3FXYA

Acidic mammalian chinase, catalytic domain
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
379
structure length
379
Chain Sequence
b'YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acidic mammalian chitinase
publication title Triad of polar residues implicated in pH specificity of acidic mammalian chitinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 132
structure length 379
sequence length 379
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3fxyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3fxyA01
4DUWA 5FD0A 2VZSA 4UR9A 3VPLA 4D71A 5I5RA 4D6EA 4UZUA 4CCEA 4U33A 2TAAA 3K8LA 4AZIA 1EDGA 1PEZA 2PWEA 3NIYA 3K46A 3NDZA 1V6VA 4K68A 4PSPA 1W1PA 2DSZA 1H0IA 4TTUA 3F5KA 1MVYA 5E6YA 3AQUA 3QHNA 3ZT6A 3WDHA 1GUVA 4AD4A 2O9TA 4C7DA 3VD5A 2BVDA 4JHOA 4AZCB 4W89A 4MNMA 2YDRA 4DWSA 1Q6DA 1NP0A 3T0DA 3BMWA 1E4IA 3GXFA 1IT0A 1DWIM 2OWXA 2CBUA 3A47A 2EXOA 1KR1A 2PC8A 4UFLA 3W25A 4AIUA 4FF5A 4N42A 4M1RA 1QI5A 1RPKA 1JDCA 1UUQA 3ARUA 2PWGA 3WBAA 4JKMA 4D6JA 4AY1A 4JZ5A 2EPOA 1DTUA 5DFAA 2WHMA 1JD9A 1KQYA 3ZSTA 2DPEA 1OIFA 3TONA 1GOWA 2J79A 1V02E 4AYSA 1UD4A 3IAQA 4TVCA 2D2OA 1EGZA 4AZBA 3IANA 2E9LA 2WMIB 3QHOA 3UCQA 3AZSA 4DWSD 3U57A 2DSWA 2PWFA 2WVUA 4EKJA 3WEMA 4OBSA 2VZVA 1EHNA 3NCOA 1UD2A 3WY1A 5CGMA 4A3YA 3MV11 2Y4SA 4TUFA 3ARWA 3BAKA 3FHAA 4V27A 2J7EA 3I3BA 4KRTA 2BFGA 1EA9C 2HVMA 3L4VA 3CHEA 3THCA 3WD2A 5D4YA 2FDMA 1J12A 2E3ZA 3SCRA 4PMXA 2BNJA 1V3JA 1G9HA 1US3A 3CMGA 1TVNA 2UY5A 3GDBA 5I6SA 2BHUA 2VX4A 1TVPA 2DH2A 3JUGA 3QR3A 3VD3A 3WH7A 3B9AA 4D1JA 3DYOA 1E55A 1X1NA 1GOIA 4W5UA 2XM1A 3OLIA 3NUKA 1HX0A 4UZSA 1GOKA 1NARA 1HIZA 4PUDA 3U5YA 4PEEA 2ZUSA 4X0NA 3THDA 4Z2IA 3AIQA 4HOXA 1W3HA 1HVQA 2WHLA 1HF6A 1Q4NX 1UKQA 2UY2A 4PCSA 1KBBA 4W84A 1DWGM 3MO4A 2W4XA 3GH7A 4N0RA 1AVAA 5A2CA 1E43A 5ABFA 5BXRA 3WD1A 1GOMA 2YL9A 2CITA 4WSJA 4UQ9A 1UWIA 3AYRA 3GTNA 3WH5A 4H8HA 3E1F1 5F7UA 3OLEA 2YL5A 4HU0A 5HNNA 5A6SA 4LYRA 3AMCA 3AXXA 1UR4A 4J3VA 3TTYA 3T2OA 3AISA 5AC4A 2XWEA 4LYQA 5LA2A 1H49A 4WKFA 4TOQA 3T0AA 1CYGA 4XZBA 1V6YA 2VUYA 4B3KA 1Q6GA 1JIBA 3AHTA 4JFUA 2ZUTA 1ODUA 1CZ1A 4UOZA 1JDDA 3ZJ8A 5CQ1A 3VIGA 3BAIA 2PB1A 1B30A 1GQJA 3CH9A 3M7SA 1XV8A 4W87A 4ATLA 5M03A 1KXHA 3D3AA 2QPSA 3VM5A 1F4HA 3CPUA 3PBGA 1VEPA 4AD0A 1ITCA 4S3KA 3L4XA 3EDFA 4XZWA 5GPRA 1UYQA 4OOUA 1NWUA 4H04A 1TZ7A 1GHRA 1HL8A 5IFPA 1C3FA 4W8BA 4FLOA 1DWJM 2JF6A 3D5HA 4M82A 2FHBA 1ZBCA 3SUUA 5JH8A 3VIJA 2YL6A 3BSHA 3HN3A 3VIIA 5A1AA 4CUCA 4JIEA 3WSUA 2WAGA 1R7AA 2W92A 3WD4A 3WF4A 2X2YA 3GXMA 5HPCA 1NOWA 5E0CA 4ML4A 1E70M 1CENA 1HVXA 1E4LA 2WZEA 3I3DA 2ZWZA 4KMQA 1HP5A 2GVYA 1XSIA 2WZIA 1V6XA 4AD1A 2VNCA 7CGTA 2WCGA 2BXZA 3FAWA 2ZIDA 3AIRA 1UKTA 1GJWA 4AZ6A 4GKLA 3WUFA 4Q7NA 4QAWA 3L4UA 3B9EA 4P7RA 3ARRA 3FY1A 5BYWA 4X0VA 4W7UA 5EBAA 5CSUA 1W2VA 2PF0A 1C91A 5GNZA 2WB5A 2YKKA 1TG7A 4ATDA 3UR8A 1KWGA 2MANA 4CKQA 3OBAA 4GXPA 2XVPA 5KZ6A 2VR4A 4XX6A 2YBTA 2C8NA 1HKJA 1QVBA 5HPOA 3WKZA 3OZPA 2ZXDA 1QOXA 4UOQA 2VVNA 1CLXA 4UFMA 4RL3A 4HZ6A 1CEOA 3AHYA 1VFOA 3AMGA 4HOWA 5CLWA 1PZ2A 1EHAA 4WJXA 1OGBA 4JFSA 1C8XA 2WMIA 2FHCA 1UR9A 2OSWA 3WF2A 1UWRA 2VVSA 2WWCA 1OB0A 1E3XA 3VGDA 1V02A 3AMKA 2VRQA 3VIPA 5ABHA 4MAZA 1OM0A 2OWWA 3VMOA 1E1EA 4PCTA 1GNXA 4H8VA 4HOZA 3AZTA 3WNPA 5ABEA 4UFKA 4Z2KA 2F61A 4UOJA 1OCQA 5C71A 1CXEA 4C7FA 2XUCA 4MTVA 1W9DM 1BYBA 3WN6A 4P7QA 5ABGA 1P6WA 4B15A 1VF8A 4GQQA 1EIBA 1FOBA 2GJRA 1KCKA 4HPGA 1MWOA 3ZIZA 5A95A 1V0LA 2VURA 2YIHA 2D3LA 2Z1KA 2D0FA 2WXDM 4FLQA 3WL0A 3VDHA 1UD8A 2NT0A 5BXTA 1FA2A 2WCSA 3K4DA 4J3UA 4W7VA 4ZE5A 2IXUA 4ZE4A 1JZ6A 4GZEA 2BVYA 1UQZA 1JFHA 2WLZA 2A3BA 1M03A 2V3EA 1LWJA 2J7HA 3RO8A 4AIOA 3VDBA 2G8ZA 3B8SA 1B1YA 4TXEA 2E40A 2Y24A 4P8XA 2W91A 3WQ6A 1V03A 3WDQA 4H2CA 1XH1A 1B3YA 3N12A 2CXGA 4MNKA 3ZR6A 1WDRA 2J78A 5IFTA 3PHAA 3B9DA 5BXSA 4GO8A 3OG2A 1LG2A 1OWQA 3WQ8A 2V3GA 5EFDA 1D2KA 5AYIA 1ISXA 1UH2A 3SCTA 7TAAA 3VDAA 2VCAA 1V3LA 1HKIA 2WMFA 2ZXBA 1QNQA 3SUSA 1HJVA 2CBJA 4AWEA 1QI3A 3ZJ6A 3PZ9A 3N18A 1J18A 4WLCA 4F66A 1MW1A 3RJYA 3AS0A 1W3JA 2CETA 2D0GA 1JI1A 5E0FA 2YA1A 1VEOA 4J3SA 4PN2A 1E5JA 3S2CA 1ITXA 1ZJBA 3WL1A 2XGIA 4PMOA 1KWKA 4PMRA 3ZMRA 4M56A 3AS1A 1V08A 4HZ7A 5HXMA 4M80A 3AJ7A 1K9EA 5ECUA 1XH0A 1X6LA 2CEQA 1PBGA 1J0HA 1NWRA 5GNXA 1GPFA 2WMGA 4L4OA 3WMSA 1ISWA 4AISA 2DSVA 3VMNA 1XD0A 2Y8KA 2WC7A 3WEOA 2QMKA 2VX7A 4F9DA 2WVTA 1FFRA 1UA7A 3SUWA 4JKLA 4JFVA 4L4PA 4OBRA 1A3HA 2ZUNA 3S6TA 2WHKA 4UQDA 4MB5A 5DT5A 1H2JA 3ARYA 3U7VA 4CCDA 2D0HA 2A3EA 1L8NA 2DT3A 2WKLA 3AICA 3SCOA 1EDTA 2YLLA 2BXYA 3ZQ9A 3UR7A 1CBGA 1FH9A 1B31A 3NDYA 4HMCA 3MUY1 1ISVA 4DWSC 2Y2WA 2XWDA 4H8UA 1MXGA 3KL3A 5A94A 1E0XA 1UKSA 2G4FA 3AROA 1ZB5A 3IJ7A 3ZO9A 5TD4A 2WCAA 1I75A 1WP6A 1IZKA 1AQHA 1MQQA 2E9MA 5FOOA 1U33A 5D8WA 2WVSA 3FW6A 3EBVA 3G6LA 3UESA 1UH3A 3RJXA 3M46A 1V6WA 5LYRA 3T08A 4RE3A 1UD5A 2J25A 1MXDA 5A8NA 3OB8A 2BY0A 5I3DA 1KR0A 3IAPA 1R85A 1W1VA 2J77A 3UG5A 1WDPA 1JI2A 4JAWA 1E4NA 1K9DA 1OIMA 3VU2A 1MQPA 1UWSA 3NJ3A 1QHZA 2FHFA 1TCMA 3RM9A 5AY7A 4DM2A 2AAAA 1AMYA 2V5CA 1WPCA 5A8PA 1BG9A 5CZKA 3CUGA 1QI4A 2WMKA 1V0NA 2VX5A 3PZGA 2UY4A 5HDRA 1VFFA 4P7NA 3WUGA 3EDKA 4AEFA 4U31A 2WYSA 1CNVA 4QP0A 3CGTA 1H3GA 2DQXA 2JF7A 1HNYA 1UOKA 4W93A 1OGSA 2CPUA 4UQBA 1CWYA 1EQPA 2YA0A 2VJXA 4EANA 2ZXQA 3O2LA 2VL4A 1IZJA 4WIWA 3AZRA 2DT2A 5A69A 3WQVA 3VGHA 4J27A 1CGVA 2O9PA 3W27A 1QNPA 3MUZ1 1GQLA 4PMDA 5M5DA 3WH8A 3AS2A 4B9ZA 3T2QA 2E9BA 1AQMA 3W0KA 5BRPA 3T09A 2PBOA 1OSEA 2XTKA 2VT0A 1HT6A 1C8QA 3SCUA 3CZKA 3NSXA 1SMAA 1EH9A 4UFIA 3K8KA 1CXKA 3LPPA 3ZJKA 5EB8A 1H11A 3QGVA 3QHMA 4F8XA 3BAYA 1WZAA 1FH7A 3A6OA 1UA3A 4LGXA 1WCGA 3AHVA 4X9YA 1K6AA 3WMCA 3W6LA 3WQ5A 2YDQA 2J47A 2ESCA 5EMYA 2X05A 1K9TA 1OD8A 4WKAA 3PZUA 4ZEPA 1JZ5A 2BY2A 2ZXAA 5BROA 4BCEA 2BV9A 3TOPA 2ZOXA 2G41A 1EO5A 4A4AA 1BYAA 1QHPA 4D6DA 1JFXA 1B3VA 3W81A 1H4PA 2CKRA 2VX6A 4HMEA 3OIHA 4CD5A 4CGTA 4PRWA 1JXKA 3T0BA 2VTFA 3WUEA 4AXNA 1BAGA 4MB3A 4JFTA 2J4GA 4W5ZA 1H5VA 5E70A 1GHSA 5AYBA 5CSYA 4E8DA 5C70A 2XYLA 1OBAA 4QCFA 1G0CA 2JIEA 2QMJA 1G94A 1XSJA 4HPHA 5AC5A 2CBIA 3PN8A 2D23A 2XSAA 1S46A 4BQ2A 3M6DA 1V3IA 2XFYA 3UEQA 2WANA 1CGTA 2GSJA 2J75A 1PIGA 1QW8A 4UQAA 1E73M 3BLKA 3RMEA 1VB9A 2C0HA 5CPSA 5I78A 1J01A 1W32A 3CBWA 2BHYA 2VRKA 2WSKA 4UFJA 5FCZA 1D7FA 2WBKA 5CPTA 4AZ7A 3RILA 4Y7EA 1ZBWA 4OIFA 3SCNA 1W1YA 3WQWA 3IJ8A 3ALGA 2GDVA 1E5NA 3ZT5A 4TTGA 1E71M 3SIMA 3RDKA 4QDMA 1JYWA 1PX8A 3MANA 1E3ZA 1BQCA 2CERA 3T2PA 2EO7A 3CZ8A 4F79A 3CHCA 1G01A 2AOSA 1TFVA 3AI0A 4AZHA 4D72A 1WB0A 3ARSA 3O6AA 1UWTA 4IISA 1QPKA 1V3MA 3MUIA 3EMZA 5A6AA 1M53A 2EPKX 3VVGA 7A3HA 4GIAA 3HU7A 1M01A 1GCYA 2NT1A 2GK1B 1E40A 4DUXA 1E0VA 1VRXA 3GNPA 4U3CA 1WNOA 1DEDA 1UWQA 2FGZA 4AD2A 1R7OA 4CD8A 6CGTA 3BH4A 1MQRA 4EAMA 4NSBA 1EOMA 2F2HA 1VJZA 2WNWA 2JALA 3ZOAA 4RE2A 3OGRA 5HBFA 1JL8A 1HJXA 3AXHA 1B3WA 1U2YA 1CXIA 1PAMA 4ZXOA 3AYSA 1E4MM 4JCMA 5I24A 2EJ1A 4PMZA 4AD3A 1VBUA 4AD5A 1JF5A 3W28A 3OGSA 1E1FA 3W53A 1ODZA 4CU7A 4AZGA 3ZR5A 4RE4A 3O9NA 2FH6A 2Y8VA 1XYFA 3WENA 2ZX5A 1NM9A 5E09A 4KGJA 2VMFA 1NOFA 1J0KA 2W66A 4JHZA 3CZGA 1E9LA 2D1ZA 4A3HA 4MADA 2OLHA 1LF1A 1Q6EA 3PZVA 4R27A 5C8BB 5BRQA 3OLGA 2VR5A 4AMCA 3WFLA 2XJ7A 1JZ8A 5BWFA 1E15A 4M8UA 1LLOA 4D1IA 1H41A 1PZ3A 2VZOA 1SR0A 1DP0A 2VZUA 4UFHA 5EFFA 2GJPA 2WZHA 3LPGA 3BMVA 4M24A 2WMHA 1OT2A 1VIWA 1U30A 4Q22A 2E8YA 3VO0A 1EXPA 4PSRA 1PPIA 3VD4A 1C7SA 5JIPA 4KWUA 4NF7A 2WM0A 1J0YA 4QLJA 5IDIA 3MS8A 3FN9A 3CZJA 3FHQA 1WO2A 2GJXB 3KL0A 4LYPA 3RM4A 2FGLA 1KGWA 5IHRA 2BY3A 2RGMA 4LX4A 2IUZA 2DT1A 1M7XA 2DIEA 2XFFA 2J74A 1JF6A 2DSUA 2XSBA 4CD4A 2ZWYA 1US2A 1TR1A 4PTWA 4TVUA 3KL5A 4C7GA 3QOKA 3CZEA 2WSPA 2G3NA 2PWDA 3APGA 1ZS2A 4P7LA 3I3EA 3A4XA 3TP4A 4YN5A 1ZBVA 1B3ZA 4TX8A 3N15A 2WVVB 2DT0A 4TX6A 3ZJ7A 2UWFA 1HJQA 1SFSA 2WPGA 4U2YA 1E72M 1BGAA 2PWHA 3K4AA 3CUIA 4AC1X 1QW9A 4E2OA 1XCXA 2QLYA 3NYDA 2NW0A 4V2XA 3WDRA 3ALFA 3VX1A 2ZICA 3VNZA 4HA1A 4AIEA 1XD1A 1ZU8A 3WF1A 3MSDA 1HKKA 1FFQA 1JG9A 4H7VA 2XFRA 3OLDA 4LQ1A 5JIWA 1WAWA 2BS9A 4UTFA 1AQ0A 2EPLX 4GO9A 1QBAA 1BFNA 4XB3A 6TAAA 1LL4A 2O92A 4PMYA 4UQEA 1BYDA 2B31A 1XYZA 3W6MA 3AHZA 1UR0A 4JCLA 3GXIA 4J28A 2EQDA 3CHFA 4CU8A 2V3FA 3OZOA 4P8VA 1C93A 1M04A 2CCRA 1KXQA 1EO7A 1JYXA 2VOTA 4B16A 4PTVA 2PI6A 3WEZA 4NRRA 3WDPP 2X09A 3MMWA 1KGUA 3RIKA 1ECEA 4MDOA 2CBVA 3BCFA 1GJUA 4D6FA 5LA1A 1GW1A 3PTMA 4E4PA 1UG6A 2VC9A 1VEMA 3M07A 3FXYA 1H0GA 3ARTA 2J7CA 4U3AA 3OGVA 4GI9A 4H41A 5E6ZA 4QLKA 5JBEA 1HN1A 2J62A 1K9FA 4EE9A 2FH8A 3GBDA 3CIVA 1XSKA 2VCBA 2C7FA 2GK1A 2UY3A 2OSYA 3WUBA 4IM4A 1EDQA 2WBGA 2J8FA 3L2LA 1W91A 1CGXA 3EDJA 2A3AA 5LA0A 2V38A 4TVDA 1YHTA 3WD3A 2OSXA 2VZTA 4M81A 3EMCA 5CJ5A 3TA9A 4P7OA 5D9PA 2V5DA 3WNMA 1C90A 3WELA 1OT1A 5BCAA 1DWFM 4ZXLA 4R5EA 3IJ9A 3VIOA 4GI6A 1OGGA 3AIEA 1FHDA 4UCFA 1V3KA 3SEPA 1WDQA 1UZ4A 2X0YA 3VUPA 5I2UA 2OWCA 3AOFA 1R86A 3F4VA 2GFTA 3ZT7A 4Z2HA 2X8RA 4BQ4A 3WF3A 1ZL1A 2XIIA 1XRVA 3VD7A 3PZMA 1G1YA 1W9BM 3MSGA 4IPLA 1W1TA 2XG9A 4ACZB 2WW5A 3BAJA 1JNDA 1SMDA 1E6NA 4P8UA 1JZ7A 5D8ZA 4B9YA 3DYPA 3UETA 1MW2A 1UKPA 3PZOA 3HMCA 4XUYA 1E0WA 4KH2A 4HU8A 3SUTA 5CPQA 4KRUA 3VILA 3ZM8A 3BAWA 1E6PA 3CUFA 4U5IA 4PTMA 1J0JA 1NH6A 1V6UA 3VD9A 1ZBKA 3ARZA 1MFVA 1J0IA 4NI3A 2EPNA 1GQKA 3AXIA 5A6BA 1E56A 1VFMA 4ACYA 3SURA 5IXEA 4OUEA 3PZQA 1UWUA 1B2YA 3ZSSA 3VOCA 4CU6A 5E9AA 3U5UA 1CGWA 2CIPA 3UERA 2G3JA 2BHZA 3AMDA 2GJXA 1ZJAA 3LMYA 5A6MA 1CXLA 3QOMA 2YJQA 1BSIA 1GQIA 2JEQA 3N11A 3RPMA 2OYLA 1LJYA 1O6IA 2W61A 2ZX7A 1A47A 1KXVA 1KGXA 2QPUA 1FH8A 1BTCA 4KGLA 3MMUA 1JD7A 1GORA 3FAXA 1CXHA 3EYPA 1UKOA 4QFUA 3ARVA 1BVZA 5A6BD 2WVVA 4AZ5A 1UD3A 2X1IA 1V0KA 3OA5A 2QHAA 3CZLA 3L2MA 3K1DA 3K8MA 2YLAA 4E8CA 4V28A 3VIMA 2GUYA 1WZMA 1W2PA 2Q8XA 4GINA 2ZUUA 2A3HA 3WH9A 2F8QA 3VIHA 3AIWA 1WDSA 5A6LA 4QCEA 3CHDA 1NQ6A 5I0DA 2ZX6A 1W9PA 4JFWA 1H1NA 2AMGA 4W86A 3TTQA 3WNLA 4EK7A 3EMQA 1JNEA 2D3NA 3WNKA 3SCSA 3W24A 1PJ9A 3WMBA 3POHA 2JE8A 2DDXA 1WZLA 3VGFA 5GQBA 3ECQA 3AMLA 1XGZA 3EDDA 3PZTA 3CMJA 3WNOA 1L0PA 2DIJA 5CXPA 1LWHA 4PTXA 3BAXA 4MAVA 3AS3A 3DHPA 1FP8A 1NOUA 2ZUWA 3CTTA 3N17A 3KZSA 1PIFA 4MDPA 1V3HA 3RM8A 5A8OA 1KQZA 1CIUA 4BS0A 3U7BA 4BF7A 3MV01 1LQ0A 1GOQA 3W38A 5FIPA 4GQRA 3MMDA 1KFWA 2Y5EA 3POCA 4J7RA 1BHGA 1HP4A 1HL9A 3II1A 1TUXA 2X0HA 1QNSA 5JBFA 2XVLA 4PMVA 1UD6A 5D9OA 1W3KA 1E6RA 5A8QA 5A3HA 3CLWA 3VGBA 4BZYA 2W63A 4BQ5A 1BLIA 1E6SM 3WH6A 1OD0A 3N9KA 4GI8A 1NWSA 1OINA 1R87A 1QNOA 2J8GA 3MU7A 1HKMA 1CLVA 4HA3A 1HXJA 4WKHA 1Q6CA 2XGBA 2ZX9A 2VQUA 2E8ZA 4OJYA 2DGAA 3L4ZA 4P8WA 1TA3B 3GZAA 2W67A 1BYCA 1ISZA 3LPFA 1FP9A 3ARPA 1CXFA 4FLSA 2CNCA 4FMVA 4U2ZA 3PZIA 4PMUA 4NRSA 1W3LA 4PMQA 2CHOA 4U5KA 3PTKA 4HMDA 2DEPA 2E4TA 2CHNA 3AIBA 3AIVA 1JYNA 2YL8A 5FKYA 1MW3A 5A6JA 3L4WA 1CPUA 1DWHM 1MYRA 2D20A 3AIUA 3DYMA 2W5FA 1LG1A 4ACZA 3BC9A 3FNDA 3WQ4A 1Y7VA 1NWTA 3BLPX 9CGTA 1GONA 2IXVA 3AHXA 3SCVA 2BY1A 3W82A 1JDAA 4CCCA 1Z32X 1UHVA 1VFUA 4W85A 1MFUA 3A4AA 4NZCA 3VX0A 2WK2A 2QV4A 1J0ZA 4ZENA 5A8MA 4YHGA 1XCWA 1V0MA 2O9RA 1UZ1A 3J7HA 4M29A 4YHEA 4MJ2A 4LPCA 1KXTA 5CG0A 1ESWA 1KBKA 2J7GA 1VBRA 5FL1A 5I79A 4AEEA 2WMJA 3NSNA 2XIBA 5JUVA 4WK9A 4W8LA 1CTNA 5KEZA 4Z2JA 4ATWA 4CVUA 3WNNA 3TTSA 1D3CA 2A3CA 3GM8A 4GZIA 5FL0A 3MUAA 1X6NA 3VM7A 2WHJA 1DHKA 1QI2A 5GNYA 4CN4A 4MPKA 4BQ3A 1JZ3A 8CGTA 2WC3A 2WLYA 5HOSA 4AZCA 3CO4A 1F4AA 4W7WA 2ZUVA 1J9YA 2CESA 1SYTA 5A2AA 4LXFA 3TTOA 1RD6A 2YOCA 1IV8A 3N04A 1CGUA 1PX4A 1E6QM 2G3MA 5DMYA 1Q6FA 4WSKA 4PBGA 4D6CA 1B0IA 4HZ8A 3VIKA 4GPNA 1LL6A 3WFZA 3NSMA 2DSKA 1I1XA 3KEHA 2XHYA 2XVNA 3BGAA 8A3HA 3MKKA 1ISYA 4J3WA 1WKYA 1RP8A 1B90A 3UG4A 3L4YA 3VNYA 1C7TA 1G5AA 3KE0A 2J7FA 3CUJA 4UNIA 4PUEA 2ZUMA 4PYSA 2XM2A 2J7DA 4YPJA 3GH5A 3F5LA 2VI0A 1GVIA 2VRJA 3L4TA 2YA2A 3A3HA 4MJ4A 3WDJA 2WWDA 1BGGA 4D6GA 5BXPA 1E6ZA 3GXDA 3GH4A 1RP9A 2YDSA 3PZNA 4URIA 4DWSB 4GZJA 5D9NA 3WBEA 3VGGA 1HJWA 1R8LA 4OOZA 3WF0A 3ARXA 2QF8A 5A2BA 3EDEA 5DEZA 1JGIA 1VJSA 1TMQA 1QNRA 1PX3A 4DUVA 2O9OA 4CVWA 3VKKA 1CECA 2JIWA 3N13A 3HJEA 5I77A 4BA0A 5A6KA 1J11A 1EOKA 3F5JA 2NSXA 4JKKA 3GNOA 3W4RA 1JZ2A 1MW0A 4CN6A 2G3IA 1EQCA 3GBEA 3A4WA 4MB4A 3GYCA 1YQ2A 4HA4A 4AW7A 1E6XM 3W29A 1QI0A 3VGEA 2D22A 1JAKA 4IPNB 1JZ4A 4J3TA 1TE1A 4D6IA 5CLTA 4XV0A 1NP2A 6A3HA 2OYKA 2ZE0A 1LL7A 2CYGA 1N82A 1W9VA 3RCNA 4CD7A 5IHSA 4CN1A 1QHOA 3LPOA 1KCLA 3VIFA 3WIJA 3PTQA 3ARQA 1H09A 4J3XA 1GOOA 2XVGA 2YBUA 1TA3A 1XC6A 2Z1SA 2DH3A 2E0PA 1W9UA 1O7AA 4JL2A 1UR1A 4Z2LA 3CUHA 5M17A 3W37A 2JEPA 2J7BA 2EBNA 5M3WA 2VCCA 4PMNA 2ZX8A 1HJSA 3KWXA 5DT7A 4B3LA 3BSGA 4F9JA 5DO8A 4UQCA 1UQYA 3GNRA 1WZKA 3UG3A 1CGYA 2BVTA 2EPMX 1J10A 3VDCA 4W88A 1C8YA 3N1AA 1CDGA 5I23A 2JFEX 1BG4A 2W62A 1QBBA 1FHLA 2PBGA 5ABFB 1GZJA 4Z2GA 3DC0A 3AFBA 4ZFMA 3VTRA 3WDIA 2WC4A 4W8AA 4DM1A 2WKGA 4WF7A 2XVKA 5D9MA 1BF2A 3SCPA 1GVYA 3VINA 4HTYA 1C92A 2GDUA 1VENA 2HISA 3VMPA 3WD0A 4MB1A 4OKDA 5CGTA 1JXJA 1I1WA 4FK9A 2VQTA 4MNLA 3SUVA 3SCWA 1BPLB 2EEXA 1UR8A 5DF0A 3BXWA 3BCDA 1B3XA 1WE5A 3W26A 1W9XA 4CD6A 2VO5A 1XHGA 2CKSA 4FLRA 4IUGA 1JAEA 1JYVA 1VAHA 1RH9A 2V3DA 1BVNP 3IK2A 1UH4A 3G6MA 2RGLA 4OZOA 2XPKA 2OYMA 3SCQA 1B9ZA 2D24A 5JBDA 1HJUA 4JL1A 4MNJA 4HP5A 1UR2A 3DECA 4D6HA 1KB3A 4QLLA 3DHUA 4S3JA 1DWAM 1XH2A
chains in the Genus database with same CATH superfamily
1V7YA 4LS2A 2VZSA 3IUHA 3O15A 4D71A 5I5RA 2B7PA 2RUSA 3NIYA 3FYOA 3O1NA 2IQ0A 4OBTA 3C8FA 1T7LA 3G1FA 2PDJA 3N2CA 1NY1A 4Q4KA 3TAKA 2HCVA 3GFXA 1HFBA 2O9TA 2E6FA 3VD5A 3C2RA 4JHOA 4AZCB 3LBMA 4O19A 1EWDA 3E5BA 3R5EA 1NP0A 4RDZA 2TSYA 4GFIA 3BLEA 1RALA 1F76A 1IT0A 5K4XA 2BZNA 1QOPA 1OFOA 4DZ3A 4JQ3A 1KR1A 1OJXA 4GA8A 4GYPA 3DI0A 5KZDA 4AIUA 3H21A 1D9EA 2ZYFA 1QI5A 1RPKA 1JDCA 3BO9A 1UUQA 4FX7A 4F4RA 3ARUA 4JKMA 4AY1A 4FXFA 4JZ5A 3VNIA 1L1PA 2ZR5A 1RQEA 3O6DA 1I2NA 3L0GA 3F4CA 3PJXA 4XQ6A 5T9BG 3TONA 4JYFA 1GOWA 1KA9F 4AYSA 1A7XA 1UD4A 1FXQA 1JDEA 3SQSA 5D37A 2WMIB 4IIHA 4HPJA 3QHOA 2DSWA 4HBEA 1UIPA 4IJRA 2VZVA 3VCCA 3MW7A 1ME9A 5CGMA 2IKJA 4NP7A 4KRTA 4N7QA 2HVMA 2PRMA 3H2AA 3VNJA 1JCXA 3CHEA 1RHCA 3H2OA 3DHDA 5CSSA 4L56A 5F2MA 5BOOA 3B4UA 3VXGA 2XIJA 1W17A 2OEKA 5HJYA 1F9CA 4F2UA 1AJZA 5CJNA 2X2GA 3BANA 1TVNA 1DE6A 3NXLA 2O7SA 2DZPA 3G77A 3UFYA 1TVPA 3QLDA 2VFGA 3WH7A 3FXGA 3B9AA 2QAFA 4KERA 4DXVA 2XM1A 3OLIA 3IWPA 5HW6A 1GOKA 2X1TA 1K4GA 3KAIA 1EF2A 1FKGA 3LHWA 4M6QA 1EYMA 2FVLA 4LAWA 3S4TA 5CGQA 1KBLA 1UKQA 3WJWA 1YEYA 3PB2A 4W84A 1ZPTA 1KFLA 2C19A 4N0RA 3O5OA 4L6OA 1P6BA 5HQLA 2Q01A 3H22A 4H8HA 1ROUA 3WFAA 3AXXA 4XAGA 4I5UA 4RNIA 4WY0A 4J3VA 3TV8A 2VWTA 5DMMA 2XWEA 3GG0A 5CZTA 3MZ2A 1N8WA 2PRHA 1O68A 3A64A 4K1GA 4XIAA 5CKSA 4GI4A 2RJHA 3AHTA 2OOFA 3FJ4A 1R38A 2JKEA 3B9OA 2ACRA 3ZJ8A 3WBWA 2P8BA 4NYYA 1T0OA 2HE5A 5IBXC 2PUZA 1BKFA 1GQJA 3CH9A 4JFKA 1JUEA 3W6YA 1U22A 4JTTA 4ATLA 2P53A 2PGRA 1XLFA 1WQ5A 3VM5A 1F4HA 3CPUA 1LTDA 1ZQ5A 3KBNA 1JRCA 1W56A 3U4AA 1VEPA 1NELA 4AD0A 3W76A 3L4XA 1XWYA 5GPRA 2IKGA 2WZTA 4OOUA 4IXHA 2VDHA 4H9TA 4HU3A 3R10A 2JF6A 3D5HA 2ODOA 4M82A 4KQNA 3ZVHA 5HA7A 3QW3A 5JH8A 1WDWA 1MUMA 5FA5A 2HROA 2YL6A 3VIIA 1YE4A 4JIEA 3WSUA 2WAGA 2DV0A 1UMYA 1UP3A 1N55A 3GR8A 1CENA 2PF8A 3NO3A 2DZVA 4ZL1A 3W22A 1HP5A 3TR9A 2WZIA 4M7TA 3W02A 4AZ6A 4GKLA 4Q7NA 1NMWA 3B8UA 4TV5A 4P7RA 1ZCNA 1T40A 3LCGA 3FY1A 1XIHA 5BYWA 1YLVA 3KOXA 1ZALA 5CEWA 3NZ1A 5EBAA 3P67A 3FJNA 1C91A 4QQ3A 2KAUC 1Y0EA 1TG7A 4ATDA 3NZRA 3PPGA 2MANA 1PDZA 3PRBA 4CKQA 3OBAA 4CLMA 5HMFA 2VR4A 2C8NA 3FK4A 1XBXA 5HPOA 1QOXA 3UQIA 4OTKA 1KM0A 2FZNA 2VVNA 2WV8A 2Z24A 1EBHA 3G1DA 5C55A 1CEOA 3HO8A 5C54A 3RG6A 1L9WA 3BE7A 1Q3NA 8TIMA 4WJXA 2ZR4A 1OGBA 4CQBA 2NQ5A 1W1A1 4PTNA 1OB0A 1E3XA 2Y0FA 1X97A 4GJIA 1EJRC 3W1AA 3AMKA 2VRQA 3VA8A 2TODA 2OWWA 4H8VA 4GWEA 7ODCA 3WNPA 3GY1A 1YTDA 3N29A 2M08A 4Y9PA 4MTVA 3CV2A 4LSBA 2GQAA 3WN6A 2Y5JA 1P6WA 4B15A 3FIGA 3HPSA 3S1GA 1ZY9A 3F2CA 1DORA 1YDVA 2GYIA 1R2TA 1AA1B 2D0FA 3PVFA 4AHPA 4KFPA 3QMRA 4H9UA 5C9RA 5BXTA 2DZTA 3NZQA 4ZE5A 3K4DA 3HGRA 4W7VA 1HUVA 3SZ8A 1TZZA 3V0SA 4ZE4A 1JZ6A 4GZEA 2BVYA 4M7SA 4H7ZA 3ZR4A 3TDFA 2CU0A 1M03A 5DMLA 1LWJA 4ERIA 1IQ8A 4DPQA 2J7HA 3MMTA 3NQDA 4Q4SA 3GUWA 2QCGA 2G8ZA 1B1YA 4CQ8A 3K4WA 3RXZA 3WQ6A 1V03A 3N12A 4MNKA 1LG2A 8RUCA 4U85A 1ISXA 3GDLA 3VDAA 4W4QA 1AH0A 1HKIA 3A5FA 2UBPC 2XH2A 3GFYA 1UUMA 1QTWA 3PZ9A 3N18A 1J18A 2DZUA 4WLCA 4J1OA 3M5VA 1YADA 3JZUA 1KD0A 2D0GA 4J3SA 1E5JA 3WLSA 4AHOA 1DQWA 5I09A 1YNPA 2OQLA 2XH4A 3FDKA 3S2CA 5LHEA 1ZJBA 3WL1A 1LUCB 1PVNA 2QCNA 2XN2A 3CYJA 3WYZA 4IFKA 1TPB1 4E2DA 2F2DA 2QVNA 1V08A 1K9EA 3HV9A 5ECUA 1XH0A 4ZPVR 2ACUA 3GD6A 4B5WA 4ADUA 5HNRA 4LRTA 3EWDA 5GNXA 2AGKA 2E6DA 3O63A 4GNJA 3RR1A 3CAQA 4ZFCA 1GPFA 3O5IA 1I2RA 2WMGA 1ISWA 2PDYA 4M6PA 1XD0A 3L9CA 5MHBA 3UI6A 2WC7A 5T91A 1Q7ZA 2NQZA 2VX7A 1FFRA 1KBIA 4TIMA 4JFVA 4L4PA 1QR7A 4X2PA 1XIFA 1GOXA 1FKLA 3R8HA 5HWMA 1HKVA 5DT5A 3ARYA 4CCDA 3O06A 4IP5A 3TW6A 2WKLA 3Q58A 2VC7A 3SCOA 3C4UA 4H00A 4E8GA 1HO1A 1EDTA 1H1YA 3ZQ9A 1SUXA 1CBGA 4IMFA 5F2LA 4F2TA 4LAYA 3ZLHA 3ZYZA 1S2CA 5FF7A 1VD6A 4EPDC 4DWSC 3ERPA 1MXGA 1A3XA 1VS1A 3TZNA 1PSCA 1IZKA 2E9MA 1P7TB 5D8WA 4E4FA 3T0TA 3VDGA 3LRMA 4F0MA 2YCJA 1Q8AA 1V6WA 5IOBA 1UD5A 3W2JA 4AWTA 4R0XA 2OGJA 2BY0A 4GNKB 4C6DA 3TYDA 6ENLA 4I8YA 3LGEA 4E4UA 4HSHA 3PJWA 1R85A 1XLLA 1RLDA 5F2IA 1TQJA 2BP1A 4RXFA 2YGYA 2HS6A 1K9DA 1OIMA 3VU2A 3BVJA 3GTXA 4QIUA 1UWSA 4C6PA 3KCEA 1QHZA 3DENA 3WBXA 2Z2BA 3GIYA 3PWIA 2Z26A 1UZDA 4LAZA 5CZKA 2WMKA 2Y7EA 3UT0A 1VYRA 3PZGA 5HDRA 3V1PA 2OZ0A 4P7NA 2VGIA 4A6GA 4R9OA 3TFXA 3W1TA 4AEFA 2CLKA 2WYSA 4ZOAA 2DQXA 4HYVA 1OGSA 2CPUA 3CHVA 1F8IA 1EQPA 4LNYA 2VXNA 3BV7A 3LN3A 1TQXA 5EBUA 2EKCA 3IPWA 1IZJA 2DT2A 2YXXA 5A69A 2PE4A 2FKPA 3PG8A 3WQVA 2VFHA 3VGHA 4MOZA 3W27A 3MUZ1 4M1BA 4IQ2A 1Z3NA 3LCIA 4YL2A 3AS2A 3EXRA 4B9ZA 2ONEA 3I6TA 1AQMA 2ZZ1A 2VT0A 1EYWA 4O1FA 3PBVA 1SW3A 3TXVA 4QJ3B 4UFIA 1CXKA 3LPPA 2PZ0A 3WBYA 5EB8A 3QGVA 4F8XA 4Y8EA 4IL0A 3BAYA 1AFSA 2YYTA 1G67A 2B7OA 3DBNA 4OV4A 2E1DA 2VDGA 1K6AA 3WMCA 4RZBA 1AW5A 4A3QA 2DZSA 2J47A 4L4LA 1PDYA 5EMYA 4HCDA 4ONVA 4ZEPA 1JZ5A 2BY2A 3TN3A 3XINA 3PSWA 1J6PA 2BV9A 3U3HA 3E9AA 1EO5A 1PS9A 5M1TA 2QPXA 4DZAA 3AO0A 4ZB0A 2CKRA 1IF2A 2OELA 4PRWA 3T0BA 4MB3A 4JFTA 2J4GA 3EOSA 1RLCL 4CNUA 1S5MA 1VLIA 2WOQA 2GUBA 1G0CA 1PTAA 4HHHA 2JIEA 2OEMA 3WLLA 1M7PA 3CUXA 4HPHA 3PN8A 2D23A 1YYAA 2XSAA 4H7CA 1KFJA 3UEQA 4AVOA 1Q6UA 4HJFA 2J75A 4RLIA 1PIGA 3O7UA 3CAKA 5F1VA 3ORWA 3FS2A 4UTIA 1DQXA 3IGSA 2VRKA 5FCZA 3TQ0A 2WBKA 5CPTA 4QT3A 4OIFA 3FKKA 1K7XA 3SCNA 4FN2A 1P48A 2YB4A 3SY5A 1OG0A 3N6HA 1XLMA 5LKYA 1E3ZA 2HNEA 5LNWA 1BQCA 3GWQA 3GHRA 3CZ8A 3CHCA 1C29A 5G4HC 3RYSA 3AI0A 4Q4RA 3MBDA 3GRIA 3AC0A 4KW2A 5DRCA 1S5WA 4G2DA 1B6CA 4DJDC 1M01A 1GCYA 2RQSA 1E40A 3GNPA 1RJQA 4J5NA 3BH4A 1RSCA 1EOMA 4HK6A 2ZZ6A 4QG8A 1VJZA 2WNWA 2JALA 3WQPA 3OVQA 4MZYA 1HJXA 1B3WA 1U2YA 3DG6A 3EOOA 1VRDA 3T6CA 1KT0A 1A0DA 1KO0A 2X7WA 4UTLA 2AKMA 4JTQA 4RE4A 3MSRA 3O9NA 3C5QA 4KWWA 2FH6A 2Y8VA 2PGFA 3DFNA 1QK2A 2WQDA 3N9SA 4JHZA 1X8FA 3OYXA 2PDBA 4HARA 2CLLA 2D1ZA 4DB7A 3KBWA 4GY1A 2VR5A 1UZHA 1E15A 1EF3A 4D1IA 2VZOA 3E6EA 1DP0A 2OJPA 1KKRA 1FCBA 1XYBA 2POTA 4UFHA 4ODMA 2WZHA 4O1AA 4AAJA 5G5IA 3R6IA 1OT2A 1VIWA 3LCHA 1L6GA 3LTSA 1VC4A 4PSRA 2RH9A 4KWUA 2WM0A 3U48A 1PTDA 2E6YA 3N3MA 1LRTA 2P4VA 3FHQA 4A35A 4RCXA 3RM4A 4H4IA 3KBJA 4LX4A 3HTWA 2IUZA 3QR1A 4BK9A 1M7XA 1OYAA 3FV9A 4GMEA 1VFLA 2DSUA 1B54A 2PD5A 3CL6A 2ZWYA 1J8VA 4AYGA 3KL5A 3QOKA 1Q6RA 3LSCA 3AWOA 3VOFA 3R13A 3SI9A 1VP5A 1OF6A 1IEIA 3Q45A 4P7LA 4S3FA 5CZSA 1YMYA 4B5SA 4AX7A 2G3FA 1ZBVA 3UWZA 3G3MA 4TX8A 3C0QA 4LBSA 3GXPA 5I7GA 2WPGA 3CV6A 4LTSA 1GVRA 3LHTA 4WDTA 5I00A 2YCIX 3QZAA 3W2KA 3EB4A 1FDYA 3HQNA 4E2OA 2NW0A 4KCTA 3WDRA 3VNZA 2I5IA 4K37A 3WF1A 1NFPA 1HKKA 4H7VA 1T5AA 1AQ0A 1SSDA 1OVDA 4XB3A 1LL4A 2O92A 4JYSA 2B31A 3T07A 3ITXA 4J28A 1ZK6A 4H9XA 2PRLA 3UXLA 4S2CA 1H5YA 2V3FA 1UW9A 1LBLA 4ODRA 2CCRA 1KXQA 1JYXA 2VOTA 3OZYA 3AU6A 3O8AA 3SRDA 3U2ZA 4NJJA 5IDZA 1S1RA 1KGUA 3LLDA 1GJUA 1Z7AA 4C60A 4TNSA 1UG6A 3QF0A 4LBUA 4JOMA 5B8IC 1H0GA 2PEVA 4GYJA 3H12A 3W85A 4PEKA 3OGVA 3BG9A 4Q8TA 3S2JA 4K36A 3M9YA 4G7EA 5HMSA 3V5CA 3TDBA 1HN1A 5HJLA 2R1MA 2P0IA 2V5KA 1REQB 1QWGA 4FXSA 1XSKA 5AFDA 3QGKC 2C7FA 2GK1A 2WBGA 1D7KA 2C91A 4HCHA 3CQIA 4LB3A 4C6OA 3DESA 3S5SA 1KRCC 2K8IA 1ZFJA 2V38A 3BARA 1DIEA 1TIWA 1SGJA 1GKQA 4OECA 5HJXA 1QJWA 3LS9A 1OGGA 1IT7A 2KO7A 2RHGA 2Y88A 1V3KA 3M5ZA 3LERA 4PL1A 1WDQA 4NNRA 2QNEA 4YTRA 1AJ0A 3M5XA 3LMZA 3ELFA 3F4VA 4LVBA 3ZT7A 3INPA 2F6XA 4HK5A 3WF3A 2XIIA 1RAKA 3QV9A 1OX4B 1CLKA 3TJ4A 5PTDA 3PZMA 3S47A 1S38A 2XG9A 3WQEA 1JNDA 1ZENA 1QUMA 1XS2A 1JZ7A 3H24A 4MSPA 3UETA 1Q85A 4L4MA 3WLOA 1TJPA 4XUYA 1AL7A 4HU8A 3IGHX 4KRUA 2H8XA 3BAWA 5CC7A 1MO0A 3BMBA 3ZWTA 4C6CA 4PTMA 4KESA 4HYWA 1GVFA 1DHPA 3VD9A 2OB3A 1T6MA 4A8IA 1TMHA 4IMAA 2JZVA 1VFMA 2IMRA 4REQA 3UW6A 3E38A 3W2UA 4JN7A 3CTLA 3NG3A 4ZBCA 1UWAA 4CU6A 1FTXA 5E9AA 3U5UA 4XVDA 1CGWA 3KM8A 4HJWA 3ATZA 1J4IA 4WD0A 5A8GA 2GJXA 5DMNA 1ZJAA 3P82A 2E6AA 1BSIA 1DYSA 2V5BA 3REQB 5D38A 3RPMA 4IT6A 2OYLA 4LVDA 1NEYA 4XG1A 1KGXA 3LU2A 1XUUA 3G1AA 4L6HA 1BTCA 4IP7A 4KGLA 5D2VA 4U84A 3I7RA 3EXSA 1UKOA 2ZRYA 4JTLA 3RO6A 3W7PA 5A6BD 3R79A 1UD3A 2X1IA 4NT0A 1X1ZA 4PBFA 1ZJHA 3NWRA 1GRJA 3K8MA 2FIQA 3P0WA 1OYBA 4E8CA 3W7RA 2GUYA 3W1XA 2Q8XA 4X61A 5LGZA 2F8QA 1KM6A 3AIWA 2I16A 1WDSA 2OODA 3IGUA 1Q8JA 1NQ6A 5I0DA 5DY2A 1H1NA 2AMGA 1QT1A 3WNLA 3EMQA 3F7JA 2DZBA 5FF0A 3WNKA 1FDZA 3L2IA 3SCSA 3W24A 3WMBA 5DXYA 3C56A 4O4WA 5J5DA 4ICMA 1WZLA 4XD4A 5GQBA 3AMLA 1XGZA 3EDDA 3CMJA 2OQYA 3MBFA 3CIXA 3G18A 3NDOA 2OU4A 3KTXA 3M5YA 3BAXA 3SADA 2ZUWA 3O16A 4GABA 1G7UA 2LJ4A 2BGSA 3RM8A 1B3OA 3WJZA 1QMLA 3LTYA 2G95A 2LPVA 1LQ0A 5FIPA 1SW7A 3POCA 4DO7A 3TQVA 5E0KA 2G97A 1W3KA 1FHUA 1E6RA 3LYEA 3UZYA 3TW9A 3CLWA 3VAWA 4QNWA 4JFJA 3W1RA 2INFA 1E6SM 3WH6A 1P43A 1OD0A 1NWSA 2GLKA 2VEKA 1WAUA 1QNOA 1FKSA 2YCLA 3MU7A 4PUNA 1CLVA 3TCSA 1HXJA 3KLKA 1Q6CA 2EULA 2XGBA 4EPKA 4XTIA 2VQUA 2RDUA 2I5QA 1EBGA 2VDIA 1Z6KA 2GDQA 4B5VA 1IE7C 1U83A 2A1YA 2PGWA 5J04A 1B5TA 3DZ1A 2DJLA 1TPFA 1BYCA 1ISZA 1L6FA 3PZIA 4PMUA 3SM0A 2TMDA 4UTWA 2CHOA 2RUDA 3UXKA 1RJRA 4LAUA 4ZOEA 4DUOA 3AIVA 1X39A 5U4NA 1S3TC 2EJAA 1IT8A 3EWXA 4G50A 4I6VA 1D8CA 3KRSA 3TC5A 1XPYA 4Y2WA 4YVPA 1MEIA 1LG1A 1F8AB 3BC9A 4WRHA 3GU9A 1R3WA 1J79A 2Z27A 3AHXA 3SCVA 1S5NA 4GK8A 1GQNA 3UJFA 4CCCA 1Z32X 4MLJA 2ZZ5A 1VFUA 3A4AA 1J4HA 4NZCA 2WK2A 1J0ZA 4NQ1A 1FX6A 4ZENA 1N7KA 3DGRA 1XCWA 4ORIA 2GVEA 2QULA 5IRPA 1UZ1A 5EMKA 4AF0B 3E2RA 4MJ2A 3QZ6A 4GH3A 5CG0A 1KBKA 2G50A 2PTXA 5I79A 3LRLA 4AEEA 1OK4A 2NUYA 1CTNA 2ZRZA 3MUXA 4IMCA 4Z1AA 1DJHA 4EPBC 3WNNA 3FGCA 2DVUA 4C5YA 3TTSA 1D3CA 3EB2A 3ES8A 2A3CA 3A21A 1U79A 1Q2RA 3SBFA 1W0MA 3ZZ1A 3O5RA 4QE4A 3TLQA 2WHJA 1DHKA 1QPQA 5GNYA 1VQTA 8CGTA 2WC3A 1TPVA 5HOSA 5FF4A 5D2WA 4GIYA 3SW6A 1I0DA 2ZUVA 1FCQA 1SYTA 1AD4A 1IV8A 2PPOA 1PX4A 4JX4A 1E6QM 2G3MA 4WSKA 2PLKA 3UF8A 1I1XA 2DSKA 2XHYA 3MB9A 1DXEA 2QCEA 3MKKA 4JN8A 2NQLA 4G8TA 1B90A 5AHFA 2VC6A 4NVTA 3CUJA 4FNTA 4N9BA 3S5YA 4DYEA 3UVIA 3G0XA 2Z2UA 4EXQA 1FVPA 3F5LA 3HB9A 4GACA 3H4XA 2PV3A 4MWAA 1PV8A 1YDYA 3B04A 2WWDA 1JVNA 3CB8A 2EG6A 2H6RA 3GH4A 5EPDA 1AL8A 3ES7A 3EEZA 3PZNA 2G0WA 4DWSB 4GZJA 1YXCA 4MKVA 4NJIA 4H8NA 2QF8A 3EA3A 4J35A 1VJSA 3KTSA 1QK0A 1TMQA 3NURA 1QNRA 4GIVA 3EWUA 3H6OA 4CVWA 1FKBA 2ISDA 3M7WA 3VKKA 1QPLA 3N13A 1H7NA 2ACQA 2B5UB 5A6KA 2HNHA 1EOKA 2NSXA 4L9YA 3BQ5A 2G3IA 3KBSA 4R3UA 4DZ2A 3KHDA 4D8AA 3OTRA 4HB7A 2J13A 3GYCA 4XZIA 1R3QA 3CIWA 3VGEA 3D46A 2D22A 4WR3A 1JAKA 3R2GA 4RZ4A 5F4WA 2DY3A 4L65A 2PDGA 4J3TA 1TE1A 1QDSA 3MDUA 4HPXA 1NAL1 1VPYA 1GKPA 3G1XA 4AVFA 5IHSA 3N19B 3PTQA 4NJKA 4FNPA 4UTJA 4I5RA 1H09A 2Z1XA 4FNQA 1EZWA 2XVGA 1EGMA 1KTBA 1TA3A 1X98A 3GR4A 3E0WA 1L6YA 4F48A 1K4HA 2XSXA 1R0MA 3CUHA 1KT1A 1QPOA 3G0UA 5M17A 3M4HA 2EBNA 3NI6A 3KOYA 4BF8A 3S2LA 1Z48A 4JQAA 3N34A 4RV8A 3KWXA 2XN0A 3CWHA 3TMQA 2F4EA 3GDRA 3M64A 3N2XA 1N1AA 3GNRA 4IGHA 2Y7GA 1CGYA 3RX3A 3SJNA 1L6WA 2EPMX 5D04C 1POKA 2PAJA 2PTWA 4LS0A 3IKDA 3TYZA 2I56A 4P5UA 3UJ2A 3FCPA 2HSAA 1F73A 4ITZA 2G96A 3KRBA 5LXXA 2PBGA 4UDMA 3PSVA 2V63A 3NOYA 5I3KA 2L2SA 4ZFMA 3PB0A 3MZNA 2WC4A 4AUBA 3IV8A 4DLFA 4I7WA 4DBUA 3GHSA 4GZ7A 2OFNA 4ASTA 1S2UA 4RX0A 1XIDA 2C79A 4J9JA 3UJRA 4J2MA 1OFBA 4QROA 1I1WA 1YRRA 3SCWA 1UR8A 4PB5A 3BCDA 1B3XA 3CT7A 1W9XA 4CD6A 2PDMA 2D2JA 2VO5A 4IUGA 5XIMA 5LSMA 3U2CA 2ISWA 4BFAA 1VAHA 1A5CA 2V3DA 3NEVA 4XIMA 1XC4A 4IZGA 2XPKA 3Q4DA 5AHLA 4N4PA 2D24A 4HKPA 5BZAA 1J5SA 2PFHA 3CU2A 4TQTA 5CBJA 1SZGA 4QLLA 4GIEA 3AUJA 3W73A 4UR9A 4N6EA 2EG7A 2M2AA 1J2WA 3CEUA 4UZUA 4U33A 1YX1A 3HIJA 3K8LA 3PUEA 4AZIA 1TUFA 1ECQA 3OPSA 2PWEA 4K68A 2D69A 3K46A 3NDZA 3PTDA 1NF0A 2C3ZA 3IGXA 2DSZA 1M5YA 4KIRA 1Q45A 1FJDA 2RJGA 5DANA 2P3ZA 3V16A 4I3GA 1MVYA 1PXGA 3AQUA 3TYAA 5I3JA 3QHNA 3ZT6A 1GUVA 3TJIA 1FKIA 5DXXA 4C6KA 5CPMA 4MNMA 2YDRA 2PC4A 5LNVA 1TV4A 1Q6DA 3KABA 2PU1A 3VZXA 3T0DA 1G4TA 3BMWA 1A0CA 3ZLFA 3QGAC 4NAEB 5BOEA 1DWIM 4XZLX 5KITA 3A47A 2EXOA 4PTDA 4RJEA 3NQGA 5JXQA 3T8LA 1Q7QA 1WXZA 4FF5A 2NXIA 3V0UA 4K3ZA 4WQ6A 2A2IA 4NZ5A 4MY8A 2PWGA 1LORA 4BKNA 5DFAA 5BMWA 1G7VA 2R1PA 2DPEA 1CT5A 3R8GA 2J79A 4QJ4B 1V02E 3TC6A 4AZBA 4ZQRA 3KACA 3IANA 2E25A 4LYKA 3VC5A 2RDWA 1XX1A 2YB1A 5LHFA 1TWZA 3RK8A 4NZ1A 3ID7A 3UCQA 2QAPA 2PWFA 2WVUA 1EGVA 3NFUA 4OBSA 4QISA 3CH0A 1ME8A 3TX9A 3WY1A 3LUOA 3JZEA 3UXIA 4A3YA 2GQ9A 3MV11 2Y4SA 3BAKA 4ROPA 2G37A 3RU8X 4A3UA 3TYUA 3L4VA 3WLPA 4JTGA 3THCA 3N3TA 1SO5A 3T81A 4WOZA 5E9XA 3SCRA 2VOMA 4XZHA 2QJIA 4KFNA 2BNJA 1G9HA 1EJSC 2PWVA 3GDBA 4DJFA 1EC7A 5I6SA 5CC5A 2BHUA 2PZNA 2VX4A 3C0SA 4IHCA 3RU6A 4GUIA 4DN1A 4ZGYA 3VD3A 1E55A 5GJNA 1GOIA 4UTMA 1A5UA 4GKTA 1NARA 4PUDA 3U5YA 7ENLA 1ICPA 1I9CB 2ZUSA 4N2YA 3THDA 2W0UA 3AIQA 4HOXA 2Q02A 4A3RA 1XKYA 2WHLA 3G1YA 1HF6A 1Q4NX 2C1IA 2ABBA 1V79A 3ITCA 3GH7A 4DZ5A 4G1NA 1AJ2A 1SSGA 4OUIA 4EIVA 1WA3A 3VZZA 5ABFA 1E43A 2NXGA 5BXRA 3WD1A 2YL9A 1U1UA 3AYRA 3GTNA 5F7UA 2NWRA 2PDFA 4HU0A 4GHRA 5DITA 3AMCA 3FA4A 4LYRA 3JXVA 3CAVA 3BW2A 3O5MA 3HGOA 2HV5A 3GX9A 5D03A 3AU2A 1W8SA 5AZ0A 4LYQA 4AH7A 1TX2A 2PGEA 4TOQA 3T0AA 1GPWA 2BGNE 4ZTXA 3BLIA 1V6YA 3W1LA 2VUYA 1Q6GA 1BKHA 4JFUA 3AXKA 1OFPA 3U2OA 3B0XA 3RFWA 3ANYA 4IPXA 1JDDA 2VENA 2CC0A 1TX0A 5CQ1A 3VIGA 2PB1A 1XCFA 4IIGA 2HWGA 3H8AA 2YYUA 4LNCA 4NAFB 1M5WA 2AKZA 3L5MA 5M03A 3M0LA 1GKRA 3GE7A 1KXHA 2ISFA 3G8EA 4O2TA 3IACA 3NL6A 3VOGA 4ILSA 2X7VA 4S3KA 1Q6OA 2VM8A 2POZA 1A50A 3EDFA 4XZWA 2R1NA 3EOEA 5K9XA 1GHRA 5IFPA 1C3FA 2FHBA 3QRHA 3UI4A 3QKZA 4MPQA 2DW6A 4CUCA 1R7AA 3NL3A 2X2YA 2Z1BA 4IMEA 3GXMA 3W1PA 5H1WA 3EKLA 5HPCA 1Z44A 4JTDA 2GGHA 2ZWZA 4H1ZA 3OOBA 2GVYA 1V6XA 4AD1A 4QG6A 2PPNA 4W9PA 2ZIDA 5CBIA 3AIRA 3WUFA 4QAWA 5MKGB 3ARRA 1O12A 4X0VA 1O95A 4W7UA 1W2VA 3W70A 5GNZA 2YKKA 2BX7A 4JNMA 1KWGA 1OG6A 3THQA 4GXPA 5DN1A 2ZFAA 5KZ6A 4XX6A 3KW3A 1Z41A 1S5TA 1QVBA 3WKZA 4B5NA 3OZPA 2MPHA 3HBLA 3OHMB 1CLXA 3MHFA 3SGZA 4RL3A 4WCJA 3AHYA 3S2NA 3VOIA 3ABXA 3ANUA 9RUBA 3ITOA 3ENLA 1YPIA 5LIUX 1J93A 4ZPTR 3ITYA 3OJGA 1C8XA 2WMIA 1ICSA 3FVDA 4QIBA 2WSQA 1R6WA 3BPWA 1NMVA 5ABHA 3M6YA 4DF0A 4IX0A 4PCTA 1GNXA 1XF0A 1FWGC 3UCDA 5ABEA 4UFKA 4Z2KA 2F61A 1PKYA 2R8WA 1LQ2A 4DAIA 3CS2A 2XUCA 1HGWA 1BWLA 1JQXA 3FA5A 3DBPA 3LEPA 1FKJA 1BRLB 1EIBA 1KCKA 2E28A 1K8ZA 1V0LA 2VURA 2D3LA 2WXDM 1KFEA 4JXCA 3WL0A 3KS6A 3TROA 4FAPA 2NT0A 3PPCA 3TUUA 2WCSA 5FF2A 1EXBA 3FYYA 3NVDA 3UPBA 3HOJA 2VP8A 2A3BA 1IIHA 2FZBA 3UQNA 3EWZA 1Q6LA 3WLTA 2QJHA 3B8SA 5FESA 4FP1A 1DJYA 1IWPA 2O4MA 4TXEA 3TLLA 2ZA3A 2E40A 4P8XA 2W91A 4BI7A 1NDVA 3SRHA 1WDRA 4K6AA 1G4SA 1OWQA 2V3GA 4K38A 5AYIA 1PBKA 1ZLPA 5EU9A 1UH2A 7TAAA 1EB3A 2VCAA 5AHIA 1XYAA 5TF0A 2ZXBA 2J9ZA 3SUSA 5G1TA 1OCJA 4DO4A 2Q5AA 5DY3A 4AWEA 4TMCA 1QI3A 1V8EA 4HN4A 5HAOA 2CLPA 1BL4A 4WXZA 3VOHA 1MW1A 1P1XA 1W3JA 1N2VA 1JI1A 1SJAA 1VEOA 1W5NA 3JS3A 1KCXA 1ITXA 4BF5A 3E2SA 4PMJA 2XGIA 2CLHA 2V2DA 3KAOA 1JGMA 4LAKA 4NKCA 4M56A 4U28A 4M80A 3AJ7A 3ZFHA 3WLMA 2CEQA 3MY9A 4C6JA 1PBGA 1Z8AA 1J5TA 1GZGA 4AX6A 1E1CB 4HTBA 1G4PA 4ODNA 3OP2A 2YXOA 2JKAA 1DKWA 1TJ1A 4LB4A 4JN6A 3UWEA 2E68A 4LUSA 2KX9A 4XKYB 3ME3A 3P74A 1D7JA 2Y8KA 4UC5A 5BW6A 3WEOA 2QMKA 4G7FA 1FWJC 4LC8A 1A3HA 4UQDA 3EOLA 2P50A 1BVWA 3OVGA 4RE0A 2A3EA 3KLLA 3UWYA 3AICA 4O10A 5CZJA 4C6QA 2FJKA 3HG3A 2YLLA 2BXYA 3UR7A 1KKOA 1FH9A 1LLWA 1M6JA 1M7OA 4MGVA 4MYXA 4ALDA 1ISVA 2P0OA 2XWDA 3SN0A 3GTHA 4FEZA 1ZB5A 4X9SA 1A80A 3EKGA 3ZO9A 2WCAA 1I75A 4I7UA 4Q8PA 1MQQA 3RHGA 5FOOA 3W75A 1LOLA 2Y8UA 3R7MA 5E93A 4EACA 4HSOA 4QDPA 2Z29A 1A5MC 4IQEA 3RJXA 4RE3A 5K9DA 1IWBA 2J25A 3MWCA 2AL2B 5A8NA 4LY4A 5I3DA 2A79A 2QJJA 1DTNA 1H50A 3ZVHB 6ALDA 3QMTA 1FAPA 4RW5A 3TC7A 2YXGA 4JAWA 3W1QA 1WX0A 1XLBA 4DO6A 1QFEA 4KEUA 3W7NA 2XU2A 4D2JA 4DM2A 2V5CA 1WPCA 4PUKA 1QI4A 2D73A 3GU2A 5C2XA 2VX5A 5CBBA 1EIXA 2UY4A 4Q6JA 3W7GA 2RUCA 3LLXA 4QP0A 1HNYA 4W93A 2WSRA 1FCVA 4UQBA 5D09A 3U8GA 2VJXA 1O5QA 3UG8A 3B0UX 1JCLA 1VGAA 2VL4A 3S9YA 3AZRA 1BKSA 3MI2A 3P8IA 2QJMA 3E0LA 5I3FA 1ZCCA 1HL2A 4PMDA 2G5WA 3WH8A 3WLNA 3T2QA 1VJIA 3W7QA 1K7FA 2PV1A 3EY6A 2XTKA 4B4FA 1XI3A 5H6HA 1C8QA 3CZKA 1RQHA 3NSXA 3THAA 1XIEA 3TN5A 4QE1A 3K8KA 4QG9A 3ZJKA 4S3BA 3FX4A 5I98A 1VCFA 3LK6A 1EFZA 3CWNA 1HZYA 1OC7A 5TBOA 4DBSA 3IUDA 3A6OA 1UA3A 3BLFA 5D2YA 3DFQA 1DL3A 3YPIA 3W6LA 2YDQA 3TH6A 4S3EA 2X05A 2Y62A 2P3EA 4V33A 2MLZA 2Y61A 5HNTA 5BROA 3B97A 1X6UA 3TOPA 2ZOXA 2ZDSA 1BYAA 3WMLA 1PYMA 2INEA 4UTWC 3DN5A 1YBQB 2D9FA 3IJLA 1JFXA 1B3VA 4YCPA 4XO6A 4I9JA 3W81A 4IIFA 2Z0IA 4HMEA 2WKJA 1F6YA 1MMFA 2BSLA 2VTFA 4AXNA 1XXXA 1FWFC 4W5ZA 5AHNA 3QV6A 4IPIA 3TTEA 3HQ1A 5C70A 3SGUA 2ZA2A 1XDMA 3HZ3A 2QMJA 1G94A 1XSJA 5AC5A 3QN3A 3UA3A 3M6DA 1V3IA 5FEXA 3URAA 3UGVA 2WANA 1CGTA 4EXBA 4X2RA 2GSHA 1QW8A 3HQPA 4NIRA 1MI3A 3VKDA 1GVOA 2YW4A 2FDSA 3OO2A 3RMEA 1UPMB 1VB9A 2BGQA 3E0FA 3PJTA 4LUTA 2NSOA 1W32A 1TTQA 1D7FA 2Q8ZA 6PTDA 3TWAA 1SJBA 3NQVA 3NQ7A 1ZBWA 2DZXA 3RITA 3V0TA 2V0TA 4PUUA 3MVTA 2DZWA 4YWSA 3D3FA 3ZT5A 1E5NA 1A4LA 2E7FA 3A22A 3SIMA 3LDVA 3S83A 5CJMA 1JYWA 3NGFA 2CERA 4CEXC 4F79A 3VC6A 4TO8A 1G01A 2AOSA 1TFVA 2J9XA 4W9TA 4AXKA 1UWTA 4IISA 1QPKA 1V3MA 3EMZA 2TYSA 1M53A 4L1XA 2NVAA 7A3HA 3HU7A 1P7TA 2PDCA 2IQDA 4DUXA 1VRXA 4U3CA 1WNOA 1DEDA 1UWQA 2FFIA 4CD8A 3MQTA 3KFTA 3EEGA 4NSBA 1CI1A 3C2OA 3RAOA 2CZFA 3OGRA 1KC7A 1H63A 2QV5A 1TELA 4ZQCA 3XIMA 1PAMA 5HINA 3AYSA 1E4MM 2OLAA 1VYSX 4JCMA 1GG1A 1VPQA 1TJ0A 3L12A 1VBUA 2NWSA 3OGSA 1E1FA 4C5ZA 2IW0A 4CU7A 2UZ5A 4C6NA 3K5XA 4IGSA 4Q4PA 3TK7A 1W26A 3LV5A 3DOPA 4GJJA 2VMFA 1J0KA 4PFHA 3L21A 1E9LA 3ITGA 2BOEX 2HPMA 4MADA 1SZEA 2HMCA 1LF1A 5C8BB 4R27A 5BRQA 1GYLA 4YTTA 1JZ8A 3AXMA 3NQFA 4C6BA 4A22A 4M8UA 1D3GA 3PANA 4AG0A 1QRQA 4FAMA 5EFFA 4MF4A 5HQMA 3CB3A 3BMVA 3VNDA 2Z2AA 3DHFA 1FKHA 2QDDA 1C7SA 4OV9A 3UR5A 5JIPA 5L9FA 1GJPA 1J0YA 4MLRA 3MS8A 1F74A 3T40A 5I3GA 2HXTA 3O5FA 4EAYA 1WO2A 4KIEA 1F7BA 5EMLA 1Q5MA 2RGMA 1O60A 3IKGA 2DIEA 1ROTA 4DPPA 3ABZA 3HMJG 1XBYA 1NFBA 2J74A 3GC2A 1JF6A 3OQ8A 4KR0B 2CHRA 1US2A 1I4NA 4FR6A 4C7GA 1XGEA 3S6DA 5LIYX 4S3GA 2WSPA 4GUJA 4NX0A 1H1ZA 3DKLA 2ICSA 3I3EA 1O66A 3A4XA 2PP1A 4WDWA 4DO5A 3C8NA 2GQ3A 3QV8A 4K7YA 3CT2A 3ZJ7A 2UWFA 1DXIA 1I8JA 1A5LC 2OEJA 2E1WA 4KCVA 4Z08A 4AC1X 4O13A 1XCXA 2QLYA 3NYDA 4KEVA 4V2XA 2VEPA 5AECA 1XD1A 1ZU8A 3MSDA 4JTEA 4F0RA 4IH3A 5A5WA 1FFQA 1JG9A 4LV4A 2XFRA 4LQ1A 5JIWA 4AY8A 1ITQA 4UTTC 3LCLA 2EPLX 2DG3A 2E77A 3H4WA 1XYZA 5I3HA 1PINA 3AHZA 1E9ZB 3LXBA 4JCLA 1D7HA 2CZDA 3GXIA 1JNSA 1B57A 2EQDA 3SR7A 3TXZA 4CU8A 1QZ2A 3RCMA 4JIIX 4ERGA 5HUOA 4ZO6A 1M04A 1EO7A 5FJTA 1Q1CA 1KRAC 4B16A 2VWSA 4NRRA 3WDPP 3K1GA 3WJYA 1ECEA 3UR2A 4MDOA 2CBVA 3BCFA 4Z0SA 2ZVIA 3PTMA 3O5KA 3PUOA 3TCEA 1VEMA 1H51A 4LRSA 3H7RA 3TKFA 3ARTA 2J7CA 4U3AA 5FAGA 3VE7A 3TYEA 1R3SA 5JBEA 1I0BA 4L6DA 3BSMA 1K9FA 1JPIA 5FJPA 4WOQA 2FH8A 3HG4A 1NSJA 1SO6A 4KF1A 2VCBA 3MTWA 3MP5A 1RD5A 1EDQA 1FRBA 3EWCA 1CGXA 4GQGA 2IKHA 3A9IA 3BLLA 5AC6A 2VZTA 4YNGA 2BOGX 5CJ5A 2V8ZA 1O1HA 4P7OA 5D9PA 2V5DA 1C90A 3WELA 3PAOA 1DWFM 4R5EA 3IJ9A 1W3TA 3PWAA 3GIPA 2RAGA 3SEPA 3VNLA 5HR6A 3IVUA 5C7HA 1ICQA 3PFMA 1XKJA 4GLEA 1R3VA 4O8AA 3VUPA 1EEPA 2OX4A 2WNNA 2GFTA 1OX6A 3E74A 5B80A 3NQ2A 3TQPA 1NDZA 3DAQA 5HW8A 4PUWA 1W1TA 4ACZB 4R9XA 5MF5A 4MJZA 1LP6A 1GWJA 4P8UA 3PUDA 4B9YA 1GEQA 4XBKA 4BI5A 3PZOA 3TC3A 1A5SA 1E0WA 4IXXA 3R12A 2OZ8A 3SUTA 1YDNA 3DFHA 3VI2A 3ZM8A 5BU9A 1E6PA 2PN0A 5A6TC 3BLDA 4IQJA 1J0JA 1NH6A 2PCQA 4B91A 1MFVA 3UZZA 5IXEA 3PZQA 1UWUA 1D3HA 3VOCA 1O4UA 3DC8A 1UR3M 1J6OA 2CIPA 2R1KA 1KM1A 4KPLA 2WNQA 2G3JA 4PB4A 3GTFA 3TYCA 2A5HA 5A6MA 2ACSA 2QCMA 2XH0A 3L0NA 2OQHA 3N11A 2CWXA 2PDLA 1LJYA 1O6IA 2GSEA 3QEZA 1FH8A 2WM1A 3VCNA 1O5RA 1JD7A 4H2HA 4HSNA 3RCYA 1F61A 1T99A 4QGCA 1WV2A 4QFUA 1BVZA 3EPNA 2CLIA 1LROA 4RPQA 2DW7A 4HU4A 4UMBA 3L2MA 3K1DA 2C16A 2H9AB 3OHIA 4V28A 1IWAA 4GINA 3ZLGA 3LHUA 3I10A 3VIHA 3TNOA 4XAFA 4R88A 2Q3RA 1D6OA 2ZX6A 4K2SA 4I90A 2CLOA 1XL9A 3HM7A 3QKEA 4EK7A 2JBMA 4N19A 3UZXA 1UIOA 1PJ9A 2F21A 3CAWA 3POHA 4DZIA 3VKCA 3NEHA 1IEWA 1OY0A 3ITTA 3BZGA 2YFOA 3WNOA 2EHHA 3P0XA 1TV3A 4PTXA 1BWVA 3AS3A 1NOUA 1AG1O 3CTTA 2LKNA 3N17A 4LV9A 1XISA 1PIFA 1XIIA 3ABSA 5A8OA 1KQZA 2WZMA 1CIUA 3NQ6A 3VABA 3U7BA 5B7ZA 4FI4A 3GDTA 2GUUA 2HBVA 1UJQA 4JFMA 1GOQA 3KBMA 3BTNA 3Q65A 4Q8VA 1B4KA 2F84A 1HL9A 2X0HA 3R0KA 1QNSA 5JBFA 1FQ0A 2VGGA 3BCJA 4JTFA 3VGBA 2W63A 1REQA 4JIHA 1BLIA 3N2BA 3N9KA 2FMNA 1RY8A 2EPHA 3WK3A 1H62A 4WKHA 1VLWA 2ZX9A 2Z6JA 4OQVA 5BNKA 2E8ZA 3IUIA 5RUBA 3PJUA 3KADA 2DGAA 2ADAA 2W67A 4JNYA 1FWSA 3G5EA 4O8RA 3LPFA 4JQ2A 3ARPA 4FLSA 4FMVA 2M1IA 1P5BA 4YWIA 1L8PA 3GDKA 4JTIA 1TRIA 4FB7A 4ZPWR 5BMXA 3R43A 4U5KA 2HQAA 1W5OA 3SB0A 4BWLC 1OFAA 3GC4A 4B4HA 2EKGA 5D2XA 1OX4A 3KVKA 3TW7A 1MYRA 5HTGA 2D20A 3AIUA 3B8TA 3DYMA 2CLEA 1QPFA 4MKSA 1Y7VA 2FKEA 1OABA 4YCOA 3B0PA 4NXSA 9CGTA 1FWEC 1KLYA 2F23A 3ANVA 4Q32A 2Z00A 4DWDA 1Y8BA 3DCPA 1TPH1 1MFUA 3VX0A 5CG7A 2QV4A 1OFQA 1WKDA 5A8MA 3GUGA 3HJZA 4H6EA 3B05A 4M29A 4F0KA 4YHEA 3C0LA 1W1IE 3BV4A 1VCVA 2A6NA 3UXDA 5FL1A 4UR8A 5KEZA 4Z2JA 3T0CA 1P1MA 4BY3A 4XD5A 2YR1A 2A7NA 1XIJA 3GTYX 2QIIA 4S1FA 3NZPA 3GDMA 1ZP3A 3QW4B 2NX9A 3GM8A 5FL0A 3MUAA 1X6NA 3REQA 2CXEA 2GZXA 1RCOB 2REQB 5IBXA 1DJIA 4ZTYA 3CO4A 3R1ZA 1F4AA 4IG2A 1IXPA 1M9HA 1YNQA 2X16A 1RD6A 2OFJA 1TMLA 2SFPA 3ABQA 3EXTA 3N6JA 4PBGA 4HZ8A 1SM9A 1XLKA 3SGGA 1OFRA 1F3EA 3RLGA 1MEHA 3T55A 4J3WA 4FIRA 1ISYA 2QGYA 2ITKA 4GVIA 3UG4A 5FI8A 5EMJA 3VNYA 3KE0A 3LNPA 2J7FA 2O56A 3ISIX 2P5NA 2J7DA 2VRJA 2XZ7A 4Q33A 3H53A 5J8LA 4S3CA 5BXPA 3LV6A 1RP9A 5EMMA 3AWNA 3G8RA 2PLCA 4URIA 4LBRA 3DX5A 1HJWA 3QY8A 4OOZA 1JRBA 4HBOA 1QU4A 1XR2A 1JGIA 3CPGA 3W7JA 1GTHA 4DUVA 2OZ3A 3W7HA 4I9AA 4K7VA 1QWKA 2XISA 1J11A 3F5JA 5GPGA 1D8WA 1UP2A 3WLJA 3GNOA 1E9YB 1SJCA 1P4CA 1MW0A 3W23A 1EQCA 4CNOA 5TAOA 2HK0A 3A4WA 3KAHA 4KEZA 4HA4A 4MWAD 4E2BA 2IF4A 1EP3A 1JVWA 4DBDA 4D6IA 5CLTA 3UU0A 1E51A 4ZSUA 3PR2A 3W7MA 2WJDA 1NSGA 2LGOA 2RDTA 3QM3A 2CYGA 1N82A 3MO7A 1W9VA 4CD7A 5G4WA 3E2VA 1QHOA 5KZMA 1XM3A 4NNCA 4XTDA 2OT0A 1MNSA 2Z7KA 3ARQA 3P3BA 1XDJA 2XDFA 7XIMA 4OVXA 3NQEA 2Z1SA 2DH3A 4AC7C 4GGBA 3CGNA 3AJXA 2FPYA 3ITVA 4DX3A 5JH1A 3T1GA 2ZCGA 2HTMA 5DT7A 2C14A 2FB3A 2R91A 5M2FX 1DV7A 4CNNA 2B7NA 5H8MA 3QC0A 3UI5A 4BR1A 1UMLA 1WZKA 1JDFA 4LVGA 2BVTA 3VDCA 4H19A 1Z9AA 5HNUA 1F40A 1W1ZA 5I23A 2JFEX 3N2OA 2MF9A 3BW3A 3GHTA 1FHLA 4GD0A 1IXNA 1GZJA 3FKRA 3DC0A 3A9BA 3C2YA 4LUYA 5HW7A 5DBUA 2R14A 2NX1A 3I65A 3WK1A 3ICJA 4AF0A 4DM1A 2WKGA 3RX4A 3R25A 5G2WA 3SIZA 2XVKA 3UZJA 1BF2A 2FTPA 3WK2A 3SCPA 2FTWA 2VYOA 4YVVA 2GDUA 3NPXA 2QVHA 1VENA 1DJZA 3WD0A 5CGTA 2A7PA 3NNTA 3VKJA 1ADSA 2GJLA 3LOTA 4MNLA 3SUVA 2EEXA 3A13A 3DU0A 4F0HA 2VHLA 1XHGA 2I9UA 3LRKA 2QJNA 1BVNP 4KCWA 3GPKA 2GGIA 3A23A 3FLUA 3B3DA 1JUKA 2RDXA 2OYMA 7REQB 4AFYA 4JL1A 4KT2A 4E2VA 4ZQOA 2IPJA 2L5HA 3G0SA 1OFDA 5HWNA 2C6QA 1RR2A 2OG9A 4HHMA 1KB3A 2OCZA 1DOSA 3R11A 1DWAM 3TOYA 3E5PA 1MUWA 4PR4A 3VPLA 5BWAA 3UWVA 4D6EA 4CCEA 2QGHA 3MUCA 1EDGA 1PEZA 5HT1A 1UPPA 3EWBX 4PSPA 4S3AA 4IT4A 1W1PA 2HDJA 1RQBA 3F5KA 3PRDA 3CXOA 1Z69A 5E6YA 4C65A 3U0HA 4BJHA 4C7DA 4E6MA 2FB2A 1QW7A 3BJFA 4FS9A 3FVMA 4DWSA 4JY8A 3P62A 3LBCA 3LBOA 1TPWA 1E4IA 1Y5XA 2FFCA 3BOFA 2OWXA 3V35A 1XP3A 2CBUA 5EA9A 1CB7B 4AQLA 1ZSXA 2I1OA 3TJXA 2PC8A 1IXOA 4UFLA 5EGRA 3W25A 3O5JA 4N42A 3LUTA 4DF2A 5C7VA 4D6JA 4O50A 5LIXX 3OOQA 4L64A 2WHMA 3ZSTA 1S2AA 2OGYA 2ABAA 1OIFA 3PBYA 1U1JA 2EAWA 4A2SA 3MC5A 4PBEA 5HUPA 4TVCA 1LT7A 3GU1A 2D2OA 1EGZA 1HQTA 4ZCWA 2GWGA 3BG3A 2QUUA 3OBKA 3AZSA 3U57A 4GXWA 4GQ0A 2NUXA 3WEMA 1XFCA 1EHNA 2ZTKA 4EF8A 1UD2A 3HG5A 3I4EA 5AC8A 1AW2A 4QXIA 3GIQA 2J7EA 1EA9C 4PA8A 3WD2A 4ZVJA 2FDMA 1FBAA 4RDWA 3MYPA 1IYXA 4PMXA 1I2PA 1V3JA 3LX9A 1FKKA 3P2VA 3CMGA 3H4GA 3HV8A 2UY5A 2JGYA 1V7AA 3W00A 4AY7A 2DH2A 4ZR8A 3M44A 2R1LA 3FSTA 4C1NB 1HGYA 3S9IA 4W5UA 3NUKA 2MLYA 4C02B 1HX0A 4FALA 1RVKA 4PEEA 3BZJA 2V5LA 4XD3A 3TIMA 2NUWA 1O1ZA 3KOZA 1JNTA 2V69A 1FD9A 3JR2A 2I17A 3K13A 4PCSA 1KBBA 4UTKA 3MO4A 5HWCA 3IIOA 1EYEA 3UQAA 4UB9A 1VHCA 5A2CA 4H9MA 1A53A 4WSJA 1GOMA 4UQ9A 1UWIA 1EPXA 5J5RA 3E1F1 2ZQSA 3TR2A 3EX2A 1J4EA 2V5JA 1V77A 2XFWA 5C9UA 5HNNA 2KZHA 4F0LA 4DJFD 3TTYA 1I45A 1CW2A 3T2OA 1Q7MA 5LIWX 3R4IA 4K1WA 4GVGA 3C2EA 2QF7A 2HS8A 3W01A 1H49A 4C1LA 2GJNA 4WKFA 3TN6A 1CYGA 4ZB2A 4B3KA 4HA0A 1JIBA 4ODQA 4DI9A 1QOQA 2ZUTA 1CZ1A 3GZ3A 3NM1A 4UOZA 4TW7A 1IR1A 1ME7A 5DELA 3M0MA 1JR1A 3DFTA 3M7SA 4QBXA 3GO2A 2Q6ZA 4W87A 3T9PA 1J6YA 3IK4A 2QPSA 2QDGA 3GU0A 4K8HA 3UD6A 5HANA 4O54A 2FMOA 3VNKA 4DXXA 1XRSA 1UYQA 1NWUA 1TZ7A 3OA3A 1FDJA 1JPHA 2A4AA 1HL8A 5GJMA 4FLOA 4YMZA 3PPHA 2ZQVA 1ZBCA 3QR0A 3W84A 1F05A 1NTHA 3RN6A 1LOSA 3BSHA 2ZRVA 5A1AA 2XP4A 4RW3A 2W92A 3WD4A 1R3TA 3DXIA 4O1EA 1XYMA 1YPFA 1VCGA 3O07A 3UVAA 1NOWA 5E0CA 1ITUA 1E70M 1E4LA 3I3DA 5GVJA 3SN4A 2V81A 1A5OC 1XSIA 3DG7A 2VNCA 2BXZA 3NGJA 1VKFA 4GYKA 4BEUA 1UKTA 1GZ1A 1EWEA 3H7UA 2NV1A 1ZUAX 4NAEA 1JEZA 3C86A 3IEBA 4XBJA 3STFA 2WB5A 4DJDA 4CQCA 3UR8A 4LUIA 1X38A 4INFA 4DY1A 3APYA 1UJPA 2YBTA 5AC7A 4FF7A 5HULA 3TMLA 4DNMA 1BXCA 2ZXDA 4FIQA 4JX6A 1XINA 4NXKA 2VD9A 2B81A 3CNYA 2OTDA 3TU9A 2XP5A 4HOWA 1PZ2A 3RLHA 2V68A 3IRSA 2X40A 2ZRUA 4JFSA 2FHCA 1UR9A 2OSWA 2DUAA 1UWRA 2HEJA 3VGDA 2GGGA 3WO8A 4MAZA 1QXLA 3VMOA 3SN1A 3HFYA 4HOZA 3AZTA 1XLAA 3KS5A 2AMXA 1IZCA 3PG9A 2DG4A 3KBVA 1CXEA 5DRIA 4C7FA 3H2MA 1W9DM 1BYBA 3QXBA 2ANUA 2Y1HA 4P7QA 4TMBA 1VF8A 4HPNA 3OG3A 4PUJA 1FOBA 1UC4A 2CZVA 4LY8A 1A5KC 1MUCA 3I7QA 3ZIZA 5KZEA 1MWOA 3UCCA 5A95A 2YIHA 2V2HA 4Q8QA 3THUA 3G1HA 2GOKA 4JHMA 4FLQA 4IICA 1HG3A 4CCZA 3VDHA 1FA2A 4J3UA 5H8PA 4PODA 3WLQA 2IXUA 3C6CA 4FXRA 1UQZA 1JFHA 1C9WA 3G24A 1T8XA 2FYMA 2V3EA 4RDYA 4GUHA 3ABRA 2QDEA 4QTGA 4AIOA 1Y5WA 2J8TA 4L5ZA 3KXQA 2PP0A 2DORA 1AD1A 1XH1A 4EOUA 3ZR6A 1TV8A 3OG2A 3WQ8A 5EFDA 5HQEA 3NPUA 5LNRA 3BW4A 3RMJA 2WMFA 4MKNA 4GG9A 1HJVA 2CBJA 3NTPA 4MIMA 3I7SA 3LHVA 2ALDA 2PDQA 3ZJ6A 4HBKA 2NV9A 1AMKA 1IGSA 1XBZA 3S3GA 2ZRWA 4F66A 2BTMA 5CC6A 3N9RA 3RJYA 3AS0A 1AODA 4B5XA 3T78A 3GSMA 3CGMA 1VBJA 5C2GA 3F4WA 3EPMA 3GTIA 3P14A 3S1UA 5AN7A 4XO7A 1KWKA 5T8GA 3SFWA 4ZQMA 5FEZA 2HRWA 2X1RA 1WKFA 3H2EA 4NL1A 4NAFA 4HZ7A 1X6LA 5XINA 2XP7A 1F07A 1J0HA 2YCEA 2IPGA 3RGCA 1TWSA 2PU0A 4F9DA 1UA7A 4JTJA 4OBRA 4C90A 2ZKMX 1EC9A 4MB5A 5DIVA 1H2JA 3U7VA 2D0HA 1XGDA 3RX2A 4KKXA 1L8NA 5FSDC 4YLWA 4YU1A 3IK8A 1PUDA 2FVMA 1B31A 3ONBA 4HMCA 3MUY1 3QJAA 4I7VA 1EPVA 4H8UA 3W1MA 4DZHA 3KL3A 1E0XA 1UKSA 2G4FA 2QYGA 5MKGA 5AVHA 5TD4A 5FSEC 4GUFA 4RUBA 1WP6A 2E5CA 4A29A 4GE8A 1U33A 4GYPC 5AHEA 2WVSA 3EBVA 2VEFA 3G6LA 5HWJA 1C8VA 3T08A 2Z6IA 3MCNA 1FKTA 3OB8A 4M19A 2I57A 3R8RA 1KR0A 2J77A 5FJRA 1WDPA 1JI2A 4QSHA 3D47A 2ZZ7A 4CQAA 1QO2A 1LRQA 3NPWA 4QDWA 1MQPA 5AB3A 3JYJA 4JD4A 4MVAA 1HXVA 4ADSA 3NOEA 2AAAA 1NQKA 1VFSA 4UWMA 3DG3A 1V0NA 1TCDA 1OEPA 3BUVA 3EB3A 4O0ZA 1W6TA 3S5NA 4Y96A 1RZMA 1S2VA 4U31A 4YVXA 3CGTA 1H3GA 2JF7A 1UOKA 4XAYA 1OYCA 1CWYA 3ABOA 4IOTA 1UC5A 4IIBA 1QASA 1YDOA 1BRLA 1EUAA 2O9PA 1QNPA 3IARA 3SQLA 2BXVA 2E9BA 1OHLA 3URQA 2XGZA 3HA1A 3T09A 3TE9A 4DRIA 3W7KA 1AH3A 3Q94A 2W27A 1PHQA 1H11A 1WUFA 1LLZA 1F6KA 2V67A 1RK6A 5CAHA 4MY1A 1WZAA 1FH7A 1PZ1A 4QEEA 3PK7A 1WCGA 3NO5A 4X9YA 2B4GA 3GAKA 2DP3A 3WQ5A 2ESCA 3EPOA 4Q7IA 1KM3A 4A8RA 1K9TA 3LNMA 2Y70A 3N6QA 3H70A 3O3RA 1TIMA 1LBFA 4XSLA 2DJXA 3LLFA 2O55A 1QHPA 4DI8A 3COTA 4D6DA 2E5BA 2GVJA 1ZAHA 4NJGA 5HUAA 4DROA 2PLMA 1H4PA 2VX6A 1SO4A 2Z25A 1Q2SA 4MFEA 3OIHA 3V1HA 4CD5A 4CGTA 3WUEA 3RFAA 3MI6A 1H5VA 5E70A 1BEUA 1J4RA 5CSYA 1DVJA 4O53A 1OQFA 1AK5A 1TB3A 3UWQA 4YYCA 5H91A 5FJIA 2CBIA 2VCDA 3NVTA 1SO3A 2XFYA 3CL8A 4X60A 2DZAA 4HNTA 1E1CA 2NV2A 4R7JA 2EG8A 4FO4A 4LS1A 4UQAA 1XG3A 3LM7A 1EJVC 5C9XA 1OF8A 1FWWA 2PDWA 3U6WA 1VZWA 4XKYA 3L7RA 1E73M 2C0HA 5CPSA 2WJEA 3CQ0A 4DHGA 1K8YA 2QXWA 4AZ7A 3GC5A 3RILA 1PTGA 1IHIA 4Y7EA 1WXYA 2R9RA 3B8DA 5TIMA 1S1PA 1FKFA 3WQWA 3IJ8A 3BG5A 3ALGA 3GKAA 4TTGA 1E71M 4LCQA 3LQLA 4HHPA 3W86A 4DEFA 3SRFA 2RFGA 1PX8A 3W1NA 3MANA 1WOBA 3T2PA 1C9HA 3V5OA 1GVEA 5AYZA 4IIDA 4EWND