3FXYA

Acidic mammalian chinase, catalytic domain
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
379
structure length
379
Chain Sequence
YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acidic mammalian chitinase
publication title Triad of polar residues implicated in pH specificity of acidic mammalian chitinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 132
structure length 379
sequence length 379
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3fxyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3fxyA01
2OLHA 1C91A 4MAVA 1GJWA 2GK1B 4AZBA 3S2CA 4DWSA 4M8UA 5D8ZA 1ZU8A 1J11A 3W29A 1JZ6A 1JAKA 3N12A 2YJQA 3RM8A 1V6YA 2FGZA 4D6GA 5A8MA 3AXXA 2Y8VA 1E6RA 4Z2JA 2WMJA 4MTVA 3BLPX 2Y8KA 5A6BD 7CGTA 1BQCA 3WDHA 5D9PA 3WL1A 1AQHA 1BYDA 4JZ5A 5A8QA 1FP8A 5FKYA 2BY1A 4D6EA 3WL0A 2G3MA 5EB8A 1ISYA 4WF7A 1BGAA 2DT1A 2DGAA 1B0IA 3L4UA 2V5CA 1GQLA 4PCTA 1UD6A 2WHLA 2NT1A 3B9DA 4ML4A 4OUEA 2WVVB 4TX6A 3AQUA 4TUFA 4MAZA 4Q22A 3WD2A 5EBAA 1AQMA 1BVNP 1VRXA 3AS0A 3WSUA 4K68A 1SFSA 3BMWA 4M24A 5E09A 1U33A 2E9BA 2CEQA 2ZX8A 3WD4A 4U2YA 3SUVA 4EAMA 4NSBA 3PZTA 4AEFA 1EO5A 4E4PA 1VIWA 3VPLA 1R87A 4AIOA 1CNVA 2PWHA 3RJYA 5I24A 4GI9A 2QF8A 3ZOAA 4WKFA 4P8UA 1E5JA 3DYMA 5BXTA 1NARA 3SCOA 2WVTA 4AZGA 4HOXA 1RPKA 1UD3A 4AZCB 4U3AA 4LGXA 5DEZA 1FH7A 3NSXA 3L4YA 3ALFA 5M17A 4IUGA 3VGBA 3ZO9A 2YDSA 3LPOA 1C8QA 3SCPA 2TAAA 1Z32X 5GNYA 5CSYA 1HT6A 4Z2HA 1R86A 1UQYA 6A3HA 3SUSA 2VOTA 2Z1KA 3D3AA 3PZNA 2WNWA 2GUYA 1K9FA 2XYLA 3OLGA 2WMIA 3MSDA 4GO9A 4U31A 1D7FA 2BFGA 4W89A 2DSVA 5I78A 1QBBA 1FHDA 3HN3A 1OD0A 2C7FA 2D20A 4GI6A 2A3HA 1J12A 1IZKA 3FN9A 1W9BM 2PBOA 4L4OA 1CTNA 3GBDA 1E6ZA 1L0PA 3SCSA 4CCCA 1CLXA 2VTFA 1ZL1A 3A4WA 2XIIA 5HOSA 2OWXA 4CCDA 1MW0A 2D23A 2QPUA 1ZBWA 1BFNA 1HNYA 5E0FA 4CGTA 2W63A 4M82A 1I1XA 2O9TA 4AD1A 3UG4A 3A3HA 3A6OA 1H3GA 4W5ZA 5EMYA 2V3DA 2VCBA 3ARSA 2X8RA 1I75A 2ZWYA 3BSHA 4GO8A 3WUFA 2DSKA 1QNQA 2J7FA 2O92A 5BRQA 3WDRA 3AOFA 5ABFA 4CD7A 3FAWA 1MWOA 2JF6A 5EFFA 2D0HA 3F5KA 4D71A 3T0BA 1W1TA 5CLTA 1HJSA 4AD0A 2V3GA 2XIBA 1KXTA 1W1YA 5BCAA 2IUZA 1D2KA 1EDTA 1XD1A 1PZ3A 3WH7A 1E6XM 2VZVA 2BY0A 1JYXA 3GDBA 5GNXA 3EDJA 4QCFA 4UQBA 8CGTA 1UQZA 1E4IA 1TG7A 1H49A 1JXJA 2XHYA 1UWIA 4UQAA 3VIFA 1RP9A 2WCGA 4WSJA 1WZLA 3AMKA 2JF7A 1W1VA 4OIFA 1FFQA 1PZ2A 4QLKA 1Q6GA 1RP8A 2XSAA 1UR8A 2ZUNA 4ACZA 4PMDA 1PX4A 2XVKA 1TA3A 4CU7A 1NWTA 2WXDM 4W8AA 4URIA 1B3ZA 5LA2A 1PEZA 4KWUA 2YBTA 1V08A 3O9NA 4ZE5A 2GJPA 4U2ZA 4UQEA 1UR0A 1ZBCA 3UETA 1S46A 2WZIA 4XX6A 1KWGA 1UUQA 4N0RA 3W38A 3PTKA 2WSPA 3WBEA 5DF0A 2V3EA 4JKMA 2ZX5A 1KGXA 3U5UA 1O6IA 4DUXA 4OOUA 3ZQ9A 4LYRA 2G3IA 4F8XA 5JBDA 5CSUA 3GXFA 1BSIA 2VQUA 1H09A 4HOZA 1GHRA 1KBKA 3GH5A 1FHLA 3PZIA 4OZOA 3DYPA 3CZGA 2QMJA 2GJRA 5E6ZA 3CO4A 1G0CA 2J7EA 1KXQA 4W5UA 3N18A 4BA0A 2BY2A 1XSIA 5BWFA 1LWJA 5ABGA 4UOJA 4A4AA 1XCXA 4D1JA 1J0KA 1VJZA 2ZXQA 4JCLA 1J18A 4UCFA 1GPFA 3IAPA 1V0KA 3PTMA 4F79A 4D72A 3M7SA 1E40A 2JIWA 2W91A 2Y24A 1FFRA 3WF3A 1JFHA 1MVYA 1Q6EA 4M80A 5I6SA 4GZIA 1MFUA 2ZX6A 3K4AA 3AI0A 2CKRA 1J01A 1A3HA 3AMLA 3AMCA 2Z1SA 4QLJA 4HZ8A 1E15A 2GDVA 1P6WA 1EIBA 4MNKA 1WKYA 1LG2A 2D22A 2DT3A 4GIAA 1UR9A 4BZYA 3HJEA 3U7VA 1UHVA 2YL6A 2GVYA 4AZ5A 2D1ZA 4AEEA 2BNJA 1UZ4A 2DT0A 1XD0A 2ZUWA 3UG3A 2WM0A 1CECA 1PX3A 4TXEA 1YHTA 1GNXA 3W24A 2W61A 3FY1A 4UFLA 3MMUA 2WLZA 5A8OA 5E9AA 3G6LA 1BAGA 1QHZA 3AXHA 5JBEA 3QHOA 1F4HA 1IV8A 4JIEA 1WDQA 5ABHA 5A69A 4NZCA 2XPKA 5A6BA 1KR0A 1XC6A 4PMQA 2AOSA 2VI0A 1V3IA 2VT0A 5M03A 1K6AA 1ITXA 4MNMA 1WPCA 3AHYA 1CGWA 3RDKA 1CYGA 2G3NA 1JIBA 4B16A 4S3KA 6CGTA 1GCYA 1UH3A 3WKZA 1DEDA 2DT2A 4W87A 2FHBA 3AHXA 5FL1A 4P7QA 4MJ2A 4EE9A 1JD9A 7A3HA 2BXZA 3I3BA 4J3XA 1W9UA 1JDDA 4RL3A 1C90A 1TVPA 2CERA 2OWWA 3NDYA 4HA1A 3UERA 3WBAA 5IHRA 1HX0A 1GJUA 1E71M 5ECUA 2WZEA 3WNLA 3AHTA 1PPIA 2PB1A 4BQ4A 5CPTA 1XHGA 3LMYA 1HKKA 2C0HA 5DO8A 4C7GA 5JIWA 2VVSA 1HKMA 2CHNA 1C92A 2VX7A 2YL8A 1G9HA 4LYQA 4GINA 4XB3A 2EO7A 3WNPA 1HVQA 3VKKA 4IISA 5LA1A 1TUXA 2VR5A 4PMVA 2EPMX 2X2YA 1ECEA 3KZSA 2UWFA 4MNLA 1UKOA 4WK9A 1JZ3A 1C7TA 3UG5A 2ZX9A 4TOQA 1GZJA 3TTQA 3FHAA 2VCCA 3VIJA 4XV0A 2E9MA 3WDIA 1GORA 1W9PA 3FNDA 3VD3A 3ZSTA 1J10A 4F9JA 3O2LA 1JAEA 1NP0A 1TE1A 3SUWA 2ZX7A 4JKLA 1UOKA 3WH6A 3UESA 3CUHA 3N04A 3NDZA 4FLRA 3VGEA 1V3MA 2JFEX 3BH4A 1JZ4A 2Y4SA 1EHAA 1QI3A 3AICA 4HZ6A 2VZOA 1JYVA 2NSXA 3E1F1 5M5DA 1M53A 2ZUMA 3BAWA 3SIMA 3NSMA 1R7AA 2HVMA 3VIPA 2ZUSA 5FL0A 1ZBVA 3VGFA 3PZUA 3CUIA 4UFMA 1DTUA 2BVYA 3DYOA 5A2AA 4Z2GA 1FA2A 2DQXA 3T2OA 4AZ6A 3AROA 1JZ7A 1ZBKA 1BTCA 5HDRA 1BLIA 3D5HA 1BYAA 3EMZA 3F4VA 1OCQA 3QHMA 4XUYA 2X05A 1W9DM 2Y5EA 2E4TA 3IJ8A 2X09A 5LA0A 1CLVA 4WSKA 3ZJKA 4PMZA 3GYCA 5CG0A 4J3WA 2XFYA 2ZXAA 2QMKA 4AXNA 4WIWA 5CJ5A 4Z2KA 2BVDA 1K9TA 3CUJA 4ATLA 3N9KA 3POCA 3PN8A 2BHUA 2BHZA 1GW1A 1E6PA 3WDJA 1B90A 3AFBA 2AMGA 4HZ7A 4LPCA 1FP9A 3AYSA 4M29A 4EK7A 1CGTA 4KGLA 5A3HA 1B3XA 1BPLB 2MANA 4ATDA 5D9MA 4D6DA 1D3CA 1KQYA 3WFLA 2EPOA 3T09A 4W88A 2YA1A 1TFVA 1V0NA 1KGWA 1HKJA 1EGZA 2WWCA 2ZE0A 1JYNA 4PUEA 4BS0A 1VAHA 3THCA 2V38A 4UQCA 4NI3A 5A6AA 3OLDA 2WC3A 3MUAA 3VIKA 1E56A 1UG6A 3ZJ8A 1B3VA 1C3FA 1CXEA 1GVIA 4CU6A 1OBAA 2WAGA 3WQVA 3TONA 2VJXA 2GK1A 1KWKA 4W84A 4CKQA 4FK9A 3OGSA 2CIPA 1EQPA 1UZ1A 1V3KA 3WEOA 1H1NA 5IHSA 3CUFA 1HJXA 4AD3A 1HJUA 1E4LA 1E6SM 3MO4A 1NQ6A 3WY1A 1UD8A 1XV8A 2J4GA 2E9LA 4UZUA 1HVXA 1EH9A 1OM0A 5A2CA 1E72M 3QR3A 3SUTA 5A8NA 3SURA 3CZLA 1W3LA 2CBUA 1W3KA 2YDQA 2BS9A 4V2XA 2XWDA 2VX6A 2WMIB 2WCAA 2FH6A 2ZUVA 4U3CA 5CQ1A 1B30A 3ARYA 3AIUA 1Q4NX 3CMJA 1KXVA 3VIIA 1GOKA 1GQIA 4B3KA 4RE4A 4J3TA 4E8DA 1LL4A 1KCKA 4P7RA 4PEEA 4P8VA 4H41A 3WNKA 3AS3A 1X6NA 2FHCA 4C7DA 2EJ1A 2PWDA 5CXPA 2X1IA 4IPLA 1H0IA 2WC7A 1NWSA 3WQ8A 1GONA 2V3FA 3AZSA 3BAXA 2XVNA 1HJWA 2WHJA 1Q6DA 2D3NA 3BGAA 4QFUA 1EO7A 2NT0A 3WD3A 2PBGA 1GOQA 4PYSA 2XG9A 2PC8A 4XZWA 3WDPP 5ABFB 5DFAA 1NH6A 4PSPA 2CITA 3BCFA 1JZ5A 2XM2A 1UWUA 3NIYA 2EXOA 3W4RA 1QI5A 4PMYA 3OZOA 5LYRA 2E0PA 3WMSA 3GTNA 2WANA 3MV11 5HBFA 1EDQA 3VD4A 2WMHA 3WEMA 2ZUTA 3CHDA 2J77A 3VDAA 3PZ9A 3WF0A 1EOMA 1BGGA 2E8ZA 5A6MA 4PTWA 1IT0A 3K8MA 4UOZA 1QPKA 1CGYA 2CYGA 1V6XA 1M03A 1R8LA 1UWQA 1UA3A 2VL4A 1NP2A 2YLAA 3OLIA 3WH9A 1HP5A 4HU0A 4ACZB 3IAQA 4FLOA 3PZQA 4KRUA 3K8KA 2EBNA 3SCRA 3L4ZA 1WDSA 1B2YA 1TA3B 3F5JA 1E9LA 1EA9C 1JI1A 1K9EA 2CPUA 4AC1X 4IM4A 1MW1A 1AVAA 2EPLX 4ATWA 1OSEA 3MU7A 3VTRA 1XH0A 3POHA 3N17A 3L2LA 4PSRA 3RO8A 3WQ4A 1M7XA 1ITCA 5I2UA 5IXEA 3WH5A 1DWJM 4P7OA 1OB0A 5DT5A 1QOXA 4J28A 5TD4A 5IFTA 3WNNA 3CZJA 2W4XA 1V3HA 4J7RA 1QI0A 4CD4A 2CXGA 3BCDA 4PCSA 2J7CA 1E4MM 4R5EA 1HIZA 4PMRA 1U30A 3VM7A 3ARTA 4CD6A 1SR0A 3BAJA 1HJVA 1G01A 2ESCA 1UH4A 1MFVA 1UWSA 5D8WA 1LG1A 1TMQA 5C70A 5FD0A 1WE5A 3TTSA 1BYBA 1DP0A 1XYFA 5FOOA 1HL8A 3OLEA 2GSJA 5BXSA 3O6AA 3W37A 1W2VA 3WUGA 3NUKA 2JEQA 3GXDA 4ZFMA 3ZJ6A 3CLWA 5CGTA 4HMDA 1VENA 3CZKA 1H41A 3W53A 1OGGA 3AISA 1G5AA 2XUCA 2YIHA 2OSWA 1Y7VA 3CUGA 1EQCA 1VEPA 2JIEA 2XSBA 1ZJAA 4HA3A 1KGUA 3VNZA 3PZMA 4GXPA 5AC5A 1C93A 1BVZA 1B9ZA 3MMWA 5A8PA 3T2QA 1HP4A 3ZR6A 5A6SA 5A6KA 2WYSA 2DIEA 2BHYA 2BVTA 3A4XA 1HJQA 4AYSA 2VNCA 1UKTA 1CPUA 4P8WA 3ALGA 3MKKA 1SYTA 3K46A 2CKSA 1C7SA 4J3VA 3W6MA 2VO5A 1JNDA 1JFXA 4X0NA 4PMOA 2BY3A 3CHCA 4PUDA 3CPUA 4CU8A 1QW8A 3VDHA 2FGLA 3QHNA 4H04A 1KXHA 1BG9A 4A3HA 4QAWA 1CWYA 1MQRA 1KFWA 1Q6FA 4HPHA 1WDRA 2D2OA 1VEOA 1BG4A 1VFUA 1UYQA 3AIVA 1V0MA 4JFVA 2J74A 4DWSC 1H0GA 2WLYA 1JI2A 1VJSA 3VILA 2VX4A 4DUWA 1KBBA 1EXPA 5I23A 4NRSA 1UWTA 1E70M 4JCMA 3U57A 1E3XA 2G8ZA 1CZ1A 2ZUUA 5BROA 5A1AA 4FMVA 1B1YA 4W8LA 1DWFM 2XM1A 3PHAA 2XFRA 3PTQA 4X0VA 4V28A 3FAXA 4QLLA 4KMQA 4B9YA 1HL9A 2E8YA 4B9ZA 3PZVA 3VIMA 4M56A 3PZOA 2WK2A 2YDRA 4W7VA 2WCSA 3GZAA 3FXYA 4J27A 1W3JA 2J47A 1XH2A 4JFTA 3VMPA 4B3LA 2D0GA 4UFIA 2J79A 4JFSA 1R7OA 3BAYA 3SCVA 2CBJA 2WKGA 3NCOA 2CCRA 3SEPA 1E0WA 3OA5A 2DPEA 4J3UA 5JIPA 5AC4A 2PWEA 1L8NA 3OGVA 3EDFA 1HXJA 1X6LA 3QOKA 4L4PA 4UFKA 3K1DA 3ZMRA 1KQZA 2F2HA 3RPMA 5AY7A 2JE8A 3BAKA 1J0IA 3NYDA 1HF6A 3KL3A 3RMEA 1UKSA 3KE0A 1VFMA 5D9OA 3W25A 1JD7A 4W85A 3MSGA 4H7VA 3WFZA 3LPGA 3VUPA 2GJXA 5BXPA 2W67A 2OWCA 2DSWA 1PAMA 3U5YA 4X9YA 2A3BA 1PX8A 4M1RA 4Y7EA 1BHGA 1KB3A 2WMFA 4WJXA 1OT1A 4BQ3A 2VRKA 3CHFA 2NW0A 1OD8A 3WNOA 1VB9A 3SUUA 4CN6A 5DMYA 1J0ZA 3CBWA 1GUVA 2ZXDA 1BF2A 3ARVA 2ZICA 2W5FA 2DH3A 1M04A 3KL5A 1QVBA 1E1EA 2VRJA 4H8VA 3N11A 2O9PA 1W91A 1ODUA 3ARXA 2BV9A 4GZEA 1EDGA 3CIVA 2VZSA 3GH7A 2OYMA 3CMGA 4YHEA 1VBUA 4D6IA 1JZ8A 3APGA 4W7UA 1K9DA 2V5DA 2F61A 2PF0A 1E0VA 3B8SA 4ZXLA 2YA2A 4BQ5A 5KZ6A 5AYIA 4F9DA 4OBRA 2A3EA 4TVCA 1Q6CA 4QP0A 3WD0A 2AAAA 3WENA 2Q8XA 3VD9A 4AD4A 2CESA 5I0DA 1PJ9A 1NWUA 1ESWA 1TCMA 4UNIA 1U2YA 1CXKA 1VBRA 7TAAA 2E40A 5A6JA 4WKAA 4W8BA 2J62A 5CPQA 4B15A 2UY4A 1WZAA 1DWHM 2G4FA 3WH8A 3AIRA 1CGVA 4S3JA 2G41A 4HPGA 5E0CA 4DWSB 1MW3A 2RGLA 5FIPA 3ZT6A 4AISA 4KRTA 3AIWA 5GPRA 3WQ6A 3HMCA 2VRQA 1O7AA 2VCAA 5A94A 4TX8A 4DM2A 3LPFA 3RILA 4QCEA 4LX4A 3SCWA 4MB5A 1QNRA 3SCQA 2W92A 2B31A 1QNSA 9CGTA 4M81A 4WKHA 4YHGA 1GQJA 4Q7NA 1E5NA 1NOWA 4C7FA 1NM9A 3MV01 3J7HA 1CXIA 1PIGA 5CLWA 3WELA 4PMUA 4ZENA 3ARZA 4GPNA 1UR2A 2OYLA 4CCEA 2WSKA 1ISXA 2QLYA 3ARRA 5CZKA 1TR1A 3M46A 4FLQA 1N82A 1W32A 2HISA 4J3SA 1MXGA 5F7UA 4W7WA 2DEPA 1ISZA 1EOKA 1QNPA 4P7NA 1LWHA 1QHPA 2EPKX 1SMAA 1W9XA 4WLCA 3W26A 5IFPA 4CD8A 3EMCA 3EDEA 4TVDA 2FDMA 2YL9A 1WAWA 2VUYA 1JZ2A 2QV4A 1G94A 3VM5A 1OT2A 2YLLA 4YPJA 1IZJA 2J78A 3ARPA 1UWRA 4AZ7A 5C8BB 3VD7A 5C71A 4PTXA 1E3ZA 4AD2A 2ZOXA 4YN5A 3RCNA 5A6LA 4TTUA 5BYWA 1J0JA 4ZE4A 2J8GA 8A3HA 2WVVA 5E70A 3N15A 4BCEA 1W1PA 1V6UA 1WNOA 3ARWA 1XRVA 4TVUA 3MUY1 3VGDA 2WMKA 3VGGA 3ARUA 2WBGA 1ZJBA 3MANA 2J7HA 1R85A 5A95A 3W82A 2WW5A 4UQ9A 1JF5A 4OJYA 4U5KA 3AMGA 3OGRA 1E0XA 3W0KA 4AIEA 4W86A 1JL8A 1QW9A 1VF8A 4CN1A 4RE2A 4PN2A 2JALA 3ZT7A 1GQKA 4AZCA 4D6FA 1M01A 1E6QM 4E8CA 4V27A 1UD2A 3QGVA 1JXKA 3SCUA 1XCWA 1MQPA 4UTFA 2OSXA 4P7LA 1LQ0A 2VZUA 4HOWA 5HPCA 2PWFA 1XSJA 1GOMA 2WVUA 3MS8A 3EYPA 4PTMA 1WP6A 4F66A 2XVGA 1UA7A 3WF1A 3T2PA 2YA0A 4D6CA 3N1AA 2FHFA 4LYPA 2UY3A 1ZB5A 1W2PA 1XH1A 4HMEA 1ISWA 1CDGA 2Y2WA 1JDAA 3HU7A 3WD1A 1LLOA 3MMDA 3MUIA 3PBGA 2WWDA 1CBGA 1V02E 3TOPA 3OZPA 4EKJA 2DDXA 3L2MA 3WN6A 5M3WA 3M07A 5A2BA 1BYCA 4HTYA 1CGUA 1UKQA 4JFWA 3AXIA 3QOMA 5EFDA 3PZGA 2DSUA 4H2CA 5KEZA 4OBSA 2UY2A 3UEQA 2IXVA 3M6DA 4AIUA 2YKKA 2CBIA 3A4AA 4FLSA 4PRWA 4AMCA 1JG9A 4N42A 1AQ0A 3UR7A 2JEPA 3ARQA 4H8UA 1WZMA 1V02A 3SCNA 2J7DA 2VX5A 4AWEA 4JAWA 1DWAM 3OBAA 1CIUA 2VQTA 1HKIA 3L4TA 2OYKA 1V3JA 2YBUA 1QI2A 3VO0A 2WBKA 2J75A 3KWXA 4MNJA 4AW7A 1J9YA 1XSKA 3OIHA 3L4WA 3WF2A 2CHOA 4OKDA 1JDCA 1QHOA 1UD5A 2XVLA 6TAAA 2J7GA 1OINA 5I3DA 4DWSD 1PBGA 1EHNA 1CXFA 1NOUA 1ISVA 5ABEA 1LL7A 4A3YA 3VIOA 5BXRA 1CXLA 3I3DA 3IJ7A 4ACYA 3VNYA 3CZEA 4AY1A 1GVYA 5JUVA 3DHPA 4BQ2A 4EANA 4Z2IA 2PI6A 2EQDA 3AJ7A 4CVWA 1QBAA 4PMNA 4HA4A 1B3WA 1E43A 2WVSA 3VX0A 5E6YA 1J0HA 3TTOA 2WKLA 3TA9A 3AS1A 1US3A 5JBFA 3T0DA 4PMXA 2ZIDA 4MJ4A 3BMVA 4GQRA 4MB3A 4JHZA 4D6HA 1RH9A 4BF7A 1GOIA 2G3JA 3GH4A 3WQWA 2XFFA 3JUGA 3ZR5A 2DIJA 1JYWA 4MDPA 1DHKA 2W66A 4AD5A 1DWIM 1XYZA 3TP4A 5HPOA 1FH9A 4GZJA 3WDQA 1CEOA 4KH2A 1MQQA 4E2OA 4CUCA 3UCQA 2WZHA 5IDIA 3II1A 3CZ8A 2GDUA 4NF7A 4PBGA 1WO2A 3GNOA 4XZBA 3K8LA 3TTYA 1VFFA 3GM8A 2XGIA 3AIBA 3EDKA 3S6TA 3WIJA 2ZWZA 2D3LA 1B3YA 1GOOA 3VGHA 1OWQA 1JGIA 1E4NA 2DH2A 4TTGA 4GI8A 5CGMA 5CPSA 1AMYA 3BC9A 1DWGM 2J25A 3AMDA 3BAIA 3WMCA 2QHAA 3WF4A 1H4PA 3WUEA 3AZRA 4UZSA 4DUVA 1W3HA 5D9NA 4MPKA 1VEMA 3L4XA 1W9VA 1UD4A 1OIFA 1NOFA 1QI4A 3FHQA 2WPGA 4QDMA 5D4YA 1G1YA 3UR8A 2XJ7A 4PTVA 1OGBA 1LF1A 3VMOA 2VVNA 3A47A 2X0YA 4P8XA 4MDOA 3U7BA 4CD5A 1V6VA 5GNZA 1F4AA 1PIFA 1KR1A 5FCZA 2FH8A 1LJYA 2EPNA 3AHZA 1JNEA 1ZS2A 3BLKA 3GXMA 4FF5A 4U5IA 4R27A 3VVGA 2VR4A 2YL5A 3VIGA 1GHSA 3AZTA 1RD6A 3BXWA 1E73M 1UKPA 1B31A 1XGZA 4UFHA 2O9OA 4DM1A 3DC0A 3W6LA 5HNNA 3N13A 2XWEA 2CNCA 1V0LA 3L4VA 1E1FA 3W81A 3VX1A 3W28A 4D6JA 2RGMA 2O9RA 1C8XA 3EMQA 1LL6A 2WB5A 3DECA 4HU8A 4W93A 2OSYA 3BSGA 3GBEA 5GQBA 2C8NA 2GJXB 1NWRA 4OOZA 3T0AA 4ZEPA 2CBVA 1A47A 2VMFA 3KL0A 2W62A 4CVUA 3F5LA 3WMBA 3AIQA 1MYRA 2F8QA 2PWGA 3IJ9A 1V03A 5I5RA 3OB8A 3IK2A 1FOBA 2XTKA 3EBVA 1TZ7A 4UR9A 1C8YA 4JL1A 3VU2A 3G6MA 1OIMA 3ZM8A 3VDBA 3WQ5A 3ZJ7A 3FW6A 1CENA 3KEHA 4HP5A 2WHKA 1QNOA 2CETA 1FH8A 1H2JA 2VURA 3CHEA 1E55A 2GFTA 2VC9A 1UR1A 4KGJA 3CTTA 3B9AA 1WZKA 1ODZA 3VOCA 5AYBA 4CN4A 3THDA 3B9EA 4MB1A 3VD5A 1J0YA 1TVNA 3LPPA 3IANA 4JFUA 3ECQA 3GNPA 3ZT5A 3RJXA 3W27A 3WUBA 3VIHA 4U33A 4H8HA 3AIEA 3GXIA 1US2A 3CH9A 2J8FA 4NRRA 2BXYA 4HMCA 2WHMA 1KCLA 1OGSA 3GNRA 1MW2A 2VZTA 3AHVA 2X0HA 3SCTA 1VFOA 2XGBA 3VMNA 3RM4A 4JKKA 3WNMA 3OG2A 3VINA 1H11A 1WDPA 5JH8A 4GQQA 2E3ZA 5I79A 4JHOA 3T08A 3I3EA 1GOWA 2ZXBA 4RE3A 4UQDA 1UH2A 3AYRA 3MUZ1 1YQ2A 2A3CA 1CGXA 4IPNB 2EEXA 1I1WA 3VDCA 2DSZA 3AS2A 3NSNA 1WB0A 5HXMA 4LQ1A 1X1NA 3CGTA 2J7BA 4UOQA 3K4DA 4AZHA 3EDDA 1UR4A 5BRPA 1V3LA 4LXFA 1H5VA 2A3AA 4MB4A 2QPSA 2XVPA 4MADA 3DHUA 2WMGA 1WCGA 1CXHA 3WEZA 1HN1A 2D24A 2D0FA 4AZIA 4JL2A 1SMDA 1V6WA 1MXDA 5DT7A 3ZIZA 4D1IA 4Z2LA 3RM9A 2WC4A 3NJ3A 3RIKA 1E6NA 1JF6A 5I77A 2IXUA 4ZXOA 4UFJA 2UY5A 2YOCA 3ZSSA 4GKLA
chains in the Genus database with same CATH superfamily
2ALRA 4OBTA 3ZVHB 4GYPA 5EMMA 1A5KC 3N2BA 2YJQA 2HE8A 3E5BA 1V6YA 1F5ZA 1EJXC 4H9XA 4A8NA 4KFOA 4Z2JA 2YPIA 4MTVA 1GYNA 4DPPA 1U83A 4GIYA 3WDHA 5D9PA 1AQHA 3GIYA 3I6CA 5FJPA 2GGGA 2DGAA 1B0IA 1ONRA 1W1B1 4JY9A 2V5CA 1GQLA 2WHLA 4WR3A 4QDPA 4TX6A 1JQVA 3UD6A 2OQYA 5CBIA 4Q4RA 4K36A 3WLMA 1ZY9A 2CEQA 4PB3A 3IUDA 1IXNA 3FK4A 4WUIA 4LC8A 4AEFA 1EC7A 1EO5A 4JDBA 1R87A 4AIOA 3RJYA 5F1VA 4GI9A 4B5XA 1NDWA 5KITA 1OC6A 4ZB2A 2DVXA 3UR5A 1NARA 3LBMA 4XZIA 4AZGA 4OV9A 1ZCNA 3OO2A 3TZFA 5HUOA 3OP2A 3L4YA 4IUGA 4LAWA 3ZO9A 5C54A 2YDAA 4O15A 3B8TA 3GHUA 4MLJA 5GNYA 4F2UA 5CSYA 3DUGA 3MC5A 1WOBA 2NVCA 5EPDA 2WMIA 1T8XA 1K8YA 3LDVA 3W7RA 1MDLA 1OD0A 4CQDA 2D20A 1GG0A 3QVQA 2A3HA 2C0AA 2FB3A 1CTNA 4CCCA 1CLXA 3XINA 2VTFA 1ZL1A 4EX4A 3A4WA 2XIIA 4LB3A 2I56A 4A3RA 3GD6A 3W3OA 4ICMA 2AQOA 1BFNA 3M4HA 3NQBA 2ZZ4A 1L6SA 2KZHA 3A3HA 2YXGA 1AA1B 3MY9A 3W00A 2V3DA 3U4FA 1VKFA 2X8RA 3P0WA 1AMKA 3WUFA 1QNQA 2J7FA 4OV4A 3UVIA 4L1WA 4Z1AA 2VFHA 4NUWA 5J5RA 5ABFA 1HXVA 4GUGA 3W1PA 3C56A 2YCJA 4QRNA 2JF6A 3M0YA 2PZ0A 4A8RA 5EFFA 1MRQA 3N19B 4D71A 5BXJA 3ID7A 4DXVA 3KOYA 2V5LA 3KS5A 2IQTA 4L6OA 1Q1CA 3OZMA 3SM0A 2XIBA 3VOHA 4GX9A 2IUZA 4KF1A 3URAA 1UUMA 1PZ3A 3WH7A 2P8CA 3NURA 8CGTA 2PCQA 3GS6A 1UQZA 1TG7A 1JXJA 3CMFA 4UQAA 4CEUC 1FFQA 4QLKA 4Z1DA 2G96A 2WNQA 2G5WA 2HSAA 1XBVA 1TPH1 1XLGA 3W1RA 2RDWA 4PMDA 3WJXA 4LW7A 4LF1A 3CPGA 2ACSA 2XVKA 3M5XA 3PBUA 4CU7A 4ZQOA 4RJEA 1LQ2A 2WXDM 3HO8A 1XIFA 3LYEA 4URIA 1OADA 4GY0A 1PEZA 1XWYA 3M64A 2R1NA 4ZE5A 2GJPA 3LCGA 4JPGA 4Q8VA 2WZIA 3TQ0A 1KWGA 1EJWC 3PTKA 2V3EA 5HTGA 2ZX5A 1EGMA 4GVGA 1EBHA 1SR9A 2G3IA 3IARA 3EZ4A 1LYXA 4HOZA 2ON3A 3VUSA 1QK0A 3WYZA 4IIFA 1G69A 5DQPA 3ABRA 4IG2A 1R3SA 2FVKA 3PZIA 3DYPA 3CZGA 2VOMA 4M7TA 3D47A 3CO4A 1KXQA 1AJ0A 3UPWA 4R7WA 3N18A 2BY2A 3M0KA 2PTDA 5BWFA 2P1FA 4UOJA 4P2VA 4D1JA 1VJZA 2FKPA 3H7VA 2WSYA 3IAPA 3PTMA 2V82A 4GUFA 2JIWA 2Y24A 4I9MA 1L1PA 1JFHA 2YCKX 1Q6EA 4LOCA 2OEMA 1E9ZB 5FF4A 1MFUA 3K4AA 5T8GA 3O1NA 4O1AA 2VXNA 1PKLA 1A3HA 4AU0A 2Z1SA 1QO5A 1A5SA 4L65A 3V5FA 3PP7A 3AU6A 2C3ZA 1LG2A 4H6RA 5I98A 3PANA 4GIAA 1UR9A 2VD9A 1Q7MA 4GQGA 3EB4A 3MKVA 3TW6A 2BNJA 2DT0A 2I1OA 2RDTA 3JVAA 1PX3A 4TXEA 4ITZA 2Z1BA 1GNXA 3W24A 3GHTA 1EX1A 3H2MA 4UFLA 4GK8A 3G6LA 1BAGA 3AXHA 2Y63A 1QCWA 3TWAA 2F6XA 1EB3A 1F4HA 2OQHA 2PF8A 1BKHA 3STFA 5ABHA 4TMBA 3KBVA 3PPCA 3U2ZA 4NZCA 2XPKA 1KR0A 3CQKA 1XC6A 3WLRA 3B8IA 1DVJA 2F2KA 3DC8A 3QZ6A 4YCOA 3O0KA 5HJXA 1RK5A 1CGWA 1CYGA 1JIBA 4JFKA 1X7IA 4LCRA 4TIMA 1OZMA 4MY8A 1Z8AA 3WCZA 1D7HA 2XP9A 3EA2A 4P7QA 3FCPA 7A3HA 4J3XA 3SN4A 1DJYA 1TVPA 4KCVA 3NDYA 4HA1A 2DVUA 4DVOA 4DRKA 3UERA 5IHRA 1HX0A 1GJUA 5CZSA 1YPXA 1JVWA 2PB1A 1HO4A 2CLOA 4HU4A 3CV2A 3FEQA 2WSQA 5K4ZA 1YRRA 3E49A 2VVSA 1V79A 1C92A 4QT2A 4XB3A 2EO7A 3GNXA 4E0CA 3ONBA 2CU0A 2VR5A 1Z48A 3R6IA 4X22A 2O0TA 3OJGA 3B9OA 2G0WA 4CQAA 2V9DA 4DYJA 3UG5A 5C9WA 3VIJA 4XV0A 1CB7B 1OX5A 1BVWA 2E9MA 1GORA 3V1HA 3WDIA 4O17A 1DQUA 4O8AA 1T0OA 3VD3A 1TCOC 1VCVA 3O2LA 1M9HA 1JAEA 1NP0A 4XZMX 4JKLA 3WH6A 2PN0A 1VBJA 4ZL1A 2WM1A 1EF2A 3N04A 1WV2A 1V3MA 3JW7A 2DZTA 3AICA 1FKHA 2VZOA 4LS2A 3HG3A 1ZZMA 3W1XA 3AUOA 5LNUA 1IR1A 2E6YA 5M5DA 1H5YA 3SIMA 3RX4A 3NSMA 2ZUSA 3VGFA 1EYEA 3FX4A 1ADSA 3NZRA 4EWND 3CUIA 3IKGA 1DTUA 2BVYA 5C5YA 4YCPA 3AROA 1GVSA 3HPXA 3EGJA 1Z9AA 3HTWA 4OUIA 1BTCA 3T1GA 2OG9A 1PV8A 1FD9A 1BQGA 5REQB 4HBEA 3BURA 3QHMA 4MLRA 3GC5A 3M7WA 1XICA 3IJ8A 1UBSA 4EF8A 3PBYA 1TZZA 1FWCC 1OFAA 4GYKA 1S5TA 3ZJKA 4FXRA 4W9QA 3GYCA 4F0MA 1F40A 1NELA 2ZXAA 2QMKA 2QR6A 4Z2KA 3GWQA 3N9KA 1GW1A 1E6PA 3WDJA 2QS8A 1B90A 4PTNA 2FZDA 4NU7A 4EK7A 1XDLA 1KM6A 4HNUA 3V0TA 5A3HA 2C16A 4HYWA 3LBCA 3TLLA 1KQYA 3WFLA 3VKJA 1WBHA 1YLVA 2ISSA 1I9CB 4RK8A 1SJCA 2XDFA 5CSSA 4BS0A 1POJA 3C5QA 4NI3A 4JIQA 2WC3A 1E56A 3LTPA 3M5YA 1CXEA 1GVIA 3N9SA 2ZDRA 3SN0A 1F7BA 3IPWA 3PG9A 4LUSB 3W84A 2GK1A 3P0XA 1KWKA 1H1YA 2QCEA 3OGSA 1FKDA 3VZZA 3NYZA 4E8GA 3O5OA 1XI3A 5K9XA 4AD3A 3TYCA 3UYCA 4HMNA 3B8VA 1H63A 4K7YA 5DMNA 1XV8A 2J4GA 4UZUA 1OM0A 4DNHA 5ECVA 3OVPA 1F73A 1W3KA 5HT1A 1SZEA 2Y7EA 3HGOA 1ME8A 4ZZ9A 3F4CA 5CQ1A 1B30A 1VLWA 3ARYA 1TPEA 1PYFA 5KTLA 4M6QA 4AAJA 5FA5A 4B3KA 4P7RA 4ZMGA 1T41A 2EPHA 4P8VA 3L5MA 5CPMA 4N19A 3QC0A 4F0RA 1VZWA 1X6NA 2ZC1A 1RY0A 3W7JA 1HQTA 1GYLA 2Z00A 3WQ8A 4ERIA 1HJWA 2WHJA 1Q6DA 4PCPA 4DJDC 4QFUA 2YXXA 4FNRA 3LNMA 3O16A 4XZWA 4JDYA 4WXZA 3TCSA 1GJPA 3R1ZA 3BICA 3NIYA 4HARA 3GXNA 3W4RA 1QI5A 1KKOA 3H24A 1X96A 1R3QA 3MBFA 2J66A 1F3EA 3GTNA 2HS6A 3K1GA 1GZ1A 3ANVA 1J5TA 3SFKA 3V0UA 3VDAA 2J9ZA 2E8ZA 1H7WA 4S3CA 4LCQA 4PTWA 1IT0A 2GPTA 3NG3A 3EOEA 4MKSA 3RLVA 3WH0A 4UOZA 1CGYA 1UWQA 4F0SA 4TW7A 3ITCA 1NP2A 2YLAA 3L0GA 3OHMB 2AKMA 3KBNA 4I7WA 1RLDA 4HU0A 4PCNA 3VKAA 4KKXA 1XBXA 1W17A 3G77A 5DELA 3TQVA 3QZAA 4LYKA 1E9LA 2ITKA 2V5KA 3A23A 2LJ4A 3TW9A 1AVAA 2EPLX 3MU7A 4JTQA 4B4HA 3N17A 3EB3A 4PSRA 1MEHA 1L2QA 3TJ4A 5DT5A 4J28A 1F74A 1K7XA 1FXPA 4GYJA 4RPQA 4HYVA 4LJ3A 2CXGA 3BCDA 2BLEA 3PBVA 4PCSA 4R5EA 1HIZA 1UP3A 1VFSA 3R8RA 4K1WA 3ARTA 2WSRA 1VLIA 3BAJA 3T0TA 1G01A 2PTYA 4ZODA 5DANA 5KZEA 1H7XA 2OOGA 3LENA 1TMQA 3TTSA 4XAPA 4S39A 3SB0A 3CS2A 1HL8A 3O6AA 2E6AA 1RHCA 2XP5A 4HU3A 3NUKA 2JEQA 1IEQA 3VI2A 1AW1A 1QPNA 3GU1A 5HMDA 3NTYA 1IXQA 3BE7A 5L9FA 3AWNA 4LBRA 2YIHA 3MHFA 2Y89A 2FYMA 2YCLA 1EQCA 1MRAA 1ZJAA 4HA3A 1KGUA 4ODKA 3VNZA 3E2SA 1FCVA 6ALDA 2NQZA 4RV3A 5LHFA 4IMCA 3QSRA 1BVZA 4C6PA 1NDYA 1EFZA 3GU2A 3GFYA 3ZR6A 1IWAA 6XIAA 2H3BA 2WYSA 3UA4A 3V5CA 1P0EA 2BHYA 2JGQA 1HJQA 1SO3A 2VNCA 1UKTA 1W3TA 1TREA 4M6VA 1PINA 3P8JA 1W5MA 3G8EA 3B4UA 1W1A1 1LRTA 5G1YA 1V7YA 3TXVA 4HCDA 4I6KA 4ILSA 4DPQA 5M2FX 1IGSA 1O1ZA 1WXYA 1W1ZA 4PMOA 3ABSA 4K2SA 3ITGA 4PUDA 1EJTC 4CU8A 2AWGA 3VDHA 1VP5A 3DG3A 1NDVA 1QO2A 2VM8A 4QE4A 1IYXA 1Q6FA 3HA1A 2QUMA 1XLFA 1VPYA 1UZDA 1GVRA 3HGRA 2GGJA 4S3BA 3KOZA 4EAYA 3AIVA 3KLLA 2J74A 5D2XA 5D2WA 4UTTC 1JI2A 1VJSA 2UZ5A 1X98A 4DUWA 1KBBA 2KE0A 2PC4A 5CPLA 1E3XA 3TC5A 2G8ZA 5DO2A 1RR2A 3TUUA 4GZ7A 4W8LA 3MSYA 3PTQA 4G6CA 4FS9A 2PDCA 4AC7C 4PBEA 1TCDA 3KOWA 1YEYA 1ADDA 2WK2A 2YDRA 2WCSA 1J4IA 1ELSA 1W3JA 3TN5A 1XH2A 5JVLA 5M1TA 5HINA 4IFRA 3BAYA 3WZ0E 2WKGA 3UFYA 1WUFA 3SEPA 3WQCA 4LVBA 2DPEA 5A8GA 1M5WA 5AC4A 3W2MA 3UNDA 2VGGA 3CV7A 3OGVA 2NSOA 1X6LA 3QOKA 2GZXA 3ZMRA 2WZTA 3OW1A 2I14A 1J0IA 4FN2A 1F8IA 5C2XA 1XQKA 5G4EA 1HF6A 1J4EA 2C6QA 1UKSA 1DIDA 4ZO6A 2KAUC 5D9OA 2J88A 4XTIA 1DIEA 2SFPA 3WFZA 5HANA 4IXHA 2W67A 2V5JA 4NXSA 1XG3A 4X9YA 2A3BA 1PX8A 2PTWA 3OYZA 1I45A 3IK4A 4DRNA 3CHFA 1GKPA 4NVTA 4MY9A 1OD8A 5FAGA 3KLKA 1QAPA 1EXBA 4CNOA 5BRBA 3S5SA 3ARVA 1IEXA 5G4HC 1M04A 2I9EA 5HATA 3GXPA 4XZLX 3F03K 4H8VA 2A0NA 3N11A 4ZSUA 1ODUA 2WKJA 4GZEA 4KESA 3PB0A 2VZSA 3USZA 2PV2A 3APGA 3CB3A 3M0LA 5D32A 2XISA 3KTXA 4DZAA 4ZXLA 5FAJA 3EXTA 3BZJA 3THUA 1PIIA 5AYIA 1BRLA 4OBRA 2A3EA 1K03A 3LXAA 3VE7A 2E5CA 2XP3A 3LSCA 1U2YA 3RO6A 1KM3A 2TMDA 1PHQA 4WKAA 1YPIA 4W8BA 2J62A 5CPQA 4B15A 3O5IA 5CZ0A 1MO0A 4HPGA 5E0CA 2ZRYA 3ZT6A 4AISA 3W7DA 3MJMA 4JGDA 4C6JA 3C2OA 3L7RA 1W5NA 1O7AA 3KOXA 4FOUA 3O3RA 1IR2A 3LPFA 1AJZA 3F4WA 3PJUA 4LX4A 4KIRA 3SCWA 1DE6A 3SCQA 2W92A 2B31A 1M65A 3DCPA 4JYSA 1GQJA 1POKA 1E5NA 2V2CA 3C86A 1NM9A 3MV01 3R5EA 1ZPTA 3CUZA 4YTUA 1CXIA 3DFNA 2VELA 3WELA 3F2DA 4PMUA 2WJFA 3KVLA 1EUAA 3QBUA 4GPNA 2OYLA 3WJYA 1I60A 4CCEA 2WSKA 3AYTA 4X2PA 3UVAA 4Q4MA 5CZKA 4FLQA 2J24A 1IT7A 1N82A 1W32A 3W6YA 1JPKA 5BU9A 2IS7A 3M6YA 2IKHA 1Q7QA 5D04C 3FOKA 2QGHA 1ISZA 4P7NA 4IWWA 4RDVA 3IVSA 3M0JA 1QHPA 1RCOB 1SMAA 1OFEA 4PA8A 1W5PA 1RQEA 4KT2A 3RLUA 3KBSA 3ZVHA 3EDEA 4TVDA 2FDMA 2YL9A 1WAWA 1RA0A 3B0UX 1PZ1A 4QEEA 4DBDA 4XBSA 4DRQA 2OTDA 4YPJA 1M1BA 5JU6A 4AZ7A 3TV8A 4ZB5A 3DKLA 5JQ9A 1S2WA 1G6CA 4JIHA 3W1UA 2OX1A 3FJ4A 2Z26A 3R0DA 5A6LA 4UC5A 1FWJC 1J0JA 3WLLA 1KT1A 1FXQA 4ZE4A 2FMOA 1DKWA 4RX0A 4JEQA 1WNOA 4NJGA 2I5GA 3UR2A 3VGDA 2WMKA 3VGGA 3HIJA 4GMEA 2J7HA 1R85A 5A95A 3W82A 4AEOA 2PSNA 4C6QA 3VOIA 4ICNA 4UQ9A 2M08A 3OG3A 4U5KA 1MMFA 4IX0A 1JVNA 4TX9A 1E0XA 3W0KA 2X42A 3V1PA 4W86A 3SGGA 4IPIA 4YTQA 2DFAA 4CN1A 4JFMA 4PN2A 2JALA 3ABXA 2FFCA 3LLFA 2ANUA 1HKWA 3TC6A 3QGVA 3HQPA 3GVQA 4UTFA 3VNKA 1NMWA 4JN7A 4XG1A 2TPSA 4XD5A 4LBUA 1L2UA 3QV9A 5A5WA 2EKGA 5F4XA 2PTZA 1WP6A 3NXLA 1DBTA 3CT7A 2DZXA 5G1MA 4D6CA 2FHFA 1A3XA 2UY3A 3PAOA 3KOFA 3S1WA 3H4WA 4K38A 3UWVA 4IQJA 3K5XA 2Y2WA 2INEA 1LLOA 3MMDA 4WDWA 3MUIA 3VC6A 3JR2A 2WWDA 1CBGA 3L68A 3OZPA 4IICA 4EKJA 2PDBA 1KRMA 4HTYA 1CGUA 1UKQA 3R0UA 1IZCA 4JFWA 5EFDA 2QCNA 3C2YA 4OBSA 5LIKX 2IXVA 2GLKA 4NYUA 3M6DA 2QZRA 4PRWA 4HNNA 3GUWA 4J4KA 3LU2A 4LUTB 2CLEA 2JEPA 2QUTA 4ZQMA 2D2GA 2J7DA 4JAWA 1DWAM 4BI5A 1CIUA 2VQTA 2ZC8A 5FEWA 2OYKA 4O4WA 1F61A 3A9BA 5C9ZA 3W1NA 1ONEA 4ZFCA 6XIMA 4ZOEA 1P48A 1XSKA 2I17A 1XPYA 3L0KA 1F9CA 2BGSA 1S5MA 1Q4WA 2CHOA 4OKDA 1DJHA 1XYCA 2RURA 3INPA 3WK0A 4Y96A 2PDUA 1OYAA 2W79A 2CZDA 4LV4A 5HWNA 1F76A 5I3DA 2QCFA 4C91A 3FVDA 1C9HA 3M16A 4G50A 2PDNA 4KQZA 1NOUA 3BW4A 3PUOA 4ZOBA 1J6PA 3VIOA 5BXRA 2OU4A 1W1IE 1ZALA 3QY7A 3ITXA 3I3DA 3IJ7A 4ACYA 5D2VA 3XISA 1QR7A 3E5PA 4AY1A 3S5YA 4AWUA 1R0MA 4JXCA 2GL5A 4GHRA 4R3UA 1ZLPA 1FCQA 1QBAA 4R7OA 4HA4A 1B3WA 1OFBA 4PUNA 3LGDA 4XZHA 3WK2A 1PKMA 3NPVA 3TNOA 5JBFA 4WEVX 4B2DD 1XISA 2FZ8A 3M5VA 1QW7A 5DCEA 3QPYA 1RA5A 4FNUA 2XFFA 2DQWA 3JUGA 3UXKA 1DHKA 2W66A 5KSWA 5IBXC 3TP4A 1TPFA 1FH9A 1VH7A 4GZJA 3H54A 2GQ8A 3WDQA 1CEOA 1MQQA 1XLHA 5CPNA 2WZHA 4IUOA 4XKYB 4GGBA 4NJIA 2PDYA 3CZ8A 2DV0A 3HFYA 3HG2A 4R0XA 3TTYA 3GM8A 1R3RA 2FGBA 3S6TA 4Y2WA 4FB7A 3V0SA 3VKBA 4A3QA 1ZJHA 2BODX 2GGEA 1NMVA 4OE7A 4TO8A 3U2CA 3WUEA 3PY2A 4O57A 3BPWA 3AZRA 4UZSA 4DUVA 1W3HA 1VEMA 3IGUA 1W9VA 1UD4A 4H7CA 3ABOA 4X9SA 8RUCA 1G1YA 3E12A 5EL1A 3VNLA 5DRCA 2XJ7A 1OGBA 3HMJG 3V16A 1LF1A 3B8WA 3A47A 4Z08A 1AL7A 4IP5A 3HV9A 4P8XA 3U7BA 4ADSA 4V1XA 3QN3A 5HWBA 3NL2A 4U10A 2WOQA 1N1AA 3AHZA 1BXBA 3BLKA 4RZ6A 4U5IA 3QQ1A 3VIGA 2QCGA 3AZTA 1RD6A 1X8FA 1AUSL 3QY6A 1UKPA 3HJZA 4UFHA 2O9OA 4DM1A 3W6LA 1O66A 3IIOA 1UPMB 3N13A 3CXOA 3F4DA 2CC0A 1V0LA 5FEXA 3EX2A 1E1FA 3W28A 2YW4A 4D6JA 2RGMA 3NVTA 2O9RA 3KVMA 4ML9A 3EMQA 1LL6A 2WB5A 3QQWA 4ODPA 2BWGA 2OSYA 3GBEA 4O14A 3STCA 1V4YA 4B91A 1U79A 4QJ5B 2NX1A 3T0AA 1VYPX 2A3LA 4CVUA 1MYRA 2F8QA 2GUBA 1TZ7A 1C8YA 4JL1A 4WY0B 1EP1A 1SW0A 3A3XA 4A8IA 4OT7A 4BI7A 3ZM8A 4K8EA 1OEPA 3ZJ7A 3FW6A 4NXKA 5CGQA 4HP5A 1QNOA 3VOJA 3GG0A 4XAYA 2GSHA 4JIIX 1DL3A 2NUYA 1UR1A 4KGJA 4S3EA 1ZUAX 1ODZA 2Q3RA 4GACA 6REQB 1F6PA 3UPMA 3VD5A 1BWKA 3N29A 1K6WA 2KFWA 1TVNA 3RJXA 3UQIA 5EMUA 1A5UA 4HPXA 3O5MA 4U33A 5AHMA 1KNWA 5J5DA 3AIEA 3CH9A 2J8FA 3GNRA 1MW2A 3RPDA 4NJHA 3QMTA 4S3GA 2P4VA 2F21A 3AHVA 3LSBA 3BW3A 4FEZA 3WQFA 3RM4A 5DIVA 4JKKA 1ZCOA 3BSMA 1H11A 1L6WA 5HUAA 4JNYA 3T08A 1AZ2A 1U22A 1GOWA 3AYVA 4YS1A 4IPNB 1PZ0A 3AS2A 4BK9A 5HXMA 4UOQA 2BDQA 1UR4A 2QCLA 3CAQA 2Z0IA 5A6TC 4FR6A 2A3AA 4MB4A 3K2GA 1BL4A 4KW2A 2JK2A 3P62A 3CL7A 1O1HA 4GOAA 2R94A 3EWBX 2D24A 3CO8A 3IIZA 3KP1A 3GVRA 3KVKA 5DT7A 1C9DA 4UTUA 5DY3A 5REQA 4UWMA 4JTEA 3RIKA 4ZXOA 1LP6A 2IKIA 2HDJA 2UY5A 2YOCA 4A8LA 1GT8A 4PH6A 2OLHA 4AWTA 4GFSA 6ENLA 4DRPA 4DWSA 4M8UA 1FRBA 1J11A 2F9RA 3ICJA 2YFOA 3N2CA 4U84A 3H53A 1JZ6A 3TYAA 3NNTA 1EA0A 4PODA 5A8MA 3AXXA 3KW3A 1K7FA 4US5A 4DBSA 2WMJA 4QQUA 3VC5A 4US6A 1D6OA 4DJFD 4AHOA 3RK8A 3WL1A 4E4FA 1TVLA 2CLHA 1XDJA 1UB3A 3WL0A 1RCXB 1KT0A 2Z25A 1BGAA 3FXGA 4LUIA 1WKFA 1GYMA 3L4UA 4PCTA 1UD6A 2A2IA 3B0PA 2B7PA 3B9DA 3EA1A 2PLJA 3SDOA 3OTRA 1TTQA 3AQUA 4ENLA 1GK8A 3GHSA 4X63A 4MAZA 3LZ5A 4NP7A 3WD2A 5K9DA 5AHNA 1RJRA 2PPNA 3AS0A 1EPVA 1OCJA 3WSUA 4K68A 4M24A 4ODRA 4K39A 3TAOA 4NSBA 4C5YA 5ENLA 3KRBA 3OVRA 1KLYA 3ZWSA 2PWHA 5CC3A 5I24A 3DFHA 4WKFA 4GG9A 3MTWA 5AECA 4LUSA 5T9CE 4O50A 3DYMA 3SCOA 1C9WA 4DROA 1AFSA 3BK0A 4AZCB 4B5NA 1V8EA 1F3TA 3NQFA 3G1VA 1OC7A 5DEZA 1FH7A 3EWZA 5M17A 4IMFA 3LPOA 5GVJA 4YVPA 4IH3A 3KTCA 1N8IA 4C6NA 2ZRUA 6A3HA 2I5QA 3S4TA 2QCDB 2VOTA 2Z1KA 3D3AA 4JTDA 2WNWA 3JZUA 4FNSA 3UWWA 3MP3A 2BFGA 3OPSA 4XK2A 5I78A 1AW5A 5LNRA 2HJPA 1FHDA 4XO6A 3AWOA 3DEQA 1JPHA 4GI6A 1J12A 4B3ZA 3FN9A 3MQTA 2ZQ0A 2PBOA 4L4OA 1E6ZA 2ZYFA 3SCSA 2BGNE 3GKAA 4C60A 3DESA 2Z29A 4CCDA 4LUYA 3MYOA 4CGTA 4M82A 5AKQA 2Z24A 3UG4A 4IIGA 2VCBA 2Q02A 3DX5A 4R53A 5I3HA 2PCEA 1Z89A 3U9IA 5TQLA 1UC4A 1U1UA 4A35A 4O11A 2FVLA 1KM4A 4TMCA 3DI0A 4B90A 2WNZA 4S2CA 2D0HA 2HBXA 4DJEC 1HUVA 1XIEA 3F5KA 3T6CA 1GPWA 2Y78A 5CLTA 1ZTVA 3V7PA 1JPIA 2LGOA 2FQIA 3F2CA 5LNVA 3TEVA 5BCAA 4GIVA 3VYLA 1EDTA 1XD1A 4XWUA 3GDBA 3EDJA 4QCFA 3LB0A 3T40A 4JICA 1RP9A 1Y8BA 2WCGA 4A2RA 3IIPA 4OIFA 3GTXA 1YKWA 1IIGA 2D73A 1UR8A 4BFAA 3S2MA 3STPA 1PX4A 2WV8A 2I9UA 2CWXA 1NWTA 4A29A 2FZNA 4NG3A 4Y9OA 4YTSA 2PURA 2WJEA 1B3ZA 2POTA 1F8AB 2YBTA 4I5RA 3LHYA 3E2QA 3C2VA 1UR0A 3M0ZA 1ZBCA 1KFLA 3CLMA 1J5SA 5TAOA 1TPDA 1SQ7A 4JTIA 4XX6A 5K4XA 1D9EA 3QF0A 5C9XA 2WSPA 3WBEA 1XIGA 3AC0A 4MGVA 3DFQA 1GW9A 3ZQ9A 4F8XA 5JBDA 1BSIA 1XRSA 5H1WA 4KWWA 1FKXA 3KX6A 1PHWA 5CG7A 1FWFC 2FLIA 3LV6A 2W3ZA 1XKYA 4OZOA 5AC7A 2CZFA 2ZZ2A 3ITLA 3QV7A 1EIXA 5HNTA 1OQFA 1ENUA 3W7KA 4O1DA 3PB2A 3PWGA 2J7EA 4J3ZA 3CAVA 3IIXA 3IIVA 4XBKA 4UMCA 4Z1YA 4WZHA 1QJWA 5ABGA 2QDDA 4H6QA 4PL2A 3GB6A 1HZYA 1J0KA 4IMAA 2ZXQA 3SR7A 1V0KA 5DCDA 4D72A 4IGSA 2NQLA 3FKRA 5HWJA 3M7SA 1FKRA 3H7RA 2W91A 7ODCA 3P3BA 4JFLA 3COTA 4M80A 1MVYA 4GZIA 2ICSA 1GKRA 2ZX6A 3FDKA 3P74A 3E0LA 2BMBA 1E9IA 1QFEA 1JCLA 2VHLA 3WLNA 4HZ8A 1P6WA 1EIBA 1WKYA 3LG3A 5DXYA 2DT3A 3W72A 1YPFA 4BZYA 3HJEA 3U7VA 1H62A 3NQDA 2V5BA 2W9MA 2YL6A 2GVYA 5CBBA 2D1ZA 4AEEA 3GVWA 4DJDA 1TV5A 1CECA 3GAYA 3FY1A 3APTA 2GVJA 1J4RA 3QZEA 3KFTA 5FJRA 4JTTA 5JBEA 3QHOA 1BF6A 4N4PA 1I2QA 3VAWA 3W2NA 4DRHA 2OEKA 2BXVA 2DZWA 4JN6A 3O0FA 3T8QA 2HE5A 2QYGA 1YE4A 2C19A 3TIMA 4CQ9A 3GIPA 1DOSA 5M03A 1K6AA 3CUXA 4MNMA 3TJXA 2GJNA 4DXXA 4ZGYA 3VNDA 4B16A 4H9TA 1PDZA 2OGJA 1XP3A 3OZYA 2NXIA 3NQGA 1TRDA 3GW0A 4FIRA 2B7QA 4LH8A 3BG5A 3I3BA 3K30A 1DJQA 1J96A 1C90A 1OK6A 3GHRA 2CERA 4WRHA 2QV5A 3WBAA 2CHRA 5AFDA 1E71M 1P5BA 3LV5A 2ACRA 3AHTA 1UCWA 3MMTA 4TR9A 5CPTA 3KHDA 1YDNA 3A12A 3LMYA 1HKKA 2C0HA 4Y6GA 1XYMA 5JMUA 4DYEA 1XX1A 1HKMA 2Y61A 2Z4GA 1S2UA 2Y7DA 2P53A 1VYSX 2VX7A 4LYQA 1XC4A 3RFWA 3HPZA 1HVQA 3VKKA 4IISA 5LA1A 1TUXA 4WCJA 5BOOA 3BJTA 4QEHA 3UCCA 1QXLA 3NQ2A 3R89A 1ECEA 2UWFA 3NQMA 3B03A 3UGVA 4XZNX 3LGGA 4WK9A 4KEVA 5HW6A 3N2MA 1C7TA 2Y88A 4TOQA 1GZJA 4YWIA 4ZO7A 4DY1A 1S2VA 4F4RA 9XIMA 2HMCA 2F84A 4NT0A 3LTYA 3FNDA 2AL2B 1R30A 3ZSTA 2VEMA 4GIRA 4MKVA 2NZLA 3BG9A 2ZZ6A 3C0JA 3UESA 2RFGA 3CUHA 4ZQRA 1D8CA 4YTRA 3EXSA 3VGEA 4MPQA 2JFEX 1EP2A 1JZ4A 2Y4SA 1EHAA 2PFHA 1GRJA 2YCEA 2NSXA 2VC6A 3E1F1 4ASTA 5B8IC 1SZNA 1R3WA 1LOQA 3EB2A 4X61A 3VIPA 5FL0A 4IGMA 1S1PA 3DFTA 2PPPA 3KDOA 5AHFA 4J4OA 2CFFA 5A2AA 1TPUA 1FVPA 3T2OA 4AZ6A 1ME9A 2FKEA 5JH1A 1SGJA 1ZBKA 4LAMA 4M5PA 5HDRA 4K1GA 1BYAA 1WX0A 2IPGA 5TF0A 4HPNA 3EEGA 4O8RA 1S3TC 4XUYA 4DXKA 2Y5EA 3C61A 4Q8MA 4LAVA 1OF8A 2QKFA 3O5DA 2X09A 3UWQA 1CLVA 1Q6RA 4IL2A 2XFYA 4C6FA 3F7JA 1OFQA 2M1IA 2YYTA 4Q4PA 4Q8QA 3TR9A 5CJ5A 1WDDA 3UYIA 1K9TA 3E0VA 4KRZA 4WX2A 2BHZA 1R5YA 1NVMA 4EPKA 3B97A 2AMGA 4HZ7A 4LPCA 4ZQCA 3T44A 1FP9A 4M29A 1QPLA 4O28A 1CGTA 1QU4A 5K3VA 4Z0SA 4KGLA 4JX5A 5I3KA 4UTTA 2H8XA 2Z6JA 1B3XA 1BPLB 1HGYA 4L4MA 3K13A 2MANA 3S46A 1WXZA 3H23A 1ICPA 2RDUA 3GC4A 4QSFA 4ZO8A 1EX5A 1XIBA 4CCZA 4W88A 1SZRA 1V0NA 1HKJA 2B7OA 2WWCA 3RR1A 3JU2A 1FWEC 1WQ5A 3O6YX 4XD4A 4H9YA 2CLLA 3P82A 1R2SA 5DX7A 4YNGA 3OLDA 2PLKA 3ZJ8A 1B3VA 4CU6A 2I7GA 2WAGA 1TX2A 4GY7A 3TONA 3UF9A 1RK6A 4W84A 5LSMA 3R8HA 2O4MA 1X8CA 2ZADA 5B80A 3CB8A 1QTWA 4PC8A 5IHSA 3CUFA 4ALDA 1HJXA 2C1HA 3AU2A 4XSMA 1NQ6A 4GJJA 4L56A 4GH3A 4AVFA 2E9LA 3SFWA 3MHUA 4UBPC 2OT0A 1YW1A 3SUTA 2R6OA 1F05A 3WMLA 1EJRC 3O5EA 4U3CA 1QZ2A 4MWAC 3CMJA 2RKXA 4GWEA 3PPGA 1P43A 3NQ8A 1V6TA 4E8DA 1LL4A 1FDJA 4RNJA 1XGEA 1I0BA 1TR9A 3QGKC 2EJ1A 4JTAA 2A7NA 1TYGA 4PB5A 2V3FA 1YNQA 3AZSA 3BAXA 5I00A 3C3NA 1YADA 4GUHA 2R1KA 2NT0A 1GOQA 1EUNA 2XG9A 5HMEA 1JEZA 4NZ3A 3TC7A 1UR3M 1JZ5A 3GDTA 2EXOA 3A5VA 2B4GA 2QDHA 4QIUA 5XIMA 5LYRA 2XU2A 3UJ2A 2E0PA 3E74A 3P7YA 5HW8A 3FGCB 5HBFA 3RU6A 4MZYA 3PPFA 4DJFC 3TJIA 2WMHA 5BU6A 1XLEA 3WEMA 1SJDA 7PTDA 4GQ0A 2PRMA 2HCVA 4QGCA 1J8VA 2QJMA 4GRSA 3W22A 4H01A 3W85A 1QPKA 2CYGA 1KCZA 3PBWA 3KXQA 5LGZA 1JPDX 3A9IA 2PEVA 4ACZB 3PZQA 4FNQA 2EBNA 2ZVIA 4ODQA 3F5JA 1EA9C 2CPUA 3DDMA 1XIIA 4N9EA 2ABBA 4IM4A 1X7FA 5F2LA 1OSEA 3R7MA 3VTRA 2OR2A 2TRSA 1RVKA 4XZ9A 5DMLA 3RX2A 1LORA 3WQ4A 1ITCA 4M3PA 3N4AA 5IXEA 3WH5A 4P7OA 4LUTA 1QOXA 5TD4A 5HJLA 5KZDA 4ZQNA 3AALA 3KCJA 1E44A 1QI0A 4CD4A 3BOLA 3UZ5A 1UASA 1Y5XA 2J7CA 4IP4A 1E4MM 4PMRA 3VM7A 3C4UA 3WX7A 4MZ1A 4O13A 1HJVA 2ESCA 1BD0A 1LLWA 1MFVA 1UWSA 1LG1A 3MPGA 2FPVA 1VCFA 4CLMA 1XYFA 1FWBC 1EWDA 3TK7A 4J9JA 4ZFMA 1UOZA 2CWNA 1VBHA 1GVFA 4RNIA 3CZKA 1GEQA 4R34A 3W53A 4F0LA 1OGGA 1G5AA 3NPUA 3W1TA 1Y7VA 1PS9A 3UWYA 2JIEA 4N6EA 2XSBA 4MWAB 3ES8A 4B92A 5G2IA 4FA3A 3NO5A 3PULA 5I3GA 4KWVA 4GXPA 5AC5A 2HS8A 4X3ZA 1B9ZA 5A8PA 4FO4A 4Z42C 5DN1A 5A6KA 4U86A 1F6YA 3R12A 2BVTA 3A4XA 1TQJA 1LT7A 1ZNNA 3NPXA 1CPUA 4AB4A 1X39A 2X40A 2MUCA 3MP4A 4P8WA 3VNIA 2QAFA 3ALGA 5E0KA 3K46A 1C7SA 3WG6A 5DMMA 5CCZA 5HA7A 1JFXA 3T78A 3NOEA 3CHCA 4A2SA 2PRLA 4MY1A 4K7VA 4H04A 1BG9A 3LD5A 3VAVA 4A3HA 1CWYA 4XKYA 2TODA 4WGXA 5CJNA 1BG4A 1VFUA 1X6UA 4UNLA 4C1NB 2DW6A 3KWSA 1DQWA 3MDWA 4JEJA 2MLXA 3UQBA 1D7IA 1Q66A 3PUEA 3G1FA 4JCMA 2LLEA 4PUKA 2JGYA 3STGA 1B1YA 2XM1A 1XUUA 4X0VA 3FAXA 3G1YA 4RNFA 4KMQA 1VJIA 4B9YA 1T99A 1VPXA 4LY8A 1SW3A 2FDSA 3SZ8A 1XM3A 1FUYA 4W7VA 2OLSA 1A4LA 2NQHA 2XIOA 4B3LA 4DT4A 2D0GA 3TYEA 4HNLA 3UPBA 1L9WA 1W26A 3NCOA 3RNDA 2CCRA 4DI8A 3S9ZA 2H9AB 5DRIA 3UJSA 4WY0F 1E0WA 2H90A 4Z17A 2QUVA 1CLKA 2OODA 1RY8A 4N2YA 1HXJA 2F2HA 1NTHA 5AY7A 4J4NA 4Q8TA 5GPGA 4HIBA 5FJJA 3KL3A 3RMEA 3B40A 2F6UA 3USBA 3GNDA 2KO7A 3W25A 3MSGA 3B05A 1MNSA 4Q8OA 3G24A 4H7VA 3VUPA 2Y7FA 5CAHA 3U5YA 5XIAA 1FWNA 4M1RA 1BHGA 4CNNA 3OIXA 2WMFA 4WJXA 1OT1A 4BQ3A 2VRKA 2NW0A 1XF0A 4JIPA 4CN6A 3UW6A 3P6LA 5AN7A 3YPIA 1J0ZA 2P0IA 1KLZA 3AXKA 1I2RA 4HCLA 4WY0A 5L6UA 2NQ9A 2ZICA 4U85A 3P93A 2E5DA 1A4MA 1LBFA 1SO6A 4MZ8A 2VRJA 4I6VA 3S1XA 1DJWA 3L23A 3ARXA 4J5NA 2PDXA 3GAKA 4Q4SA 4MHBA 4WHBA 5EKYA 4LY4A 3OYXA 4Y9AA 2ZR5A 1QRQA 4FXJA 6REQA 1NFPA 4W7UA 5I3FA 3U3HA 1E0VA 3G8RA 4BQ5A 3GR7A 3WQDA 5KZ6A 1D8WA 1EP3A 5HW7A 2ZR6A 4TVCA 3WD0A 5IBXA 2AAAA 2Q8XA 3VD9A 4FOJA 3P67A 1NWUA 1ESWA 1TCMA 3I4KA 3BVJA 3DU0A 5A6JA 2PTXA 2VGBA 3ENLA 3G1SA 3VCNA 2UY4A 3LUOA 1OFPA 1WZAA 4MSPA 4FZIA 1N55A 4XAGA 1F6KA 1PDYA 4S23A 1CGVA 2H3DA 3QFEA 5HWCA 2RGLA 4KRTA 5GPRA 3HMCA 3W02A 1I2NA 4TX8A 3WO8A 4IPJA 1A5NC 2CLMA 2QCHA 3RILA 4DM2A 2HVOA 4QCEA 1G4EA 2ZBTA 2J13A 4H1ZA 4RE0A 4MB5A 2PGRA 2DORA 2EG6A 4M81A 2F2DA 1KM2A 4JTHA 4Y9NA 1NOWA 3ZFHA 4N9CA 3J7HA 1FKFA 4C6DA 4IMGA 3NA8A 4MGGA 4XD3A 3LHVA 3ARZA 2VFIA 1C8VA 4WD0A 2QLYA 4KWSA 3ARRA 3WLJA 4H4IA 3EX3A 3EKGA 3HBLA 3DXIA 1IWBA 3LEPA 3WLQA 4CNUA 4JX6A 2LKNA 2E28A 3N6JA 2V68A 3C2EA 2DUAA 4UNKA 1BEUA 4IIEA 3KCEA 3DFSA 3EMCA 3W7QA 4C6CA 3ZR4A 2VUYA 3CWNA 1UIPA 3F1QA 4LF2A 3T05A 2R82A 2EAWA 3OOQA 5C7VA 3UT0A 5CC5A 2YLLA 4I5UA 4FOKA 3I6RA 3TN4A 3ARPA 4ERAA 3VD7A 1FWAC 4ROPA 2WJZA 3BMXA 3H2FA 3RG6A 4I9TA 2EGZA 3L67A 3QH2A 4IMDA 4DBUA 2ZOXA 4TTUA 5BYWA 4WSHA 5CH9A 2J8GA 3TJLA 5E70A 4RZ5A 1PSCA 1VBGA 3RCYA 1J2WA 3DBNA 5BZAA 2PGFA 1B54A 1ZJBA 2VEGA 3DGRA 4FX8A 4PFHA 1ZAJA 3NTPA 1GKQA 4I3GA 4E4UA 3N25A 4LC6A 3DERA 5I06A 4TNSA 5KMYA 4AZCA 4DQWA 1E6QM 2HXTA 4E8CA 5AB3A 1YDYA 1MQPA 4JYDA 4P7LA 1LQ0A 3O5PA 3VKDA 4RV8A 5I7GA 4HOWA 2PWFA 5FI8A 4YXGA 2QULA 5PTDA 2EHHA 2QCDA 5GJNA 4NNBA 4V33A 3DFYA 1I8JA 4JFIA 2OZ3A 2E25A 3DOPA 3L0NA 4MF4A 2G4JA 1IX5A 2YA0A 3O6DA 4LYPA 2C18A 5D09A 1ZB5A 5F2GA 1W2PA 1DTNA 1XH1A 4HMEA 1ISWA 1CDGA 3TA6A 1XQLA 3GG8A 3GU0A 4ZPTR 2HTMA 3PBGA 2C91A 3TOPA 1GEHA 3KHJA 3UBPC 5KETA 2OOFA 3AXIA 3QOMA 2DSUA 4H2CA 4WQ6A 1FKKA 1EJSC 3WLOA 2A6LA 3UEQA 5CSRA 5DLCA 4GABA 3TYBA 4AIUA 4LB4A 3A24A 3A4AA 5LNWA 3BZGA 3FYPA 1A5LC 4XUGA 3RFAA 3SGZA 3BLFA 5LIWX 3ARQA 4H8UA 1WZMA 3MP5A 3SCNA 4JTLA 4AWEA 1XG4A 1HKIA 3UI4A 2YBUA 3AXMA 2ZZ1A 4ZSTA 3LNPA 4NL1A 1DPMA 1JUKA 1YTKA 5FF7A 1J9YA 3WLIA 2VEKA 4QNEA 2XVLA 1TV3A 4S3FA 3LRKA 5HWMA 4TX0A 2IMRA 1F3WA 1CXFA 3E0FA 3T9PA 1LL7A 4JN8A 4A3YA 3V3WA 5I02A 4IHCA 3N73A 4MYXA 2O7SA 1KCXA 1IE7C 1XBYA 3KCOA 3LZ3A 5JUVA 1ZP4A 3EWUA 1OX4B 2Z2BA 4EANA 4Z2IA 2EQDA 4PMNA 5F4WA 3KRUA 3TN3A 2WVSA 4IX2A 1R9HA 4YYCA 2V0TA 5H8MA 2XN1A 1Z69A 3HQNA 4DNMA 3GNNA 3TA9A 2PD9A 4ECLA 1OCNA 4PMXA 4H6KA 4NNRA 3MZNA 4GE8A 4MB3A 1WDWA 2UZ9A 4JHZA 1RVGA 1DXIA 2PS2A 4D6HA 4L61A 3CAWA 3PFRA 3H2OA 3PSWA 4QE1A 1GOIA 4GXWA 2ZRVA 4ZOCA 1PCWA 3ZR5A 2DIJA 2QJNA 2J27A 4AD5A 1DWIM 1RBAA 3PG8A 5LXXA 4B5TA 4KH2A 3U0HA 4CUCA 4R9OA 1F07A 1TWWA 3UI6A 5IDIA 1RXOB 3FS2A 5D33A 4DEFA 3D0CA 4NF7A 2GVEA 3R2GA 1WAUA 1VFFA 3TQKA 1GVQA 3BLOA 1ICSA 1U1HA 4JQ3A 1GOOA 1OWQA 1JGIA 1E4NA 2DH2A 3W71A 4TTGA 2Q3OA 1FQ0A 1Q6OA 3BC9A 1DWGM 1U5JA 3S5OA 2H8ZA 2QHAA 2DG9A 2ISDA 1WXJA 4XAKA 3I6TA 4LV9A 4MPKA 3NWRA 1XLIA 1OIFA 1NOFA 3HZ3A 2WPGA 3R94A 1PYMA 4QS6A 4AYGA 2ZQVA 3WQOA 4MDOA 2P5NA 1NFBA 4AXKA 5GNZA 1F4AA 3BTNA 3ZVIA 3LI0A 1VFLA 2FH8A 4FX7A 1ZS2A 3GXMA 4B5UA 2XP4A 3UWEA 3VVGA 4E6MA 5CZJA 1KBJA 3VOFA 3G0UA 1YX1A 1DJNA 1E73M 2E68A 4H19A 1XLBA 3DC0A 3H8AA 1Y5WA 2XWEA 4INFA 2XP7A 1FWWA 4FNPA 3S8HA 1S2TA 4UUIA 4DYKA 1J79A 3W7CA 3GY1A 2Z1WA 3W81A 1DORA 1W56A 3PBMA 4DJEA 5FJUA 2FZ9A 4HU8A 1OHLA 3CWHA 5GQBA 2E6DA 5E93A 2C8NA 1NWRA 4OOZA 1VFTA 4RPPA 2CBVA 1JCTA 2VMFA 3F5LA 1YXYA 3AIQA 2PWGA 3IJ9A 1V03A 3OVQA 4AX6A 3GG7A 5I5RA 3OB8A 1SFLA 3TN6A 4E2BA 1M68A 1R3VA 3WBWA 3BQ5A 3LM7A 4UR9A 1HTIA 5DXXA 1KC7A 4HK7A 4E5TA 3VU2A 4ZTYA 1B6CA 3QFWA 5D75A 2PDQA 4GY1A 3V5OA 1V77A 3VDBA 3WQ5A 2CZVA 3LCXA 1CENA 2Q71A 1IEIA 3MUXA 2BSLA 3MDUA 5EY5A 4DZ5A 2OPJA 2QJHA 2VC9A 1FHUA 3KBMA 5H8UA 2PDWA 5AYBA 1LDCA 2P8BA 3UZXA 1J0YA 5CAKA 2ZFAA 3LPPA 3ECQA 3ZT5A 2X1TA 3QM3A 1JPMA 2PDLA 3TAKA 3IRDA 1IIHA 3IUIA 2J6XA 4W9OA 4H8HA 3I68A 2Y7GA 3GXIA 2QJIA 4NRRA 2BXYA 4HMCA 2E1DA 4R9XA 3RU8X 2P0OA 2XGBA 2VEIA 4OTKA 3UNTA 9XIAA 3R4IA 3VINA 1WDPA 5JH8A 4QBXA 2E3ZA 2E09A 5I79A 4JHOA 2HQAA 3S47A 3I3EA 2ZXBA 2AL2A 3AYRA 1YQ2A 3UF8A 3JXVA 1S5WA 4PB4A 1TPB1 5D05A 3PUDA 3UG8A 3VDCA 1O5KA 2DSZA 3UGRA 1OG6A 2J7BA 5H8PA 3EDDA 4DF1A 1MI3A 1EZWA 1DV7A 3Q67A 3U4AA 4C1LA 2XVPA 3GTFA 3PR2A 3KZPA 2F7FA 2WMGA 1WCGA 3NOYA 5T9BG 4YMZA 4AUBA 1K77A 4NHVA 4GD0A 1EZ2A 3CPRA 5EMLA 5K2ZA 3WJWA 3S5NA 4NX5A 4YJ5A 1S38A 3SSZA 3EX4A 3RM9A 2WC4A 3E9AA 4DF0A 2IXUA 2NV9A 3MBDA 4I5XA 3SRHA 3UWZA 5C2GA 4ADUA 1V7AA 4GKLA 1OVDA 1H7NA 2GK1B 3W29A 5D8ZA 4GCXA 1ZU8A 5HJYA 1JAKA 4GXMA 4DI9A 4OU1A 1GVEA 4D6GA 4GC3A 1YBQB 4KQNA 4IPXA 2Y8KA 3UZWA 5A6BD 4UCGA 2Y70A 7CGTA 3QPZA 1M41A 7XIMA 1BYDA 1FP8A 4XISA 2BY1A 5FKYA 4F48A 4OVXA 2G3MA 2CLIA 2DT1A 4U28A 1CT5A 3W7MA 1ROTA 1V51A 2NT1A 4OUEA 3DI1A 2WVVB 4TUFA 3G22A 4Q22A 2FFIA 4RDZA 2GDQA 1BVNP 3KACA 3LBOA 4M6PA 3B0XA 4B2DA 3M47A 1TPWA 3B8DA 5E09A 2E9BA 4G7EB 2ZX8A 3WD4A 7ENLA 3EOUA 4U2YA 4EAMA 3NZ1A 3C6CA 5H2ZA 1VIWA 4I90A 3VPLA 4NJKA 1YDOA 4Q7BA 3Q4DA 1T8QA 3ZOAA 4GJIA 5I3IA 3VNMA 2A7RA 4HYRA 4RKAA 4Q8NA 1E5JA 5G2HA 3MI6A 1TJ2A 2WVTA 4ODLA 4IQLA 1KTNA 4HOXA 1UD3A 4U3AA 4LGXA 4YYFA 3NSXA 1E1CB 3KCLA 3BCJA 3VGBA 1X97A 1F3XA 1S5VA 2ABAA 1C8QA 1W0MA 3HPSA 3SCPA 1Z32X 4ONVA 1HT6A 4Z2HA 1R86A 1UQYA 4KS0A 3M0HA 2HZGA 3VOGA 2YSWA 3SUSA 3PZNA 4C6BA 2XYLA 3G3DA 4NNCA 4GO9A 3ITTA 1D7FA 4W89A 2DSVA 4LVGA 1K1DA 1P0DA 1Y0EA 3NL5A 3N3TA 3UXAA 1EJVC 4QG8A 1TV8A 5HOSA 2OWXA 4ES4A 4C1KA 2D23A 2QPUA 3THAA 1ZBWA 3OBKA 1HNYA 2K8IA 5E0FA 2W63A 2G50A 1I1XA 2QDGA 3A6OA 1H3GA 5EMYA 3C2FA 1ZAHA 4NIRA 1I75A 2DSKA 1TWDA 3NR0A 4HHPA 4DRMA 2VFGA 4DELA 5BRQA 3WDRA 1ZGDA 1KFKA 1MEIA 4HB7A 2WO5A 1TB3A 4IJRA 2NUWA 1KA9F 2D2HA 2Y6ZA 1PB0A 3F2BA 2FTPA 1RBLA 4NAEB 1HJSA 4AD0A 3C2RA 4XKMA 3FGCA 1KXTA 3MCNA 1W1YA 1RALA 3RN6A 1OABA 1JYXA 3L5AA 1H49A 2A5HA 1UWIA 3VIFA 4WSJA 2VDGA 1TMHA 1H50A 4EP8C 1XXXA 2QCCA 4B5WA 1PZ2A 2NWSA 1RP8A 2XSAA 3H7UA 2HPIA 3W2JA 2MNTA 2ZUNA 4ACZA 5AYXA 3R43A 4Z1BA 3OU8A 4O54A 3LN3A 4A22A 1YTDA 1XIDA 1DXEA 2ONEA 1JCJA 3NRKA 3W1LA 3A64A 2BP1A 1AODA 4IQ2A 1V08A 3SIZA 4L6HA 4U2ZA 1KFCA 2FB2A 3MJYA 3UETA 4PGLA 4CNPA 2PPGA 3E2VA 4N0RA 4B4FA 3W38A 4DH0A 1B4EA 3O6CA 4JKMA 1KGXA 4O4VA 1O6IA 4QM1A 4DUXA 4M6UA 5JXQA 3GXFA 1WKDA 1H09A 1TWSA 1GHRA 4BWLC 1KBKA 4N6FA 3GH5A 1FHLA 1GTEA 2PRHA 2M2AA 2P3ZA 3BWWA 1EC9A 4MWAE 5KZMA 2Q8LA 2QMJA 3SRDA 2PV1A 2C1GA 5E6ZA 3IGSA 1A3WA 1G0CA 4W5UA 1Q6UA 4IFOA 1LWJA 3TMLA 1XCXA 3D46A 7TIMA 1PXGA 4UCFA 4G7FA 3MI2A 1GPFA 2GQAA 1NJJA 4MWAA 2P10A 1FKIA 1FFRA 5HUPA 5I6SA 4JTUA 3WK3A 3BLDA 3CGNA 1V93A 3AI0A 2CKRA 1J01A 3HGSA 1JDEA 1B3OA 1ROUA 3E02A 4JTCA 3KADA 2GDVA 3G1HA 4KWOA 4AVNA 4MNKA 3L65A 3R79A 3UJFA 3KAHA 4DX3A 1UHVA 5C2CA 3QTGA 2RSEA 2OT1A 3GPKA 4JD4A 3UG3A 3W1QA 5B7ZA 3W76A 4E38A 1YHTA 1YE6A 1T5AA 2W61A 1PO9A 3MMUA 4NYYA 5A8OA 5E9AA 1QHZA 5CZTA 1SZGA 4JIEA 1Q63A 3Q58A 4IQEA 4AG0A 4DJFA 5BWAA 4HQVA 4C1NA 4PMQA 5H6HA 2VI0A 1V3IA 4WJ8A 3RDKA 2G3NA 2PLCA 1TJ0A 3MWCA 3CNYA 2CXEA 3BOFA 1Z41A 3DHDA 1THFD 1GCYA 1UH3A 1CI1A 3LQGA 2VEPA 4PRRA 1MSSA 2HEJA 1Z42A 2DT2A 4TW6A 1XINA 5KINA 2FHBA 3AHXA 1RPXA 4MJ2A 4LANA 3SRKA 4YVVA 2X2GA 4R85A 2CLKA 1FKLA 4IFKB 1EGVA 2VC7A 2Q6ZA 2PDPA 1DJGA 1PPIA 5HR6A 5LGXA 1V5XA 4NILA 3TDFA 4C7GA 4QJ3B 4DAFA 5HQEA 1ONXA 3CQ0A 3IJDA 3BGJA 3CK5A 2H9AA 1J93A 1FWGC 5D30A 5LZLA 1FKWA 1U1JA 4NZ5A 3E96A 4PMVA 2EPMX 1PVNA 3T42A 4UR7A 1UKOA 1DHPA 3VCCA 4H6EA 3TTQA 3FHAA 3MDYB 4QT3A 1M7OA 1W9PA 5HMSA 1J10A 4F9JA 1NSJA 3NQAA 1TE1A 3SUWA 1VHNA 1UOKA 5T91A 4EPEC 4YU1A 4HZMA 5CEWA 3NDZA 3EIPA 4FLRA 3WLKX 2XP8A 3BH4A 4Y9MA 3FDGA 3TYZA 1QI3A 3Q45A 1JYVA 1A0EA 3HPAA 2NVDA 4EPBC 3QSTA 1G4TA 9RUBA 1RLCL 3BAWA 4QSHA 1BKFA 2HVMA 2RUQA 3U48A 3GO2A 3PZUA 3WK1A 4F0HA 1XLMA 2NQ5A 4MVAA 4UFMA 4WGHA 3LS9A 4KCUA 3GK0A 4Z2GA 5AOUA 3GRIA 3IGXA 4ZOAA 3W87A 1VQTA 3P81A 1E0TA 1SFTA 3BARA 4GGQA 1EL3A 5LXEA 1TIWA 3NQVA 2PGWA 3FAPA 3NO3A 4DZIA 2X05A 3S1UA 1Q2SA 2GSEA 1E0UA 1TPC1 2ZA3A 2ZR4A 1BXCA 4DBEA 4WSKA 3BLEA 5AVHA 3VK5A 3N2TA 4PMZA 4J3WA 1JRCA 4Q3MA 4AXNA 4WIWA 5EBUA 3POCA 4BJHA 2OO0A 3PN8A 1S2AA 3PF3A 1W8GA 1UUOA 4R88A 2G97A 2XFWA 4GLEA 1TWIA 3PJTA 1RZMA 3MB9A 5D38A 1NAL1 5D9MA 4D6DA 1D3CA 2EPOA 1HFBA 1DJZA 2YA1A 1P0NA 3C0LA 1KGWA 1EGZA 1B4KA 1JYNA 1VAHA 3THCA 4UQCA 4ZTXA 1YDVA 1SU5A 3Q94A 4MYAA 3WQEA 3W01A 2ZDSA 1C3FA 3PAJA 4YWSA 2VJXA 3W83A 3O5KA 4IT1A 3F4NA 4CKQA 4DJED 4FK9A 3B7XA 1HKVA 1SJBA 2CIPA 3IV3A 3EWYA 5DY2A 1H1NA 4C02B 2GOKA 1NY1A 3AAMA 2YZ5A 2ADAA 3BL3A 3MO4A 1FDYA 1P0KA 5FEZA 3WY1A 4UTWA 3B9NA 1UD8A 1RUSA 2O56A 1XR2A 5DITA 1YMYA 4BF9A 1EH9A 3SO7A 2ZTJA 5A2CA 3V36A 2A1YA 3MZ2A 1DIOA 3SURA 3CZLA 2ISVA 3BDKA 1W3LA 2YDQA 2BS9A 4V2XA 3H9RB 2VX6A 2HRWA 2OCZA 3W7IA 2NVAA 2ZUVA 3KS6A 5CBJA 3RITA 1TMLA 3AIUA 1Q4NX 4HN8A 3C8FA 2LPVA 3VIIA 1GOKA 3DAQA 2BASA 4J3TA 2VFDA 1LTDA 4H41A 3WNKA 2J9YA 1G7UA 5EMJA 4PR4A 2FHCA 2EG7A 2PWDA 3QQ0A 1RV8A 2X1IA 1H0IA 2WC7A 1U5VA 1W8SA 1PUDA 3RCMA 1XUZA 2XVNA 3S83A 4TW8A 3MO7A 1REQB 3C0SA 4H2HA 3WLSA 1TTJA 2Z1VA 3WD3A 3ODKA 2QW5A 3KRSA 4PYSA 1ADOA 4S3DA 1L6GA 3W1MA 1ZRQA 1NH6A 4PSPA 2CITA 5BMWA 3BCFA 4HVXA 3CYJA 1WUEA 3IUHA 4PMYA 2NXHA 3W7NA 4DBWA 3DG7A 3GFXA 3WMSA 3W9ZA 2GWGA 1FCBA 2ZUTA 3CHDA 3PNZA 2J77A 3KZ7A 1P7TB 1TE6A 1AZ1A 1TJRA 3FV9A 2YZRA 4M1BA 3OQEA 3K8MA 4RDWA 1OF6A 1QT1A 2OZTA 1V6XA 4PTDA 4DO4A 3UJRA 2QIIA 4ADTA 2G3FA 2VL4A 2QVNA 3WH9A 4DB7A 1ZJIA 3LQLA 1R6WA 3IAQA 4KRUA 2L5HA 4ORMA 3K8KA 3OEXA 2OELA 3L4ZA 1WDSA 1B2YA 1TA3B 4WOZA 4HNCA 4HBKA 3HG4A 4HN4A 1K9EA 4AC1X 1XLLA 2WJDA 3L2IA 1O4UA 4WDXA 1MW1A 4ATWA