3FXYA

Acidic mammalian chinase, catalytic domain
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
379
structure length
379
Chain Sequence
YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Triad of polar residues implicated in pH specificity of acidic mammalian chitinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Acidic mammalian chitinase
total genus 132
structure length 379
sequence length 379
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3fxyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3fxyA01
4A3HA 5CQ1A 2YL5A 4FMVA 4TVUA 3OGRA 4OBRA 1IT0A 5KZ6A 1HIZA 3AIVA 1W1VA 1GHRA 3EDJA 2OLHA 3W37A 1MQQA 3ARSA 4MB4A 3BMVA 1XC6A 5A8OA 6TAAA 4W7WA 4P7RA 2XUCA 4GZEA 1GPFA 1UR8A 2YL8A 4GZIA 1R86A 2NT0A 2C0HA 3I3BA 1NWRA 2XFYA 3WD4A 1V0KA 2DH3A 3UCQA 1Q6EA 2ZUSA 1KXQA 5A6JA 1TMQA 2VZTA 4AYSA 2VVSA 1BLIA 4QP0A 3B8SA 2G3IA 2WPGA 2E8ZA 1HKKA 1UR2A 3B9AA 3LMYA 2EO7A 4PSPA 4WKHA 3ARXA 1E55A 2D0GA 2CBJA 3M6DA 5FL0A 1QNOA 1SYTA 2CESA 1Q6DA 3RMEA 2GDUA 4B9ZA 1QHPA 3PZOA 2VJXA 3GXDA 3BAXA 3AIEA 1Q6CA 3VILA 1MW3A 1IZKA 1R85A 2Y2WA 1V6XA 4XZWA 3WD0A 1OB0A 3U5UA 1GHSA 4TTGA 4P7OA 4H8VA 1KBBA 3WENA 2XVPA 3VD9A 3MANA 3GNPA 4GINA 4MADA 3KEHA 4U2ZA 3NIYA 1E6XM 3ARWA 1FH9A 4GO8A 1BYBA 2OSWA 3WD1A 3PZTA 2E8YA 2WLYA 4JL1A 4MB1A 3EMQA 3VD3A 3A47A 5DFAA 1EQCA 4D6GA 2VC9A 1JNEA 4L4PA 3EBVA 4FLOA 1E6QM 4JCLA 3WEMA 1EDGA 4IM4A 1FP9A 3WBEA 5HOSA 4JL2A 2O9OA 2XSAA 1MYRA 5A6BA 3PZVA 5GQBA 5A6SA 2WBKA 1KGWA 2EPOA 4D6JA 4PUEA 2ZXBA 3AICA 3OZPA 4KGJA 3BAIA 4LYRA 1KXHA 1CXLA 1G9HA 1FA2A 1H41A 4IPNB 4UFIA 1RH9A 2G8ZA 5ECUA 2WVVB 3VIFA 5D4YA 2VOTA 2XYLA 3FHQA 3AS2A 1J0YA 2J79A 1DWHM 4JFVA 3RM8A 3WFZA 4DUVA 4OJYA 2BHZA 3ZR6A 1UWSA 1W1PA 4IISA 4WF7A 2J77A 1W9UA 1V6WA 1V3KA 3AMGA 2VCAA 1FH8A 4W5ZA 1V02A 1JAKA 2J7DA 5GNXA 4F9DA 4M8UA 2EBNA 1V3JA 2WW5A 4PCSA 1IV8A 4JFSA 5I23A 3VIJA 2VZSA 3DYOA 2BHYA 1GVYA 1MW2A 3KL0A 4X0NA 2V3DA 1DP0A 1WZAA 4RL3A 3DYMA 1CYGA 2O9PA 1X6NA 5IHSA 1E3XA 2W5FA 3BAJA 1OT2A 4R5EA 1BQCA 2ZX8A 2XHYA 1V0NA 3GM8A 4UCFA 3AI0A 3VMNA 2E9MA 1JZ8A 2IXUA 2GK1B 3W24A 3WF4A 2W91A 4C7DA 1VJSA 2ESCA 1XCWA 1E0XA 1BYCA 2WWDA 1UKSA 4DWSD 1R7OA 3S2CA 9CGTA 4XB3A 5D9PA 2DGAA 1CGVA 4ZENA 5ABFA 4LQ1A 1HP4A 2XJ7A 4PCTA 2D2OA 4KMQA 1E1FA 5HPCA 4UFKA 4CN6A 4M81A 5M3WA 3AMLA 1UD4A 2QMKA 3APGA 5D8ZA 5JUVA 2Y24A 3MU7A 1RD6A 1UKOA 2ZIDA 3WD3A 4AIUA 4FLSA 4CN1A 4ACYA 1V3IA 1H5VA 1VBUA 4UQBA 1UD2A 2CYGA 5A6AA 3ZJKA 1XH2A 1MW0A 2C8NA 5E09A 1GOKA 3RPMA 4ACZA 2AOSA 1KGUA 2WBGA 1NOWA 2DT3A 1ISXA 3RDKA 1QI3A 5EMYA 5CLWA 4UFHA 3BGAA 3HN3A 4MNJA 1LL4A 4PMOA 2JIEA 1DWAM 1CXHA 1WKYA 1C93A 2DH2A 1M53A 3CO4A 4DUWA 1MW1A 2ZUMA 1LQ0A 5BRQA 3RCNA 1CGXA 3QGVA 3TONA 4Z2IA 1H3GA 4TX6A 3U57A 1UH4A 1CECA 4W89A 2YDRA 4AZBA 5CPTA 4UQ9A 4AC1X 1JG9A 4K68A 1VJZA 3OA5A 4OIFA 4ML4A 4NRSA 2ZXDA 1K9DA 1MFVA 1AQHA 2WWCA 4H7VA 3WQ6A 3RM9A 3F5KA 1XYFA 3W81A 4DWSB 1CWYA 1KWKA 1DWJM 1Y7VA 3LPFA 5CPQA 2VL4A 4W7VA 3VMPA 3FXYA 1ODUA 3BH4A 3FAXA 4KRUA 6A3HA 4UQCA 1HJVA 3FHAA 3QHOA 2EJ1A 2HISA 1JL8A 3W29A 1UA3A 2JIWA 1PZ3A 4AD3A 1ODZA 2V38A 3W27A 7CGTA 2FH6A 2VRQA 3G6MA 3NCOA 1UKPA 4PMXA 2DPEA 2VRJA 3IJ8A 4D6FA 4AZHA 3ALFA 1AQMA 3MUY1 4CGTA 1B3ZA 2J8GA 4U5KA 5EFFA 4W93A 3NDYA 3W82A 2EEXA 1EO5A 4B3LA 3M07A 4CCDA 3EMZA 3GTNA 2EPMX 4CU6A 1TVPA 4JFUA 4JKKA 1C92A 4B3KA 4D72A 1KR0A 1BAGA 2W67A 2WLZA 1BHGA 3AXXA 3W28A 3L4WA 4V27A 1UR0A 3PTMA 1UH3A 1BVZA 3WSUA 5A8PA 3WN6A 2XVLA 4AEEA 4FF5A 2OYMA 2BVTA 4Q7NA 1BTCA 3OLDA 3CHCA 3WD2A 3AHVA 3VX1A 1CEOA 3K8MA 4OZOA 4C7FA 3K4AA 2G41A 5HBFA 2OYKA 1HP5A 2OWCA 4CKQA 2F2HA 3IK2A 4AXNA 4B16A 3RILA 2VZVA 4U3CA 1EHNA 2WMHA 4PBGA 1JYNA 1PJ9A 1ZBKA 3HMCA 4YHGA 1EOMA 2X09A 1OGSA 3MO4A 5I77A 1MVYA 4LYPA 3BAKA 1GNXA 1XYZA 4N0RA 3U7VA 5C70A 4PTWA 1NM9A 1ZJAA 1RP9A 1O7AA 3AIQA 1G0CA 2OWXA 1ECEA 1JXJA 4JZ5A 3W6MA 3WDHA 1NP0A 3ZOAA 1KFWA 3IJ7A 3L2LA 4JKMA 4UQDA 2JF7A 3SURA 1W3JA 1CGYA 3A4XA 4RE2A 3UETA 1KCKA 3SCWA 4H2CA 1ZBVA 1E4IA 3II1A 2PF0A 3W38A 1ZJBA 1B3VA 4JCMA 3ZSTA 2QV4A 4PYSA 4E8CA 5BXTA 4U33A 4S3KA 1NWTA 1EO7A 4EK7A 6CGTA 1CIUA 1HNYA 2BV9A 5HNNA 1W9DM 3BC9A 3LPGA 1A3HA 3CHEA 3RIKA 3T0BA 2D24A 3POHA 4NZCA 4D6HA 2FHFA 3F5LA 2QLYA 4UZUA 2BXYA 2Z1KA 2W63A 1GJWA 1WZKA 2J7BA 1QBAA 5CZKA 2CBIA 1HJWA 4GPNA 2W66A 2CCRA 1JGIA 2XIIA 3WEZA 3BCDA 2J8FA 4AZ6A 1FHDA 2BVYA 2PBOA 4N42A 4D1IA 4L4OA 2YLAA 4M24A 3UR8A 4KH2A 1UH2A 4Y7EA 1XD0A 2XG9A 8A3HA 5ABHA 1WNOA 3K4DA 3N15A 3VIKA 1ESWA 5FIPA 3ARTA 3VUPA 3SCSA 1A47A 1UD8A 4JHZA 3WMSA 2XM1A 2WSKA 3N13A 3WIJA 2WK2A 4PMYA 4CD6A 3CH9A 4MB5A 1UZ4A 1ZBWA 1XSKA 1GQKA 4TOQA 4W7UA 3AMCA 3WDJA 4KWUA 3OZOA 1GQIA 1KXVA 2EPKX 3CZLA 5JBDA 1Q6FA 3WF2A 1ITCA 2VNCA 2CKSA 3SCQA 3ZT7A 3TTOA 2GK1A 2WC7A 2B31A 3OLEA 4HA4A 2WB5A 4BCEA 4HA1A 3U7BA 1B3WA 2WHMA 1WDQA 4YPJA 2UY4A 1PZ2A 3LPOA 1PX8A 4GQRA 1W2PA 2W61A 3BMWA 4J3UA 1E4MM 5D9OA 1WZMA 3VIHA 1G1YA 1B31A 1BG4A 2DT2A 2ZXAA 4ATWA 3AS0A 1JAEA 1TUXA 1E43A 1WB0A 5BRPA 5A1AA 1K9EA 2WCAA 4J28A 1CPUA 1WP6A 4PTVA 4UQAA 1B90A 2YDQA 1V6VA 4M1RA 3TTSA 3VD4A 3VDBA 1HL8A 5F7UA 3OGVA 3T09A 3SCOA 1C91A 3RJYA 2BXZA 1ZU8A 3FNDA 1LL6A 1LWJA 2DSWA 3CUGA 1LJYA 3ARRA 4XX6A 4D71A 2DEPA 1VBRA 4DWSC 2FHCA 3NUKA 2X0HA 1UZ1A 3UESA 1CTNA 3EDKA 5EBAA 2ZUWA 5JIWA 1JYXA 1NP2A 3VIIA 1J18A 1OIMA 1YHTA 1JFXA 3N1AA 1B2YA 4IPLA 2X1IA 1GOIA 5JIPA 1UOKA 1J0JA 3AFBA 3CIVA 2VCCA 2XFRA 4BA0A 3AIRA 3AS1A 2YLLA 3WH6A 5AC5A 3M7SA 1PEZA 1QPKA 1LWHA 2VX7A 2BHUA 2VR5A 3VD7A 4P7QA 3A4AA 5CGTA 3WNLA 2DSUA 4Q22A 1GOOA 2FGZA 1E6NA 1VFMA 4Z2JA 2GUYA 1HN1A 1RP8A 4NF7A 1MQRA 5I0DA 1TZ7A 3VGGA 1QI0A 2ZWZA 4U5IA 3S6TA 4AZ7A 1UR4A 1FH7A 5I2UA 1XSJA 4CVWA 1DHKA 3OIHA 2GFTA 1GQLA 4QDMA 3PTQA 2G3JA 5E0FA 2XVNA 2WMJA 5A69A 2V3FA 3UG4A 2BNJA 3GYCA 3ZJ6A 1NQ6A 4W86A 3AYSA 1IZJA 1UD6A 1C8XA 1BGGA 4NRRA 5JBEA 1PIGA 3NSNA 1NARA 1V3HA 4YN5A 3B9EA 2V3GA 3UR7A 4LXFA 3MUZ1 1VFUA 2ZWYA 5C8BB 1TA3A 1MWOA 4DUXA 3DYPA 2WZIA 4HU0A 1E4LA 1V03A 3VIOA 4ZXOA 3AQUA 1CLVA 1E72M 3ZQ9A 3EYPA 2IXVA 1JNDA 2OWWA 3WF3A 4PMRA 3AMKA 3MV01 1EHAA 5I3DA 1CXFA 4H8HA 1PPIA 2E0PA 1KR1A 1VAHA 1VEPA 3JUGA 4E2OA 5E9AA 4BF7A 5AC4A 5A94A 2FGLA 1UG6A 2VX6A 1CXKA 1X1NA 2XWDA 5IHRA 3OB8A 3ARZA 1ITXA 2GJXB 5D9MA 3MSDA 5M5DA 5KEZA 5LA0A 4HZ7A 2Q8XA 3WNMA 1S46A 3K1DA 5AY7A 1M03A 3MV11 1VEMA 3WKZA 5BYWA 3SUSA 5LA1A 3BXWA 4IUGA 4BS0A 3FAWA 1J0HA 2O92A 3VM5A 4CCCA 3BLPX 5HDRA 5A8MA 2DIJA 1V3MA 1WE5A 3QHMA 3BSHA 3I3EA 1OIFA 4HP5A 3WNNA 4JKLA 2WANA 4URIA 4UFJA 1XV8A 5BXPA 1FFRA 3WUBA 2ZUVA 3WFLA 4H8UA 3LPPA 1CNVA 1PIFA 1VB9A 4AW7A 2GJRA 3EMCA 3O9NA 2PB1A 2J75A 2Y8KA 3N18A 3CUIA 5I79A 5I6SA 3SCTA 2JEPA 3CLWA 1E73M 3DC0A 3ZJ7A 3PZQA 1XRVA 4P8XA 4TTUA 4H04A 3KZSA 2XM2A 1BF2A 4GZJA 3L4ZA 2CNCA 3IJ9A 1EIBA 2V5DA 1OSEA 2Y4SA 3WBAA 2ZUNA 2PWFA 4QCEA 3RM4A 2A3BA 3ECQA 4JFTA 3A3HA 5A6MA 4HU8A 1TFVA 3ZT5A 5IXEA 2XVGA 1E6ZA 4TUFA 5E0CA 4W8LA 1SFSA 3VIMA 3SCRA 2PWDA 4PSRA 4EE9A 3FY1A 1PBGA 3IAPA 2G3NA 1H1NA 5FD0A 1C8QA 4BZYA 4CD4A 7TAAA 2QHAA 3WELA 1H0IA 1DWFM 1H09A 3WMBA 2EXOA 1Q4NX 4AZGA 4V28A 4HOWA 4OUEA 2DIEA 2D0FA 3OGSA 4J3VA 1UR1A 1GJUA 2VQUA 2WKGA 2JFEX 1NWUA 2J7CA 5A6BD 3F4VA 1CDGA 1EOKA 2PWGA 2A3AA 2WVUA 2ZOXA 3WNPA 3AROA 1OINA 3QOMA 4PRWA 1GVIA 3N17A 4P7LA 1GQJA 4A3YA 5D8WA 3PHAA 1E4NA 3VOCA 2PC8A 3AHXA 1HKIA 3CHFA 1M7XA 4U3AA 1C90A 3TOPA 2YBTA 3MMWA 1VRXA 3ZIZA 1F4AA 1V6UA 2WZEA 1UKTA 4UR9A 1GONA 2QF8A 4BQ2A 2J47A 1LF1A 4TXEA 4WKAA 1E0WA 1OBAA 3AZRA 1OM0A 1E5JA 4F8XA 3PZ9A 2VT0A 1R87A 3A4WA 5A2AA 1QBBA 1US3A 3T08A 3EDEA 5BXSA 2RGLA 1OGGA 1V08A 5A6LA 1MXDA 1MXGA 1QNPA 1HJSA 2GJPA 2OYLA 4XUYA 3AXIA 4HMDA 4XZBA 3OBAA 4UQEA 1E0VA 3GH4A 2VR4A 4BQ4A 1JYWA 4CU8A 3MKKA 1E1EA 3GZAA 2QPUA 4CUCA 2V3EA 3D3AA 3QOKA 3A6OA 4WSKA 1UWRA 1XSIA 5LA2A 4UOZA 4D6IA 5FOOA 1W9BM 2XPKA 3ARPA 3GNRA 2GVYA 4FLQA 3QHNA 1CXEA 3VKKA 1BPLB 4PMUA 2BY3A 5HPOA 3AXHA 4WLCA 1JF5A 3WH8A 4AWEA 5CLTA 5BCAA 3THCA 1GUVA 4UTFA 2GDVA 1C3FA 2UY2A 2G4FA 5JBFA 3WDPP 3KL3A 1XHGA 1NOUA 3VIGA 4J27A 3AZTA 3BLKA 2NSXA 2XGIA 4J3TA 2NW0A 1UA7A 3TTYA 1R8LA 1TR1A 3GBDA 2NT1A 3TTQA 4E4PA 3VVGA 2OSXA 3RJXA 3PBGA 4W5UA 4CD7A 1JZ5A 4MNKA 2D3LA 4GIAA 2WHJA 1SMDA 2ZICA 4ATDA 3VGHA 2WCGA 4PMZA 2WMFA 2EQDA 3VPLA 4UNIA 2PWEA 1J11A 1JDCA 3CUFA 2XSBA 2VO5A 1C8YA 1H4PA 2D20A 2WMKA 1XGZA 4AZIA 4OKDA 5DT7A 2BY0A 3VTRA 5E70A 1LLOA 3UEQA 3FN9A 1EXPA 1KWGA 1CGWA 3WH5A 1VIWA 3VU2A 1FOBA 4MAVA 3PZNA 3PZUA 2YJQA 3WUFA 2WZHA 4Z2LA 2WMIB 1O6IA 1BFNA 2WMIA 1YQ2A 1BGAA 4PMVA 1JF6A 3OG2A 1U33A 4RE3A 1TE1A 3AOFA 2D22A 1J9YA 2AMGA 5DMYA 1SMAA 4BQ3A 4JAWA 2BY1A 1BG9A 4XV0A 3CZ8A 5I24A 2XFFA 4MNLA 3CHDA 2BY2A 4JHOA 1UUQA 1I75A 1HT6A 4AD5A 4AD2A 1HX0A 1AVAA 3UERA 1ISVA 3O2LA 1JZ3A 4MNMA 1JXKA 2WMGA 3VGBA 5IFTA 1HKMA 3AHTA 4HOXA 1FP8A 4NI3A 5A95A 4Z2HA 2Y5EA 5CSYA 1M04A 3ZO9A 3CPUA 2YA1A 1JZ6A 3VX0A 1JI2A 3ZR5A 4TVCA 2YOCA 4DM1A 5A6KA 2RGMA 4ZFMA 4EANA 5FCZA 4W88A 4LYQA 1LL7A 4UZSA 3VGEA 1WZLA 4C7GA 3G6LA 3AYRA 1BYAA 3PZIA 1X6LA 3W26A 3WNKA 2C7FA 5BROA 4U31A 4ZXLA 3SIMA 3W6LA 4PEEA 3AHZA 5FL1A 2BVDA 2FDMA 1E6RA 4M80A 4UOJA 4OOUA 2VUYA 3ARUA 1UWTA 1TG7A 1QNRA 1CBGA 4NSBA 1J01A 3GH5A 3MS8A 1KCLA 3T2QA 3ZM8A 5ABEA 2G3MA 3VGDA 4JIEA 1NH6A 5LYRA 1BSIA 5A8NA 3M46A 4DM2A 4QLKA 4F79A 4QAWA 1W91A 2J62A 2VZUA 4HA3A 2X8RA 3QR3A 1LG2A 4QLLA 1C7SA 1E9LA 1H11A 1DWGM 4GI6A 2X05A 1JD9A 1J12A 4AD1A 1E70M 3VINA 5ABFB 1QW8A 4HZ6A 4UFMA 5E6YA 1UWUA 3WL0A 1UWQA 4LX4A 4M29A 3T2PA 2CEQA 4V2XA 4J3XA 3BCFA 1KXTA 2WVTA 4Z2KA 4ACZB 3T2OA 3GNOA 3J7HA 2VRKA 2YKKA 1V6YA 3W25A 2F8QA 4GKLA 1VF8A 5I78A 4M56A 1JI1A 5HXMA 1W9VA 1GCYA 1GOMA 2A3EA 2VCBA 4FK9A 1V0MA 1W32A 4U2YA 3BSGA 2JALA 4JFWA 3W0KA 3F5JA 3ZJ8A 2ZUTA 3CMJA 2CHOA 2WYSA 4UFLA 2PBGA 3VD5A 1U2YA 3ZT6A 1QHOA 4S3JA 3AJ7A 3VDHA 2WSPA 3WDQA 4B9YA 1HJQA 1I1XA 2A3HA 2J78A 1JZ4A 1ISYA 3KWXA 3N04A 1TVNA 4M82A 5A3HA 3GXMA 3EDFA 3ARQA 4P8WA 5A8QA 3L4TA 4P8UA 3BAYA 4D6EA 1US2A 2X0YA 1M01A 2PI6A 4BQ5A 4WK9A 3MUIA 3ARVA 3N9KA 1EDTA 2W4XA 3WL1A 1CENA 1GZJA 4E8DA 2WC3A 1NWSA 1K9TA 2D23A 1E5NA 1OWQA 1C7TA 1EGZA 4CU7A 1JFHA 1XH0A 4D6CA 2HVMA 2BFGA 4W8BA 2VMFA 3ZSSA 3W53A 1XCXA 4QFUA 1L0PA 2WM0A 1GW1A 2VI0A 3T0AA 3K46A 4A4AA 1JIBA 2DSVA 4R27A 4Z2GA 2WAGA 2CITA 1UHVA 1EH9A 1E3ZA 1LG1A 1TCMA 1ZL1A 3IAQA 2E9LA 4AEFA 4AISA 5EB8A 1UYQA 4PMDA 1V0LA 3VMOA 3L2MA 3I3DA 2YA0A 1EDQA 3WMCA 2UY3A 3HJEA 4UOQA 4MJ4A 3N11A 1TA3B 4MDOA 1V02E 4WKFA 1FHLA 2GSJA 3O6AA 3TA9A 4P8VA 2E4TA 1PX3A 1WPCA 2ZXQA 3CUJA 3RO8A 1K6AA 2XIBA 1QHZA 3ALGA 4HZ8A 1DEDA 1KQYA 1ISWA 3WUGA 4LPCA 2VZOA 3THDA 1B30A 4OOZA 1HKJA 1PX4A 4PN2A 2E40A 1FFQA 3GH7A 5CGMA 2O9TA 2J7EA 1UWIA 3N12A 2JF6A 4WIWA 2YA2A 3WUEA 3AHYA 2YBUA 1KB3A 2D0HA 3PZGA 3AMDA 4W85A 1E56A 3T0DA 2YL6A 4J7RA 4PTMA 4B15A 2ZX5A 2Z1SA 3AIBA 2DQXA 4DWSA 4AD0A 1Z32X 1CZ1A 5C71A 3MSGA 2EPLX 1DTUA 3WQ4A 3WDRA 4HPHA 3SCNA 4EKJA 4PUDA 4TVDA 1HVQA 5JH8A 2CETA 1EQPA 4AZCB 1XH1A 2D1ZA 3KE0A 3PTKA 3VNYA 1W1YA 5M03A 4WJXA 1JDDA 5AYBA 3WH7A 3CUHA 4ZEPA 3VDCA 4D6DA 4W8AA 1UR9A 8CGTA 1JDAA 5E6ZA 2WXDM 1QI4A 2VQTA 4OBSA 4GXPA 1VEOA 1B3YA 4MB3A 3K8LA 1J0KA 2J25A 3GBEA 5EFDA 3PN8A 3CGTA 1L8NA 2XGBA 5A2BA 2W92A 5CSUA 4QLJA 1J10A 1HL9A 3NSMA 1QVBA 2FHBA 1K9FA 3WF1A 2J74A 1JZ7A 5AYIA 1ZBCA 4HMEA 4AMCA 2MANA 3SUTA 3NDZA 4X0VA 2CBVA 1SR0A 2WHKA 1J0ZA 5DF0A 1AQ0A 1KQZA 3VO0A 1B3XA 1QOXA 3DHPA 2FH8A 1AMYA 1UQYA 2WVSA 3WQ5A 1HF6A 2E3ZA 2AAAA 5DO8A 1D2KA 1CGTA 2CIPA 5CG0A 3MMDA 1HXJA 4F9JA 1UKQA 1E6SM 3TP4A 5GPRA 3VGFA 3CZKA 4GQQA 1KGXA 3MMUA 1G01A 4MJ2A 4PMQA 4MTVA 2CHNA 3KL5A 3SEPA 1JYVA 4MAZA 1PAMA 1HJXA 1D3CA 3WH9A 1B1YA 5GNZA 2DSZA 3BAWA 3EDDA 4GO9A 2VVNA 4PTXA 4KRTA 1OD0A 3CBWA 3VIPA 1G5AA 1WO2A 2YIHA 1ISZA 2DDXA 2VX4A 2X2YA 1UD3A 3CZEA 5D9NA 2WNWA 2YDSA 1W9PA 2DT1A 3MUAA 5IDIA 5A2CA 1VFFA 1B9ZA 2JE8A 3SCUA 2YL9A 1WDRA 2ZX9A 3NYDA 4AY1A 3NJ3A 1D7FA 4QCFA 1OGBA 2WC4A 1GORA 1QNQA 4KGLA 5ABGA 4AZCA 3SCVA 2PWHA 2ZX6A 1H2JA 2W62A 3L4VA 1W9XA 2CKRA 1I1WA 4MPKA 2D3NA 3OLGA 4P7NA 1WAWA 1E71M 5DT5A 3CTTA 3VNZA 3AIUA 3L4YA 5FKYA 2F61A 5IFPA 1MFUA 2J4GA 7A3HA 2CXGA 2TAAA 2QPSA 2IUZA 3CZJA 3WNOA 1OT1A 4HPGA 4ZE4A 3VM7A 4GI8A 1B0IA 2OSYA 3WF0A 1JZ2A 4J3WA 1F4HA 3DHUA 4ZE5A 4CD8A 4CVUA 3WDIA 2E9BA 3AIWA 3ARYA 2WVVA 4F66A 2DSKA 2VTFA 1DWIM 3GXFA 2UWFA 2WHLA 1CGUA 3L4UA 2J7HA 2XWEA 2CPUA 2QMJA 1CXIA 2GJXA 1E6PA 1J0IA 3L4XA 3WQ8A 3W4RA 2WKLA 1BVNP 1V3LA 3OLIA 3U5YA 4HTYA 2VX5A 1GOWA 1MQPA 3AZSA 5CXPA 4AIEA 1WCGA 2V5CA 1Q6GA 2O9RA 1UQZA 4HMCA 1N82A 3GDBA 1E40A 2Y8VA 1W3HA 2BS9A 3CMGA 4J3SA 1WDPA 5CJ5A 1EA9C 4EAMA 1UD5A 2ZUUA 1QW9A 3E1F1 2XVKA 1ZB5A 1CLXA 3NSXA 1GOQA 3SCPA 1JD7A 3PZMA 4HOZA 1OD8A 4ATLA 5CPSA 1ZS2A 1RPKA 1W3KA 5GNYA 2CERA 4CCEA 3CZGA 1QI5A 2ZE0A 1HVXA 1KBKA 3SUVA 3SUWA 2J7GA 3D5HA 5BWFA 4LGXA 1W2VA 3WY1A 1P6WA 1WDSA 5I5RA 4WSJA 1VFOA 3WQVA 1VENA 1R7AA 4CD5A 1E15A 3ZMRA 3DECA 3SUUA 4GI9A 3IANA 3UG5A 1W1TA 2EPNA 2WCSA 4W84A 3GXIA 2XTKA 1QNSA 4FLRA 4W87A 1NOFA 3POCA 4TX8A 1HJUA 2VURA 3AS3A 1QI2A 4AD4A 1XD1A 3K8KA 4X9YA 5TD4A 5DEZA 1BYDA 4CN4A 4MDPA 2UY5A 4RE4A 2ZX7A 5M17A 3WQWA 4AZ5A 1H49A 3WEOA 1H0GA 2JEQA 2CBUA 3HU7A 3B9DA 4PMNA 3FW6A 2J7FA 5BXRA 3AISA 1U30A 4H41A 3UG3A 4D1JA 3VDAA 1G94A 2DT0A 1W3LA 4YHEA 1OCQA 4AIOA 2A3CA
chains in the Genus database with same CATH superfamily
1TV2A 2X2GA 4L56A 3BW2A 4MWAC 3FKKA 3PUDA 4TVUA 5T8GA 3OGRA 4OBRA 2N87A 3UNTA 2V69A 1R9ZA 3IWPA 4UXDA 1W1VA 2M08A 4IGMA 3E38A 3BK0A 2Z25A 3EDJA 3D0CA 4G50A 1H60A 1MQQA 1NFPA 5A8OA 2V68A 3URQA 4GZIA 2NT0A 3HM7A 3I3BA 2QR6A 7TIMA 4GYFA 3GR7A 1QPOA 1I2PA 4H7ZA 1ITUA 2EJAA 4AYSA 2VVSA 3TN4A 3H7UA 4QP0A 4J35A 5D30A 3BW3A 4JTSA 3W7EA 4PUKA 1YPIA 4KIRA 1NEYA 3C2EA 1JCNA 1FCVA 1QNOA 1SYTA 3C61A 1ROUA 1ELSA 3O6YX 4OU1A 1Q6CA 1QPRA 1Q6LA 4JYDA 3IUDA 3VKBA 4L3NA 4XZWA 3WD0A 3STCA 4H6QA 1O12A 2C1IA 4C91A 1WA3A 1TCDA 4P7OA 4DRNA 2DV0A 1J4HA 3VD9A 4WXYA 3RR1A 4HKPA 3VA8A 1FH9A 3W72A 1GQNA 3WD1A 4FXFA 3EEZA 1X96A 3HG2A 3W1UA 3GTIA 4JL1A 3O5OA 3B9OA 3A47A 3CM4A 4D6GA 2FAPA 1JRBA 4JCLA 3GC2A 4L1WA 1FP9A 3RLUA 4HZMA 1RQBA 4K7VA 1TWWA 1O95A 1EKOA 4MY8A 4LB4A 1FWCC 3A4JA 5AYZA 4KGJA 4M6PA 3HOJA 1KM2A 3NXLA 3NXFA 2GJLA 3OYZA 3THQA 1FA2A 5HW7A 2G8ZA 3FFSA 2WVVB 1UW9A 1J0YA 3RM8A 3WFZA 1AH0A 1FKLA 4WX2A 4IISA 2J77A 1FH8A 1ZK6A 4W5ZA 2DJLA 3OQ8A 5GNXA 4M8UA 1IV8A 4WDXA 5I23A 1ICSA 1Q6RA 1VP5A 2ZZ5A 3DYOA 2YYUA 8TIMA 5AHLA 3T6CA 1GVYA 4DH0A 1VPQA 3UWEA 4XZMX 4ERAA 4R5EA 1BQCA 2REQB 2ZC1A 2ZX8A 4Q8PA 1V0NA 3UZYA 3MQTA 3AI0A 2Z24A 1SJCA 2E9MA 3VMNA 2VM8A 3W24A 3LI1A 2W91A 4C7DA 1CI1A 2MNRA 2ISWA 2ZDRA 1TQXA 1CGVA 1GEHA 1CT5A 1HP4A 5G2WA 3PRBA 1RR2A 4KMQA 1TV7A 3V1HA 3CC1A 1LRQA 4RLIA 2C79A 1XWYA 4M81A 4IJBA 3H2FA 1UD4A 3GDKA 1EJSC 3APGA 3RU6A 3PBWA 5JU6A 3MU7A 4R7OA 1RD6A 4QG8A 4ACYA 3NI6A 1D6OA 1HO4A 3LCFA 4A21A 4UQBA 3SY5A 3AO0A 3VC6A 5A6AA 1MMFA 1RCOB 4HYVA 2C8NA 5LHEA 4FALA 1TV4A 3VK5A 1KGUA 2HCVA 2WBGA 4JTGA 1DQUA 3TWAA 1ISXA 2Q8LA 2UBPC 4CCZA 4MNJA 1CXHA 1WKYA 2VUNA 1TPDA 3HF3A 4Q6JA 4DUWA 2QUTA 4WY0B 5GVJA 4S3AA 3E02A 5E93A 4RZBA 1K02A 3DG6A 3TONA 4LC6A 4LUJA 3GG1A 4HIBA 5D37A 3U57A 1DJZA 1CECA 4W89A 3DC8A 1UMLA 3ZZ1A 5AVNA 3Q67A 5CPTA 3NQBA 4UQ9A 1JG9A 3S6OA 1VJZA 1W1A1 3OA5A 4OIFA 1OF8A 1XRTA 1JPDX 3WLMA 4WJ8A 3FKRA 3A64A 1K9DA 1MFVA 4RNJA 1QPQA 3VZXA 3RM9A 1F40A 3PULA 4GABA 2ITKA 1HGWA 4DWSB 3W81A 1KWKA 3VUSA 1Y7VA 2VL4A 1F3EA 4A05A 3FXYA 2XH0A 4Q8UA 3U48A 4KRUA 5ECVA 2CXEA 4OWGA 4IFKB 3IRDA 2JZVA 1XKYA 3UZXA 1PZ3A 1WBJA 3PK7A 4L1XA 2GGJA 5G4EA 3W27A 7CGTA 3NQ8A 3D46A 3G6MA 4WCJA 1O60A 1EZWA 4PMXA 3E2SA 5CH9A 2DPEA 2IS7A 2YDAA 3IJ8A 4ZB0A 3ALFA 4HU4A 1AQMA 3GDTA 5TIMA 2HTMA 4MOZA 4W93A 2EEXA 4DXXA 4QITA 4QRNA 4ZQCA 4LAUA 1EJRC 3OODA 2EPMX 1R46A 1TVPA 1VBHA 4B5XA 4B3KA 1ZALA 4IQCA 1J4IA 1L8PA 3W28A 4NZ5A 1RALA 1UR0A 1BVZA 1J6YA 3C2VA 3IUHA 2G97A 1OX6A 1KNWA 4ICCX 3NWRA 1GT8A 1XIBA 4EOUA 4KQNA 3VX1A 3SY1A 3W87A 3TDFA 1RJQA 3VNMA 1EPVA 1BL4A 3F4CA 3GU2A 1MI3A 4Q7IA 4GACA 3CV1A 4V15A 2ZBTA 3S5SA 2OYKA 3WZ0E 4CKQA 2YCIX 3LQGA 4HNOA 4M51A 3RILA 2VZVA 4U3CA 2XP9A 5EYWA 1PJ9A 5AC8A 1EOMA 3WLRA 3M0XA 1T41A 4GHRA 2X09A 1OGSA 4MUPA 5I77A 3W7PA 3IUIA 5JMUA 2BOFX 3BAKA 3MHUA 2QCDA 4BHYA 2BWGA 3U7VA 1SSDA 2PD5A 4Z1BA 1ZJAA 3G24A 3VZZA 5BXJA 4N7QA 2I7GA 1O7AA 4NAEA 4QQ3A 4H6KA 3AIQA 3DENA 3QV9A 1JQXA 1JXJA 3IJLA 3M64A 3W6MA 3W1RA 1NP0A 3MKVA 1TJPA 1KFWA 4JNZA 7ODCA 3O0KA 1CGYA 3S5ZA 2K8IA 3RR4A 3SCWA 1OFPA 2GWGA 4EPBC 2FJKA 2HBXA 3II1A 2PF0A 1I6NA 3H9RB 4JCMA 3TVAA 5BXTA 4LW7A 4U33A 2OT1A 1KRAC 3GR8A 1NF7A 3KRBA 3IVUA 3ID7A 5HNNA 3IRSA 3T4CA 3O5IA 4JDBA 1GJPA 1W56A 2ZQVA 2GVLA 3F5LA 2QLYA 2F6XA 1DHPA 2BXYA 2Z1KA 1Q6UA 2OT0A 3WLSA 5G1TA 1UASA 2VGIA 5CZKA 1HJWA 2W66A 2C71A 2PTDA 2XZ9A 1JGIA 1FKRA 4O28A 2J8FA 3G1SA 3K30A 2PBOA 3LCGA 3NG3A 4D1IA 3V5OA 1EP1A 2YLAA 3UR8A 3S1VA 4LUTB 1NDYA 1XD0A 2VGFA 4ZR8A 5C2CA 4F0HA 2V2HA 5J8LA 4GISA 3RITA 1ESWA 4C6IA 2Q71A 3ARTA 1MEHA 4XBJA 1Q66A 3LM7A 2X7WA 1T96A 1HKVA 4ODOA 1NFGA 1PSCA 2G0WA 4IP7A 3O5KA 4JHZA 4NNCA 5BWAA 1Q4WA 3PG8A 4PMYA 2X30A 3EX4A 3WCZA 1IGSA 4DJFC 1DL3A 1XSKA 2ALDA 5LXXA 5I3JA 4C5YA 3WDJA 5T9CE 4KWUA 3WJWA 3CZLA 5HINA 3BMXA 3W7JA 2DG4A 1ICQA 3GTFA 3PUOA 2B31A 2H9AA 4ENLA 4DZ5A 1S5VA 4HA4A 3RPDA 4DUOA 1SJAA 3GU1A 3BZGA 3VAWA 2RJHA 3U7BA 3EKZA 1J6OA 2PPGA 1ZCNA 1PZ2A 3HFTA 2W61A 3LBMA 4XWUA 1XC4A 1G1YA 3QW3A 1QR7A 1CW2A 2QUNA 4C6NA 3TTEA 2WQPA 4DAIA 1K9EA 2WCAA 3GE7A 3NGFA 4C1LA 3N4EA 4LY8A 1CPUA 4MM1A 1H1ZA 4JIQA 4DB7A 4UQAA 2YDQA 1V6VA 4MKSA 1FDJA 4DZIA 4M1RA 1TMHA 3FJ6A 1XIHA 3KVLA 1FWFC 3D47A 3RJYA 5FEZA 1Q8AA 2A85A 3EWYA 1LWJA 5AC6A 4JFMA 3CUGA 4X3ZA 1AH4A 2FQIA 3UESA 3EDKA 5JIWA 4C1NA 3ABQA 3JU2A 1Q7ZA 1KKRA 3CTLA 3UWYA 4UCGA 2MPHA 1GK8A 3ES8A 4DJEA 4IPLA 3QN3A 4MKNA 1X7IA 1FCQA 3MSRA 3AIRA 4YWSA 3WH6A 2WNNA 3PNZA 1CB7B 3M7SA 3P3BA 1LWHA 4P7QA 3THAA 2GUYA 3KX6A 5HR6A 4DZHA 1MQRA 5I0DA 2ZVIA 1SSGA 3E12A 4O1EA 3R6IA 4GJ1A 2Z7KA 3ZYZA 1LORA 3UR2A 1F76A 2ZWZA 1QPNA 6TIMA 2FYMA 4LCQA 1E9ZB 4I7WA 2CLMA 3KWSA 4G2DA 2HS8A 3PF3A 2NV2A 3BO9A 3MP5A 5A69A 3KBVA 1NQ6A 4W86A 1C8XA 2ZZ7A 1ZCOA 2A5HA 5JBEA 1ZENA 4DN1A 2ZFAA 3UR7A 2WO5A 1VFSA 1M5WA 4ZQOA 2AL1A 4H9YA 1E4LA 3HO8A 5HNUA 4GIVA 3PA7A 4JD4A 4ZXOA 4K39A 1P0KA 5DXYA 3AQUA 4ZZ9A 1CLVA 3GXTA 1E72M 3BLIA 3EYPA 1GGOA 2O4MA 2GGHA 2RUQA 3RX2A 1DXEA 1EHAA 1CXFA 1PKLA 1TPH1 4FAMA 1PPIA 4S3BA 3GLCA 4GGBA 3LG3A 3TYZA 1OC5A 2PLJA 1VAHA 1VEPA 3JUGA 4MLRA 4E2OA 4HSOA 2XU2A 1UG6A 1CXKA 2UV8G 1CLKA 3OB8A 3ARZA 1MUCA 2B7PA 3SECA 3MSDA 5M5DA 2NX9A 2PGFA 2X7VA 4Q4OA 3LU2A 4G7EA 4CNNA 3YPIA 4Q8WA 4BF9A 1VEMA 1Z7AA 4H00A 4RUBA 3BXWA 4BS0A 1TPB1 1M1BA 4CCCA 1TB3A 5A8MA 2DIJA 5DCEA 2WNZA 4AFYA 2YFOA 4LEQA 3CUXA 1F61A 3TE9A 4R0XA 2OOGA 4L9YA 5KZMA 3KADA 4LUSA 3TDBA 1OFDA 4NHVA 2WANA 1XV8A 2ZA1A 2ZUVA 2QIWA 4TO8A 1DPMA 1VB9A 1X98A 2WJDA 3O9NA 4B5TA 2J75A 1S3TC 3TC5A 2JK2A 2Y8KA 3BLFA 3FX4A 3CUIA 3KS6A 1N2VA 5I6SA 3CLWA 1E73M 3ZJ7A 3XINA 3QPZA 2QCDB 3KZSA 2XM2A 4GZJA 4O10A 5EMMA 2CNCA 2V5DA 3WBAA 3RU8X 2PWFA 2ZUNA 3H2OA 4QCEA 3A3HA 5A6MA 5IRPA 3DG3A 3GO2A 4ROPA 1TFVA 1PTAA 1KW1A 3ZT5A 4L6OA 4IQLA 1E6ZA 4W8LA 4PH6A 1QK0A 4LBUA 5CZSA 3FY1A 1QK2A 1H1NA 2NXGA 1C8QA 3P74A 7TAAA 1GVOA 1AD1A 3V35A 4FA3A 4CNUA 3QC0A 3C2OA 1LOSA 3PJWA 3GU0A 3H23A 2CU0A 1XR2A 3NM1A 2RDTA 4FXRA 2D0FA 1UMYA 4GNVA 2D69A 1NWUA 1XG3A 2FKPA 4UTWC 1KRMA 2PWGA 1DJHA 2WVUA 3T0TA 2ZOXA 1LZOA 1SJDA 3QOMA 4PRWA 2TPSA 1GVIA 1FX6A 3N17A 3R4IA 4A3UA 4A3YA 5D8WA 1Z9AA 3IIZA 2PC8A 4QM1A 1HKIA 4U3AA 1XQKA 3MMWA 1RA0A 4E3VA 3H2MA 1F4AA 1UKTA 1MSSA 2B7OA 2QF8A 3TR9A 4TXEA 4YTUA 4O19A 1HQTA 4JTDA 2QW5A 1BEUA 1OM0A 1YEYA 3BQ6A 4F8XA 3PZ9A 1Z89A 2VT0A 3DDMA 1R87A 3OPSA 5G1MA 3T08A 3EDEA 3BMBA 3H53A 3EPMA 4S2BA 1IT8A 1MXDA 1XIIA 1QNPA 1HJSA 3PJTA 1OG0A 3AXIA 3KBJA 3RF9A 2VR4A 2C13A 3GZAA 4FXSA 5BMXA 1WKFA 3AXMA 5LA2A 4XAFA 2ACSA 4UOZA 4D6IA 2ZC8A 2XPKA 1QJWA 3W7DA 2GVYA 1CXEA 4H2HA 2VCDA 2BY3A 3NQ6A 5CC5A 3T9PA 4AWEA 4UMAA 3KXQA 5CLTA 3WH8A 1GUVA 3M1ZA 1C3FA 2GQAA 2G4FA 5JBFA 2YGYA 3ITLA 3ERPA 4YLWA 3KS5A 1NOUA 2VDHA 3UXDA 4J3TA 3P0XA 1UA7A 1R8LA 3LDVA 3C2RA 2VGBA 4O4VA 1WXJA 4L4LA 3PBGA 4W5UA 2PV2A 3SM0A 5CGQA 4ILSA 3TZFA 2WHJA 3FVDA 4H6RA 1JNSA 1SMDA 3P8IA 4ATDA 3VGHA 3VPLA 4UNIA 1JDCA 1K6WA 2XSBA 5I03A 2VO5A 1C8YA 1NY1A 4E2DA 3C8NA 2GQ8A 1XGZA 2YZRA 4ML9A 3H4XA 1EXPA 4IT6A 1KWGA 4V33A 3WLOA 4TMCA 4C6FA 2QUVA 2ISVA 3H55A 2F21A 2WZHA 1RBOB 1DJYA 2WMIB 3LBCA 4GBDA 2J9YA 4DNMA 3BZJA 1BGAA 1JF6A 1OG6A 2DVUA 1EJVC 4PTDA 3S1UA 4BQ3A 4R3UA 3WLHA 3G8RA 4YYCA 4QJ1A 1DTNA 4MNLA 2NUWA 3QGAC 2R94A 2R8WA 1WBHA 1Y65A 2ZRVA 1YXCA 1QAPA 5G1YA 3ZLHA 5BOOA 3UERA 1ISVA 3BQ5A 2AGTA 3BV4A 1F05A 4KQZA 3AHTA 3L65A 4K1WA 1NSGA 1FCUA 4RX0A 2GSHA 1GKRA 1KCZA 3HQ1A 5CSYA 3ZO9A 4GC3A 3ITCA 3NQ7A 4MVAA 4TVCA 3LGGA 1KFCA 2DUAA 4EANA 3KAGA 2AL2A 5FCZA 4W88A 1W1IE 4LYQA 4PUNA 3VGEA 1ZSXA 3AYRA 4GQGA 4HARA 3M0IA 4XVDA 3OA3A 3T05A 2C7FA 2ZZ1A 5FJTA 4QIBA 3P67A 4ZXLA 3SIMA 3W6LA 1DIDA 4YXGA 2BVDA 2PP3A 4GGQA 2DW6A 4UOJA 4OOUA 3PAOA 3V1PA 1F6KA 4MWAE 1D7HA 2ICSA 4JFLA 3TAKA 2KE0A 5C9ZA 1BSIA 1W91A 5C7HA 1EYEA 3CV2A 3W74A 5FAGA 1R3WA 1MUWA 3P61A 1C7SA 5HKGA 1UCWA 4XQ6A 4WVXA 1E70M 4KCVA 2GOKA 4UFMA 4AY8A 1UWUA 3WL0A 2Z29A 2CEQA 3I7SA 2Z6IA 4HNLA 4AH7A 4IMEA 2JQXA 4HD5A 2XFWA 1OHLA 1FCBA 1T11A 1IXNA 2F8QA 2QCGA 4HJFA 1UZHA 5I78A 4A8RA 5K9XA 2R91A 2JGYA 4H8NA 1GCYA 4JN8A 2G3FA 2VCBA 4S3DA 4IFOA 4KFNA 3U2EA 2WYSA 3BE7A 4UFLA 1XW8A 2X40A 5F4SA 2P8CA 4HB7A 1TIMA 3CAKA 1AZ2A 5I07A 3WDQA 4B9YA 5HQLA 3B0XA 2J78A 3UVAA 4AVFA 1TPFA 2E6YA 2PPPA 4JX4A 4RKAA 4RR4A 3W1QA 3JVAA 4J40A 1PB0A 2PI6A 3UGRA 4BQ5A 3CV6A 2F2DA 3WL1A 4E8DA 4UTKA 3SSZA 2D23A 3O1NA 4FNSA 1E5NA 1OWQA 2DJXA 2HVMA 4DRMA 1YDYA 2VMFA 1XCXA 2GGEA 1CCWB 1GW1A 3NOYA 2C1HA 2IPFA 4LC8A 4Z2GA 3QW4B 5TQLA 4J1OA 5DIVA 1FKGA 1EH9A 1A5UA 3H2EA 5C5YA 2Q01A 1A0EA 5EB8A 3W84A 1KT1A 3G1VA 1V0LA 4IGHA 3L2MA 3WMCA 2UY3A 4UOQA 4QS6A 4XAPA 1PWLA 4ZO7A 4B5VA 4NIRA 2GSJA 2H9AB 1JDEA 4XIMA 2PEVA 4GYJA 2ZXQA 4REQB 2PURA 1K6AA 4I5XA 2XIBA 4HZ8A 5CC6A 4IL0A 3LQLA 1GKPA 1KQYA 3G18A 4LRSA 3LN3A 3MHFA 3WUGA 4LPCA 4JQ3A 4CLMA 5CZTA 3FA4A 5AVHA 3EPOA 3ODKA 3GH7A 1XKJA 1TJ1A 2BOEX 3AHYA 3M16A 1BQGA 4I6VA 3HMJG 2OQLA 3WLJA 3PZGA 2RUSA 4W85A 1E56A 1YKWA 3QKEA 1Q6HA 2ZX5A 4MZ8A 2PAJA 3UD6A 3W2MA 4JTRA 3MSGA 1EJUC 4IIFA 2Z1XA 1MDLA 4GGHA 4TVDA 4LUTA 3MP4A 5JH8A 3VCCA 2YSWA 1G69A 4U4MA 1XH1A 4LVGA 2J66A 3PTKA 1W1YA 3V5CA 5M03A 3S9IA 1Q2SA 5AYBA 3E2QA 2HV5A 4W8AA 1R2SA 3O5EA 4HHPA 1UR9A 4QEEA 8CGTA 5KZEA 5H1WA 2WSRA 3EKLA 1RD5A 4GXPA 2Z2UA 3TKFA 1VEOA 2ODOA 3M9YA 4MB3A 4N2YA 1BRLA 1J0KA 4EPEC 3CGTA 5A2BA 1J10A 3SN1A 1QVBA 1IIGA 2E5CA 4HA0A 4OFCA 3WF1A 1MZHA 2R14A 5AYIA 4X0VA 1W37A 1SR0A 2OX1A 4EX4A 1J0ZA 3VO0A 2FJUB 2WVSA 5DO8A 4MLJA 4H1ZA 4JN6A 5DLCA 3DFYA 1F8AB 3MMDA 1Y5VA 4F9JA 1UKQA 4J2MA 5GPRA 2PODA 1Z6KA 2I17A 1UROA 3CZKA 1KGXA 3MMUA 1A7XA 1YNPA 2PDKA 3M5ZA 4BI6A 4GY1A 3L5AA 4YCPA 4MAZA 2OZ3A 1YPFA 1B1YA 4WGHA 3BAWA 5D2XA 5FJUA 2YXXA 3RGTA 5DMLA 2ANUA 6ENLA 1QZ2A 3RAOA 1JUEA 1BXNA 5DMNA 3VNIA 2R82A 2YIHA 3EIPA 2DDXA 2VX4A 2X2YA 4M0XA 1UD3A 5EMUA 1U5JA 5D9NA 3OW1A 2PC4A 4IPXA 3MUAA 4TX9A 3SCUA 2D9FA 4QZVB 5FF7A 2YL9A 1A5CA 4JTAA 4AF0B 2BOGX 3GC4A 5FI8A 4AY1A 1AW1A 1SO5A 2NWRA 4C6QA 1QRQA 3DKLA 1RLCL 1VKFA 2PDWA 3NO5A 3AUOA 2E6FA 3ZWTA 4DPQA 1GYLA 4MHBA 3TK7A 3A23A 1FD9A 3T4WA 4I9TA 2W62A 3L4VA 2OQYA 1I1WA 4TW6A 2D3NA 4P7NA 1E71M 3VDGA 3UWZA 3AIUA 3VZYA 4XTDA 2F61A 4P2VA 1MFUA 3GTYX 2CXGA 3SADA 3CT7A 2OFNA 3TJXA 4HPGA 4GI8A 5XINA 4ERIA 2GPTA 4KESA 2J24A 1H51A 2VKZG 3OOBA 3WDIA 5CPNA 1FWDC 2E9BA 1I2QA 3AIWA 3GAKA 3AYTA 1OF6A 2QYGA 3IS4A 3GXFA 4JBRA 2UWFA 3GD6A 3V75A 3KZ7A 3LNMA 5JVLA 1S3HA 2GJXA 4CNSA 3L4XA 3W7OA 4XD6A 5C9RA 3W4RA 4B92A 3VKDA 3BLEA 4DELA 3H26A 1XIJA 1V3LA 1S5TA 1PZ1A 4HTYA 2X1SA 1MQPA 5AFDA 1XPYA 1UP3A 2BDQA 2PFHA 3ITOA 3UZ5A 1AG1O 3M43A 3GVVA 3WQCA 1DJNA 2ZTJA 4EAMA 2ZUUA 2FTPA 4BFAA 1M5YA 4FOJA 3F2CA 5HJLA 4CQ8A 3KAOA 1ZS2A 1U83A 5GNYA 2CERA 1ADDA 1PZ0A 3UQAA 3KAIA 3C56A 3E3HA 4HHHA 1KBJA 5AHIA 3L12A 4MJMA 4PUMA 3WY1A 1ME7A 4L4MA 1R7AA 5HUOA 1XLDA 5B7YA 2QXWA 1E15A 2YR1A 3SUUA 1A5KC 1M7PA 2VP8A 2WCSA 2XTKA 1XBYA 4S3FA 3T0CA 4W87A 4B4FA 1VBGA 1NOFA 3TW7A 1ME8A 1DXIA 1XFCA 3POCA 1HJUA 3LS9A 2FB2A 3AS3A 4AD4A 3K8KA 5TD4A 4CN4A 1BYDA 3KRSA 3TZNA 1C8VA 4IIGA 2YX0A 1W3NA 3WEOA 2WJFA 3L0KA 2NQ5A 4O1DA 4F2BA 3C0SA 1TR9A 5FJIA 4KEVA 2VFIA 2RSEA 1H7WA 4E5TA 5BXRA 1W3IA 1N8IA 2W9MA 1U30A 2PGEA 3UXIA 3N9SA 2OEKA 3HV8A 3UG3A 1G94A 4L72B 3G1FA 1W3LA 3QH2A 3CO8A 1EPXA 1A53A 3TW6A 3NPXA 2RHGA 2QCEA 3OTRA 2POTA 1TTIA 4PBEA 1CX9A 1JPIA 2ZA3A 3BOXA 2QNEA 4HSNA 5I09A 1GHRA 3UWUA 2OLHA 3REQB 4ROQA 1Q2RA 3ARSA 3TYAA 6TAAA 3HA1A 4P7RA 1GPFA 1OFRA 5LIXX 1R86A 2C0HA 1XRSA 1NWRA 2XFYA 1V0KA 1Q6EA 1E9YB 2ZUSA 2BZNA 2HK0A 4IGNA 3O07A 1BLIA 3TWBA 3W00A 3B8SA 2YBVA 4GVGA 2G3IA 5AECA 5BOEA 4IMDA 3APYA 4A8LA 1UR2A 4O1FA 5I00A 3LMYA 3H8AA 4YL2A 4DXKA 1ENUA 1U5VA 4LYKA 4WKHA 2D0GA 1N8FA 4ZB2A 4C6KA 3DAQA 5LIUX 5FL0A 4ODRA 1AK5A 4EACA 2CESA 3V7PA 3BGGA 1XIMA 4YVXA 2GDUA 4Q33A 4B9ZA 1QHPA 2VJXA 3GXDA 2QCMA 4MZ1A 3CWNA 2Y2WA 5AB3A 1V6XA 3OBEA 2Q5AA 1ICPA 2P3ZA 4TTGA 4XVEA 4H8VA 4POCA 1SPQA 3VOIA 1E44A 2XVPA 1DIEA 1XBVA 2ABBA 4LAWA 4LAYA 3GNPA 3KEHA 4U2ZA 3BG5A 1FWHC 4GO8A 2OSWA 4IIEA 4TQTA 4N19A 1EWDA 4I7VA 1QOPA 3IJIA 2PRMA 1KM6A 1D9EA 1RAKA 4Y8FA 5DFAA 1EQCA 2VC9A 1JNEA 1R5YA 4DRSA 3EBVA 4FLOA 1E6QM 3WEMA 4IM4A 3WBEA 2O9OA 4AU0A 3PZVA 1E1CB 2WBKA 2EPOA 4HGXA 1TPVA 1YBQA 1RV8A 2FZ8A 1RJRA 2AL2B 3AICA 3CQKA 4OUIA 3BAIA 1TYGA 4UFIA 1G9HA 1RH9A 2Z00A 3TNOA 5D4YA 2PDGA 1H63A 3RXZA 1PKMA 5LSMA 4DUVA 4AC7C 4OJYA 3N2XA 1UWSA 4WF7A 2RDXA 1IWPA 1W9UA 3AMGA 2NLYA 1L6WA 1V02A 1JAKA 3QTPA 1XUZA 4E6MA 2ATSA 2XN0A 4JFSA 4NAEB 4Z42C 2VZSA 4N6EA 1YDVA 2CZ5A 1MW2A 3KL0A 4AWUA 5IHSA 3LY0A 1NFBA 2W5FA 3BAJA 3IIXA 4Z1AA 4DRJA 4O1BA 4Q4KA 1DXFA 1BVWA 1F3TA 3GPKA 4QE5A 2GK1B 2XH4A 1ZLPA 3NURA 1VJSA 2ESCA 2QIIA 1SVDA 5FEWA 1TJRA 1D8WA 3RGCA 3S2CA 3QMRA 9CGTA 1U22A 1V51A 4I9MA 5D9PA 2DGAA 3P6LA 4O14A 4ZENA 4EXAA 4IMFA 4U85A 3VKAA 3KBNA 1W5QA 2XJ7A 5F1VA 5I02A 2D2OA 3NQFA 2QJHA 4FR1A 1SQ7A 1TV5A 3HG3A 1BF6A 3LMZA 4KT2A 1V77A 3WLLA 4DJEC 1EC8A 1YYAA 4RZ4A 5D8ZA 5AYXA 3RO6A 3KACA 2ZIDA 4AIUA 4FLSA 3M6YA 3O6DA 1PVNA 4I9AA 3ZJKA 1Y5WA 3V3WA 3VNJA 4O11A 2A2IA 3RPMA 4ACZA 3PRDA 4QE4A 2AOSA 1XLAA 3ONBA 2PDPA 2VGGA 2EAWA 5LNRA 2X0SA 2QGHA 5EMYA 5CLWA 2RDUA 4GH1A 2E09A 1SFLA 1V8EA 3HN3A 2CLPA 3WLPA 1Y5XA 1R9XA 2AQVA 2INFA 5EL1A 3CL8A 1A0DA 4ECLA 1MW1A 4Q3MA 3LRLA 1KM1A 2EULA 5HJYA 3SGZA 3HQOA 2LLEA 1RSCA 3FGCB 4WOZA 4QJ3B 3QRHA 3ABRA 3UY7A 1M7JA 3QV6A 4AC1X 4H3DA 4LRTA 2G95A 3B0PA 5DCDA 4A8IA 4E4FA 4MWAA 3U2OA 4I9JA 4MY9A 3RFAA 2EPHA 5FACA 2Y1HA 2Q09A 2HROA 4E4UA 3TSDA 3G5EA 3INPA 1JPHA 3B3DA 1QO5A 2PUZA 2VHLA 3BJSA 3TYUA 1V7AA 2M2AA 4UQCA 5CSRA 2HISA 4CEUC 3I6RA 1UA3A 4LNCA 3WK0A 4YWIA 3W1AA 1F8IA 2FVLA 1KTCA 1P5BA 1SUXA 3BLOA 2VRQA 3NCOA 6PTDA 4I5RA 4JN7A 4NJGA 4D6FA 3O5JA 1GYNA 4CGTA 2J8GA 4UMBA 5HNRA 4XAKA 1EO5A 3C0LA 5HR7A 2AQWA 1PXGA 4PB4A 3GWQA 4KCTA 2A4AA 2Q3OA 3QEZA 3GTNA 3EX6A 3STPA 4JKKA 4ZFCA 4D72A 5T91A 3R8GA 1N8WA 4NKCA 1BHGA 3L4WA 5HWBA 1TZZA 2PS2A 4AEOA 4JTJA 4XAYA 4FF5A 2RH9A 3HPZA 3MCOA 2OYMA 4IGSA 1RZMA 4Q7NA 1BTCA 3GU9A 2MNTA 4TV6A 3O7UA 3AHVA 4GBUA 2XIJA 3HIJA 3EOSA 1CEOA 4HN8A 4OZOA 2E28A 3K4AA 3E6EA 2G41A 4DZ3A 5HBFA 3HQPA 4A8NA 4IJRA 5H6HA 1JYNA 5REQA 3SRKA 1EHNA 1I0DA 1Q65A 2WMHA 3GVGA 1ZBKA 2HS6A 4YHGA 4NASA 1AJ0A 1T6MA 3GHUA 4MKVA 4IL2A 4MSPA 4NJHA 3A13A 1VRDA 4EWJA 1GNXA 4N0RA 3T40A 3E5PA 5C6MA 4GYKA 1NM9A 3BJTA 5C70A 3TQKA 1NF0A 1G0CA 1FKSA 4QT2A 4YS1A 3K4WA 4HYWA 3GFZA 4JEQA 3WDHA 3USBA 3IEBA 4B5NA 3ZOAA 2VEGA 3E2VA 4GX8A 3W9ZA 4UQDA 2XN2A 5A5WA 3ABZA 2H3BA 3N4FA 4HNCA 4RE2A 1DORA 1KCKA 1RK6A 2AQOA 1ZBVA 5T26A 2VENA 1EA0A 4LAZA 1ZJBA 3PTDA 1NWTA 1TIWA 4EK7A 2HRWA 2QCNA 2BV9A 3CWHA 3PSVA 5CPLA 3LPGA 3RIKA 3CHEA 1I45A 3DX5A 4GH3A 3S1WA 5SWUA 2DZSA 5FF2A 4CNTA 2OO0A 1XJBA 3EA2A 4I8DA 3SRFA 3WK1A 1WZKA 2MF9A 2VC7A 2Z1WA 4JTHA 3CEUA 2CCRA 1M65A 2XIIA 5K2ZA 3COTA 4H4IA 3WEZA 4AZ6A 1FHDA 5KTLA 1XLJA 2BVYA 3PPFA 4N42A 3PPHA 3WLNA 1X39A 1HZYA 2OB3A 4KH2A 4PMJA 3LXAA 2P0IA 2XG9A 1A4LA 1W3TA 4HPJA 3C2YA 3K4DA 1H7RA 2HK1A 4NJIA 2PMQA 1KFLA 6REQB 4M5PA 3FAPA 1UD8A 1OFBA 4IXXA 4NNBA 3SJNA 2QDHA 4R9XA 3WIJA 2Y63A 4QG9A 3CLMA 3H21A 3NO3A 1PUDA 3AJXA 3E5BA 4TMBA 2R24A 3SR7A 2B7QA 4PEKA 4TOQA 4DJED 1IEIA 5I3IA 4LS0A 1GQIA 1KXVA 1VHCA 4FPSA 1Q6FA 3UWQA 3KAFA 4CNOA 2VNCA 2E6AA 1QMLA 4L80A 3TOYA 3IIOA 2WB5A 4BCEA 1GTEA 5LNSA 1SZGA 3HQNA 4Z08A 2WHMA 3NGJA 4YPJA 2UY4A 4ZPWR 5D02A 4J3UA 4HU3A 3HG4A 4S38A 4AXKA 4U86A 2XP6A 2OZ8A 4TU1A 2DT2A 1XS2A 1JAEA 1HUVA 5BRPA 4LFYA 1DVJA 3MC5A 4FHAA 4XZ9A 3VABA 4Y2WA 1WP6A 3O15A 3W75A 4LVDA 3SZ8A 3M0KA 3TTSA 3VD4A 3B8TA 1FWWA 3NM3A 1AD4A 1YNQA 4RCXA 4V1XA 4ZSUA 4IIHA 4CQCA 2BXZA 3CPRA 1LL6A 1OCBA 1TTQA 3A3WA 3O5LA 4J4NA 2XP5A 1E0TA 1DOSA 4XX6A 4ZTYA 3R0DA 5AHFA 3L66A 4DWSC 3QFWA 5EBAA 1JYXA 4LCRA 1YHTA 1YDNA 1JFXA 3TFXA 1QOQA 4GIYA 1M9HA 2X1IA 1UOKA 1EIXA 3DOPA 3LXCA 3CIVA 3NQAA 2VCCA 2XFRA 2YLLA 2CFFA 3S0CA 1PEZA 2C6QA 4D8AA 4PUJA 8XIMA 2NQJA 2DSUA 1GOOA 4IJCA 2IPWA 3E9AA 4I90A 1HN1A 1OADA 1ZCCA 1TCOC 2FB3A 1L2QA 4O0QA 4EXBA 3DBPA 1JR1A 2OQHA 2Z0IA 4H6EA 1QI0A 5CAHA 3S6TA 1FH7A 4PTNA 3P0WA 1XSJA 5A8GA 4CVWA 3BPWA 3KCOA 4J3ZA 2OTDA 1K70A 3G1DA 1UUOA 1GQLA 4QDMA 3PTQA 2V30A 3T44A 1FXPA 4LF2A 5E0FA 2XVNA 3G0SA 2WMJA 2R1LA 1XLGA 1POJA 4ES4A 1YRRA 1LCOA 1BGGA 4NRRA 4O13A 1NARA 4QISA 4HMNA 4OHQA 1XLLA 3LTPA 3QGKC 4YN5A 3G8EA 3MWAA 3RG6A 1VFUA 1PHQA 1GVEA 4DUXA 3D6NA 2WZIA 1FWJC 3QPYA 3BURA 3VIOA 1TPC1 3ZQ9A 1JNDA 4DLFA 3AMKA 3MV01 1KBLA 2I9EA 4W9OA 1P1MA 5I3DA 5FSEC 2AAMA 2Y0FA 1ZHAA 2ZE3A 3CL6A 1WKEA 5HMSA 3B04A 1ZQ5A 5AC4A 2VX6A 1FWNA 4DF1A 2OVLA 2ZDSA 4GK8A 4F40A 1OYAA 4IHCA 1U1JA 3FYOA 1MXSA 3THUA 3TN5A 3DUGA 5LA0A 1JUBA 1KM3A 3TU9A 5AY7A 1M03A 1G7UA 5BYWA 3SUSA 5LA1A 3GW0A 1T7LA 5DRCA 1FUYA 3BARA 3VM5A 4GG9A 1WE5A 3QHMA 4B4HA 3L0NA 3S2NA 2Q3RA 3U2ZA 3I3EA 3PRAA 3TFCA 1EYMA 4Q8MA 4N4QA 5DXXA 2H90A 3M0YA 1P4CA 3VCRA 2GSEA 5BXPA 1FFRA 4DYKA 2ZR5A 3LHZA 1LTDA 3LHVA 2GJRA 3EMCA 4R7JA 3DHFA 4X63A 2PB1A 2PF8A 3DIPA 1IYXA 5I79A 4MGGA 3SCTA 4C5ZA 2BASA 2J27A 4AB4A 4UTUA 1SM9A 3DC0A 1XRVA 3R43A 1FKXA 4BR1A 1BF2A 4XBSA 2GL5A 1SFTA 3E0IA 5EMLA 1PO9A 1EIBA 2GQ9A 1O94A 1S5WA 4JFTA 2YCJA 3DG7A 4HU8A 1A3WA 4PL2A 3KOZA 3RLVA 4GNJA 5H8UA 2XGZA 5A6TC 2ZRWA 1SZRA 3VIMA 4QBXA 2L2SA 4EE9A 3B8WA 3W7MA 1PBGA 2G3NA 4N4PA 4QEHA 1LRNA 4JQ1A 2V81A 3WELA 5EA9A 1H09A 3TA6A 4JXCA 3Q65A 4AZGA 2VOMA 4V28A 3W88A 4HOWA 2HE8A 2FVKA 3OGSA 1FAPA 1PDZA 1TJ0A 1KO0A 2JFEX 2J7CA 5A6BD 3PM6A 3F4VA 1CDGA 1EOKA 1SW3A 3CB8A 3GQYA 4HYRA 3AROA 1OINA 4IMCA 3B97A 3PBVA 3SGUA 3CHFA 1M7XA 3KZPA 3EGJA 3QJAA 1C90A 2QJIA 4N9CA 3TOPA 4C6DA 3R0KA 2NXIA 4AHQA 2VFHA 2XPBA 2VC5A 3EWWA 2DU2A 3G22A 3WK3A 2PDXA 4WKAA 4NNRA 1E0WA 4YTRA 4ADUA 4F2UA 5HUPA 3WK2A 1ZP3A 2DORA 3A4WA 3P5YA 3W22A 3O0FA 1A5BA 5DY3A 5A6LA 3L21A 4XUYA 1FKKA 4HMDA 2ACRA 3L5LA 1E0VA 3GH4A 2RURA 4BQ4A 1G7VA 2F9RA 2R1KA 3MKKA 4O8RA 2PCEA 2QPUA 3RN6A 3WJZA 2QUUA 2V0TA 3QOKA 3A3XA 4WSKA 2NSOA 1UWRA 3KFTA 5IM51 1XSIA 4TW7A 4NYYA 5FOOA 6XIAA 3WLQA 2VEMA 1EXBA 4IQEA 5M1TA 1EL3A 1BPLB 5KZDA 3G1HA 4PMUA 5JH2A 1NAL1 1LOQA 5D09A 2HJPA 3ES7A 1EX1A 1XDMA 2P3EA 1PCKA 1T8XA 5BCAA 4L61A 5K3VA 2UY2A 1B54A 2YCLA 3IKDA 4TR9A 3TCSA 5F2LA 3VIGA 3ITXA 8RUCA 3E0LA 3TTYA 1Q63A 3TTQA 3VVGA 3UPBA 3RJXA 5B7ZA 1OCJA 4R9OA 7REQA 4YNGA 4PL1A 1JZ5A 3B7XA 1XRFA 3OG3A 2QCLA 2D3LA 4MY1A 4IF2A 1S5NA 4FNPA 5BMWA 1MZRA 1AW5A 2CLFA 4A2SA 1AH3A 1OVDA 4KBXA 4PMZA 1JULA 4ZOAA 2PWEA 4ZS6A 4LVBA 2ZA2A 3CUFA 2ISFA 3T8QA 1H4PA 2D20A 2BGQA 4Z1DA 5DT7A 3GG0A 3W7CA 1HKWA 3VTRA 2OZ0A 1SZEA 3W2KA 1G6CA 3VU2A 5D2WA 1FOBA 2R6OA 4PUWA 3E2RA 3WUFA 1R2TA 1BFNA 4JS3A 4LBRA 2HBVA 2P10A 1FKFA 3OG2A 1EF3A 4QGCA 5F1UA 2E7FA 3EA3A 3CAWA 1U33A 5C55A 2PN0A 2D22A 1J9YA 2OLAA 2FFIA 1SMAA 3R5EA 4JAWA 1M3UA 4XZLX 3MI2A 5I24A 2XFFA 4UMCA 1GG0A 3CHDA 2NXHA 2BY2A 2RFGA 4JHOA 4MFEA 1IXPA 1HX0A 3UQNA 2JKAA 2OO6A 3O2LA 1VH7A 1H7XA 3VGBA 1NSJA 5IFTA 3QY6A 1FP8A 5A95A 4LSBA 4LVAA 4DZ2A 4JTUA 3PJUA 1L6YA 3IJDA 3F2BA 1XLCA 3CPUA 4FF7A 2YB1A 1JZ6A 3ZR5A 5DBTA 1Z41A 4JTIA 2YOCA 3S4TA 1S2UA 2CW6A 1YMYA 3V4BA 3SFWA 1OJXA 2A7PA 3M0MA 4V1YA 3E49A 1WZLA 2YCLB 5H2ZA 4O0KA 3G6LA 3UPMA 3BUVA 3DH7A 4B5WA 4NZJA 5BROA 3GG7A 3KLKA 4PEEA 5FL1A 2FDMA 4NAFA 4QSFA 1VFHA 4XKYB 1FKWA 4DJFD 1CBGA 4NSBA 1J01A 3GH5A 4WSHA 3TCEA 4PE8A 3ZM8A 3KW3A 3O5PA 1XYBA 2G3MA 2WV8A 4N6FA 3USZA 4RPPA 3VGDA 4JIEA 4DRKA 5LYRA 3W6YA 1IEVA 3BG9A 4J2PA 4QLKA 4F0RA 4QAWA 2P4VA 1K03A 1Q6IA 2D2JA 2X8RA 2PDYA 2PWUA 4QLLA 3WFAA 1TWIA 4NNAA 3NTPA 1H11A 1DWGM 4AF0A 3RNDA 4EWND 1J2WA 2BVWA 3MJMA 1DV7A 1MUMA 3UA4A 2RAGA 4HZ6A 2GOUA 3H7VA 2GWNA 3OVPA 2FZ9A 3PWGA 4M29A 3MI6A 3KTSA 1KXTA 2WVTA 4Z2KA 5HJXA 3T2OA 3GNOA 3J7HA 1FWRA 4S2CA 2A79A 2VRKA 1V6YA 2VYOA 4C65A 1VF8A 4PRTA 5LIKX 3BGJA 1F5ZA 1JVWA 1JI1A 1W9VA 1GOMA 3LSBA 5TNVA 3LCIA 1YTDA 3FYPA 3HFYA 3LGDA 4JFWA 3F5JA 3W0KA 4RNIA 2NVDA 4L9XA 3TQPA 3CMJA 2CHOA 1XINA 3VD5A 3ZT6A 1FKHA 2ZTKA 4OV9A 3A22A 3TLLA 1WUEA 3F4NA 3KABA 3TC6A 3GIYA 1Q7MA 2UZ9A 5CPOA 3EWZA 2WSPA 1UC5A 1JCMP 1HJQA 4DF0A 3Q4DA 4JOMA 3N04A 5A3HA 3ARQA 4P8WA 5A8QA 4ORMA 1S5MA 4ZO8A 2HQAA 1YATA 1Z69A 2CLIA 1LM1A 3QF0A 1Z48A 3ZVHB 4F48A 2NQZA 3MT1A 3ZVHA 4MWAD 1J79A 2KR7A 2QVHA 4Q8OA 3ARVA 3N9KA 3DFOA 1EDTA 2XSXA 4CQBA 1CENA 1GZJA 2Y7EA 3GAYA 5AC7A 4F0SA 2F7FA 5I06A 3MA8A 3VI2A 4WJEA 1EGZA 4W8BA 5DANA 4YTTA 5JXQA 3IIPA 1L0PA 2VI0A 4LAOA 3T0AA 3VAVA 3K46A 1K77A 2WKJA 4A4AA 1JIBA 1ZNNA 1XI3A 2WAGA 2CITA 4U84A 1UHVA 3BWWA 4C6BA 1LG1A 1TCMA 1ZL1A 4K2SA 5HWJA 5J6EA 4PMDA 3JRKA 3VMOA 1ZP4A 4IG2B 3C6CA 3PAJA 4ZVJA 4DBSA 3TQVA 1XYCA 2IKHA 5BZAA 1HTIA 1V02E 1FHLA 4NX0A 5L6UA 3UZZA 3N6JA 3CUJA 1GTHA 3QSTA 5D04C 1QHZA 1QT1A 3EOUA 2OCZA 1EF2A 1ISWA 3TJ4A 1JNTA 2FVMA 3S5YA 3THDA 3SSJA 2FMOA 1PX4A 1R6WA 2E40A 4NJJA 1QNVA 3W1XA 1KFKA 3GHTA 3WYZA 2O9TA 3KUMA 2J7EA 2VD8A 2HEJA 3N12A 3GKAA 2GGIA 3GVQA 4CQDA 1I0BA 4WQ6A 2ZR6A 5LKYA 1ZJHA 3T0DA 2YL6A 1PTGA 4J7RA 4PTMA 2H3DA 1MEIA 4K36A 5C54A 2EPLX 4NAFB 2R1PA 3GIPA 3WDRA 2I57A 4EKJA 1B3OA 1HVQA 1BD0A 3H4GA 1P5QA 1EQPA 4H9UA 4AZCB 1TO3A 2D1ZA 3CU2A 3UA3A 3KE0A 4YYFA 3WQDA 3H22A 1PHWA 4IT4A 4WJXA 1KM5A 3WO8A 1W1B1 4WD0A 3R8HA 3DN5A 3SO7A 3S2MA 2ZVRA 4R34A 3GUGA 1QI4A 2V67A 3M47A 4ZB5A 2PV1A 3KRZA 3PVFA 4EP8C 1BTMA 4QLJA 3M0LA 1HL9A 2TSYA 3NSMA 2I9UA 3M5XA 4GXMA 3CXOA 1TKKA 1K9FA 1R3RA 2FPVA 3B03A 2RUDA 2CLLA 1Q45A 3P93A 3DGBA 1KQZA 1QOXA 3DHPA 5HWNA 1AMYA 1UQYA 1FKDA 2E3ZA 3AALA 3F1QA 3LZ3A 1LQ2A 5CG0A 2EG8A 3N73A 1E6SM 1FRBA 3VGFA 3LRMA 1M41A 3NQMA 1GWJA 3M4HA 1HJXA 3WH9A 3LUTA 5GNZA 4GUGA 2DSZA 4GC4A 1FWEC 4PTXA 4KRTA 4TIMA 1OD0A 3KP0A 5G4WA 4UNKA 1G5AA 1XFBA 1ISZA 4ZQPA 5MKGA 1RA5A 2GUUA 4FP1A 1OCNA 2YDSA 4XKMA 3QQ1A 3NL6A 1Y0OA 3WQPA 5A2CA 4UUIA 3Q2DA 1B9ZA 2OMAA 4UTTC 1JQVA 2ZX9A 4INFA 2QGYA 3CWOX 3LD5A 2J6XA 1OFOA 1FY6A 4QCFA 1OGBA 2WC4A 2PGRA 5FF4A 4PCFA 3P84A 1ONRA 2GLKA 5CCZA 4AZCA 3Q45A 1A0CA 1JEZA 3LENA 3IPWA 5LIWX 1N1AA 3CQ0A 1AMKA 2G50A 4ZPTR 1TVLA 5F2GA 4JNMA 2P76A 4QG6A 4HPXA 2V5KA 5C9UA 3NQ2A 1NDVA 4ZQRA 2NWSA 2GVJA 4DY1A 2TAAA 2QPSA 1OT1A 3VM7A 1AFSA 1O1HA 4QROA 3WMLA 2PBCA 4HBEA 3TV8A 1F4HA 4LAVA 4MMWA 4CVUA 3EKGA 3E0WA 3ARYA 1IXOA 2DSKA 3IV3A 1DWIM 3DKJA 3IV8A 4LOCA 3PANA 1CGUA 2J7HA 1A4MA 1SR9A 3B06A 1CXIA 4UNLA 1X8CA 2QS8A 4XAGA 2O7SA 2PA6A 2BP1A 3WQ8A 4BF5A 2WKLA 2ZQTA 1BKHA 1XBXA 3CV7A 3TSBA 3U5YA 2HPIA 4W9TA 1GOWA 3EEGA 5CXPA 2WSYA 1WCGA 2QDGA 1KBIA 3I10A 3WQOA 3N9RA 4YMZA 1KD0A 2B0MA 3CMGA 4J3SA 5CJ5A 4QS5A 3OBKA 4C6MA 3TQ0A 1ZB5A 4L6DA 1CLXA 3NSXA 1GOQA 3R7MA 1JD7A 1BWKA 1VYRA 1TX0A 5CPSA 4JTFA 2DZWA 2QVNA 1JCHB 4IP4A 4CCEA 3PNUA 1RCXB 1DQXA 4UTHA 1XUUA 3A24A 5J5RA 1HVXA 1AZ1A 1EGVA 1RXOB 5EU9A 4LU0A 5BWFA 2AGKA 2TYSA 4ZA0A 5FAJA 3T78A 3OEXA 4KW2A 5I5RA 1J4RA 1VFOA 4CD5A 3IACA 3UCCA 3ZMRA 3C0JA 3B0YA 3HBLA 2VFDA 3KCJA 3PUEA 1T99A 1K4GA 1WOAA 1OY0A 1S2VA 2NQHA 1QI2A 4J9JA 2DQWA 5DEZA 6XIMA 3HURA 2ZX7A 3BLLA 3QM3A 4F0LA 1EBGA 3QKZA 3I7RA 1KM4A 1YXDA 2IQDA 3QR0A 4F2TA 3AXKA 2J7FA 3EX3A 4H41A 1VFLA 3AC0A 4D1JA 2ATMA 2J13A 5LNWA 4YHEA 2BLEA 2DZXA 4XD4A 2YL5A 3RCYA 5AN7A 4A3RA 1HIZA 3MB9A 3P8JA 1EP3A 2ZZ4A 4MB4A 4Q8VA 3BMVA 3A5VA 4W7WA 3W7HA 2XUCA 3GRIA 1F9CA 2PCQA 1UR8A 3PC0A 4WGXA 1EEPA 3ZS4A 2E77A 3NOEA 2ASHA 3NPVA 3LHTA 3Q37A 3KCEA 1K1DA 4KCUA 3TC3A 5A6JA 5TBOA 1TMQA 4QSHA 1ZY9A 1KTBA 3W76A 5RUBA 1OYBA 1TV3A 2E8ZA 1HKKA 3B9AA 1YX1A 3P60A 4Y6GA 3NA8A 2EO7A 4PSPA 3ARXA 2CBJA 1FKBA 3BJFA 3DXIA 3S9ZA 2EHHA 1YBQB 1SZNA 3PZOA 2BGNE 3BAXA 4HPNA 2E68A 3QPEA 1OFQA 5HAOA 3VILA 1XG4A 4Y90A 4HCHA 1ADOA 1IZKA 1R85A 4O16A 1P6CA 4ONVA 3WENA 3C2FA 2MLZA 2H6RA 1W1ZA 3NQGA 4IIBA 4GINA 2QT3A 3KTXA 4QIUA 3NIYA 3ARWA 4GUIA 4DJFA 4ODKA 2PDQA 3W1LA 4MB1A 4OT7A 3VD3A 3NPWA 4HK7A 2D73A 4L4PA 4PODA 2FZNA 1DJXA 2FDSA 3BTNA 1AUSL 3C5QA 4JHMA 5DN1A 2FLIA 5A6BA 3QYQA 1KGWA 3WJSA 4ZPVR 2R1MA 1VBJA 3OIXA 2ZXBA 2V2CA 3OZPA 3LLXA 4G7FA 1KFJA 4F4RA 1JCTA 3S47A 1H41A 4E2BA 2GGGA 2XYLA 1R30A 2J79A 3CJPA 3QLLA 1DWHM 4NZ1A 4JFVA 3HZ3A 3B40A 1J93A 3I6EA 2BHZA 1RPXA 3V0TA 2CZEA 1WYIA 1KV8A 2EBNA 1V3JA 2WW5A 1V93A 4PCSA 1U79A 3VIJA 4AWTA 4X0NA 4A2RA 4FXJA 1DP0A 1WZAA 3DYMA 4LAXA 1CYGA 2O9PA 1X6NA 2VELA 4BWLC 1E3XA 1OT2A 3W70A 3WLIA 2XHYA 5EBUA 4IQJA 3GM8A 4UCFA 1C9HA 1GVQA 4C6EA 1GW9A 1JZ8A 2IXUA 4MFDA 3WF4A 1E0XA 1BYCA 2WWDA 1R7OA 4Q4QA 4L1GA 4US5A 2I5QA 3ENLA 3QQWA 3ITVA 4AUBA 4KFOA 5ABFA 4LQ1A 3TAOA 2CZFA 4M1BA 3KTCA 4PCTA 1FHVA 5AYYA 4TX0A 3UJFA 1NTHA 1Q3NA 3FVMA 2X42A 3L5MA 1WAUA 3IGHX 1E1FA 3NZQA 4F3HA 5C2GA 4UFKA 4G1NA 4CN6A 5M3WA 4LNYA 4NYUA 5CAKA 5J04A 5JUVA 2Y24A 3GX9A 4JFJA 1L1PA 1UKOA 2OG9A 4QJ4B 3O5MA 1EBHA 3HPXA 4BJHA 3N6HA 1P0BA 2QEZA 2OKOA 1D8CA 3UP8A 2P88A 5E09A 1EQ3A 3IGUA 3BANA 1GOKA 4C6PA 1NOWA 4GZ7A 3TLQA 2DT3A 4WUIA 3GNDA 4JFIA 3KM8A 4IZGA 3KVKA 1LL4A 4E0CA 4PMOA 3EWBX 2JBMA 2O56A 3UBPC 1FKTA 2XINA 2DH2A 4CEXC 1M53A 5FESA 1H61A 5L9FA 1PWMA 2ZUMA 4IQ2A 1LQ0A 2AKMA 3CUZA 5BRQA 3LYEA 5G5IA 5GJPA 3QGVA 1XYLA 5DCBA 4Z2IA 1H3GA 3UI6A 1IEQA 5H91A 2WJZA 3V18A 3PP7A 1PYMA 4MPQA 4N02A 3GYEA 3DHDA 2B7NA 4PFMA 1YE4A 4AAJA 1WXYA 3R25A 4K68A 1GEQA 5GJMA 2V63A 4ML4A 3RHGA 5K7JA 3LHUA 4NRSA 1XP3A 2G5WA 4G5DA 1SFJA 4H7VA 3DI0A 3WQ6A 3F5KA 1VD6A 1XYFA 1GVRA 2F38A 1CWYA 3VOHA 3V36A 3FJLA 1DWJM 3LPFA 5CPQA 1ZJIA 3VMPA 1ODUA 1A5LC 3FAXA 3ONCA 4FNUA 5C9WA 3QHOA 3FHAA 3CNYA 2QJNA 1FTXA 1S2WA 1JL8A 2EJ1A 2WOQA 3W29A 2JIWA 4ZOCA 1XISA 3FEQA 4IMGA 1EGMA 1ODZA 2V38A 3MKCA 3N2CA 4B91A 4JX5A 4MZYA 2VRJA 3LOTA 4G8TA 4DO4A 5DITA 3GB6A 4YCOA 1O5KA 1B3ZA 2WJEA 4U5KA 3CPGA 3W82A 1LLZA 1AJ2A 1PBKA 4MIMA 4DYJA 4CCDA 1JPMA 3EMZA 4ORIA 3TIMA 3U3HA 4CU6A 1HW6A 4JFUA 4LF1A 4KIEA 1KR0A 1BAGA 3MW7A 2PU0A 2W67A 4GNKB 3AXXA 2OX4A 2XZ7A 4IG2A 4V27A 2AMXA 4LWWA 3WSUA 5LHFA 1QWGA 2LPVA 3VKJA 1OC7A 2C0AA 3IK8A 3QQ0A 3WD2A 5AKQA 5HQEA 5KINA 4DT4A 1VLIA 4C7FA 1KLZA 3EB3A 4Z1YA 1Y8BA 2INZA 3GXNA 2I5GA 2OWCA 2F2HA 3IK2A 4JIHA 3AU2A 1R47A 3HMCA 3I65A 2OEMA 4UBPC 4BF8A 1FJDA 1J4EA 1MVYA 2KI3A 5D05A 3ME3A 4LYPA 1LBMA 3MYOA 3PY2A 5IBXC 3SN0A 3OVRA 1O1ZA 4PTWA 1VGAA 3N2MA 1EJWC 1RP9A 4D9PA 2OWXA 1ECEA 1PKNA 4JQ4A 1R38A 4JKMA 1WOBA 1NDZA 3LCWA 1OK6A 1W3JA 3UETA 4PRRA 4H2CA 1E4IA 5E1QA 3W38A 3LBOA 1HO1A 4US5D 5HQMA 1B3VA 4JFKA 3ZSTA 4KS0A 4KKXA 2HXTA 1P0DA 2WSQA 6CGTA 1CIUA 3MHGA 1W9DM 3BC9A 3TXVA 2BG5A 1W8SA 1HG3A 1LBLA 4NZCA 4D6HA 3WQFA 2FHFA 4HQVA 5K4XA 2J7BA 1IR1A 2RQSA 1BWLA 4GPNA 3R89A 2QQ6A 3JXVA 2ALRA 3TYCA 1TWSA 2BGSA 3CL7A 2OGJA 4ALDA 4L4OA 1UH2A 4Y7EA 1IWBA 3N15A 4DWDA 5FIPA 1JRCA 5MF5A 1SZFA 4QX4A 3VUPA 3EWCA 2W79A 5HW8A 4EPDC 3RRAA 2PP1A 1YPXA 2XM1A 3N13A 1I60A 3R12A 1LWIA 2WK2A 3G77A 1IR2A 4REQA 4MB5A 1OEPA 5BOFA 1ZBWA 1H7NA 4G6CA 3ZWSA 2FMNA 3ZVIA 3PR9A 5AZ0A 1GQKA 4XZNX 1WXZA 3AMCA 2ZRXA 3CASA 2D2HA 3CQHA 3R13A 3N25A 1E0UA 4C60A 3EY6A 3ZT7A 3TTOA 2WC7A 4H9XA 2QAFA 2XN1A 4EVZA 1X1ZA 2PV3A 3OZMA 4HA1A 3R8RA 4GUHA 1B3WA 1LRTA 3W3OA 3LPOA 3NFUA 4GQRA 1T5AA 1E4MM 4HNUA 1XM3A 1WZMA 3GUWA 5D9OA 4F0MA 1B31A 1BG4A 3C0QA 2ZXAA 1R3TA 3LLFA 2HE5A 2V2DA 3WG6A 3AS0A 1E43A 1WB0A 4ICNA 4GVFA 1H5YA 4J28A 5HT1A 4GRSA 4RV8A 2YFNA 1B4KA 4YJ5A 2XH7A 3VOJA 4HHMA 3GDRA 1K3UA 3VDBA 3O06A 1HL8A 1WDDA 4EXQA 3T09A 1C9DA 3SCOA 3FNDA 4WDTA 2DSWA 2A21A 4D71A 1O66A 2DEPA 4TV5A 3S9YA 4AWSA 1NP2A 3FDKA 1J18A 3VIIA 5D32A 1LP6A 2PD9A 3N1AA 4UR7A 2OPJA 1GOIA 5JIPA 1J0JA 1U5HA 1UC4A 2A1YA 3O3RA 2VEKA 1EZ2A 2ZKMX 1KT0A 1BKFA 3M44A 2KFWA 5AC5A 1QPKA 2VX7A 3A4AA 5CGTA 1XPGA 4Q22A 3UI5A 2FGZA 1E6NA 2P0OA 3C86A 1IX5A 3R2GA 1RP8A 2XIQA 4NF7A 3V5FA 2OZTA 3PBYA 1TZ7A 1PS9A 1EFZA 3NRKA 1FDZA 6ALDA 3O6CA 5I3GA 1NDWA 3GXPA 4U5IA 2VEIA 3LERA 1DHKA 1DE5A 1SU5A 4GVIA 3B4UA 1KCXA 2G3JA 2AWGA 5LNUA 2V3FA 4PZVA 3UG4A 3GYCA 3KBMA 1IZJA 1UD6A 1PIGA 3NSNA 3TN3A 3B9EA 2V3GA 4LXFA 4O2TA 1ITQA 3OJGA 5C8BB 3W07A 1TA3A 1MWOA 2PE4A