3FXXA

Human epha3 kinase and juxtamembrane region bound to substrate kqwdnye[ptyr]iw
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
299
structure length
288
Chain Sequence
TQTVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITAARPSNLLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-A receptor 3
publication title Structural recognition of an optimized substrate for the ephrin family of receptor tyrosine kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 288
sequence length 299
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fxxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fxxA01
3ZRLA 1WVXA 4TKSA 4EJNA 3U6JA 2JBOA 1OIYA 2ZV7A 2XK6A 4O7TA 2JIVA 3PPJA 3AG9A 3BBTB 3PXRA 3GT8A 1XH5A 2HZNA 4IAFA 3AMAA 4FKOA 2VWVA 4U97A 4PMPA 3QWJA 2ZOQA 3OEFX 4ZEGA 3IW6A 4RJ6A 3DPKA 3Q3BA 5HLPA 5KMLA 4P5ZA 3C5UA 1CM8A 2XNOA 3RINA 4RC4A 1M7QA 4NJ3A 3PWYA 2BRBA 4BCMA 5AFVA 3MVMA 4BHNA 4IM3A 1M17A 5AP3A 2WTIA 2O2UA 1T45A 3LVPA 3PXKA 4YBJA 5HG7A 3PPZA 3VS0A 3ZLSA 4CNHA 4X2FA 4ZS0A 2OXYA 4FV7A 4O7YA 1ZOEA 4U9AA 3AC1A 4EOKA 2FVDA 2NRUA 3VHEA 1W98A 2R5TA 3FC1X 3FI4A 3PJCA 3FZSA 1B38A 4XP0A 4QMWA 4PPBA 4DEIA 3LCSA 2GTNA 3HMIA 3MPMA 3ZDUA 3GOPA 2Y6MA 4HGLA 2Z02A 5CS6A 4B9DA 4KIKB 2JBPA 4L53A 4ANSA 5AA9A 2GS2A 1XH7A 5TO8A 4RG0A 5CZHA 3ZO4A 3R00A 3ZH8A 3AT2A 4UMTA 4MXYA 3F2NA 4MNEB 3PE2A 5F94A 1JSVA 3MW1A 1NVQA 3CLYA 3M1SA 3ORXA 4K6ZA 4Q5HA 4MWHA 3QF9A 3QD2B 4GL9A 4KBKA 4UEUA 4ZZMA 4FEUA 3LCDA 3ET7A 3L8PA 4A9UA 4BICA 3C0HA 4FSYA 4HOKA 5D41A 4HW7A 4DT9A 1YOJA 4B6LA 5A6OA 4QQJA 3ZRMA 3R0TA 4AP7A 1UU3A 1IA9A 2KTYA 3UOHA 4GSBA 3IG7A 1NVRA 4R6VA 3ZDIA 5CF6A 3QQLA 3VAPA 3ORTA 4DITA 3QX2A 1OKWA 3F69A 4AW0A 4D2TA 2GQSA 5I9YA 3GQIA 3KXMA 4L45A 4KIKA 1ZYCA 3ZM4A 3AOXA 2IZTA 3RGFA 3KA0A 4PNKA 1OKYA 3U54A 3MA6A 3IOKA 4JDJA 1PYEA 3LMGA 4XBRA 3QZGA 3PPKA 3RPRA 1BL7A 5ANJA 3I4BA 2ITTA 1W7HA 3BHHA 1KV1A 3QXOA 2OICA 2J2IB 4GYGA 4MNEA 4ZTQA 2XIKA 4AZTA 3WF7A 3LZBA 4HCTA 3DZQA 4I1ZA 2ZDUA 3C4FA 1BL6A 3OZ6A 3UNKA 5JGBA 5IQDA 5CAVA 4BDFA 4R5SA 5G6VA 3QCYA 3RK5A 2CKPA 3UOLA 5D10A 3A7HA 3D15A 2UUEA 3LCOA 3UZPA 2J50A 3HMNA 4E20A 4A07A 4IAKA 2QHNA 3PA5A 4KBAA 1OIRA 1Q8TA 1RQQA 2PY3A 3A60A 2BFXA 3PIYA 2OK1A 4FSRA 2UW8A 4RFYA 1DI9A 2V7OA 3R7UA 3CGOA 2WO6A 4ALVA 4KUJA 5IQIA 4XG8A 1YDSE 2XBJA 4IQ6A 2QC6A 4J71A 5HVKA 5D12A 4QD6A 4D1XA 2BIKB 2WGJA 4L6QA 4BCHA 3R2YA 4UWYA 1PXKA 3K2LA 2DS1A 4Z9LA 4R3CA 3F88A 2XEYA 4QMMA 4X3FC 2JD5A 1Q3DA 4MD8E 1E9HA 3FWQA 4H3BA 4QMZA 2ITZA 4TWCA 3MVJA 4QP4A 2I0YA 4A4OA 2GFCA 2B9FA 3FYJX 5C03A 4FSMA 3ZYAA 3TUCA 2R2PA 3LPBA 3R73A 4FSZA 1VYWA 3A8XA 1QCFA 5HG5A 4D28A 2CLQA 2GTMA 4EOMA 1STCE 1UU8A 4RVMA 4FC0A 4E4LA 3GCUA 4FIFA 3ORZA 3LMHA 5JEBA 3OFMA 1MP8A 2BCJA 5LWMA 3H9FA 3BHYA 4EK5A 4UMPA 5IA2A 3B2TA 4O0TA 5AR7A 2QOLA 4K77A 2OG8A 2XNPA 3VQUA 1NW1A 4JT3A 3QKLA 4BGHA 4F1MA 4FTJA 3VBYA 1IG1A 4HPUE 3W2RA 1Y8YA 3RPSA 4ZLZA 4EJ7A 1GY3A 2QU6A 4USEA 2GS6A 5AUVA 1R0EA 3ROCA 3GB2A 3SVVA 3DAKA 4GT5A 2F2UA 2WMVA 3DBEA 3NEWA 3HEGA 3FLYA 3UE4A 2EXCX 3AMBA 4O81A 4O83A 3C51A 4TYJA 1H24A 4JAJA 2R3RA 3NW7A 2A4LA 4BDCA 2X39A 3QZHA 3W10A 3PRIA 2OW3A 2VU3A 3CY2A 2B9IA 4V05A 2JAMA 5DA3A 3MTFA 5EK7A 5IMXA 3TTJA 3QRJA 5JFSA 3CKWA 4C0TA 1ZRZA 3AQVA 2UW0A 2JDOA 3GC8A 5AV0A 4F09A 3E87A 4X7QA 3VUHA 4CXAA 3AC4A 2B1PA 3TUDA 5DGZA 1Y6AA 3S2PA 3Q04A 4QTEA 4NT4A 2FSOX 2X2MA 2RFSA 4MKCA 4PX6A 3NYOA 3RK9A 3GCQA 3TG1A 4MVFA 4E3CA 4DH1A 3ZFXA 4DE4A 4O22A 3GU4A 3I6WA 4C61A 5LOHA 4UX9A 4ZJIA 4C57A 3LCTA 2R3FA 3G6GA 2R3KA 3DJ5A 1UVRA 5AX3A 5DEWA 3BWFA 4YHFA 2XIZA 2IVSA 3VRZA 4O6LA 3G51A 1XH8A 1PXIA 2QOCA 2C30A 3A4OX 3WZDA 1RE8A 5AA8A 5ETFA 4MCVA 5FDPA 3C4XA 3D2IA 3VS1A 3NS9A 1KOAA 4J52A 3D5VA 4PQNA 1WVWA 3QD3A 3F5GA 3KULB 2BDWA 2UW5A 2X7GA 2X2LA 3TEIA 1P4FA 4R1YA 2HZ0A 4TTHB 4QYFA 4XG9A 5JZNA 1SZMA 4ASEA 4FKUA 1HCKA 5GNKA 4PL4A 2UZEA 2X9EA 3BEAA 4LGDA 3U9CA 4BL1A 1R78A 4UWBA 4E1ZA 3DJ7A 5M53A 5C8MA 1ERKA 2OF4A 2VWUA 4KSPA 4WG4A 4BTMA 5LVPA 4OBQA 4WUNA 3PXFA 4ACMA 2OH0E 5AWMA 5IA1A 5K5NA 3NAXA 3BE2A 3R28A 4F9BA 3E8EA 5C8NA 1CMKE 4J1RA 3C0IA 4F6WA 2AC5A 5CAUA 4FOCA 2R3QA 2JC6A 2OJJA 3ORNA 4U45A 5EDQA 4CTBA 3H10A 4EOOA 3F3UA 4FKLA 4BKYA 2JGZA 3ORKA 2CNUA 1OPJA 4O21A 4V04A 4GW8A 3KULA 4CMOA 3ETAA 4DLIA 3FMJA 3QGWA 4BKJA 5LQFA 4PPAA 2VTPA 2R64A 4DC2A 3GP0A 4G3GA 5F20A 2OF2A 4S31A 5E4HA 4QQTA 4GUEA 4NM7A 3DKOA 3QWKA 3Q2JA 3ATSA 4G5JA 4GK3A 5CEQA 4O0YA 4CCUA 3HV3A 3OROA 1JNKA 5M55A 4JOAA 4EYJA 5IISA 3R1NA 4GT4A 2J0JA 4E6DA 4RLKA 2WTCA 3E5AA 4PY1A 4G5PA 4P7EA 3MA3A 3VW6A 1XQZA 5AP4A 5DR2A 5LMKA 3OCSA 3L1SA 1RDQE 4F0GA 3SX9A 3PY3A 4DBXA 1PXMA 3V5PA 3QHRA 4U43A 4FMQA 2YFXA 2XBAA 3JY0A 3D5WA 1MQBA 2F7ZE 3AT3A 3KRRA 4IX3A 1EH4A 2YCFA 4XG7A 2OSCA 2XP2A 4XEYA 3GXLA 1PXJA 2ZMDA 1H00A 4JX3A 4AGCA 2WKMA 5I3OA 2WTDA 4PNIA 3COKA 4BR3A 2O5KA 3KXXA 4K2RA 5C4LA 4QP9A 4KA3A 3ACJA 1J91A 3KC3A 4HGTA 4RA5A 5AR4A 4FSQA 4G17A 4XHKB 5DN3A 1OPLA 2YA9A 3VUKA 2R0UA 3SC1A 3BGQA 3DS6A 4CFFA 3ULZA 3CTHA 3TWJA 3WF5A 5BVKA 3PSBA 2QG5A 4O7LA 1LR4A 4K9YA 4A9TA 4M3QA 3OTVA 4JI9A 4FKTA 3PSDA 3DDQA 1FBNA 5IZFA 4IWQA 4G3FA 4FYOA 4ITIA 4DCEA 4YP8A 2GS7A 2CCIA 3EJ1A 4NW6A 4XOYA 3W2QA 2CN5A 3HDMA 5CQUA 3ZLXA 2WPAA 2VNYA 4K1BA 5AV4A 5JK3A 3R9RA 3ZTXA 4FT7A 1U4DA 4IZYA 4ENYA 1R1WA 3UMWA 4M66A 2WOUA 4AX8A 3VS4A 4AZVA 1FQ1B 3F3ZA 5DH3A 3FXZA 4BDGA 5A4QA 3GU6A 2VO3A 3E7OA 5I4NA 3ZZEA 5ANEA 2ITOA 4MYGA 2CGUA 3PDTA 4RBLA 4UV0A 3G15A 2ITPA 4DGGA 4C36A 4NWMA 4DG3E 4IC8A 3ACKA 4O7WA 1H4LA 3S00A 1UNGA 4BZNA 2XNMA 1WBOA 4QMQA 1OKZA 2WD1A 2VWYA 2IW9A 4H1JA 3R6XA 4BKZA 3CXWA 3TUBA 3VS2A 4LOPA 4QMVA 3Q4ZA 3FSFA 4L3JA 2OIBA 3FLNC 4TYHB 5DYJA 2P2IA 3DXNA 3MFRA 2PUNA 3W32A 2V5QA 3RTPA 2X6EA 4BBFA 4OGRA 4PRJA 4AG8A 5IEVA 2CMWA 4WNPA 5EHOA 2HXLA 3O7LB 2Q83A 4DFUA 4FV4A 2W1ZA 3DB6A 4EEVA 5KNJA 3RKBA 5A9UA 2VV9A 3F5XA 5CSWA 5LJJA 4FV6A 3F3TA 4YJPA 2R9SA 5BMSA 4X0MA 5GIPE 2XA4A 3PJ3A 4GT3A 2UW3A 2W5AA 1IA8A 3O17A 1J1BA 3R7GA 5AUYA 3BGZA 1Q8ZA 3QTSA 2Y4PA 4RX9A 4MNFA 3SXRA 5HIEA 5F95A 5ITAA 3RHKA 3EZRA 4Z7HA 4IAZA 4ZJVA 3EFKA 4IB3A 4ASZA 2XEZA 2OJIA 3R7IA 4CT1A 2YIYA 3ZXTA 4F0FA 4CKJA 5JGAA 5HHWA 5CAOA 4ZMFA 1YI3A 2R3MA 5AM6A 4FIGA 4TYHA 5A6NA 4OUCA 4W8DA 4I94A 4JL9A 3RAIA 4F6SA 4X2NA 4G34A 4IFGA 5EQYA 5HLWA 3CD3A 5EDPA 2VGOA 4HCUA 3RK7A 3I7BA 3R1SA 4FG8A 4WG5A 2YM3A 4C02A 4BDHA 4EHZA 3WZEA 3ZM9A 5IH5A 4GIIA 4D4RA 5TR6A 3EMGA 1ZXEA 3IW5A 1K2PA 1W83A 4JR7A 5BUIA 4ZAUA 4KINA 1E1XA 1UV5A 3UIMA 5IA3A 4FL3A 5DWRA 5E8YA 4FSWA 3ZHPC 4FKIA 3OT8A 3OXZA 5GHVA 2Y9QA 3KVWA 4S33A 2A27A 4CGAA 4ZZNA 3TNPC 2ITVA 2ZV8A 3PJ1A 3ZCLA 5KMIA 1MQ4A 5HO8A 5CT7A 4ZTNA 4BTJA 2VTQA 4CV8A 5CSVA 2Y4IB 3VN9A 3WIKA 2C6TA 2UW9A 2PVKA 5AP5A 5CI7A 3TNIA 2E9OA 3EN9A 4AGUA 1BMKA 3BU3A 4GG5A 4EH7A 1JKSA 2PVFA 4BTFA 1U5QA 2ZJWA 4BVUA 1U59A 1Z5MA 5H2UA 5H8GA 3D94A 3R7YA 3UIUA 1JPAA 5FGKA 2XS0A 3G9NA 4RPVA 3TKIA 3JYAA 4EOSA 3DK6A 4KIOA 2XM9A 4HYHA 4YTCA 5KMKA 3PY0A 3LKMA 3RJCA 4BCQA 4NTTA 3QZIA 3R8MA 2PVNA 4AE9A 4GU9A 4S2ZA 5DIAA 2XB7A 3U55A 1VEBA 2IW8A 2H96A 3F5PA 4EWHA 1FPUA 4JQEA 1OBDA 2QI8A 2IJMA 3FZRA 3P7BA 3RP9A 3QD0A 4BI2A 4BYIA 4AN2A 4EYMA 3NW5A 3CCNA 3WZJA 2XK7A 4EUTA 1G5SA 4R3RA 4DH7A 4PP7A 2ERKA 3GVUA 1J7UA 2CKOA 3R71A 4QP6A 4E5WA 5A46A 5L2WA 3O8TA 3B8RA 3I0OA 4QTCA 4WSQA 3OS3A 3R2BA 4LGGA 4YJQA 3KL8A 1LUFA 5E1SA 4F9YA 3FZPA 3KF7A 3POOA 4FTAA 4JNWA 1H25A 2BZIB 2C6MA 3DK7A 3PWDA 4X21A 3FEGA 2FUMA 4O0SA 4PTGA 2WOTA 3GFEA 2Y8OA 3T8OA 1FOTA 3UIXA 4F9WA 2VNWA 4CFXA 4FEXA 3DKGA 3FI3A 1JLUE 4DCAA 2XVDA 3LFSA 3QA8A 3SDJA 5BX0A 4MWIA 3PVWA 2QNJA 2OWBA 2C6OA 4ZSLA 5J9LA 2R7IA 4QYGA 3RAHA 3LIJA 3LLAA 1ZOHA 1XJDA 3OTUA 2W5BA 4HVDA 2XYNA 3F7WA 5CVGA 3AC2A 2JDRA 4UMUA 1H0VA 3O51A 4IJPA 4XG4A 4HVGA 3TV6A 4O96A 4DGOA 1WBNA 1V0BA 3RNYA 1LEWA 2EB3A 4WBOA 3DFCB 4DAWA 5L6PA 2BIYA 2E9UA 3K54A 2HENA 5CAPA 2B52A 3MPTA 3QQKA 4WG3A 4FZDB 4QTBA 5HEZA 4I4EA 3VUMA 4ASXA 3BV2A 3LQ5A 1TQIA 4I3ZA 2PVRA 4GFOA 3LOKA 2HAKA 3I79A 2R3OA 4Y73A 2YM4A 2C3IB 4EL9A 1J7LA 4I0SA 3W55A 3ZS5A 1M7NA 3HMOA 5J5SA 3HV6A 3RPYA 3G2FA 2W9ZB 4FIHA 3E8DA 5FQDC 4A9SA 2I6LA 3VJNA 4GK2A 3JUHA 4S34A 4XV2A 3RAKA 5HVJA 3RVGA 4M14A 2OIQA 2WB8A 3H3CA 3FZTA 4HPTE 2ITNA 3ORIA 2WQEA 3VWAA 4LRJA 2XJ2A 2XNEA 3EQHA 4KB8A 1URCA 5A14A 3VF9A 4FNWA 3KRWA 3UO4A 3ZLWA 3BE9A 3OT3A 4FTUA 5LARA 3V04A 5HG9A 5DFPA 3V01A 5KZIA 3I7CA 3QC9A 1KE5A 3FMLA 5CTPA 2AC3A 1OZ1A 3SGCA 2YM5A 5J1VA 4L8MA 3V5WA 4JX7A 4C38A 3RALA 3QLGA 4M12A 4ALUA 4FOBA 2BRMA 4NKSA 4QTAA 5FEEA 3NSZA 4FTRA 3ROYA 3ZO3A 1K9AA 4C4GA 1QPCA 2BR1A 4I24A 3AC5A 1YWNA 2ZVAA 3R01A 4QMUA 2UW4A 4LMUA 4YJNA 5F4NA 5JFXA 3AC8A 3P08A 3ZEWA 4TYEA 3ORMA 3QYZA 3OHTA 3DCVA 4FG9A 3JVSA 3UBDA 2WQMA 4MK0A 2ZDTA 1SNXA 5IMEA 2Z2WA 2GQGA 5HNBA 2UVYA 2Z60A 3NRMA 5JN2A 3VBVA 3TV4A 1CKPA 4FKJA 2GNGA 2XNBA 2BROA 3P78A 4WHZA 5AADA 4BDDA 4C37A 1JKKA 3E93A 2ETKA 2XYUA 2ZM1A 3DTCA 4EUUA 5CNNA 2HZIA 3OCGA 5HORA 4FL1A 4EHGA 5CU0A 3KRJA 4J8NA 4MD7E 5BNJA 4A9RA 4UWCA 4D2WA 3ALOA 4DFZE 4EORA 3O71A 2OGVA 5IH4A 5KMMA 4DFXE 3SLSA 4RC2A 3D9VA 5GJFA 2W06A 2NRYA 1GIJA 3TI1A 2OJGA 4PMSA 2ITYA 4M13A 2OKRA 4EH9A 4EOIA 5IQBA 3EYGA 4LUEA 5LVLA 3TNHA 1PW2A 4ENXA 2VO0A 4R78A 4U44A 2PWLA 3R1QA 2C6LA 5CEIA 3FPQA 3UGCA 2PPQA 5LVOA 2CNQA 2FYSA 3RPVA 2HXQA 4UMRA 3BRBA 3F5UA 2BUJA 3NGAA 1QMZA 3CE3A 2O8YA 4Y5QA 3DLSA 3G90X 4F4PA 4FTCA 2V7AA 4DBNA 3LJ0A 2GU8A 3EHAA 5HX6A 2WMQA 4PDOA 2A1AB 4BDIA 1M52A 2V62A 4YJSA 4CMTA 1WVYA 2WQNA 2W1GA 1KV2A 3PTGA 4FKSA 4ZTRA 3PA4A 5DRDA 4F7LA 3NX8A 1OI9A 3UP2A 3PVGA 4F08A 4NCTC 3R7VA 4YSJA 2YLFA 3ERKA 1YVJA 3TKHA 4RX5A 4K0YA 4WNOA 4UY9A 5CSPA 5FTQA 4L3LA 2PYWA 2P0CA 1U46A 3BU5A 4KS7A 1ATPE 2X4FA 4WSYA 5CT0A 3C9WA 4FKGA 2LAVA 2RL5A 3WILA 1RW8A 2ONLA 4X6RA 4E73A 4YURA 2YWVA 3QAME 4EOJA 4IM2A 5TT7A 4CRLA 2ITUA 2J0IA 3ZSIA 4IH8A 5E7RA 4AFEA 4U80A 3EQCA 3EFWA 1PRYA 5FD2A 3LFBA 3KQ7A 3TDWA 2E9VA 3ZRKA 4GG7A 2V22A 2BAQA 3NLBA 2OFVA 4I6HA 2CHLA 4JAIA 4K18A 1PYXA 1YKRA 4RJ3A 4O91A 4C35A 3EQPA 3KVXA 4EZ7A 5IQAA 3BV3A 3Q32A 3GOKA 4U6RA 4FKPA 2O63A 4RWJA 3U8WA 3KRXA 5HIDA 2R3LA 4IVDA 2X81A 2VTOA 1AQ1A 3R8UA 4FKVA 4HJOA 3PZHA 3CQEA 1ZWSA 4RMZA 5FBNC 3BYMA 4U0IA 3PXZA 5GIOE 1ZMVA 4XUFA 2Y7JA 3V8TA 3FSKA 4EHEA 1SM2A 3MVLA 4LQMA 4OR5A 2WFYA 4I22A 4C4JA 4WOVA 1YRPA 4GK4A 1Y6BA 4IC7A 3GU5A 4J98A 4R7BA 3GCPA 5CYIA 3R8LA 2FO0A 3CSVA 4AZFA 3H9RA 4NM5A 5EI2A 1PXNA 2JEDA 5HLNA 1JVPP 2HOGA 4ZK5A 4FV9A 5H3QA 4NIFB 5CX9A 2YCQA 3UQGA 3N4UA 4GJ3A 4AE6A 4EH3A 5FEDA 3R9OA 2ZM4A 3AMYA 4C59A 5IU2A 2ZB1A 4I6BA 1M2PA 2YZAA 3LW0A 3QHWA 4XP3A 4FSTA 5EW8A 5HD4A 3H4JA 2C6KA 3FI2A 2R0IA 4EOPA 1OVEA 5E91A 3WF9A 1G8AA 3U51A 3I6UA 3Q5IA 3V5TA 1YHVA 2PE0A 1WBPA 3NUNA 5M51A 4X2KA 4FE2A 5DR9A 3N9XA 3RWPA 3C50A 3D2KA 4TNBA 3UZRA 3WF6A 1I44A 1WBSA 3H9OA 3EN5A 4BZOA 5IQFA 5LMBA 5J87A 3NCGA 2VTSA 5JFVA 4BY9E 2BRNA 2YM6A 3BPRA 4EQCA 4D2VA 2VRXA 2YCSA 3QX4A 2JIUA 3EYHA 4ANLA 3SRVB 4LOQA 4IZ5A 3KXNA 1UKHA 3HRFA 4YTHA 3HECA 3GFWA 2EVAA 5EQPA 5DHJA 4IB5A 4FTLA 4GS6A 1GAGA 3HL7A 3CBLA 4NIFA 4PWNA 4AA5A 4DEGA 3A2CA 2WEIA 2VTAA 3D0EA 3QALE 4RT7A 5CU6A 3MBLA 4FICA 4KIQA 1ZLTA 3VIDA 4FYNA 4GVAA 3BWJA 3D7TB 2IW6A 3HV5A 3NUUA 4S32A 3Q9WA 5ANOA 4UZHA 3OXIA 4JJRA 4RVKA 3IW7A 4V01A 5CQWA 5CU3A 2QG7A 3FXXA 2LGCA 4W4VA 4MXOA 2BTRA 3A7IA 4HGSA 2UZDA 3REPA 2R7BA 3FHRA 4YZDA 1OPKA 4HZSA 4QNAA 4RSSA 4E26A 4IWOA 1JSUA 5C26A 2UZTA 1DI8A 3SRVA 3NDMA 1YXUA 4C3PA 4BWPA 3E8CA 2C0OA 3L9NA 3MTLA 3CY3A 3LFFA 4F7SA 1PHKA 3SXSA 2FB8A 2VX0A 4J95A 4QYYA 4D55A 4Z55A 3OVVA 5HD7A 4XH6A 3F2AA 3MH1A 1WFCA 1XBBA 4D9TA 2OFUA 1OGUA 4DGLC 4UYNA 1ZY4A 2XIRA 3OD6X 2PE2A 5CU4A 1OM1A 3MESA 5B0XA 3U87A 3MV5A 4AOTA 5LXMA 2BVAA 3AGLA 2A19B 4QYEA 5KMJA 1XR1A 4FTNA 2HY0A 5KUPA 4YC6A 3V6RA 4EK6A 2CGWA 2PVYA 3D7TA 5BPYA 5M4UA 2E2BA 4G6NA 2R3GA 3IW8A 1R0PA 3BYOA 3O0GA 2EU9A 3QQGA 1XO2B 5AV2A 3PJ2A 5CENA 3FKLA 3I81A 4IAYA 1FINA 3QRKA 3G0EA 4FZAB 4G16A 4I5CA 5K0KA 2PUIA 4MH7A 1VZOA 5HTBA 2EUFB 4E8AA 2GNJA 3PG1A 3BIZA 3FMEA 4DH8A 2XZSA 3JXWA 2PVJA 3PRFA 4I5HA 4O7SA 3QTRA 3W8LA 5CAQA 2X6DA 1Y57A 2BZKB 1P2AA 3D5UA 2BZJA 4GRBA 4N0SA 3U9NA 3V5JA 5JT2A 4F65A 4YJUA 2WMBA 4YTFA 2B55A 5GZAA 1PXPA 4WUAA 5CVFA 1JKTA 4BGQA 2C5VA 2IZRA 4ACDA 3SG9A 2ETMA 3A4PA 5AV1A 5JZJA 3BKBA 3ORLA 4FODA 4RZWA 2VTIA 4LRMA 5GZ8A 3G6HA 4LV5A 4DN5A 4FEQA 3F3VA 5BUEA 2FGIA 2VD5A 4UZDA 4FTQA 3S3IA 4PUZA 3HLLA 3HV4A 3NNWA 1A9UA 4X3FB 3PY1A 3UNJA 3R21A 3FE3A 3HVCA 1MRUA 4XJ0A 4XX9A 3DZOA 3NVMB 3ANRA 3QTIA 3FMDA 3VBQA 1Q8WA 3RMFA 5BYYA 4PTEA 3EL7A 5D9HA 4RGJA 3LFNA 2J9MA 4NZWB 2PHKA 2WMRA 2QCSA 3E63A 4YLLA 3LLTA 4RIYB 5BVWA 2I0HA 3K3IA 4XYFA 4GKIA 4KIPA 5IA0A 2CPKE 4FT3A 1TQPA 4FV3A 2Y6OA 4AU8A 1O9UA 2F2CB 2ZAZA 3OBJA 4X6QC 4CSVA 4O7RA 4Y83A 3FL5A 4BC6A 4PTCA 3FKOA 4Q5EA 4XOZA 4JR3A 2G2FA 4J53A 1R39A 1ZARA 2JKQA 2C3JA 4BCKA 4TL0A 1KOBA 3NVKI 3O96A 3KXGA 3VJOA 4Q9SA 1LP4A 2QOFA 1KE8A 4YZMA 2UZOA 4L44A 1H0WA 4X3FA 3M11A 5J5TA 1V0PA 4OTPA 3VS3A 4O0VA 2J5FA 2C69A 4KRDA 4D1SA 2HW7A 2W1HA 2XCKA 3QUDA 4JLCA 4LUDA 3OWKA 3ZO1A 3Q9ZA 2XNNA 3B2WA 3BLHA 4AT4A 2WTVA 5I9UA 3LFEA 2W1FA 4QMYA 3DT1A 1YHSA 2H6DA 2OH4A 5AP0A 2XKFA 4IVCA 2YACA 4RIYA 1CDKA 4C3FA 4ZS4A 5CEMA 3FQHA 3IECA 2GDOA 3NUPA 4MEDA 1S9IA 2J0LA 4RWKA 2YIRA 4BIBA 5ANIA 4QMNA 4ZY5A 3UO5A 4DTBA 1Y91A 5K9IA 2C6IA 2YDIA 3QTZA 4FL2A 1G3NA 3P79A 4OTGA 3RCJA 3WOWA 4G6LA 1ZAOA 4CT2A 3DQWA 5TOZA 4BN1A 4ZLOA 2VX1A 3GI3A 2BILB 3LXKA 5GJDA 4KNBA 3V8WA 3IONA 3BCEA 4CMUA 5CSHA 4MTAA 5AUZA 5I5ZA 1JKLA 3QQFA 3MPAA 3HZTA 4JXFA 5T3QA 2XK3A 3PA3A 1LEZA 4NM0A 3QRIA 2C3LA 1HCLA 3OWPA 4S30A 1NT2A 3N4VA 3F2RA 2I40A 3A7FA 2VN9A 2UW7A 4CRSA 3SW7A 1W84A 4DEDA 3FHIA 4ZTMA 4M0ZA 4EC8A 3QA0A 4EH5A 4ID7A 4XBUA 4YC3A 4RVTA 3OXTA 2Q0NA 4O0RA 2O65A 4P5QA 5E92A 4F64A 5M56A 1SVGA 4LGHA 5HCYA 3BELA 3R9NA 2YEXA 2CNVA 2PMIA 3O8PA 3LJ1A 4KKEA 5IG1A 2H34A 1YW2A 1GOLA 1VJYA 2VX3A 4L01A 3RZBA 4AN3A 4AQCA 5TF9A 4BF2A 4CFMA 2JKMA 3SXFA 1OBGA 2BRGA 3HP5A 2GNHA 3DBFA 5D7VA 3MJ1A 1H07A 1Q24A 4DF3A 3ATTA 2PVHA 3ZSGA 2W96B 5BYZA 5AAEA 3FMKA 1W82A 3MWUA 4JG6A 3R7OA 3W18A 5IUGA 2C5XA 2FSMX 2RIOA 3DK3A 3PZEA 4MXCA 4RLLA 1FMKA 4YZ9A 4DH3A 5L8LA 2DWBA 2UZLA 5M09A 3DY7A 5CSXA 2UZVA 5FM2A 5CF4A 4DFBA 5KZ0A 5M07A 4CKIA 3TIYA 1DM2A 1U54B 3UPXA 3ZEPA 4D5KA 3VVHA 2WXVA 3QTWA 4PF4A 4Z3VA 4CV9A 1BI7A 1GNGA 1G8SA 4I6FA 3HAVA 5DT3A 2YJRA 2W1EA 4R8QA 3IGGA 4O7NA 2GHGA 3QGYA 3MFTA 2FA2A 2Z7QA 2QLUA 4O27B 3Q4UA 2J0KA 4DFNA 4WD5A 3QCQA 4A9YA 5HU3A 4ARKA 2JITA 4ANMA 2W7XA 3LFDA 3FUPA 4BIDA 4C8BA 3QKMA 3DB8A 2YDKA 3AT4A 2QVSE 4ANOA 1NVSA 5EOBA 3TZ7A 1OITA 2P3GX 1Q8YA 4IZAA 3PG3A 3TZ9A 4FK6A 5FP5A 4FTTA 3PLAE 3FQSA 4CD0A 5CWZA 1U54A 2HWPA 3UG2A 3MH0A 3NYXA 3GU8A 5IEYA 2H9VA 2BZHB 3FZ1A 5DT0A 4WRGA 3I5ZA 5J79A 2PMLX 5AP1A 1AGWA 2GNIA 2J90A 5CNOA 3DKCA 4IW0A 5AR3A 5EHYA 3MGYA 5IA4A 4AOIA 4H3PA 5IKWA 4P90A 3FMNA 3CS9A 4XG2A 3D5XA 3FBVA 4YJOA 2GHMA 3PFQA 1JSTA 4O0WA 1MRYA 5AMNA 3D4QA 1REJA 4KD1A 3JPVA 4H36A 1Q97A 5A4CA 4I41A 4LMNA 4IB1A 4ALWA 1PMUA 4W9XA 3RPOA 2J4ZA 3G9LX 3AD4A 1WBVA 1SVHA 1FVTA 5JH6A 2WIPA 3TTIA 4I4FA 3VBTA 3W8QA 1O6LA 4R5YA 4W4XA 3Q6UA 2UZWE 3FJQE 4G6OA 2FSTX 4AZWA 2C1AA 4D0WA 3BHTA 4DG0E 2G15A 2W1IA 2B9JA 4DLJA 4O2ZA 1RJBA 5GZ9A 5EYKA 1Q99A 4YNEA 4R77A 3RM7A 4IHPA 2OZAB 1UNHA 4OAVB 2IZUA 3DBCA 5EI8A 4IACA 2W5HA 3E64A 2X9FA 5HE2A 4CLIA 4EOQA 4LOOA 3ZUVA 3E62A 4PDPA 1DAWA 3WE8A 4ANQA 4XG3A 1OL5A 4ZMEA 3VBXA 5KKRC 2UW6A 2WTWA 4J99A 3NR9A 4DT8A 3QKKA 3EQGA 3ID6C 2P33A 4EH4A 3M2WA 2F9GA 2XF0A 2RFEA 3V3VA 4D2RA 4QNYA 5KHXA 3KMMA 2PUUA 3DXPA 4C7TA 5CXZA 3PVBA 2PUPA 3AGMA 4AUAA 2W99B 4XRLA 3DAEA 3R30A 4FV1A 5LWNA 4IFCA 4TY1A 3QCXA 3KGAA 3LXNA 3ZUUA 4D2PA 1ZY5A 2RF9A 5C9CA 2JIIA 3ULIA 3QCSA 3DFAA 3EFLA 3RNIA 4DFYA 3ZOSA 4F9CA 3LQ3A 4GU6A 3UPZA 5KMNA 2VWBA 2OZAA 3SQQA 3MY0A 5F9EA 1UU7A 1FMOE 4LL0A 3KMWA 2YABA 4HVIA 2YM7A 5A3XA 4B0GA 3IDCA 3R8PA 4ANNA 2YERA 4JRVA 5EDRA 4QP8A 3CIKA 3ZFMA 4CFWA 3I0QA 5BVEA 5A54A 5BVFA 2WELA 4EKKA 4M68A 4L7FA 3TDVA 3UODA 3NNUA 4BGGA 3E7VA 1PMEA 1OUYA 1ZMUA 1IRKA 4FIIA 4QMLA 4D4YA 1OIUA 3WF8A 4ACHA 5HX8A 2IPXA 4JDIA 1Q61A 2NNWB 4YO4A 4IEBA 2KULA 2CDZA 4QT1A 2QD9A 3FXWA 2YHVA 5K4JA 5FTGA 4BRXA 4C4IA 2YDJA 3PP1A 4LRKA 4Y95A 1GIIA 2ESMA 4RJ5A 4ZLYA 4K11A 3HA6A 4PDYA 4C4HA 3L8XA 2OJ9A 1UNLA 3GC7A 4YTIA 2NP8A 3RI1A 4IZ7A 3A8WA 3PVUA 4LV8A 3S4QA 3LFAA 4UB7A 4FNXA 4ASDA 3C4WA 4BCOA 4BI1A 4IB0A 5DI1A 4L7SA 4DTAA 3TL8A 1PMVA 4Y72A 5AP6A 4DEHA 3HP2A 1VR2A 1H1RA 3IPHA 2ITWA 2C6DA 2C5NA 2PZYA 3POZA 2QOBA 4ANBA 2XK8A 4ZSEA 2VTHA 4KRCA 3QXPA 4K33A 4KS8A 3QUPA 2HWOA 3DXQA 3Q9XA 2C1BA 4BWXA 3DJ6A 4Y5HA 4Y46A 2WTKC 3CQWA 4J96A 3OOGA 4H1MA 3DKFA 3EQDA 3F66A 3F82A 5AIKA 4YHTA 5T68A 3W16A 2EB2A 4MXXA 4DG2E 3DQXA 5FRIA 2WU7A 1XH9A 3TNWA 4APCA 4YJVA 4D9UA 4RVLA 3TXOA 4AAAA 1K3AA 4CVAA 5LCKA 1H27A 4DYMA 1P5EA 4GFMA 2QHMA 4W4YA 4CCBA 5HU9A 3V8SA 5EI6A 4E4MA 1OL6A 4QPSA 3ZU7A 2QODA 1ZYDA 4NK9A 4QPAA 1I09A 2JAVA 4OAUC 3FLQA 3I5NA 3MB6A 4IADA 3ZXZA 5E9EA 4GKHA 4OTQA 4TRLA 1H1WA 4M97A 3QYWA 1Q3WA 3EKNA 2W4JA 2BALA 3R02A 3DNDA 1JQHA 2BRHA 4IE9A 4U42A 4Q2AA 3QFVA 4Y8DA 4YZNA 3ZMMA 3TV7A 4AT3A 4PL5A 4DEEA 3Q96A 1CTPE 3MIAA 2C5YA 2CCHA 4RIWB 2RG5A 3DDPA 4HCVA 3KN5A 5HNIX 2ITQA 4FT9A 4BCIA 3FDNA 4WNKA 3OOMA 4CFVA 3HKOA 4EH8A 4G3CA 4AXAA 3BLRA 5IQCA 4USDA 2WQOA 4U40A 5I9WA 3ZC6A 2R3PA 4WKQA 2G2HA 5L2QA 3C13A 4OBPA 1OL2A 2F57A 1B6CB 4MXZA 4W4WA 3AD6A 5E8XA 5C4KA 4XLVA 4BYJA 1BI8A 5EM8A 5CF5A 1BYGA 4U5JA 3UO6A 4E6CA 3OW3A 3EN7A 2R3JA 5EYMA 4D2SA 4FZ6A 1V1KA 3PIZA 4YO6A 2QOHA 2UZBA 4RIOA 5EOLA 4F7JA 2I0EA 3CEKA 5CZIA 5AV3A 4BDBA 4G9CA 3QLFA 4YPSA 1A48A 5E8WA 3I1AA 4L46A 4Y85A 3CPCA 4GH2A 3L9PA 5E8UA 3V5QA 3ENMA 3E3BX 2PTKA 4RIWA 2YN8A 5DPVA 4A06A 3VBWA 5BYLA 5EM6A 3VF8A 3QQHA 3TM0A 4OT6A 4N57A 4FVRA 1UU9A 4YJTA 3UMXA 2PL0A 4O38A 4BHZA 5K0XA 1WMKA 2X0GA 4IVBA 4ACGA 5KMOA 1CSNA 3W33A 5FBOA 4RJ4A 5BUJA 2XRWA 2JDSA 2C6EA 2J6MA 5ANDA 3VQHA 4OTIA 3T3UA 4ACCA 4H58A 2YZLA 3A62A 3JY9A 4XV9A 5FM3A 3R63A 2IZSA 4NM3A 3OCTA 5JKGA 5M4IA 1S9JA 3EB0A 3GC0A 3NNVA 5HE1A 3O50A 4CQGA 3UQFA 4F0IA 2YAAA 3Q4CA 4NFMA 1LPUA 3TJDA 3QTXA 2PZIA 4HYSA 3CGFA 4ZZOA 2VO7A 4ZTSA 4FTOA 4FGRA 3QQJA 3DBQA 3M42A 1Z9XA 4XV3A 3D7ZA 5JFWA 3NPCA 1XHAA 2Q0BA 3ITZA 2VTRA 4MX9A 1H01A 2WIHA 3WIGA 4BCJA 2HY81 5KCVA 4TWNA 5FDXA 5HNGA 3HNGA 5EQEA 3T9IA 5AAFA 4TXCA 3MB7A 4MXAA 4XMOA 5EG3A 3NAYA 4U41A 3EQBA 3UVQA 2XJ0A 4FIEA 5HCZA 4K8AA 5CALA 4GFGA 1ZYLA 2Y0AA 5AR2A 5D7AA 1L8TA 4TNDA 2BFYA 4PDSA 3UJGA 2C5OA 3GBZA 2JFLA 4FTKA 2X8EA 2BDFA 3SV0A 2F7XE 3R8VA 4MBIA 4FK3A 4FV5A 3DA6A 4EH2A 4FKRA 4UN0C 5CU2A 2RFDA 4IBMA 5HKMA 4B8MA 4EWQA 2J51A 5CASA 3P0MA 3CC6A 5KO1A 3KY2A 2QKRA 1YDTE 3HA8A 3G0FA 2HZ4A 4FUYA 1URWA 5L4QA 3KMUA 2QO2A 3R9DA 3HV7A 3QL8A 4ITHA 3VUGA 1MRVA 1H1QA 3GCSA 4GCJA 3NIEA 4JQ7A 4LL5A 3LMIA 2AYPA 4TWPA 5IQGA 5ACKA 1NA7A 1YWVA 2JDVA 1VYZA 3WYYA 4NYEA 1H1SA 3IK3A 2QOKA 3HMMA 3P5KA 4JBVA 5K3YA 4E7WA 3OY1A 4J7BA 1E1VA 4E6QA 1FGKA 5L6OA 4DINA 2I1MA 2VO6A 4FUXA 2PSQA 3P1AA 4HVSA 3QQUA 4M8TA 3DGKA 2BPMA 3FV8A 3PXYA 1QPJA 5BVOA 3Q4TA 4CLJA 5J1WA 5B2LA 3HAMA 2RSVA 3WE4A 4EK8A 4D0XA 2XKEA 3KXZA 5HG8A 3GENA 3ZLYA 4I21A 3ANQA 3FI8A 1JWHA 4EK4A 2IN6A 5CLPA 3JR1A 2IVVA 2B4SB 4UALA 1ZZ2A 4JS8A 4BBMA 2W9FB 2YISA 3SOCA 2VWIA 1CKIA 4G1WA 4O1OA 5EYDA 2JLDA 3LM5A 3Q5ZA 4JQ8A 4YR8A 3CR0A 5FXQA 4B4LA 4ITJA 3O23A 2NO3A 3KK8A 1HOWA 4JBQA 3UQCA 2DUVA 3OUNB 2J5EA 1Q5KA 2C0TA 2EWAA 3QRTA 4QP2A 2WMAA 4GV1A 3RAWA 3UP7A 5EM5A 4N6YA 4CKRA 4RJ7A 4BDEA 4IJ9A 1B39A 3COMA 3KB7A 4YC8A 4U3YA 4OLIA 5HQ0A 2P4IA 4FR4A 1IR3A 4G9RA 4BBEA 4H05A 2GNLA 3HUBA 3P23A 3EL8A 3TACA 5ACBC 1M2RA 4ERWA 5EKNA 4FV2A 4EBWA 5JQ8A 5GINE 3EH9A 4E93A 3UTOA 4MQ1A 4WT6A 2GQRA 3IQ7A 4A7CA 2C3KA 2IG7A 1O6KA 2QOOA 1J3HA 1Y8GA 4ZY4A 3S95A 4BCGA 2V0DA 4CG8A 4EQMA 5H8EA 4JG8A 5HTIA 3AD5A 2F7EE 5JQ5A 4IMYA 5ETCA 3T9TA 4W8EA 4AT5A 2JFMA 3NCZA 2PVLA 2BHHA 3FAAA 4MQ2A 1H1PA 3MY5A 5HE3A 4IX6A 1BUHA 2GMXA 2YIQA 4QMPA 1GZOA 2ZV2A 4FI1A 2UZUE 4FSNA 3OWLA 4QQ5A 3G33A 3V6SA 3LXLA 4L43A 3OUKA 3MIYA 3C7QA 4ONAA 5G1XA 4B8LA 5CEPA 4DGNA 5M06A 2QONA 1L3RE 3A7GA 3DU8A 3Q52A 4AW1A 2HCKA 1IEPA 1UWHA 3QUEA 5IUIA 3NNXA 4H39A 4QOXA 4YU2A 1H26A 3UOJA 4NCTA 4NH1A 5IH6A 2WZJA 3Q60A 4DFLA 5M4FA 3R22A 4UMQA 5M08A 4RFZA 4FTMA 2VGPA 4AGDA 4JDKA 4IDVA 3LXPA 2CKQA 4O0XA 4KWPA 5HOAA 2R4BA 3S0OA 3NZ0A 1P14A 4U7ZA 1Q4LA 3I60A 3EFJA 2G1TA 3ODYX 4OTHA 3UOKA 3PIXA 5T6KA 5HESA 4NUSA 3ZBFA 4BDAA 4CZYB 5J8IA 4YHJA 5LMKC 2IVTA 3COHA 5EH0A 5AX9A 1YXVA 5CXHA 1GZKA 3SG8A 3DBDA 4L52A 3C4ZA 4I23A 4NL0A 5E8SA 4R3PA 3BQCA 2R3IA 2ZV9A 4IDTA 3T3VA 4FT0A 1TQMA 3MY1A 4TZRA 5DLSA 2X1NA 1O6YA 2ETRA 2XRUA 2PVMA 2J7TA 2GCDA 2OU7A 3CTQA 3EQRA 3W2CA 4AFJA 4C62A 3C4EA 2CSNA 2XK4A 4QP3A 3QBNA 3NMUF 2ACXA 1KWPA 5AUWA 2ERZE 3GU7A 5ETIA 3FLSA 4YUQA 4GEOA 4U81A 5FP6A 3TT0A 4L3PA 5ANKA 3QZFA 1SYKA 4QQCA 4F99A 5HIBA 3Q6WA 3OMVA 4RX7A 4C4EA 4KBCA 2WHBA 3W2SA 3VUIA 4EH6A 3DOGA 4BWKA 4Z7GA 2WNTA 5E1EA 5J9ZA 1PF8A 2PZPA 2XH5A 2C4GA 4FF8A 4P2KA 2DQ7X 2ZM3A 4YNOA 4EQUA 4E4NA 1ND4A 4AN9A 2BMCA 2UZNA 2X8IA 3IS5A 2WMSA 4WA9A 4X2JA 4JBOA 3BGPA 3RM6A 3QC4A 3DV3A 5IDPA 5LCJA 4DH5A 3ELJA 2A2AA 1F3MC 3FMHA 2C47A 1OB3A 3WZUA 3KK9A 4R1VA 4M0YA 4U8ZA 4XS2A 5EM7A 5B2KA 3U4WA 1FGIA 4C3RA 5DNRA 3LJ2A 4RQKA 2W0JA 1OL7A 3V51A 1H08A 2B54A 4G31A 4O2PA 5KBQA 2O64A 1YI6A 2G9XA 3IDPA 2ZB0A 3THBA 1XKKA 4IAIA 4OTWA 3TN8A 4DTKA 2QOQA 3BX5A 3E8NA 5HICA 3B8QA 4BCFA 2HW6A 5FEQA 2W1CA 1QL6A 4IANA 4E6AA 1IAHA 3ENHA 4IIRA 4RQVA 3OF0A 4JBPA 5J7BA 3TCPA 4FNZA 5L8KA 1XH4A 2IO6A 5FUTA 4A4LA 3R9HA 4PMTA 2XK9A 3ZZWA 1PXOA 4V0GB 4CG9A 1PJKA 4FG7A 4FT5A 3UYSA 4DGMA 4J97A 3L9MA 3IKAA 2E9NA 3AXWA 2BAJA 1DAYA 3TZMA 4YGAA 2Z8CA 5I0BA 4QPMA 4GIHA 5AEPA 3OBGA 3UC4A 5L2SA 4FGBA 2PMOX 3COIA 3EZVA 2YJSA 3PUPA 4DEAA 4IVAA 1M14A 1YOLA 2ZMCA 4XCUA 5ETAA 4IX4A 5AM7A 3BQRA 4TYIA 5B7VA 3Q2MA 3N51A 4ZSJA 1YHWA 1F5QA 2YCRA 2P2HA 3CPBA 3CJGA 3IGOA 4LFIA 3CTJA 1U5RA 1NY3A 2OZOA 2EXEA 3QD4A 4HYIA 3VRYA 1GZNA 1ZZLA 4KKHA 3UZTA 3C0GA 4QP7A 4ZSAA 1A06A 2BKZA 4RX8A 4O82A 3Q53A 5HO6A 2OXXA 4H3QA 2YITA 4ZSGA 4E4XA 4RZVA 1ZMWA 2QLQA 4AZSA 4C34A 2HYYA 3KF4A 4CYIA 2DYLA 5CEOA 4V0GA 3L9LA 4FZ7A 4GYIA 2X7OA 4YBKA 4EC9A 4NJDA 3H0YA 4CQEA 5AR8A 3TZ8A 1IASA 4BDJA 3ZFYA 2QO9A 4ZIMA 4YSMA 5D1JA 3ZONA 4GVJA 4KKGA 4I0RA 4RC3A 3DLZA 3IOPA 3TKUA 4FEVA 4ZTHA 2WTJA 2VTJA 2O3PA 3NW6A 3QRUA 5HBHA 4B7TA 5E90A 4YMJA 2PU8A 2X7FA 1YOMA 5DVRA 1NXKA 2G2IA 1OKVA 3QU0A 4KSQA 4OT5A 4TYGA 5DRBA 4AWIA 5DMZA 1J7IA 4D1ZA 3HRCA 3AC3A 4JIAA 3CJFA 5AJQA 5HO7A 4PMMA 5J7HA 2CGXA 4EZ3A 3BYVA 2QQ7A 2W17A 3NWWA 4HYUA 1JOWB 2XUUA 4TT7A 3GC9A 2UVXA 3EN6A 1OL1A 3O2MA 4XP2A 1WCCA 4BCPA 3H0ZA 4RJ8A 3BZ3A 4L68A 2W1DA 1ZYSA 4N70A 4DHFA 3OC1A 2YLEA 4WNMA 4M15A 3SD0A 2W4KA 1FVRA 3PYYA 3LCKA 4LI5A 5IA5A 4FBXA 1W0XC 4LM5A 4RRVA 5HBJA 3R04A 3HMPA 1V0OA 5EHLA 2H8HA 1ZYJA 2QOIA 5HCXA 4PPCA 1KE7A 3VS6A 4C58A 1GZ8A 2I7QA 2EXMA 1PY5A 3EQIA 5CI6A 1GJOA 2CKEA 1OECA 4Q9ZA 1KUTA 3O7LD 4E5BA 3SW4A 3DAJA 3ZC5A 3GEQA 5LVNA 5EFQA 3FPMA 3KCKA 3CP9A 4AW5A 1KE6A 3OWJA 4YLKA 3A61A 5AIRA 4L00A 5C1QB 4O0UA 3RCDA 3FC2A 4O6EA 5ANGA 2Y4IC 3DNEA 3FYKX 2YIXA 4MD9E 4WIHA 3R8ZA 4F7NA 5M44A 3MFSA 3GUBA 4C2WA 1YQJA 4QMXA 2OXDA 2X4ZA 5HI2A 2PULA 4AACA 4NW5A 5DOSA 5IQEA 3LFCA 2WMUA 5DR6A 4L42A 3SA0A 3RWQA 4OTRA 2FH9A 4CFNA 3OEZA 5HE0A 3OP5A 5KBRA 5LMAA 2OIDA 4CZUA 3A7JA 4RWIA 4D4VA 1J1CA 4ZOGA 4O1PA 4E5AX 4APPA 5KE0A 2I0VA 3SAYA 1TVOA 3P7AA 3WYXA 3ZUTA 3LE6A 3NUYA 4N6ZA 4IWDA 4IXPA 1OIQA 2W4OA 2WMXA 5B2MA 2VWZA 3DTWA 5C8KA 4XLIA 3RHXA 3SKCA 4BZDA 3JS2A 5IUHA 4YZBA 4UXQA 3Q9YA 3UC3A 4ZJJA 4NEUA 2QR7A 2QURA 1YWRA 3GQLA 4L67A 3UVPA 1YDRE 5DEYA 2Z7RA 2F49A 4HNFA 5J9YA 3HYHA 4RFMA 3LM0A 4XRJA 3N4TA 2V55A 3WI6A 4C2VA 3R83A 4PV0A 4QTDA 3F61A 2VUWA 4QRCA 4WO5A 1OMWA 3ZBXA 1KE9A 4MAOA 4UBAA 5IDNA 4BI0A 1PXLA 4LYNA 4M7IA 2CN8A 2P55A 3BYSA 3MJ2A 4X3JA 5F1ZA 2XJ1A 5FG8A 3ZSHA 4EOLA 4F63A 4IWPA 2PE1A 5JRSA 4AW2A 4HVHA 4WRSA 3OG7A 3G5DA 3PXQA 4R7HA 4I0TA 4IAAA 2VTNA 4G3DA 4FIJA 1JBPE 1UKIA 2WQBA 4FNYA 4FVPA 4R7IA 2G01A 5D11A 3NYNA 5AUUA 4CFUA 2CGVA 3EN4A 5C27A 2QKWB 4NKAA 3BHVA 3HGKA 4KABA 3CQUA 5ICPA 3PSCA 3C5IA 4O7VA 4I93A 3NYVA 3PE1A 2HK5A 4F1TA 5AUXA 1H28A 3P9JA 4GJ2A 5J95A 5DE2A 2C0IA 4D58A 5KHWA 1MUOA 4FZFB 3ODZX 4TN6A 5CY3A 5AAGA 1BLXA 3FL4A 2F4JA 5HGIA 4EK3A 3K5UA 1QPDA 2Z7LA 4BTKA 3BBWA 4D5HA 3WZKA 4EKLA 3IW4A 4YLJA 3VUTA 3E92A 4QMOA 3LFQA 3KXHA 3UNZA 4Z16A 3K3JA 3LHJA 4BCNA 1WAKA 2XM8A 4M67A 4C4FA 3BEGA 1FVVA 5KX8A 5L3AA 4FA2A 2NPQA 3BHUA 4JG7A 2UVZA 3HDNA 1GIHA 2RG6A 3MVHA 4QMTA 4YJRA 3F6XA 4M69B 3W1FA 4BB4A 2J0MB 2OJFE 2VAGA 4G2FA 1W8CA 2WMWA 4MBLA 3BYUA 4QMSA 3KREA 3L8VA 1APME 3R1YA 2YAKA 2B7AA 4QP1A 3NUSA 4CYJA 5A4LA 3RZFA 3VULA 5IF1A 4NTSA 1Q41A 3P4KA 4BDKA 5HBEA 4FSUA 3TNQB 4O7ZA 3FLWA 2Z7SA 2XMYA 4QO9A 4ZTLA 1SMHA 1REKA 2QU5A 3FQEA 1QPEA 5AP7A 2RKUA 4UXLA 4HNIA 3C4CA 2YIWA 4I6QA 4EONA 1IAJA 5JRQA 3LQ8A 3KRLA 2SRCA 2WEVA 2WMTA 3CD8A 3OW4A 1Q8UA 3W2OA 3NUXA 5M4CA 4DA5A 5LVMA 3EKKA 5HZNA 2OI4X 3EIDA 3ORPA 2RFNA 4IM0A 4ZP5A 3SHEA 4LG4A 5IQHA 3F7ZA 1YXXA 3MH3A 3K5VA 2YWPA 1WZYA 2XIYA 4IX5A 2OO8X 5HVYA 1SNUA 4FV8A 4TPTA 4F1OA 2PMNX 2VTMA 4QYHA 3VUDA 3HUCA 4I5PA 1M2QA 4M69A 3IO7A 2BDJA 4NU1A 1BKXA 5FWKK 4B99A 1X8BA 4OBOA 4AF3A 4DEBA 2C68A 3FKNA 4OW8A 5I9VA 3E88A 3LAUA 4CEGA 4TWOA 1Z57A 5BVNA 3ZO2A 4PL3A 2VTLA 5BMMA 4D4SA 3PP0A 5H8BA 3NIZA 2PZ5A 1F0QA 1WBTA 5E8ZA 5AR5A 4M84A 5BQ0A 3KEXA 5E8VA 3NUAA 2VZ6A 4FKQA 5JSMA 2O0UA 3KN6A 3W2PA 5FTOA 5L2IA 5DBXA 3RBWA 5L2TA 4WBBB 2X2KA 4A4XA 2BKKA 3OCBA 2W05A 2A0CX 3FZOA 3L8SA 4BFMA 4EBVA 1UWJA 4C33A 3WARA 5C01A 1ZOGA 2WAJA 4RWLA 4W9WA 5I9ZA 5M57A 1SVEA 3FLZA 1XWSA 5I9XA 2B53A 2RGPA 3GGFA 3VHKA 5KKRB 3MSSA 3KU2A 2JKOA 2IVUA 2CLXA 3KCFA 4P4CA 1T46A 2XCHA 5IPJA 4YZCA 4MBJA 1P4OA 4RA4A 4U79A 1BX6A 1KSWA 1JAMA 2CJMA 2R3HA 3KKVA 4OTDA 2ITXA 5FXSA 4NFNA 4YPDA 4MF1A 5CVHA 5FLFA 3VS7A 4GMYA 2XKDA 1YXTA 5GJGA 3GCVA 2ONLC 1Q62A 4AA0A 3VNTA 1OUKA 3H30A 4GUBA 5HTCA 4JIKA 1YI4A 4ORKA 1CKJA 1UA2A 3ALNA 5EKOA 5E8TA 5K4IA 4FKWA 1XH6A 3FY2A 3KFAA 2X8DA 3QTUA 5DG5A 4FX3A 4UYAA 3FY0A 4FVQA 3MFUA 4MF0A 2GNFA 4HGEA 4JDHA 3IDBA 4MHAA 3U4UA 2OBJA 4I5MA 4I92A 2VWXA 3CKXA 3C1XA 1WBWA 3UG1A 5EYCA 3VO3A 3WBLA 3SOAA 3HX4A 2GPHA 4AA4A 4XV1A 4F9AA 5A4TA 3BLQA 3EWHA 2QO7A 2REIA 5A4EA 3VS5A 5H9BA 4FEWA 4O86A 1H8FA 2R3NA 2JKKA 5TE0A 3GNIB 4RIXB 2QR8A 2HELA 2VWWA 5EW3A 3O8UA 2AUHA 4II5A 5K5XA 4N4SA 4NSTA 3F9NA 2E9PA 2HIWA 4CTCA 1PKGA 5AUTA 1PMNA 3MDYA 5I3RA 5L6WL 3D14A 2UV2A 2FSLX 3BI6A 4JRNA 4G3EA 5EW9A 3VC4A 4BIEA 3QTQA 2BTSA 3FMMA 3F3WA 3II5A 3MI9A 1YXSA 2GSFA 3JVRA 4X2GA 5BVDA 1PKDA 2YM8A 2XNGA 4AOJA 3P7CA 2XKCA 1XBCA 5CF8A 4EI4A 3TIZA 3UDBA 2B0QA 4XNEA 2B9HA 3U6HA 4J8MA 2PZRA 3V5LA 2JDTA 5IEXA 5JGDA 4CZTA 2WU6A 4KAOA 3MH2A 4AGWA 2OLCA 1R3CA 3P86A 4XG6A 4OTFA 4RIXA 2BAKA 2WTKB 3VW8A 2PK9A 4F6UA 2VTTA 5TKDA 4ZXTA 1DS5A 2BHEA 3PLSA 4FV0A 3R7EA 3U6IA 1TKIA 4O84A 2GFSA 5L8JA 4AZEA 4HZRA 5CANA 2IWIA 2XIXA 3EOCA 5CEKA 4I20A 3OY3A 3BU6A 5AP2A 5DT4A 4EZ5A 4U3ZA 3TJCA 3UIBA 3PJ8A 3EQFA 4AS0A 3S1HA 1AD5A 4L9IA 4PP9A 4EHVA 5FXRA 3UVRA 1XBAA 4JVGA 4TW9A 3D83A 3HRBA 4ERKA 3MYGA 3UYTA 5JMSA 4FTIA 4F70A 4ZY6A 3A99A 3MS9A 2ZYBA 3E3PA 4USFA 2GHLA 3MN3A
chains in the Genus database with same CATH superfamily
3ZRLA 1WVXA 4TKSA 4EJNA 3U6JA 2JBOA 1OIYA 2ZV7A 2XK6A 4O7TA 2JIVA 3PPJA 3AG9A 3BBTB 3PXRA 3GT8A 1XH5A 2HZNA 4IAFA 3AMAA 4FKOA 2VWVA 4U97A 4PMPA 3QWJA 2ZOQA 3OEFX 4ZEGA 3IW6A 4RJ6A 3DPKA 3Q3BA 5HLPA 5KMLA 4P5ZA 3C5UA 1CM8A 2XNOA 3RINA 4RC4A 1M7QA 4NJ3A 3PWYA 2BRBA 4BCMA 5AFVA 3MVMA 4BHNA 4IM3A 1M17A 5AP3A 2WTIA 2O2UA 1T45A 3LVPA 3PXKA 4YBJA 5HG7A 3PPZA 3VS0A 3ZLSA 4CNHA 4X2FA 4ZS0A 2OXYA 4FV7A 4O7YA 1ZOEA 4U9AA 3AC1A 4EOKA 2FVDA 2NRUA 3VHEA 1W98A 2R5TA 3FC1X 2A98A 3FI4A 3PJCA 3FZSA 1B38A 4XP0A 4QMWA 4PPBA 4DEIA 3LCSA 2GTNA 3HMIA 3MPMA 3ZDUA 3GOPA 2Y6MA 4HGLA 2Z02A 5CS6A 4B9DA 4KIKB 2JBPA 4L53A 4ANSA 5AA9A 2GS2A 1XH7A 5TO8A 4RG0A 5CZHA 3ZO4A 3R00A 3ZH8A 3AT2A 4UMTA 4MXYA 3F2NA 4MNEB 3PE2A 5F94A 1JSVA 3MW1A 1NVQA 3CLYA 3M1SA 3ORXA 4K6ZA 4Q5HA 4MWHA 3QF9A 3QD2B 4GL9A 4KBKA 4UEUA 4ZZMA 4FEUA 3LCDA 3ET7A 3L8PA 4A9UA 4BICA 3C0HA 4FSYA 4HOKA 5D41A 4HW7A 4DT9A 1YOJA 4B6LA 5A6OA 4QQJA 3ZRMA 3R0TA 4AP7A 1UU3A 1IA9A 2KTYA 3UOHA 4GSBA 3IG7A 1NVRA 4R6VA 3ZDIA 5CF6A 3QQLA 3VAPA 3ORTA 4DITA 3QX2A 1OKWA 3F69A 4AW0A 4D2TA 2GQSA 5I9YA 3GQIA 3KXMA 4L45A 4KIKA 1ZYCA 3ZM4A 4JMQA 3AOXA 2IZTA 3RGFA 3KA0A 4PNKA 1OKYA 3U54A 3MA6A 3IOKA 4JDJA 1PYEA 3LMGA 4XBRA 3QZGA 3PPKA 3RPRA 1BL7A 5ANJA 3I4BA 2ITTA 1W7HA 3BHHA 1KV1A 3QXOA 2OICA 2J2IB 4GYGA 4MNEA 4ZTQA 2XIKA 4AZTA 3WF7A 3LZBA 4HCTA 3DZQA 4I1ZA 2ZDUA 3C4FA 1BL6A 3OZ6A 3UNKA 5JGBA 3W0QA 5IQDA 5CAVA 4BDFA 4R5SA 5G6VA 3QCYA 3RK5A 2CKPA 3UOLA 5D10A 3A7HA 3D15A 2UUEA 3LCOA 3UZPA 2J50A 3HMNA 4E20A 4A07A 4IAKA 2QHNA 3PA5A 4KBAA 1OIRA 1Q8TA 1RQQA 2PY3A 3A60A 2BFXA 3PIYA 2OK1A 4FSRA 2UW8A 4RFYA 1DI9A 2V7OA 3R7UA 3CGOA 2WO6A 4ALVA 4KUJA 5IQIA 4XG8A 1YDSE 2XBJA 4IQ6A 2QC6A 4J71A 5HVKA 5D12A 4QD6A 4D1XA 2BIKB 2WGJA 4L6QA 4BCHA 3R2YA 4UWYA 1PXKA 3K2LA 2DS1A 4Z9LA 4R3CA 3F88A 2XEYA 4QMMA 4X3FC 2JD5A 1Q3DA 4MD8E 1E9HA 3FWQA 4H3BA 4QMZA 2ITZA 4TWCA 3MVJA 4QP4A 2I0YA 4A4OA 2GFCA 2B9FA 3FYJX 5C03A 4FSMA 3ZYAA 2X0OA 3TUCA 2R2PA 3LPBA 3R73A 4FSZA 1VYWA 3A8XA 1QCFA 5HG5A 4D28A 2CLQA 2GTMA 4EOMA 1STCE 1UU8A 4RVMA 4FC0A 4E4LA 3GCUA 4FIFA 3ORZA 3LMHA 5JEBA 3OFMA 1MP8A 2BCJA 5LWMA 3H9FA 3BHYA 4EK5A 4UMPA 5IA2A 3B2TA 4O0TA 5AR7A 2QOLA 4K77A 2OG8A 2XNPA 3VQUA 1NW1A 4JT3A 3QKLA 4BGHA 4F1MA 4FTJA 3VBYA 1IG1A 4HPUE 3W2RA 1Y8YA 3RPSA 4ZLZA 4EJ7A 1GY3A 2QU6A 4USEA 2GS6A 5AUVA 1R0EA 3ROCA 3GB2A 3SVVA 3DAKA 4GT5A 2F2UA 2WMVA 3DBEA 3NEWA 3HEGA 3FLYA 3UE4A 2EXCX 3AMBA 4O81A 4O83A 3C51A 4TYJA 1H24A 4JAJA 2R3RA 3NW7A 2A4LA 4BDCA 2X39A 5BV3A 3QZHA 3W10A 3PRIA 2OW3A 2VU3A 3CY2A 2B9IA 4V05A 2JAMA 5DA3A 3MTFA 5EK7A 5IMXA 3TTJA 3QRJA 5JFSA 3CKWA 4C0TA 1ZRZA 3AQVA 2UW0A 2JDOA 3GC8A 5AV0A 4F09A 3E87A 4X7QA 3VUHA 4CXAA 3AC4A 2B1PA 3TUDA 5DGZA 1Y6AA 3S2PA 3Q04A 4QTEA 4NT4A 2FSOX 2X2MA 2RFSA 4MKCA 4PX6A 3NYOA 3RK9A 3GCQA 3TG1A 4MVFA 4E3CA 4DH1A 3ZFXA 4DE4A 4O22A 3GU4A 3I6WA 4C61A 5LOHA 4UX9A 4ZJIA 4C57A 3LCTA 2R3FA 3G6GA 2R3KA 3DJ5A 1UVRA 5AX3A 5DEWA 3BWFA 4YHFA 2XIZA 2IVSA 3VRZA 4O6LA 3G51A 1G8JA 1XH8A 1PXIA 2QOCA 2C30A 3A4OX 3WZDA 1RE8A 5AA8A 5ETFA 4MCVA 5FDPA 3C4XA 3D2IA 3VS1A 3NS9A 1KOAA 4J52A 3D5VA 4PQNA 1WVWA 3QD3A 3F5GA 3KULB 2BDWA 2UW5A 2X7GA 2X2LA 3TEIA 1P4FA 4R1YA 2HZ0A 4TTHB 4QYFA 4XG9A 5JZNA 1SZMA 4ASEA 4FKUA 1HCKA 5GNKA 4PL4A 2UZEA 2X9EA 3BEAA 4LGDA 3U9CA 4BL1A 1R78A 4UWBA 4E1ZA 3DJ7A 5M53A 5C8MA 1ERKA 2OF4A 2VWUA 4KSPA 4WG4A 4BTMA 5LVPA 4OBQA 4WUNA 3PXFA 4I6LA 4ACMA 2OH0E 5AWMA 5IA1A 5K5NA 3NAXA 3BE2A 3R28A 4F9BA 3E8EA 5C8NA 1CMKE 4J1RA 3C0IA 4F6WA 2AC5A 5CAUA 4FOCA 2R3QA 3W0MA 2JC6A 2OJJA 3ORNA 4U45A 5EDQA 4CTBA 3H10A 4EOOA 1TZDA 3F3UA 4FKLA 2JGZA 3ORKA 4BKYA 2CNUA 1OPJA 4O21A 4V04A 4GW8A 3KULA 4CMOA 3ETAA 4DLIA 3FMJA 3QGWA 4BKJA 5LQFA 4PPAA 2VTPA 2R64A 4DC2A 3GP0A 4G3GA 5F20A 2OF2A 4S31A 5E4HA 4QQTA 4GUEA 4NM7A 4MUQA 3DKOA 3QWKA 3Q2JA 3ATSA 4G5JA 4GK3A 5CEQA 4O0YA 4CCUA 3HV3A 3OROA 1JNKA 5M55A 4JOAA 4EYJA 5IISA 3R1NA 4GT4A 2J0JA 4E6DA 4RLKA 2WTCA 3E5AA 4PY1A 4G5PA 4P7EA 3MA3A 3VW6A 1XQZA 5AP4A 5DR2A 5LMKA 3OCSA 3L1SA 1RDQE 4F0GA 3SX9A 3PY3A 4DBXA 1PXMA 3V5PA 3QHRA 4U43A 4FMQA 2YFXA 2XBAA 3JY0A 3D5WA 1MQBA 2F7ZE 3AT3A 3KRRA 4IX3A 1EH4A 2YCFA 4XG7A 2OSCA 2XP2A 4XEYA 3GXLA 2IEWA 1PXJA 2ZMDA 1H00A 4JX3A 4AGCA 2WKMA 5I3OA 2WTDA 4PNIA 3COKA 4BR3A 2O5KA 3KXXA 4K2RA 5C4LA 4QP9A 4KA3A 3ACJA 1J91A 3KC3A 4HGTA 4RA5A 5AR4A 4FSQA 4G17A 4XHKB 5DN3A 1OPLA 2YA9A 3VUKA 2R0UA 3SC1A 3BGQA 3DS6A 4CFFA 3ULZA 3CTHA 3TWJA 3WF5A 5BVKA 3PSBA 2QG5A 4O7LA 1LR4A 4K9YA 4A9TA 4M3QA 3OTVA 4JI9A 4FKTA 4O4FA 3PSDA 3DDQA 1FBNA 5IZFA 4IWQA 4G3FA 4FYOA 4ITIA 4DCEA 4YP8A 3P5JC 2GS7A 2CCIA 3EJ1A 4NW6A 4XOYA 3W2QA 2CN5A 3HDMA 5CQUA 3ZLXA 2WPAA 2VNYA 4K1BA 5AV4A 5JK3A 3R9RA 3ZTXA 4FT7A 1U4DA 4IZYA 4ENYA 1R1WA 3UMWA 4M66A 2WOUA 4AX8A 3VS4A 4AZVA 1FQ1B 3F3ZA 5DH3A 3FXZA 4BDGA 5A4QA 3GU6A 2VO3A 3E7OA 5I4NA 3ZZEA 5ANEA 2ITOA 4MYGA 2CGUA 3PDTA 4RBLA 4UV0A 3G15A 4O4CA 2ITPA 4DGGA 4C36A 4NWMA 4DG3E 4IC8A 3ACKA 4O7WA 1H4LA 3S00A 1UNGA 4BZNA 2XNMA 1WBOA 4QMQA 1OKZA 2WD1A 2VWYA 2IW9A 4H1JA 3R6XA 4BKZA 3CXWA 3TUBA 3VS2A 4LOPA 4QMVA 3Q4ZA 3FSFA 4L3JA 2OIBA 3FLNC 4TYHB 5DYJA 2P2IA 3DXNA 3MFRA 2PUNA 3W32A 2V5QA 3RTPA 2X6EA 2XAMA 4BBFA 4OGRA 4PRJA 4AG8A 5IEVA 2CMWA 4WNPA 5EHOA 2HXLA 3O7LB 1G8KA 2Q83A 4DFUA 4FV4A 2W1ZA 3DB6A 4EEVA 5KNJA 3RKBA 5A9UA 2VV9A 3F5XA 5CSWA 5LJJA 4AXCA 4FV6A 3BLAA 3F3TA 4YJPA 2R9SA 5BMSA 4X0MA 5GIPE 2XA4A 3PJ3A 4GT3A 2UW3A 2W5AA 1IA8A 3O17A 1J1BA 3R7GA 5AUYA 3BGZA 1Q8ZA 3QTSA 2Y4PA 4RX9A 4MNFA 3SXRA 5HIEA 5F95A 5ITAA 3RHKA 3EZRA 4Z7HA 4IAZA 4ZJVA 3EFKA 4IB3A 4ASZA 2XEZA 2OJIA 3R7IA 4CT1A 2YIYA 3ZXTA 4F0FA 4CKJA 5JGAA 5HHWA 5CAOA 4ZMFA 1YI3A 2R3MA 4QDVA 5AM6A 4FIGA 4TYHA 5A6NA 3PUFC 4OUCA 4W8DA 4I94A 4JL9A 3RAIA 4F6SA 4X2NA 4G34A 4IFGA 5EQYA 5HLWA 3CD3A 5EDPA 2VGOA 4HCUA 3RK7A 3I7BA 3R1SA 4FG8A 4WG5A 2YM3A 4C02A 4BDHA 4EHZA 3WZEA 3ZM9A 5IH5A 4GIIA 4D4RA 5TR6A 3EMGA 1ZXEA 3IW5A 1K2PA 1W83A 4JR7A 5BUIA 4ZAUA 4KINA 1E1XA 1UV5A 3UIMA 5IA3A 4FL3A 5DWRA 5E8YA 4FSWA 3ZHPC 4FKIA 3OT8A 3TMOA 3OXZA 5GHVA 2Y9QA 3KVWA 4S33A 2A27A 4AXEA 4CGAA 4ZZNA 3TNPC 2ITVA 2ZV8A 3PJ1A 3ZCLA 5KMIA 1MQ4A 5HO8A 5CT7A 4ZTNA 4BTJA 2VTQA 4CV8A 5CSVA 2Y4IB 3VN9A 3WIKA 2C6TA 2UW9A 2PVKA 5AP5A 5CI7A 3TNIA 2E9OA 3EN9A 4AGUA 1BMKA 3BU3A 4GG5A 4EH7A 1JKSA 2PVFA 4BTFA 1U5QA 2ZJWA 4BVUA 1U59A 1Z5MA 5H2UA 5H8GA 3D94A 3R7YA 3UIUA 1JPAA 5FGKA 2XS0A 3G9NA 4RPVA 3TKIA 3JYAA 4EOSA 3DK6A 4KIOA 2XM9A 4HYHA 4YTCA 5KMKA 3PY0A 3LKMA 3RJCA 4BCQA 4NTTA 3QZIA 3R8MA 2PVNA 4AE9A 4GU9A 4S2ZA 5DIAA 2XB7A 3U55A 1VEBA 2IW8A 2H96A 3F5PA 4EWHA 1FPUA 4JQEA 1OBDA 2QI8A 2IJMA 3FZRA 3P7BA 3RP9A 3QD0A 4BI2A 4BYIA 4AN2A 4EYMA 3NW5A 3CCNA 3WZJA 2XK7A 4EUTA 1G5SA 4R3RA 4DH7A 4PP7A 2ERKA 3GVUA 1J7UA 2CKOA 3R71A 4QP6A 4E5WA 5A46A 5L2WA 3O8TA 4DHZA 3B8RA 3I0OA 4QTCA 4WSQA 3OS3A 3R2BA 4LGGA 4YJQA 3KL8A 1LUFA 5E1SA 4F9YA 3FZPA 3KF7A 3POOA 4FTAA 4JNWA 1H25A 2BZIB 2C6MA 3DK7A 3PWDA 4X21A 3FEGA 2FUMA 4O0SA 4PTGA 2WOTA 3GFEA 2Y8OA 3T8OA 1FOTA 3UIXA 4O4DA 4F9WA 2VNWA 4CFXA 4FEXA 3DKGA 3FI3A 1JLUE 4DCAA 2XVDA 3LFSA 3QA8A 3SDJA 5BX0A 4MWIA 3PVWA 2QNJA 2OWBA 2C6OA 4ZSLA 5J9LA 2R7IA 4QYGA 3RAHA 3LIJA 3LLAA 1ZOHA 1XJDA 3OTUA 2W5BA 4HVDA 2XYNA 3F7WA 5CVGA 3AC2A 2JDRA 4UMUA 1H0VA 3O51A 4IJPA 4XG4A 4HVGA 3TV6A 4O96A 4DGOA 1WBNA 1V0BA 3RNYA 1LEWA 2EB3A 4WBOA 3DFCB 4DAWA 5L6PA 2BIYA 2E9UA 3K54A 2HENA 5CAPA 2B52A 3MPTA 3QQKA 4WG3A 4FZDB 4QTBA 5HEZA 4I4EA 3VUMA 4ASXA 3BV2A 3LQ5A 1TQIA 4I3ZA 2PVRA 4GFOA 3LOKA 2HAKA 3I79A 2R3OA 4Y73A 2YM4A 2C3IB 4EL9A 1J7LA 4I0SA 3W55A 3ZS5A 1M7NA 3HMOA 5J5SA 3HV6A 3RPYA 3G2FA 2W9ZB 4FIHA 3E8DA 5FQDC 4A9SA 2I6LA 3VJNA 4GK2A 3JUHA 4S34A 4XV2A 3RAKA 5HVJA 3RVGA 2IF8A 4M14A 2OIQA 2WB8A 3H3CA 3FZTA 4HPTE 2ITNA 3ORIA 2WQEA 3VWAA 4LRJA 2XJ2A 2XNEA 3EQHA 4KB8A 1URCA 5A14A 3KIOC 4DDIA 3VF9A 4FNWA 3KRWA 3UO4A 3ZLWA 3BE9A 3OT3A 4FTUA 5LARA 3V04A 5HG9A 5DFPA 3V01A 5KZIA 3I7CA 3QC9A 1KE5A 3FMLA 5CTPA 2AC3A 1OZ1A 3SGCA 2YM5A 5J1VA 4L8MA 3V5WA 4JX7A 4C38A 3RALA 3QLGA 4M12A 4ALUA 4FOBA 2BRMA 4NKSA 4QTAA 5FEEA 3NSZA 4FTRA 3ROYA 3ZO3A 1K9AA 4C4GA 1QPCA 2BR1A 4I24A 3AC5A 1YWNA 2ZVAA 3R01A 4QMUA 2UW4A 4LMUA 4YJNA 5F4NA 5JFXA 3AC8A 3P08A 3ZEWA 4TYEA 3ORMA 3QYZA 3OHTA 3DCVA 4FG9A 3JVSA 3UBDA 2WQMA 4MK0A 2ZDTA 3W0OA 1SNXA 5IMEA 1ST4A 2Z2WA 2GQGA 5HNBA 2UVYA 2Z60A 3NRMA 5JN2A 3VBVA 3TV4A 1CKPA 4FKJA 2GNGA 2XNBA 2BROA 3P78A 4WHZA 5AADA 4BDDA 4C37A 1JKKA 3E93A 2ETKA 2XYUA 2ZM1A 3DTCA 4EUUA 5CNNA 2HZIA 3OCGA 5HORA 4FL1A 4EHGA 5CU0A 3KRJA 4J8NA 4MD7E 5BNJA 4A9RA 4UWCA 4D2WA 3ALOA 4DFZE 4EORA 3O71A 2OGVA 5IH4A 5KMMA 4DFXE 3SLSA 4RC2A 3W0SA 3D9VA 5GJFA 2W06A 2NRYA 1GIJA 3TI1A 2OJGA 4PMSA 2ITYA 4M13A 2OKRA 4EH9A 4EOIA 5IQBA 3EYGA 4LUEA 5LVLA 3TNHA 1PW2A 4ENXA 2VO0A 4R78A 4U44A 2PWLA 3R1QA 2C6LA 5CEIA 3FPQA 3UGCA 2PPQA 5LVOA 2CNQA 2FYSA 3RPVA 2HXQA 4UMRA 3BRBA 3F5UA 2BUJA 3NGAA 1QMZA 3CE3A 2O8YA 4Y5QA 3DLSA 3G90X 4F4PA 4FTCA 2V7AA 4DBNA 3LJ0A 2GU8A 3EHAA 5HX6A 2WMQA 4PDOA 2A1AB 4BDIA 1M52A 2V62A 4YJSA 4CMTA 1WVYA 2WQNA 2W1GA 1KV2A 3PTGA 4FKSA 4ZTRA 3PA4A 5DRDA 4F7LA 3NX8A 1OI9A 3UP2A 3PVGA 4F08A 4NCTC 3R7VA 4YSJA 2YLFA 3ERKA 1YVJA 3TKHA 4RX5A 4K0YA 4WNOA 4UY9A 5CSPA 5FTQA 4L3LA 2PYWA 2P0CA 1U46A 3BU5A 4KS7A 1ATPE 2X4FA 4WSYA 5CT0A 3C9WA 4FKGA 2LAVA 2RL5A 3WILA 1RW8A 2ONLA 4X6RA 4E73A 4YURA 1VLRA 3QAME 4EOJA 4IM2A 5TT7A 2YWVA 4CRLA 2ITUA 2NYAA 2J0IA 3ZSIA 4IH8A 5E7RA 4AFEA 4U80A 3EQCA 3EFWA 1PRYA 5FD2A 3LFBA 3KQ7A 3TDWA 2E9VA 3ZRKA 4GG7A 2V22A 2BAQA 3NLBA 2OFVA 4I6HA 2CHLA 4JAIA 4K18A 1PYXA 1YKRA 4RJ3A 4O91A 4C35A 3EQPA 3KVXA 4EZ7A 5IQAA 3BV3A 3Q32A 3GOKA 4U6RA 4FKPA 2O63A 4RWJA 3U8WA 3KRXA 5HIDA 2R3LA 4IVDA 2X81A 2VTOA 1AQ1A 3R8UA 4FKVA 4HJOA 3PZHA 3CQEA 1ZWSA 4RMZA 5FBNC 3BYMA 4U0IA 3PXZA 5GIOE 1ZMVA 4XUFA 2Y7JA 3V8TA 3FSKA 4EHEA 1SM2A 3MVLA 4LQMA 4OR5A 2WFYA 4I22A 4C4JA 4WOVA 1YRPA 4GK4A 1Y6BA 4IC7A 3GU5A 4O4EA 4J98A 4R7BA 3GCPA 5CYIA 3R8LA 2FO0A 3CSVA 4AZFA 3H9RA 4NM5A 5EI2A 1PXNA 2JEDA 5HLNA 1JVPP 2HOGA 4ZK5A 4FV9A 5H3QA 4NIFB 5CX9A 2YCQA 3UQGA 3N4UA 4GJ3A 4AE6A 4EH3A 5FEDA 3R9OA 2ZM4A 3AMYA 4C59A 5IU2A 2ZB1A 4DHJA 4I6BA 1M2PA 2YZAA 3LW0A 3QHWA 4XP3A 4FSTA 5EW8A 5HD4A 3H4JA 3TYKA 2C6KA 3FI2A 2R0IA 4EOPA 1OVEA 5E91A 3WF9A 1G8AA 3U51A 3I6UA 3Q5IA 3AKJA 3V5TA 1YHVA 2PE0A 1WBPA 3NUNA 5M51A 4X2KA 4FE2A 5DR9A 3N9XA 3RWPA 3C50A 3D2KA 4TNBA 3UZRA 3WF6A 1I44A 1WBSA 3H9OA 3EN5A 4BZOA 5IQFA 5LMBA 5J87A 3NCGA 2VTSA 5JFVA 4AXDA 4BY9E 2BRNA 2YM6A 3BPRA 4EQCA 4D2VA 2VRXA 2YCSA 3QX4A 2JIUA 3EYHA 4ANLA 3SRVB 4LOQA 4IZ5A 3KXNA 1UKHA 3HRFA 4YTHA 3HECA 3GFWA 2EVAA 5EQPA 5DHJA 4IB5A 4FTLA 4GS6A 1GAGA 3HL7A 3CBLA 4NIFA 4PWNA 4AA5A 4DEGA 3A2CA 2WEIA 2VTAA 3D0EA 3QALE 4RT7A 5CU6A 3MBLA 4FICA 4KIQA 1ZLTA 3VIDA 4FYNA 1XMLA 4GVAA 3BWJA 3D7TB 2IW6A 3HV5A 3NUUA 4S32A 3Q9WA 5ANOA 4LV7A 4UZHA 3OXIA 4JJRA 4RVKA 3IW7A 4V01A 5CQWA 5CU3A 2QG7A 3FXXA 2LGCA 4W4VA 4MXOA 2BTRA 3A7IA 4HGSA 2UZDA 3REPA 2R7BA 3FHRA 4YZDA 1OPKA 4HZSA 4QNAA 4RSSA 4E26A 4IWOA 1JSUA 5C26A 2UZTA 1DI8A 3SRVA 3NDMA 1YXUA 4C3PA 4BWPA 3E8CA 2C0OA 3L9NA 3MTLA 3CY3A 3LFFA 4F7SA 1PHKA 3SXSA 2FB8A 2VX0A 4J95A 4QYYA 4D55A 4Z55A 3OVVA 5HD7A 4XH6A 3F2AA 3MH1A 1WFCA 1XBBA 4D9TA 2OFUA 1OGUA 4DGLC 4UYNA 1ZY4A 2XIRA 3OD6X 2PE2A 5CU4A 1OM1A 3MESA 5B0XA 3U87A 3MV5A 4AOTA 5LXMA 2BVAA 3AGLA 2A19B 4QYEA 5KMJA 1XR1A 4FTNA 2HY0A 5KUPA 4YC6A 3V6RA 4EK6A 2CGWA 2PVYA 3D7TA 5BPYA 5M4UA 2E2BA 4G6NA 2R3GA 3IW8A 1R0PA 3BYOA 3O0GA 2EU9A 3QQGA 1XO2B 5AV2A 3PJ2A 5CENA 3FKLA 3I81A 4IAYA 1FINA 3QRKA 3G0EA 4FZAB 4G16A 4I5CA 5K0KA 2PUIA 4MH7A 1VZOA 5HTBA 2EUFB 4E8AA 2GNJA 3PG1A 3BIZA 3FMEA 4DH8A 2XZSA 3JXWA 2PVJA 3PRFA 4I5HA 4O7SA 3QTRA 3W8LA 5CAQA 2X6DA 1Y57A 2BZKB 1P2AA 3D5UA 2BZJA 4GRBA 4N0SA 3U9NA 3V5JA 5JT2A 4F65A 4YJUA 2WMBA 4YTFA 2B55A 5GZAA 1PXPA 4WUAA 5CVFA 1JKTA 4BGQA 1TFFA 2C5VA 2IZRA 4ACDA 3SG9A 2ETMA 3A4PA 5AV1A 5JZJA 3BKBA 3ORLA 4FODA 4RZWA 2VTIA 4LRMA 5GZ8A 3G6HA 4LV5A 4DN5A 4FEQA 3F3VA 5BUEA 2FGIA 2VD5A 4UZDA 4FTQA 3S3IA 4PUZA 3HLLA 3HV4A 3NNWA 1A9UA 4X3FB 3PY1A 3UNJA 3R21A 3FE3A 3HVCA 1MRUA 4XJ0A 4XX9A 3DZOA 3NVMB 3ANRA 3QTIA 3FMDA 3VBQA 1Q8WA 3RMFA 5BYYA 4PTEA 3EL7A 5D9HA 4RGJA 3LFNA 2J9MA 4NZWB 2PHKA 2WMRA 2QCSA 3E63A 4YLLA 2ZFYA 3LLTA 4RIYB 5BVWA 2I0HA 3K3IA 4XYFA 4GKIA 4KIPA 5IA0A 2CPKE 4FT3A 1TQPA 4FV3A 2Y6OA 4AU8A 1O9UA 2F2CB 2ZAZA 3OBJA 4X6QC 4CSVA 4O7RA 4Y83A 3FL5A 4BC6A 4PTCA 3FKOA 4Q5EA 4XOZA 4JR3A 2G2FA 4J53A 1R39A 1ZARA 2JKQA 2C3JA 4BCKA 4TL0A 1KOBA 3NVKI 3O96A 3KXGA 3VJOA 4Q9SA 1LP4A 2QOFA 1KE8A 4YZMA 2UZOA 4L44A 1H0WA 4X3FA 3M11A 5J5TA 1V0PA 4OTPA 2XANA 3VS3A 4O0VA 2J5FA 2C69A 4KRDA 4D1SA 2HW7A 2W1HA 2XCKA 3QUDA 4JLCA 4LUDA 3OWKA 3ZO1A 3Q9ZA 2XNNA 3B2WA 3BLHA 4AT4A 2WTVA 5I9UA 3LFEA 2W1FA 4QMYA 3DT1A 1YHSA 2H6DA 2OH4A 5AP0A 2XKFA 4IVCA 2YACA 4RIYA 1CDKA 4C3FA 4ZS4A 5CEMA 3FQHA 3IECA 2GDOA 3NUPA 4MEDA 1S9IA 2J0LA 4RWKA 2YIRA 4BIBA 5ANIA 4QMNA 4ZY5A 3UO5A 4DTBA 1Y91A 5K9IA 2C6IA 2YDIA 3QTZA 4FL2A 1G3NA 3P79A 4OTGA 3RCJA 3WOWA 4G6LA 1ZAOA 4CT2A 3DQWA 5TOZA 4BN1A 4ZLOA 2VX1A 3GI3A 2BILB 3LXKA 5GJDA 3VONA 4KNBA 3V8WA 3IONA 3BCEA 4CMUA 5CSHA 4MTAA 5AUZA 5I5ZA 1JKLA 3QQFA 3MPAA 3HZTA 4JXFA 5T3QA 2XK3A 3PA3A 1LEZA 4NM0A 3QRIA 2C3LA 1HCLA 3OWPA 4S30A 1NT2A 3N4VA 3F2RA 2I40A 3A7FA 2VN9A 2UW7A 4CRSA 3SW7A 1W84A 4DEDA 3FHIA 4ZTMA 4M0ZA 4EC8A 3QA0A 4EH5A 4ID7A 4XBUA 4YC3A 4RVTA 3OXTA 2Q0NA 4O0RA 2O65A 4P5QA 5E92A 4F64A 5M56A 1SVGA 4LGHA 5HCYA 3BELA 3R9NA 2YEXA 2CNVA 2PMIA 3O8PA 3LJ1A 4KKEA 5IG1A 2H34A 1YW2A 1GOLA 1VJYA 2VX3A 4L01A 3RZBA 4AN3A 4AQCA 5TF9A 4BF2A 4CFMA 2JKMA 3SXFA 1OBGA 2BRGA 3HP5A 2GNHA 3DBFA 5D7VA 4DHIB 3MJ1A 1H07A 1Q24A 4DF3A 3ATTA 2PVHA 3ZSGA 2W96B 5BYZA 5AAEA 3FMKA 1W82A 3MWUA 4JG6A 2X0QA 3R7OA 3W18A 2C5XA 2FSMX 2RIOA 3DK3A 3PZEA 4MXCA 4RLLA 1FMKA 4YZ9A 4DH3A 5L8LA 2DWBA 2UZLA 5M09A 3DY7A 5CSXA 2UZVA 5FM2A 5CF4A 4DFBA 5KZ0A 5M07A 4CKIA 3TIYA 1DM2A 1U54B 3UPXA 3ZEPA 4D5KA