4GEOA 3P5JC 5LCJA 2QONA 4YTCA 4APPA 3A8WA 2J0MB 3PXQA 5EHLA 5B2KA 1WVWA 3R7OA 3OY1A 4M67A 4ACDA 5AA9A 5HG8A 5G1XA 3PA4A 4HCVA 2R3HA 4MF1A 3D14A 4HVIA 1ERKA 4GUEA 4P90A 4O7VA 3E5AA 4KSPA 3G9LX 2QO2A 1H1RA 3R7IA 3EN6A 3L8PA 2X7FA 4RWIA 3RPRA 5K4JA 3PLAE 4FTIA 4CLIA 4MNEB 3OBGA 2FSOX 5AV0A 1GNGA 5KMIA 3EYGA 4S34A 2CNQA 4L43A 3BU3A 2PULA 4L7FA 2ITZA 4LOOA 2GHGA 4AOJA 3CEKA 1UWHA 4CYIA 4MXXA 5BYZA 4BFMA 3ZSHA 2JIVA 3MPTA 5AAFA 4YHJA 4IAZA 1U54A 3HRBA 4O4EA 2GQSA 4NW5A 3VBXA 1FQ1B 2XARA 4PPBA 4BWXA 1K9AA 1CTPE 2PL0A 2YZAA 4U80A 5CU3A 4O7TA 5HG7A 5BYLA 3E7VA 2YM6A 1V1KA 1IR3A 4Y5QA 3PVUA 2WIHA 3VUDA 3QQKA 1YHVA 4GU6A 5EDRA 5EM8A 5IQBA 3TKUA 1G8AA 5HIDA 4JQ8A 2X8IA 4M0YA 1XJDA 4BVUA 5HZNA 3KXZA 3GC7A 3ZFXA 4BWKA 5EK7A 1JSUA 1Y91A 2PWLA 3H9OA 1JNKA 1H08A 3EYHA 3CSVA 3IGOA 5M08A 4E73A 1YHSA 3B8RA 2HIWA 3MB6A 2FSMX 3O17A 5HE0A 5L8JA 2QVSE 2YITA 1DAWA 1YDSE 3R73A 2FGIA 2IW9A 4MHAA 4JOAA 5FDXA 4FSNA 4RC2A 4GKIA 2NNWB 2GS7A 3OEFX 4DTAA 3Q9WA 2YJRA 2R64A 5EQPA 4FTCA 4PWNA 3IONA 4YR8A 3KRJA 3N9XA 3TKIA 2ETKA 2WPAA 4AW1A 3NX8A 5IQEA 3Q53A 4D1ZA 3UBDA 3C9WA 2JKKA 3IOPA 3IO7A 3DPKA 2AQXA 1UA2A 4EK3A 2UZOA 2FUMA 3P7BA 5HIEA 2F7XE 2OI4X 3MVJA 3VJOA 3AGMA 3RNYA 3A99A 3G15A 3QHWA 4QO9A 5M4IA 4CCUA 4G6LA 5AP3A 3KVXA 4DITA 5K9IA 2VV9A 4DCEA 4FOCA 4E5WA 5DRDA 4QMZA 4FK6A 3WE8A 3IK3A 2WMQA 3G6GA 4IZAA 4M15A 4DN5A 3NCGA 4FUYA 4JLCA 3R1YA 5IA0A 4RWKA 1M52A 2WB8A 3DAJA 4Z7GA 1OIUA 3HVCA 3NPCA 5DEYA 4E7WA 1BI7A 1MQ4A 2BVAA 2OWBA 2PSQA 4IW0A 4IX5A 5GINE 4LYNA 3AC8A 1KUTA 4EEVA 5CSHA 4ZTSA 1H4LA 3PTGA 3F7WA 3VS6A 4ARKA 4ALUA 1B39A 2ZFYA 2WEIA 2UZNA 4XOYA 4DGLC 3CD3A 3QWKA 4QEBA 3DKOA 4GYIA 4OTFA 1IAJA 2VTAA 2J0LA 3TJCA 5AP2A 3CTJA 1UU7A 4FT3A 1JSVA 4JDIA 4MD8E 3R8UA 5FTQA 4FKUA 3L8SA 5L2IA 1DAYA 2EB3A 2WMAA 4NM5A 2BTRA 3VS7A 2AEGA 3E87A 4ID7A 4MEDA 3RM6A 2PZIA 3I5ZA 2H6DA 3MFUA 3MS9A 2YFXA 3PP1A 4D4YA 3VUTA 4KRDA 4GG7A 4U3ZA 3SXRA 5FWKK 3RHKA 2VWUA 3BBWA 4RX8A 1E1XA 5AUYA 3ZC6A 2PUUA 3ATTA 5AUZA 5GIPE 1G8SA 3W2PA 4ANSA 4IJ9A 5LWNA 2VWIA 4CRSA 5DE2A 3VUHA 5HBHA 3VUKA 3MV5A 3R7UA 3SKCA 2YCRA 2ESMA 4HNFA 4LI5A 4YC8A 5I0BA 4FKJA 4XMOA 5HU9A 1Y6BA 5L4QA 3U6JA 5J5SA 3LKMA 2J6MA 4FTKA 4N57A 4FZFB 4D1XA 4U44A 5E8TA 2QNJA 4AX8A 3QC9A 4EOKA 3LCTA 3PWYA 4BF2A 3NGAA 2YCSA 3OF0A 4FNWA 3OY3A 5TE0A 3W2QA 5L6OA 4GT5A 3DNDA 3POZA 4FIHA 2WQMA 4BCGA 4GSBA 5KMJA 3SRVA 3I6WA 1JAMA 2OZAB 4NWMA 4FTMA 2EVAA 2REIA 5ACKA 4BCQA 2C6EA 3RCDA 5JEBA 4YMJA 3LFCA 3OEZA 4DF3A 5CYIA 4NTTA 3EZRA 4IC8A 4EC8A 4AZVA 4JG7A 4U6RA 2GMXA 1ZZLA 2W9FB 4CYJA 4M12A 4FR4A 5LMBA 4U97A 4O0WA 3NAYA 5EI2A 5L3AA 2FB8A 2G1TA 4JAIA 3KXXA 3GBZA 3LXNA 3SXSA 3C4ZA 2C3KA 4BDGA 4D2WA 4RQKA 4FIFA 4AUAA 4EOPA 1H28A 3DLSA 4ZTHA 5JRSA 3FHIA 4BC6A 4BHNA 1SMHA 5HX6A 5FQDC 3V6SA 3BPRA 2XAOA 3LXPA 4QD6A 4O86A 3F3UA 3W0PA 1GZOA 2OXDA 2C6KA 2WMTA 1Y8GA 3EN9A 3H10A 4NFNA 5FXSA 2ZMDA 3PY3A 2Z2WA 4MD9E 3NYXA 3Q04A 3TEIA 3ZLSA 1AQ1A 3UDSA 3TCPA 4L01A 3DJ6A 2GNHA 3KC3A 1UU9A 4U40A 3ZO1A 4IBMA 3ALOA 2ITYA 3VF9A 5L6WL 3EQCA 3FLYA 4ACMA 4CVAA 3HAVA 2GS2A 1J7UA 3CCNA 2JDTA 4FV4A 3R7VA 1F5QA 2X0QA 4FSRA 4F0FA 3ML1A 4EH5A 1OKWA 4L67A 2WTKC 1ZYLA 3QTQA 3R1NA 1NW1A 4RC3A 4XV2A 3Q4TA 1GIJA 1ZMWA 4AN3A 2NPQA 4FZDB 2XNBA 4JDHA 4D1SA 5HEZA 3U4WA 2YM3A 5E90A 4QPAA 4PY1A 4IIRA 2XM9A 3ZTXA 4FVQA 4EQMA 3PP0A 3RPOA 1RJBA 5EKNA 1ZOHA 3NAXA 4FVRA 4RWLA 2Z8CA 4IM2A 3ORXA 3Q6UA 2LAVA 4I24A 4EI4A 4ZTLA 3VBQA 1VZOA 3MY0A 4CFUA 4MH7A 1QPCA 4U9AA 5A4QA 2HAKA 4YO4A 4MWIA 1OKYA 1YKRA 1UNHA 4WUNA 3RJCA 2V22A 4HCUA 4YZNA 4FL2A 3LXKA 4IZ5A 1YW2A 3FMLA 4K9YA 3FAAA 3FLSA 4BDIA 4EH2A 3O96A 3QRIA 5FUTA 2R3OA 1SYKA 3HV3A 3U51A 3F2RA 4WSYA 3PIXA 3ZC5A 2YERA 2OJIA 3FMNA 3QZHA 4O2ZA 4ERWA 5EKOA 4QTBA 4GT4A 4L42A 3D83A 3LAUA 4Z3VA 4UB7A 5FBOA 4D4SA 5FEQA 4D55A 5J7BA 4UWCA 3ZSGA 3R0TA 4FV0A 4Z9LA 3ZUTA 3ZRMA 5BUIA 1CM8A 5DHJA 4EWQA 2X2LA 4IXPA 2Z60A 3SGCA 4QYFA 4BCPA 2IJMA 1XR1A 3K3JA 4FODA 2C5OA 4QRCA 4I3ZA 2JKMA 4LDTA 3VHEA 1GAGA 4RVKA 3TZMA 5IQGA 4IACA 3Q9YA 2V7OA 2E9NA 3QKLA 1WBNA 4IB5A 5DFPA 4B6LA 4AOTA 2YDJA 1Q62A 3QA8A 5D41A 3WIGA 4AACA 2FSTX 3KK9A 3A7IA 4GCJA 4YJSA 4U81A 5E8SA 3FMEA 1PMUA 4IM3A 4YPDA 4AE6A 4B0GA 2BRMA 4X3FB 4DH7A 3TKHA 1H8FA 2WMRA 3JVRA 2RFEA 1UU8A 4O1OA 3FUPA 2QOHA 4O2PA 2J9MA 1F0QA 3UO4A 3DZOA 2YZLA 4QT1A 5CNNA 5AUWA 2W1CA 2YM4A 4TYIA 2VAGA 4C36A 2OLCA 1G8KA 3ID6C 4R3CA 1WVXA 3EFLA 3R21A 3ACJA 3CS9A 3ZHPC 1OI9A 2PYWA 3NVMB 4QDEA 2VWZA 3FBVA 4G6OA 4R5YA 4GMYA 1IAHA 5IH5A 1ZARA 4IE9A 4S30A 2NRUA 4DHZA 4D58A 1XMMA 1ZAOA 3PDTA 4C3RA 1CKPA 3DJ7A 5HNBA 4A4OA 3RINA 4N70A 3RZBA 3TL8A 4CFXA 4XP2A 4ACGA 4CGAA 1KE6A 2WTKB 5IU2A 3MN3A 5CENA 3FC2A 3KGAA 4C4JA 5CS6A 3E3BX 1Q8ZA 3G90X 4ZEGA 3F61A 5JMSA 2VTJA 4EK8A 3OOGA 5JK3A 2IEWA 4U45A 3ZLYA 3F9NA 4W4VA 5CWZA 3Q3BA 4ZSGA 5H3QA 4O7SA 2VGOA 3LFNA 4BDAA 3FQEA 3VW8A 4FF8A 3UQGA 1Z9XA 1Q97A 2UZTA 2VO3A 3MFRA 3QTRA 4D9UA 4EH6A 2ITPA 4CCBA 4IADA 5IQAA 4F4PA 2PTKA 4FIGA 4I41A 4ANMA 3OROA 2BDJA 3DTCA 4GW8A 1MUOA 4HW7A 5M4UA 5AIRA 4DCAA 2PZ5A 4S32A 4ZY5A 3QX2A 5CSXA 3QLFA 4FTAA 5HVJA 1H1QA 1YOLA 3C1XA 3PUPA 4CV9A 2OGVA 2R3RA 3KVWA 4PPCA 2B9HA 2O64A 3BEAA 3HMMA 3N51A 4QTDA 2WMVA 2IVTA 3RGFA 4CFVA 4TL0A 3KULB 5T3QA 2YCFA 4P5ZA 3NWWA 5DT0A 2YJSA 3UZTA 1YWVA 1H0WA 3ZCLA 3BGQA 2R3FA 3PJ8A 4K2RA 3VS2A 3QTIA 4FV8A 5KKRC 3O50A 2I7QA 4C3FA 3HDMA 3NZ0A 2ZM4A 4II5A 5J9YA 2ERKA 4RJ6A 5FM2A 5CF6A 1E1VA 4S2ZA 4FTQA 4KS7A 3OCGA 3R8ZA 5LCKA 3HA8A 1H1SA 2R3JA 4LL0A 3CKXA 3U9CA 4PNIA 5CSPA 1KOBA 2B4SB 5E8ZA 4WNMA 3H30A 4I4EA 4E4NA 3ZFMA 3MH2A 3A60A 2R3PA 4QYEA 5AR8A 5HE2A 3CTHA 3NW7A 4CT1A 4OGRA 4R1VA 4FGBA 2F2UA 4PTGA 4F70A 4OTWA 4PPAA 4AA5A 4CFMA 4RQVA 3C4CA 4IX3A 3VBYA 2C5XA 4AZTA 3BGZA 4CZTA 3BV3A 2B9FA 3ELJA 3PWDA 5HO6A 4DHIB 1H1WA 2XB7A 1HOWA 2WFYA 4FSWA 4OT6A 4TTHB 3UOKA 2XK8A 2XZSA 3FJQE 2F49A 2X7OA 3PZHA 4XOZA 1LP4A 2HXQA 3CQEA 3PFQA 4XX9A 5D7VA 4IAYA 4M68A 3LCDA 1M7QA 3RK5A 3KMMA 4ANOA 4K6ZA 3RK9A 1LR4A 4HGEA 5KZ0A 4BGQA 5BVDA 4J97A 3B2WA 5DLSA 4DBNA 5ANIA 4ALWA 4YU2A 1PRYA 2H34A 2O63A 2XM8A 3E3PA 3QAME 3U54A 1TQIA 2O8YA 2QKWB 2YIQA 4CRLA 4O91A 3ORMA 4PNKA 3L9LA 5HORA 3ZBFA 4IAKA 2QO7A 5HBEA 2QOBA 4AZEA 3HKOA 4YJVA 3P1AA 3TTJA 1PYEA 4OBPA 5CEQA 1ZOEA 2C5NA 3L8XA 2WU6A 3BYVA 2WU7A 3HX4A 3HV4A 4ANLA 4NCTC 3G5DA 3REPA 1UVRA 4FNXA 5LVMA 4DGNA 3OWKA 4C57A 4RJ3A 1PXLA 3UMWA 4F9CA 3C4WA 4Y8DA 4AXEA 2UV2A 2CSNA 3VHKA 2BIKB 2W4KA 3ULIA 4BYJA 1NY3A 3V01A 2HW6A 3OCBA 3UP2A 5JFSA 2F9GA 2YDIA 3DQXA 2GNGA 2OF2A 3PY0A 4QMSA 4TRLA 4AGWA 4HCTA 1BMKA 3IECA 3EN4A 4F7SA 5HGIA 1GIHA 3UMXA 1XBBA 4HZSA 3Q32A 4JMQA 3W0RA 2F2CB 4OTIA 4CQEA 4HVHA 5JZNA 1Q3WA 4O0UA 4OAVB 3WYYA 4L9IA 3EZVA 3EKNA 3FZ1A 3PSDA 2WGJA 3AD6A 4HGLA 4NCTA 3VIDA 3CKWA 1YQJA 4RBLA 3VO3A 5HG5A 2JDOA 5AP0A 4XBUA 4FT5A 4OTQA 2XK4A 4FZAB 5AADA 4XLIA 3PUFC 1WAKA 2QR7A 2PK9A 3IG7A 4QP1A 5ETIA 4ALVA 4LV7A 2HZ0A 4MKCA 2XIYA 1OIQA 3EKKA 5CF8A 5FDPA 3KF7A 4WHZA 4XP3A 4GH2A 2OXYA 4FKTA 2ITXA 2R3KA 3LFEA 4H3PA 2WMXA 2XIRA 3HUBA 3R63A 3QQFA 4O81A 1ATPE 2ZM3A 4FTOA 3VBTA