3FXYA

Acidic mammalian chinase, catalytic domain
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
379
structure length
379
Chain Sequence
YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Triad of polar residues implicated in pH specificity of acidic mammalian chitinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Acidic mammalian chitinase
total genus 132
structure length 379
sequence length 379
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3fxyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3fxyA01
4C7GA 4CN6A 3PZUA 7CGTA 2W66A 4AY1A 2CHNA 5D9PA 1ESWA 4TVCA 2VZOA 2VZSA 1B3VA 4MJ2A 4MAZA 2JALA 5BXRA 3S6TA 1CTNA 4JHZA 3BSHA 3AHYA 1E5JA 3SCSA 1CLVA 5A1AA 3KL5A 4NRRA 2ZICA 4IM4A 1MW0A 3WFZA 3T2OA 4AZ7A 1BYCA 4KH2A 4MNMA 3OIHA 1B2YA 4HMDA 4OIFA 1E71M 3ZM8A 4AIEA 1ISVA 1OM0A 1PX3A 2E40A 1R7AA 3EDDA 3AS3A 4AISA 2WKGA 5BYWA 3ARZA 4BF7A 4AD5A 4PTXA 4AXNA 4U3CA 1CXEA 1E73M 1HJXA 2VURA 1MQRA 1ZB5A 3II1A 3PZGA 2Z1SA 1VRXA 2BHZA 4TOQA 4JL2A 3WBAA 3BMWA 1E1FA 5BXPA 6A3HA 1V6XA 1LL4A 4H8HA 1O6IA 2WVSA 1I1WA 4E8DA 3MV11 1OGSA 2YBTA 1W3HA 4XZBA 3HU7A 2HVMA 1JZ7A 2CBIA 3L4TA 3W27A 1TVPA 4PMVA 3WQ4A 2WHLA 1XSJA 4JL1A 4QFUA 5FL1A 3L4UA 4CU8A 1NWTA 3CUJA 3VNYA 2EPMX 4ZE4A 2OSYA 4CN1A 4CUCA 1B90A 3VGBA 1JFXA 2DPEA 2BY0A 1UWQA 1I1XA 1HP5A 3L2MA 2A3CA 1E6NA 1WZLA 3ZIZA 4WF7A 5C70A 1C90A 3SURA 3SEPA 3IJ8A 5AC4A 3HMCA 1UQYA 4WSJA 2YBUA 4UQBA 4X0NA 3K4DA 2XIIA 1C93A 4TX6A 2W91A 3GXDA 1LJYA 2DT2A 5BWFA 1WZMA 1ZJBA 1C8XA 1EHNA 2CITA 4UOJA 1R87A 3POHA 3VD3A 3OGRA 2Y24A 4PCSA 4D72A 3VGHA 3VGFA 4AD3A 1OB0A 5EB8A 1UH2A 1V3IA 1VFFA 3VDAA 4HMEA 4UFMA 3W4RA 2E8YA 4F66A 1ZBWA 1JDAA 3BXWA 1BF2A 4LXFA 2JEPA 3CZ8A 2D3LA 5CQ1A 2VR4A 4UFIA 4PSRA 3AI0A 3L4ZA 5A3HA 5I24A 2XTKA 1VFOA 2CCRA 3NSXA 1A3HA 5DF0A 3WNMA 1P6WA 4K68A 1S46A 4W8BA 4ML4A 1NWSA 2VRQA 2CEQA 3BC9A 3ZQ9A 2J7GA 2Y2WA 4CCEA 3F4VA 3VIPA 2WM0A 8CGTA 4JFUA 4LYQA 4KGJA 5I3DA 3AMLA 3WD4A 1TA3A 2QF8A 1GVYA 3WEZA 2EBNA 1W3JA 1RP8A 4U2YA 1JZ4A 2VCBA 2VQTA 5IFPA 1ECEA 2XM1A 3UEQA 2A3HA 2GSJA 1SR0A 3QGVA 4HPGA 1E6ZA 1V6VA 3ARPA 1BGAA 1AVAA 2DSUA 1QNPA 1UA3A 1JZ5A 2E9LA 1GHSA 2XVLA 4UQDA 5GPRA 1JI1A 3O9NA 3FAXA 3UG3A 2F61A 2PWFA 1HJSA 3BSGA 1UR0A 5D9MA 5EFFA 3BLKA 1W9PA 3T2QA 2FDMA 1HKJA 3BAWA 1OGGA 1AQMA 4F8XA 1BVZA 2QPUA 3UCQA 4OZOA 4ACZB 1QBAA 4Z2GA 3ZR5A 1TZ7A 3VGEA 3CHEA 5JBFA 4U3AA 1WDRA 1PX8A 1GW1A 1UD4A 2CNCA 1V3MA 3TA9A 1CXLA 4BQ3A 2VRJA 2J7FA 1BYDA 2WZHA 3M07A 4UZUA 3VIGA 1DWJM 3CZGA 2DIJA 4UFHA 4TVDA 1E70M 5GNZA 2NT1A 1W1PA 1HT6A 2Y8VA 2EPKX 1J11A 4EK7A 2VX7A 4JKMA 3OLEA 3AIVA 4U2ZA 2O9PA 3FHAA 1V6UA 1J0IA 2IUZA 3VVGA 4MAVA 3ARSA 1NQ6A 1E4LA 3FY1A 1JL8A 4GO9A 1NH6A 4U33A 4IUGA 3N1AA 3BAYA 3HJEA 5CSUA 1UKTA 5CSYA 2RGMA 5D9NA 3AZSA 4ACYA 3M46A 4JFTA 2OWCA 3VD5A 1J0HA 5A6SA 4W8AA 4UQEA 4MPKA 3W29A 1DWFM 2CBVA 3ARYA 1HVXA 3MMWA 5CG0A 3PZIA 4M24A 4BCEA 2FHFA 2XUCA 4FF5A 2VCCA 3MU7A 1EGZA 2J77A 5JIWA 3VM7A 2ZXQA 4Q7NA 1H41A 3K8LA 4M8UA 3AZTA 3WMSA 2E4TA 1W32A 2C0HA 2PC8A 1VENA 2FH6A 1J0YA 4KWUA 5HXMA 1JYNA 1K9TA 1JD9A 4D71A 3WELA 3DYMA 4PUEA 4Z2LA 1KR1A 4HMCA 2O9OA 5E09A 3RIKA 1PPIA 2WVVB 3KE0A 2PBGA 1ISXA 1V3JA 4L4OA 4PMOA 3AQUA 1J12A 5AC5A 3MUY1 4AD2A 1J0ZA 5TD4A 5IXEA 4C7FA 1VBUA 1ZBCA 4KGLA 4GINA 4MB1A 4BS0A 3ARUA 3WL1A 5IDIA 3RDKA 3FNDA 4CVUA 1GZJA 3AIQA 2UY4A 4KRTA 5A6JA 1GHRA 4AW7A 4W85A 5A69A 2VVSA 4PSPA 4QLLA 3ARVA 3CHDA 1V02E 2XM2A 1G9HA 3SCPA 2X05A 4D1IA 3CZEA 4HA4A 1RPKA 3G6LA 4JCLA 5ECUA 1G01A 1LWHA 4NRSA 4MADA 5AY7A 2WMGA 4D6HA 4MNKA 1NP0A 1YQ2A 1BGGA 3K4AA 1W9XA 1LQ0A 1GQJA 2XFFA 5KEZA 3W24A 1BHGA 1UKSA 2JF6A 1BVNP 2EJ1A 4NZCA 1H5VA 1V0NA 3NYDA 2EQDA 1E3XA 4M80A 2JIEA 1CXFA 1TR1A 3GM8A 1MQQA 1XH1A 1VB9A 2VUYA 4P7NA 1MFVA 4CD6A 4X0VA 5E9AA 1SFSA 2ZUUA 4PTVA 1BFNA 2VCAA 4XUYA 1AQHA 4PMYA 1Q6CA 5A8PA 1GQIA 1UWRA 3AIEA 1KXQA 3ZOAA 4MTVA 4ZFMA 1UHVA 4PRWA 3VILA 4J3UA 1JZ2A 1UWIA 5DMYA 3NSMA 4W5ZA 3TTQA 2DH3A 3AISA 1KQZA 4PMQA 1JAEA 4TUFA 4M81A 3PTMA 4GO8A 5CGMA 3WDIA 3WH6A 3A3HA 4Q22A 3A47A 1MQPA 5A6MA 5HPCA 4PN2A 4EANA 4TVUA 2AAAA 1Q6DA 2ZE0A 3CHCA 3RM8A 1SMDA 3NDZA 3SCOA 2E3ZA 3THCA 3BH4A 4P8UA 1NWRA 4BA0A 2YA2A 3VIHA 1ZBKA 4WKAA 1W9BM 5I5RA 2BNJA 5LA1A 4R5EA 1H49A 3WDJA 2FH8A 1CXHA 3CH9A 1JDCA 3GNPA 4AEFA 3BAXA 3VX0A 3RILA 3VIJA 3W6MA 2FGZA 1XYFA 2BFGA 4J3SA 1XC6A 2QMKA 3AIWA 4D6DA 1EOKA 1FHLA 1JG9A 2ZUWA 4ATDA 1LG1A 2VZVA 4RE3A 2DT0A 4OOZA 4OBRA 2WBGA 1FP8A 2DSKA 3VX1A 4Z2JA 3WSUA 1IT0A 1G0CA 3QHNA 1R8LA 1B3WA 2EPOA 1W1TA 2EXOA 4AD0A 1MW3A 4CGTA 2ZX5A 3CBWA 4GXPA 4YHGA 4UNIA 3ARWA 3MKKA 3WF2A 4RL3A 4PMUA 2G3NA 4UOZA 3POCA 1V0KA 2ZXBA 2IXUA 3OB8A 4CVWA 3DHUA 2ZX7A 3SCWA 2QPSA 1MFUA 4KMQA 5I0DA 2DIEA 3ZSTA 1CXIA 1D7FA 5FL0A 2XVKA 1VBRA 1B1YA 3CLWA 2BY2A 3LPFA 4GZEA 3APGA 1HKMA 4QAWA 1K6AA 2CXGA 3AFBA 1VJZA 3GZAA 3KWXA 4Z2IA 5FKYA 4HA3A 1JIBA 1MW1A 3WNKA 3OGSA 1ZBVA 1WZAA 4NF7A 1OCQA 3O6AA 4IPLA 3TOPA 3ARTA 3ZJKA 4JFSA 1Q6FA 2ZOXA 5CPTA 1Q6EA 2WCGA 3TTYA 1BAGA 2PWHA 2J7DA 5HOSA 1GJUA 3WH5A 3GTNA 2D2OA 3RJYA 3W25A 5A2CA 1L8NA 2Y5EA 4AYSA 1DTUA 2PBOA 1GORA 1E6QM 2VRKA 3UG5A 3OLGA 1EO7A 3VTRA 2G3MA 1OD8A 5CPSA 1B3ZA 4U31A 4OKDA 4DUVA 3ALGA 4HOWA 1RP9A 3OLIA 3DYOA 3ZT5A 4N42A 1VEOA 3A4AA 1UD8A 4XZWA 5C71A 3WQVA 4ATLA 3ZJ6A 3BGAA 3CPUA 1KXVA 1V3HA 3GH4A 1ZL1A 4CD4A 1JNDA 1JZ8A 3GH7A 3PZTA 4GQQA 2J78A 3I3BA 2DDXA 4UR9A 4DM2A 1XSKA 5CJ5A 1KR0A 2OLHA 4M56A 4U5IA 1VEPA 1C92A 2XJ7A 2WHJA 1J18A 2O9TA 3RJXA 3L4VA 1E15A 2WMHA 3QR3A 4UTFA 2J74A 4HZ8A 4A3HA 2A3EA 4GI6A 3FN9A 2ZUVA 1WPCA 4HP5A 1W3KA 1QI5A 1J9YA 1GCYA 2DEPA 1QHZA 3MUAA 2W63A 4U5KA 3SCQA 1H09A 1V6YA 4ACZA 2J47A 1V6WA 1WCGA 2TAAA 1KWGA 3BMVA 3AZRA 5DT7A 1NOUA 5D8WA 3ZR6A 1D3CA 1QW9A 2F2HA 1PJ9A 1E3ZA 3SCRA 5CPQA 1CGYA 2DSWA 1GOWA 1E72M 3AICA 2YA1A 1NOFA 1ZJAA 2WYSA 3PZVA 3U57A 1FFQA 5HNNA 5DT5A 3ZT6A 4EKJA 1TA3B 1KWKA 1US3A 1B3XA 4J28A 4LYPA 3WMCA 1GPFA 1M53A 1MYRA 2DQXA 4W7WA 3U5UA 2J7EA 3U5YA 3T08A 2QLYA 3PZMA 1MWOA 2A3AA 2ZWYA 4F9JA 4MB3A 1FFRA 2BV9A 1UA7A 5A2AA 1KFWA 4P7LA 3WF1A 9CGTA 2WZEA 2J79A 3KL0A 3NSNA 2XGBA 5DFAA 1HNYA 3VUPA 3BLPX 3M7SA 3GNRA 1HN1A 1QNQA 1EIBA 1Z32X 2BY1A 2J7CA 4PMRA 4B15A 1X6LA 3VD7A 3WENA 5IHRA 2YL6A 5D8ZA 2PI6A 3K46A 5KZ6A 2YJQA 3DHPA 3MMUA 1JZ3A 5BXSA 2EO7A 1M7XA 4PMXA 1HXJA 3GH5A 4C7DA 5FD0A 4R27A 1C8QA 5E6YA 4URIA 1OT2A 3AYSA 1WP6A 5A8NA 2D0FA 3W28A 2YL5A 5BXTA 5ABEA 1KGXA 3SUSA 1CEOA 1UR8A 4XX6A 1H2JA 2X8RA 1KCLA 2UWFA 3DECA 4YN5A 2OSXA 2XVGA 4D6CA 3KEHA 1QW8A 3N15A 4UQAA 4EE9A 1E0WA 4CD5A 3N9KA 3PZ9A 3MV01 3ARRA 1HJVA 3B9EA 4N0RA 1CWYA 4D6FA 2G3IA 4E2OA 3T2PA 2Z1KA 2GJRA 3WQWA 4B9ZA 1UR4A 3VD9A 3AMCA 1X6NA 6CGTA 2ZXDA 4W86A 5JBEA 4OOUA 4LGXA 2QHAA 5HDRA 1W3LA 4TTUA 2EPLX 3DC0A 1A47A 1XSIA 3EMQA 4M1RA 2WLYA 5E0CA 1XD0A 1W91A 4RE2A 4UQCA 3WUEA 2WB5A 2WVTA 4UZSA 3WN6A 4W8LA 4HU8A 1HJQA 1ZU8A 1CZ1A 2CKSA 2WNWA 1CGVA 1JAKA 4NI3A 1OSEA 3SCUA 1E5NA 5IHSA 2GVYA 5HBFA 1SMAA 1BPLB 3N12A 3ZSSA 1JFHA 4PMDA 4UOQA 4IISA 3A4XA 3VINA 2D1ZA 4QCEA 2AOSA 4AZIA 5CXPA 1NP2A 3WEOA 1UH3A 2WMJA 2VZTA 4W87A 1XH0A 2WMKA 3QOMA 4MB4A 3AS1A 3EDKA 5A2BA 3WNPA 1FA2A 2PB1A 4AIOA 1FH9A 3WY1A 3EDJA 1CLXA 3U7BA 5D4YA 1EQPA 2BHUA 2YA0A 4J27A 4YHEA 4BQ5A 1UH4A 4M82A 5DEZA 2GK1A 4CCDA 1UWTA 1ISWA 3WD0A 2DT1A 5GQBA 3NCOA 4QLKA 1C7SA 4D6JA 1B9ZA 1K9EA 1JXKA 1IV8A 2HISA 1PEZA 1OIMA 1UUQA 1WZKA 1M01A 1KBKA 5CLTA 1E1EA 6TAAA 3WL0A 2YDSA 2WC7A 1ODZA 1OIFA 2YKKA 2WW5A 3WEMA 3VM5A 1E6PA 2VNCA 1GNXA 2X1IA 2WC3A 1W2VA 2BS9A 5D9OA 4W88A 1CYGA 4XB3A 1LG2A 1VIWA 2GJPA 5ABHA 5AYBA 1PZ3A 3A6OA 1UG6A 1TG7A 1XRVA 1HP4A 1E4MM 2XG9A 2VJXA 1NOWA 4L4PA 4BQ4A 5BRQA 2XPKA 1OINA 3UERA 1JF5A 1JD7A 1TMQA 2OYLA 4AEEA 1U2YA 3AYRA 3FHQA 1G5AA 2GJXA 2YOCA 3VIOA 1QVBA 2W62A 5I23A 2XWDA 1MXDA 1H4PA 4JHOA 1UD5A 3WBEA 3WNLA 3RPMA 1CXKA 3L4YA 1PZ2A 2WHMA 1QI3A 3M6DA 3WDRA 2Y8KA 3KL3A 2WMIB 2E0PA 1EDQA 1QI2A 1JF6A 3WUBA 2ZX8A 1CGTA 3VDBA 2XIBA 1VJSA 1KGWA 3B9AA 3WQ6A 4UFLA 2NSXA 2XFYA 3W37A 3WFLA 2VC9A 3VGGA 3CIVA 3WNOA 1ODUA 3DYPA 1EHAA 3MUZ1 2ZX6A 3SIMA 3MMDA 2CETA 3LPPA 3EDFA 5M3WA 1E56A 1Q4NX 4QCFA 1V08A 1UZ1A 1OWQA 2D3NA 4LX4A 1O7AA 1J01A 3I3DA 4GZIA 2CHOA 1H0GA 5A6AA 2JF7A 3IJ7A 4Y7EA 3ECQA 3CO4A 5A6KA 3AMKA 1HL9A 4DWSA 2X0YA 2C8NA 5LA2A 4H04A 3WUFA 1DWGM 2XVNA 4B3KA 4V27A 3WQ8A 3PZOA 2OYKA 1JYWA 1CDGA 2X0HA 2VI0A 5DO8A 2J8GA 5ABFA 4OBSA 2J75A 2ZUNA 1NWUA 2WANA 3UR8A 3VD4A 1MW2A 2YDRA 4HPHA 5CGTA 2J4GA 2WWCA 2WC4A 3IANA 3CUFA 3PHAA 3VNZA 3W53A 4J7RA 1LWJA 2YL8A 5A6LA 4HZ6A 4QDMA 1SYTA 1GUVA 1F4AA 1AQ0A 4J3XA 4UFKA 1TCMA 3E1F1 4D1JA 2FHBA 3AIBA 3TP4A 3B8SA 4DM1A 5JUVA 5EMYA 2O92A 1QNOA 1R86A 3ZJ7A 3AMDA 2E9MA 4CD8A 5BRPA 5LA0A 3CMGA 5E0FA 2E8ZA 1QPKA 4WSKA 4AD1A 3AHTA 3CMJA 2XGIA 3RO8A 1L0PA 3VO0A 1XV8A 5FOOA 3ALFA 1AMYA 1E6XM 1WDQA 3L4XA 1WO2A 1UQZA 1XCXA 2VT0A 5CLWA 3MANA 3NJ3A 3WQ5A 1QI0A 3GBDA 1GVIA 3L4WA 2ZIDA 3S2CA 1VFUA 1BG9A 4GKLA 3QOKA 2AMGA 4KRUA 2UY5A 3PZNA 4OJYA 1FP9A 2CYGA 4FLOA 3D5HA 4DUWA 2BVDA 1EDTA 5M17A 3D3AA 2GDUA 2IXVA 3CZJA 3N11A 3GBEA 5I2UA 1KXHA 1UYQA 1K9FA 3AXXA 2VL4A 1UD2A 1EDGA 4TX8A 1J0JA 5FCZA 4GPNA 2VVNA 2XFRA 2BHYA 1OBAA 3AHZA 1B3YA 3MSDA 1DWHM 2NT0A 4ZXLA 2WPGA 3K1DA 4ZE5A 1PIGA 7TAAA 1UZ4A 3WKZA 1CBGA 5LYRA 4JZ5A 3ZO9A 1G1YA 1JGIA 2VX6A 4WLCA 3FAWA 5BCAA 2DT3A 4B9YA 3LPOA 3F5JA 1EOMA 5FIPA 1JI2A 3TONA 3AXIA 1HX0A 3VIKA 4QLJA 1DP0A 1W2PA 3MSGA 3TTOA 2W5FA 3I3EA 3WNNA 3T0DA 2YIHA 3K8MA 4M29A 4RE4A 4H8VA 3GNOA 1GOIA 4CU6A 1WDPA 4PEEA 3AROA 1VAHA 2VO5A 4PCTA 3VDHA 4H41A 4YPJA 4J3TA 4AC1X 1BLIA 1UR2A 1V02A 1XGZA 4AZCB 3VU2A 1Y7VA 2WVUA 1OGBA 1JNEA 1C8YA 1TE1A 3CHFA 2JEQA 4AWEA 2A3BA 1YHTA 3NIYA 3OLDA 3MS8A 1PBGA 1NARA 1U33A 1XHGA 1E6SM 4HOZA 1VF8A 1PAMA 3SCNA 4MNLA 3THDA 2WCSA 2YL9A 1QHPA 3EMZA 5C8BB 2G4FA 3W81A 4AZGA 1J10A 3EMCA 4LPCA 1QBBA 2XSBA 2VQUA 3RM9A 2CPUA 1C3FA 3A4WA 4PMNA 3ZJ8A 3SUUA 4ZXOA 3VOCA 3IJ9A 4PMZA 1EA9C 1KCKA 3PN8A 5M5DA 1IZJA 4MNJA 2CIPA 4FLSA 4AZ6A 1GOMA 3ARXA 3WDHA 4UQ9A 2XSAA 5CZKA 1WKYA 4QP0A 4AZBA 4E8CA 3VKKA 3ARQA 3VIIA 2XHYA 3FW6A 5EFDA 3PZQA 3QHOA 3W26A 4CCCA 2CKRA 1HKKA 1JDDA 1U30A 1V3LA 1QOXA 2UY2A 2G41A 4GIAA 2WHKA 3PBGA 1FH8A 1XH2A 2WLZA 1WNOA 1DWAM 4W7VA 2RGLA 1ISYA 3EDEA 1UKOA 1UOKA 1EH9A 4Z2KA 2PWGA 2GDVA 3QHMA 1UKQA 3CGTA 8A3HA 1E55A 4PYSA 4EAMA 1E0XA 4W89A 4UCFA 2ZUTA 4CU7A 5A6BA 1D2KA 1MVYA 3N04A 3GXIA 4DWSC 1NM9A 1E4NA 1ISZA 1CPUA 1XCWA 1BG4A 2C7FA 2VMFA 3OGVA 1UR1A 1BYBA 1CGWA 4JKLA 3N13A 4UFJA 3WDQA 2QV4A 1EO5A 5ABGA 4MJ4A 4BZYA 1GQLA 3N17A 2FGLA 2V3FA 1FOBA 1G94A 2VX4A 1BYAA 1KGUA 1V0MA 1ITXA 4AZHA 4AMCA 3OZPA 2XYLA 2JE8A 5IFTA 1E6RA 3NUKA 2UY3A 1KBBA 2J62A 2V5DA 3OBAA 1E0VA 1UR9A 3WF3A 3SCVA 4DWSB 1M03A 1C91A 1FH7A 4V2XA 2ZX9A 4JKKA 3VGDA 1CENA 4GZJA 4DWSD 4F9DA 3WUGA 3L2LA 1J0KA 4AIUA 1R85A 5A94A 3TTSA 1F4HA 3OG2A 3CUHA 1JZ6A 5HPOA 2CBJA 4PUDA 3VPLA 5I6SA 2W67A 2ZXAA 3F5KA 3T0AA 3FXYA 1GOQA 4H7VA 4HTYA 2WBKA 2DH2A 2FHCA 2W4XA 2ZUMA 2WK2A 1W1VA 2QMJA 3AIUA 2NW0A 4H2CA 2VX5A 4OUEA 4BQ2A 2VR5A 4P7RA 3AIRA 1DHKA 1HJWA 1H3GA 1WB0A 4WK9A 2D0GA 1WDSA 3SUWA 3G6MA 1V3KA 4W7UA 1HIZA 2GFTA 3AOFA 4ATWA 4JFVA 1LL7A 2WSPA 4TTGA 1XYZA 2GJXB 1GOKA 1LF1A 5GNXA 5EBAA 3LMYA 2WWDA 4J3VA 3N18A 2GUYA 4P8XA 5AYIA 2V3DA 4FLRA 2YLAA 4W84A 1UWSA 3WF0A 2GK1B 1HL8A 2YDQA 4NSBA 4E4PA 1IZKA 4HZ7A 2J7BA 3EYPA 2EPNA 2WMIA 1X1NA 4PTMA 3PTQA 3CUGA 1WAWA 4D6EA 4S3JA 4FLQA 2Y4SA 2V5CA 1QNRA 3WF4A 5A8MA 2WXDM 1B31A 1HVQA 2EEXA 5GNYA 7A3HA 1UWUA 1R7OA 5ABFB 3O2LA 2XWEA 4MDOA 2J7HA 4GQRA 4V28A 2CBUA 1E40A 2D0HA 4A4AA 3IAQA 3WD1A 1QI4A 4D6GA 2BVTA 1V03A 4F79A 2WCAA 3EBVA 3W0KA 3GYCA 3UESA 3U7VA 4ZENA 4MDPA 1UD3A 1JXJA 4X9YA 5F7UA 5JIPA 5A6BD 3BCFA 3JUGA 1OD0A 3B9DA 2DGAA 1PIFA 5A8QA 4LQ1A 1LLOA 3BAJA 1GONA 1H1NA 4P7OA 4PBGA 1K9DA 2V3GA 2PF0A 4B3LA 1H0IA 1US2A 1WE5A 3GXFA 3HN3A 5E70A 3NDYA 3WH9A 1CECA 2WKLA 4S3KA 1MXGA 2B31A 4HA1A 3LPGA 3VMNA 2G8ZA 3WH7A 4HOXA 3RM4A 1HJUA 2OWWA 2CERA 4CD7A 3GXMA 2BXZA 4FK9A 1PX4A 3GDBA 1E43A 3SUVA 1HF6A 4ZEPA 5A8OA 5E6ZA 3W82A 3WH8A 2ESCA 3CUIA 4LYRA 5JBDA 1KXTA 1V0LA 4GI8A 3BCDA 4H8UA 1N82A 3AS0A 3VMPA 3RCNA 3SCTA 4PTWA 4Z2HA 3F5LA 1W9DM 3T0BA 1EXPA 4J3WA 1B0IA 4IPNB 2BXYA 3OZOA 4B16A 4W93A 2PWEA 2WAGA 1E9LA 1EQCA 1CGUA 4XV0A 4CKQA 1DWIM 4W5UA 3CTTA 3SUTA 2OSWA 4HU0A 2PWDA 1JYXA 4WKHA 3ZT7A 1XD1A 4JIEA 2MANA 3RMEA 2G3JA 5A95A 1KB3A 4P7QA 2Q8XA 2CESA 2F8QA 3WDPP 1QNSA 1FHDA 3KZSA 1ITCA 1GQKA 1UKPA 2D22A 1CIUA 2V38A 4AD4A 2D23A 2VZUA 1LL6A 1W9UA 2WSKA 3IAPA 3WD2A 1BTCA 1GJWA 3AHXA 2BY3A 1DEDA 2OYMA 2JIWA 4WJXA 3VIMA 1C7TA 2J8FA 2W61A 1I75A 3CZKA 1GOOA 3W6LA 1RH9A 2X09A 2YLLA 1CNVA 3WD3A 1B30A 2D24A 2W92A 3MO4A 3VMOA 3AMGA 3BAKA 5M03A 2BVYA 2WMFA 1TFVA 1TUXA 3J7HA 3MUIA 2WZIA 2J25A 1ZS2A 2OWXA 3UETA 1OT1A 2XVPA 2ZWZA 4JCMA 4P8VA 3VIFA 1BSIA 1W9VA 1H11A 3UG4A 1JYVA 3T09A 1M04A 1TVNA 4GI9A 4WKFA 1HKIA 3ZMRA 2DSZA 4MB5A 4A3YA 4P8WA 5JH8A 1UD6A 4JFWA 2D20A 3AS2A 3W38A 3AHVA 1Q6GA 4AZCA 2WVVA 1BQCA 1VEMA 3AJ7A 1W1YA 1QHOA 5I78A 4JAWA 1RD6A 5I77A 2ZUSA 3BAIA 2X2YA 3K8KA 5BROA 4DUXA 2VTFA 4TXEA 3VDCA 3AXHA 2V3EA 3IK2A 4AZ5A 4FMVA 2DSVA 4WIWA 2JFEX 1E4IA 2O9RA 2VOTA 3CZLA 5I79A 1KQYA 4D6IA 3UR7A 3WMBA 2E9BA 3WIJA 3OA5A 1VFMA 1CGXA 4CN4A 3PTKA
chains in the Genus database with same CATH superfamily
4C7GA 4CN6A 3QC3A 2CHNA 5D9PA 1PL9A 1Q8JA 1ESWA 3TV8A 2QYGA 3S5NA 3MWAA 4MAZA 3VCRA 3TCEA 3DDMA 5IBXC 1X8CA 3U8GA 1CLVA 2ZICA 1MW0A 4C6JA 4KH2A 4LBSA 5M1TA 2OT0A 4OIFA 3W9ZA 1E71M 3U3HA 2IF4A 1PX3A 3UWYA 2PA6A 3EDDA 3PRBA 3AS3A 4AISA 4BF7A 5CZSA 1F73A 4XG1A 1C29A 3M5ZA 2NZLA 4AXNA 3T44A 1HJXA 3QGKC 3BLDA 3LSCA 4DQWA 3Q94A 4JL2A 3WK0A 3BMWA 1E1FA 5BXPA 6A3HA 1JDEA 4H8HA 1XLKA 1IEQA 3E2RA 4UTJA 3MV11 3TFXA 1OYAA 3V16A 4XZBA 4DAFA 1Z42A 3HU7A 2VWTA 2HVMA 5B80A 1TVPA 2F7FA 1JDFA 3DFTA 3RHGA 2ATSA 1PTGA 3H7UA 4TW6A 5BMXA 4O10A 4JL1A 3DX5A 1TZZA 5HR6A 4X63A 3AO0A 5EKYA 3CUJA 3B8IA 1TPWA 5IDZA 1PWLA 4J4NA 2VDGA 3E9AA 1UWQA 1I1XA 2V63A 1RBAA 3PTDA 1HP5A 3R11A 1XLHA 2G95A 4HBOA 2WZTA 2F2DA 4E0CA 1C90A 1AZ2A 1FWDC 1IIGA 2ZDRA 3SURA 3SEPA 1UQYA 2ABBA 4WSJA 4X0NA 3GAKA 4B2DD 1R3SA 2W91A 1LJYA 2JGYA 3EPNA 4Q8QA 1LOLA 3OGRA 2Y24A 4PCSA 4D72A 1MUCA 3LLXA 4AD3A 2VWSA 1UH2A 1FCQA 3VDAA 4HMEA 4UFMA 4BHYA 4L1WA 3VFLA 3T0CA 2D73A 1VCFA 3G0XA 3S42A 4J3ZA 1ZBWA 3BXWA 1F3WA 1REQB 4L4MA 2VR4A 4UFIA 2P5NA 1F7BA 3A24A 1S46A 4BY3A 4TYOA 1PO9A 4IFOA 4JTHA 3RFAA 1NWSA 5G1YA 2IKIA 3OYXA 3GU2A 2HXUA 2VEFA 2Y2WA 4CCEA 3DH7A 3ZWSA 1EA0A 4JFUA 1C9HA 3VKDA 5I3DA 1KT0A 4G7EA 3DKLA 1PCKA 4A05A 3QFWA 1A0CA 5DRCA 1RP8A 3LLDA 4U2YA 3H2EA 2GGHA 3KLKA 3U4AA 1ECEA 3UEQA 3GHUA 1XBXA 3H2MA 1TCDA 5DCDA 4Y9PA 1ADOA 1O5XA 4GUIA 2YXGA 4Y8EA 3ARPA 1AVAA 5BXJA 1JZ5A 1WUFA 1GHSA 1TWWA 2FZ8A 1JI1A 2XP9A 3DFNA 5FF4A 3GG8A 1MUWA 3P7YA 3STCA 1I0BA 1MI3A 4JTFA 4YMZA 3V5FA 2XPAA 2DZUA 4EXBA 2PPGA 4JD4A 4I3GA 3BAWA 4TQTA 4OZOA 3UQNA 3VNDA 4Z2GA 1HZYA 3ZR5A 3NQCA 1W1B1 3VGEA 3CHEA 5JBFA 4U3AA 6TIMA 1PX8A 4C1KA 1Y0EA 1KV8A 2PPPA 4NAFB 1HQTA 1M5WA 4DI9A 2DIJA 1TCOC 1OC6A 5GNZA 2NT1A 1W1PA 2F84A 4N9CA 1Y5XA 1J11A 4EK7A 2CU0A 4U2ZA 2DZAA 2ISFA 2XP4A 4IQLA 1YADA 1E4LA 1V93A 2GJNA 3KDOA 2WQPA 1AJ0A 2PDCA 4GC3A 5C6MA 1NH6A 1XGDA 4H4IA 1PTAA 3OODA 4GBUA 4US5D 1ZTVA 3GDRA 5FEWA 4BFAA 2R24A 1DJYA 2CLHA 5C9RA 4N4PA 2NXGA 4UQEA 3ME3A 4QSFA 1IWPA 3TH6A 2A7RA 3TC5A 3QV9A 4OT7A 4ZMGA 5LKYA 3IVTA 4BCEA 1EC8A 1Y8BA 1ZJHA 3K8LA 1A3XA 4AIBA 3AZTA 1JCNA 3VE9A 2QKFA 3R8GA 2C0HA 1AW5A 3MJYA 4D71A 3SW6A 3M5VA 1DJXA 2BVWA 4PUEA 3H53A 1KR1A 4HMCA 2GVLA 3D6NA 2Z1BA 2Q71A 1V8EA 1TPB1 3V75A 3HG4A 3WCZA 3MA8A 1DJQA 3MUY1 1Y65A 4Q4MA 2IQDA 2P4VA 4X2PA 3SJ3A 1T7LA 3UY7A 4KGLA 1R2TA 4MB1A 1EZWA 3VC6A 3ARUA 3FDKA 4DROA 5IDIA 3UW6A 4A8LA 8TIMA 3A22A 2UY4A 5A6JA 1GHRA 4UUIA 4AW7A 4IPXA 2Y85A 3G24A 5HKGA 4NNBA 3CHDA 3N73A 2XM2A 3SCPA 3CZEA 2H90A 2P0IA 4JIIX 1RZMA 3FGCB 1ONRA 3QY6A 4LW7A 4MNKA 1NP0A 4L80A 4BK9A 1QCWA 4LAUA 1GQJA 2KE0A 3CB3A 5KEZA 3W24A 2JF6A 2EJ1A 1V0NA 1VPXA 1XS2A 2G97A 2EQDA 1E3XA 3VOFA 1EXBA 1XH1A 1QASA 4Y9AA 5E9AA 1SO5A 1XKYA 1BKFA 1BFNA 3W7OA 5EY5A 1RK6A 1FKSA 5A8PA 1V6TA 4MKVA 3UWVA 3AIEA 1T11A 4MTVA 4S3BA 4NHVA 4ZFMA 1UHVA 3VILA 1UPPA 3T0TA 1YTEA 1XLEA 5DMYA 1P0EA 2NQZA 2DH3A 3PJXA 2ODOA 1H7PA 3AISA 1AH3A 3H4WA 1KQZA 3G0UA 4ADSA 4HNTA 4DB7A 3NPUA 1JAEA 4AF0B 4E6MA 1NSJA 3A4JA 2V8ZA 1L6FA 1Y5VA 3GR8A 1TRDA 4XZHA 3A21A 3WDIA 3UT0A 3WH6A 2EG8A 3A47A 1MQPA 1M3UA 4WXYA 4EANA 1QZ2A 2AAAA 5XINA 1R3RA 1HFBA 2LPVA 5CJMA 1BD0A 3NDZA 4C5YA 2E3ZA 3UNDA 2R94A 2OLAA 5H1WA 1NWRA 3B4UA 1OFQA 4XQ6A 4WKAA 3JZUA 4O54A 4FNRA 1X38A 4OU1A 4QG6A 1WDWA 4MKSA 4R5EA 4XTDA 3WDJA 4QDWA 1GYMA 2FH8A 3A3WA 1CXHA 3CH9A 1JDCA 3GNPA 4B90A 4ZQMA 3DXIA 3QYQA 3W72A 5CGQA 2BFGA 3CAKA 4MG4A 2QMKA 3AIWA 1EOKA 1JG9A 3FSUA 4NG3A 2VZVA 4OBRA 4DRHA 1FP8A 2DSKA 5BZAA 1ZAHA 4Z2JA 1RJPA 1F07A 1IT0A 1G0CA 2OOFA 1R8LA 1B3WA 2Q09A 3MUCA 1MW3A 4C1NA 2ZX5A 3P61A 3W2LA 4KEUA 4MVAA 4YHGA 4I9TA 3S47A 3EOEA 1ONWA 2G3NA 2DU2A 2BGQA 2ZX7A 2QPSA 4KMQA 3G8RA 4DJEC 2DIEA 2XINA 3ZSTA 4PUNA 1CXIA 1D7FA 1QFEA 2XVKA 1GRJA 2B7QA 4JNYA 6REQA 2ALRA 3OYZA 3CMFA 4HT3A 3APTA 4GZEA 3VCCA 1QPLA 1ELSA 4QJ1A 4H9YA 3IVSA 2VFGA 3GG7A 3KWXA 4GHRA 1JIBA 1VFTA 3BWWA 3WNKA 3O6AA 2PTZA 3OBEA 4ONVA 3LSBA 2CLEA 3TW6A 1RCOB 4JFSA 5D38A 2YW4A 1R9YA 3TTYA 1BAGA 5DANA 2NWRA 4KQZA 3GTNA 3HPFA 2D2OA 4JDYA 4IQCA 1G6CA 1L8NA 1VJIA 2Y5EA 3WLMA 1PHWA 5KMYA 3GTFA 1KO0A 3TYDA 2VRKA 1Q6LA 1PCWA 3OLGA 5AN7A 5D33A 3FEQA 4ZCWA 3VE7A 4KRZA 1RP9A 3OOBA 3EWBX 2PDWA 1VEOA 3HQ1A 3G1SA 1ZL1A 1VIZA 5DMNA 1MEWA 2FVKA 3GH7A 3M0KA 4B5TA 2DDXA 3W2NA 1XSKA 1JNTA 2MNTA 1LQAA 1LRQA 1V7YA 2WHJA 3IJ6A 3RG6A 3BJFA 5GJMA 4CNPA 1GVRA 3MVIA 4UTFA 1F2JA 4U84A 2PDXA 3WQCA 4S3CA 4H6QA 4E8GA 1WPCA 1LBFA 4HP5A 5KETA 4IMCA 1R3YA 1GCYA 1LUCA 3R2GA 5KZMA 2DEPA 5BOFA 1SU5A 4YCPA 3EWCA 1ME7A 2YZRA 4U5KA 4DJED 2NV9A 1DPMA 3NL6A 1H09A 5F4WA 4ACZA 2OELA 3GD6A 5MKGB 2MLZA 1V6WA 2TAAA 2QF7A 4DELA 1DQUA 1KWGA 2Y5JA 3SSJA 1U5VA 4IGSA 4NAEA 4LUYA 2CHRA 2ADAA 1XYAA 3VOHA 1D3CA 2F2HA 1PJ9A 4QITA 4N19A 5CPQA 1CGYA 1TREA 1E72M 4BF8A 2AAMA 3H2NA 2WYSA 4GJIA 1FFQA 1ZY9A 1TA3B 3TN6A 4EWJA 4LYPA 3SAZA 2DQXA 3VKCA 4CEXC 1XBYA 2KI3A 3NZ1A 1X8FA 2XGZA 4CQDA 1DL3A 2ONEA 3LU2A 3KOWA 3O3RA 4F9JA 4MB3A 1XYCA 3O05A 2HQAA 3CC1A 1UA7A 3EIPA 1KFWA 3PWAA 4P7LA 3WF1A 4PA8A 9CGTA 5G4EA 1VBJA 3NSNA 1TYGA 2HEJA 1X96A 1K1DA 1DIKA 2WNZA 5HWCA 1VBHA 1QNQA 1EIBA 2BY1A 3CLMA 4Y96A 2X7VA 1RBOB 1DIOA 1X6LA 1J2WA 2FDSA 1ZHAA 3MBFA 5KTLA 5I3KA 4O8RA 3CGMA 3HIJA 2MUCA 1EJRC 4LUIA 5KZ6A 3MMUA 4CQAA 4KEMA 3GH5A 5E6YA 3TKFA 1FJDA 1OT2A 1WP6A 2D0FA 3GRIA 3W7CA 5BXTA 4R9XA 3KRUA 1UR8A 3GO2A 4XX6A 2X8RA 4X61A 4HJWA 3C52A 2QDEA 3QVQA 1FCBA 1AD4A 2IQTA 1IEWA 4YN5A 2NV1A 3OIXA 4CEUC 2OSXA 4D6CA 1FXPA 4EE9A 3HQPA 5LHEA 1E0WA 2YCKX 2FKEA 3MV01 1XLGA 1HJVA 3B9EA 3I6CA 1ZRQA 1IE7C 1CWYA 3UF8A 1O5KA 4RJEA 3CAVA 4B9ZA 1UR4A 5C7HA 1X6NA 5JBEA 4OOUA 3CAWA 2EPLX 5G1TA 4M1RA 1W91A 2WB5A 3DIPA 2R1KA 3WN6A 3EXSA 4HU8A 2O4MA 5A5WA 1ZU8A 4DF0A 3P60A 1KBIA 2ITKA 1JAKA 3SCUA 5U7SA 4A3UA 2M1IA 1E5NA 2NQJA 5IHSA 1WV2A 1JRCA 4K8HA 5LHFA 3DCPA 3UQIA 4PMDA 4MLRA 3DOPA 3HGOA 4IISA 3BOXA 2RUQA 2ZQTA 1TO3A 2AOSA 3NR0A 3HPXA 4RV3A 1G7VA 5AOUA 1UH3A 1DJHA 1GEQA 3SGUA 4PTDA 1KRCC 3R79A 2PB1A 4LC8A 3U7BA 3SRHA 2GVJA 4RX0A 2BDQA 1UPMB 5DEZA 2PEVA 2XP7A 2VDIA 3WD0A 5GQBA 4DBEA 4GYKA 3KOFA 3KVKA 3TA6A 2HISA 4Q6XA 4ICNA 4R33A 3QFEA 3PBVA 4PRTA 2AL2A 2VENA 4IX0A 1XR2A 4REQB 2YDSA 2YKKA 2A4AA 5DITA 3NQDA 1SPQA 1JCMP 2X1IA 2C1IA 5D9OA 4W88A 1TWSA 2PWUA 4NI8A 3UZYA 1A7XA 1LG2A 1OVDA 2QW5A 4U85A 1WKFA 5ABHA 1U83A 1TSIA 3GU1A 5HUOA 2PDIA 2TODA 1ZP4A 1E4MM 1W54A 3KAGA 2VJXA 4ZO8A 5HMDA 2DUZA 2DV0A 3B40A 5BRQA 1LDCA 5EMJA 2VEKA 1JF5A 1JD7A 4JX6A 1QDSA 4RPQA 3AYRA 3FHQA 3OVGA 3S5SA 4XWUA 2YOCA 3VIOA 1QVBA 5I23A 3R89A 4JHOA 1O12A 3WBEA 3RPMA 3QPEA 4GLEA 1U79A 4QT2A 3CU2A 4HJFA 2WMIB 1K8ZA 4FB7A 1FRBA 1BWVA 5D03A 1QI2A 1VH7A 3KABA 4LAZA 4H19A 4UFLA 2NSXA 3VNMA 3WFLA 1C9WA 3VGGA 3CIVA 2F23A 1TPVA 3WNOA 3K5XA 1I2OA 1RHCA 1A3WA 2ZX6A 4BF9A 3MMDA 1GYLA 3EDFA 1Q4NX 3PUEA 1R9XA 1DJZA 4LX4A 1O7AA 5FEXA 3C4UA 3XISA 2CHOA 1Q45A 1H0GA 5A6AA 2BTMA 3TC6A 4Y7EA 2RURA 2OO0A 3RYSA 2XN2A 2C8NA 3GY1A 3N2XA 1DWGM 4NZ3A 4OFCA 1GVFA 2ETNA 1TVLA 2ATMA 3NYZA 2OYKA 1CDGA 4RE0A 4Z0JA 3TJ4A 2B5UB 5DO8A 3T40A 2YYTA 3DENA 3BZGA 1DE6A 1UROA 1U22A 1YDYA 1QPFA 3IANA 4O1AA 3E12A 1Q3NA 3AUJA 4OBTA 2PGWA 1KKRA 3GNNA 2QT3A 2WJFA 3FFSA 2FHBA 2ZVIA 3B8SA 4DM1A 2W9MA 5JUVA 1KC7A 1QPOA 5DY3A 2O92A 1XGEA 2PFHA 1Q6RA 4GY1A 4M7SA 3KCLA 2ZA2A 4WSKA 2NVCA 4EAYA 2QDGA 1MRQA 3QV7A 2Q01A 3RO8A 1XV8A 3VUSA 2FTPA 5FOOA 3VCNA 1WO2A 3KW3A 1UQZA 3EWDA 2ISSA 5CLWA 4WY0A 3MKCA 2YZ5A 3O5GA 3WQ5A 2E77A 4AWSA 1QI0A 3VOGA 2ZIDA 2H6RA 4K7YA 1SUXA 3HPAA 4FEZA 4LUTB 4GKLA 4AC7C 1TR9A 2AMGA 4PCNA 3PZNA 4OJYA 1FP9A 2VFHA 3LRLA 3M7WA 1LYXA 2GWNA 3D5HA 4JTTA 4DUWA 2GDUA 2IXVA 3GBEA 5I2UA 1SJDA 3NO5A 1FAPA 1K9FA 3AXXA 4UC5A 3BV4A 4NUWA 3MI6A 2REQA 3CT2A 4C5ZA 2DFAA 3CNYA 2VVNA 4IXXA 3AHZA 3P93A 2Y62A 3RLVA 1R9HA 2JKPA 3K1DA 4ZE5A 3U2EA 4PE8A 1UZ4A 1B5TA 4LV9A 1S2WA 3EA1A 4E38A 1ZCOA 1G1YA 1JGIA 1D3GA 1FKWA 1WXJA 4DLMA 1EJXC 3FAWA 4PFHA 2DVTA 3LHVA 3RAOA 4FX8A 3R94A 3O5DA 1JGMA 2C91A 1EOMA 1JI2A 1KV5A 2X0SA 2DJXA 4GJ1A 4ASTA 3VK5A 2OX1A 2W5FA 2FZMA 3H2OA 3VDGA 3TR2A 3K8MA 4M51A 3GNOA 3K4WA 4CU6A 3THUA 2OQLA 1WDPA 4PEEA 3KXQA 3F2DA 1XX1A 1G4SA 1QJWA 3C6CA 1ZJIA 3R25A 5C2GA 4PCTA 3F4WA 3AYTA 4KQNA 3MB9A 3WO8A 3U2ZA 1V02A 3S1GA 1Q4WA 7REQA 1S3HA 3GVRA 1Y7VA 2TPSA 2PV3A 5HMSA 2O0TA 3PG9A 2NLIA 1PBGA 1NARA 2ZRVA 5AHIA 3WMLA 1E6SM 1VF8A 5FSEC 4WCJA 3UA3A 1XPYA 4KIRA 1UMYA 3CPGA 4O15A 2EGZA 2TYSA 4ODQA 3W81A 3MDYB 2QGHA 1S1PA 3QXBA 4REQA 4UB9A 1J10A 3PBMA 4TU1A 1MXSA 5G2IA 1C3FA 3CASA 2Y7GA 4PMNA 3W73A 3SO7A 4LVBA 3ZJ8A 3SUUA 3W1TA 4ZXOA 4PMZA 3UZXA 1KCKA 4LC6A 1MDLA 5M5DA 5T26A 1IZJA 4B91A 3IJDA 4JNMA 4E4UA 4MM1A 1J4HA 1S2TA 2Z1XA 5C5YA 1P6BA 5MF5A 1WKYA 1OG0A 4IL2A 3WBWA 3BE7A 3FW6A 4LUSB 3QQ0A 1WBHA 3V35A 2QCGA 2DZBA 1V3LA 2ON3A 2K8IA 2VGGA 1S5WA 2UY2A 3TR9A 1KRBC 3TEVA 2ZC8A 3GXTA 3V1HA 1UKOA 3PR2A 3P80A 3ITTA 2PWGA 1UKQA 3W02A 4PYSA 5PTDA 2O4QA 3UFYA 1E0XA 5A6BA 3RNDA 3DBPA 4DRJA 2H9AB 1LOQA 3N04A 4GIEA 1NM9A 2VFFA 4H9MA 1ISZA 1XCWA 5JQ9A 4WY0F 3OPSA 2QV4A 1EO5A 4UMAA 4MJ4A 5CPMA 4AMAA 1OYCA 1GQLA 3N17A 1W37A 3GTYX 1FOBA 1G94A 5LXEA 3EA3A 1E6RA 3NUKA 4LNCA 5LIXX 1KBBA 4N9BA 4Z1DA 1A5BA 5AYZA 3SCVA 1ROUA 1FH7A 3UBPC 1OQFA 2ZX9A 3VABA 2A6NA 4DWSD 4F9DA 5HWNA 3PAJA 1P43A 3L2LA 3WUGA 4AIUA 4ZPTR 3TTSA 1O1HA 1F05A 3MI2A 5HPOA 2CBJA 4ZOEA 3RRXA 2ZXAA 4Q8WA 3HJZA 4HTYA 4NP7A 1Z7AA 1Q6UA 4O0KA 1W8GA 1W1VA 1AQFA 3BCJA 3DG6A 1R2RA 3R0DA 2NW0A 1XC4A 1TE6A 4H2CA 4FNSA 4OUEA 4JY8A 2VR5A 3DFYA 3W01A 1HJWA 2IKJA 3CQIA 3L65A 4A22A 2PP3A 1V3KA 2PDGA 1HIZA 3AOFA 3KZ7A 3S5YA 2Y1HA 3UJFA 2GJXB 1Z3NA 4MWAB 5GNXA 5EBAA 5AVHA 3DUGA 5AYIA 4GX9A 4JTJA 1FD9A 1H7WA 2GK1B 1DXFA 4NSBA 4HZ7A 4L72B 1T0OA 1TB3A 3DFHA 4H01A 4PTMA 2PCEA 4S3JA 1UJPA 3IRDA 5KSWA 1VBGA 1QNRA 1KNWA 4H6RA 4KPLA 1WKDA 2QQ6A 1HVQA 2EEXA 5IOBA 3E0VA 2PTYA 3RFWA 2CBUA 3UXDA 1NF7A 1QI4A 3LRMA 4DVOA 4D6GA 2JGQA 4UTIA 2WCAA 3IV3A 3W0KA 1H50A 3F4DA 4GXWA 1Z48A 2P8CA 3UESA 3MI3A 3QR0A 4DHGA 1AL8A 4Q6JA 3CTLA 3T05A 2FZDA 4X9YA 4GC4A 5JIPA 1DJWA 4N9DA 3JUGA 5XIMA 4XAFA 4US5A 1PIFA 2WNQA 1D7HA 4LQ1A 4GNJA 1GONA 3HGRA 3JR2A 3KBJA 1YNQA 2PF0A 3HZ3A 3CL6A 4HYWA 1US2A 3HN3A 3TJLA 2ZRXA 1X97A 3G8EA 1JCXA 3KS6A 5AC8A 5JH2A 3T1GA 2FFIA 3LCHA 1XLBA 1F8AB 4UTTC 2I5QA 4HOXA 3DEQA 2OWWA 4O0ZA 2CERA 3NPWA 1LT7A 2BODX 1PX4A 3GDBA 2AMXA 4HPXA 3F4CA 2RDTA 3SUVA 1RQBA 1NJJA 3O7UA 5CSSA 3TN5A 3LN3A 3RU8X 5JBDA 2IKHA 4P2VA 3OOQA 1V0LA 2XN1A 3BCDA 4XBSA 3NQ8A 3AS0A 1NEYA 2PDLA 3DBNA 3GTIA 1G67A 1KCZA 3N14A 3RCNA 3ABQA 4PTWA 3E74A 4Z2HA 1OX6A 2PDJA 3P0XA 3WLNA 4TO8A 1EXPA 4J3WA 1EBGA 3GR7A 4IPNB 3OZOA 1Q6OA 3WLJA 2WAGA 2V2DA 1P7TB 3AXMA 4XV0A 1P0BA 4UMCA 4R34A 1TTPA 1QO2A 1AW2A 1QNVA 4WKHA 3TW7A 3NNTA 4JIEA 2MANA 4P7QA 1YXYA 3MHFA 1JEZA 2F8QA 1RLDA 1X1OA 3KBWA 4N7QA 5EL1A 1FHDA 3KZSA 1UKPA 2V38A 4ORMA 3EX3A 3QY8A 4WSHA 3MCOA 3GW3A 3A64A 1BWKA 1GJWA 3AHXA 2BY3A 1PKYA 3Q45A 1DEDA 3S5ZA 2JIWA 3CAQA 3ZVHA 2O56A 2W61A 4JEJA 3BJSA 2X09A 1CNVA 4PB5A 2OODA 4N6EA 4ILSA 1B30A 1P1XA 2W92A 3MO4A 3FX4A 3MZ2A 3VMOA 3GG1A 3J7HA 2J25A 1ZS2A 2OWXA 4ADTA 1OT1A 3DAQA 5CKSA 2P8BA 4HBEA 4H8NA 4PULA 4GQ0A 4FAPA 2A2IA 1H7XA 1ICSA 2PP1A 4LBUA 3ZZ1A 4WKFA 2WZMA 3EX1A 4OVXA 4P8WA 5JH8A 1F3XA 3UQAA 2X41A 2PDUA 4AZCA 4R3UA 1DJNA 1LTDA 3ANYA 1BQCA 5I02A 1RD6A 3KACA 4AQLA 2TSYA 3K8KA 1XLCA 3M41A 3CYJA 4DUXA 3VDCA 2V3EA 2Z2AA 3IK2A 1BSLA 2VOTA 3CZLA 2B7NA 1KQYA 3BOLA 3GS6A 3OO2A 1PVNA 4D6IA 1TX0A 3WMBA 4QR6A 2OJPA 3LHUA 3IUDA 1CGXA 2MLYA 3PTKA 3O5MA 5HQEA 2HPMA 4DPQA 4TVCA 4HYRA 4GNVA 1JPDX 4XD5A 4Y9OA 4L56A 1CTNA 3PRAA 3BSHA 1FKRA 5A1AA 4NRRA 3T2OA 4AZ7A 1QOQA 3VXGA 2AKMA 5AHLA 1SR9A 3G3MA 4J9JA 3SM0A 4AIEA 1ISVA 2PGFA 1GGOA 1VC4A 2EG7A 3G1YA 3NQAA 2Y61A 3ARZA 3O5RA 4CNTA 1GG1A 3IGHX 3CWOX 4PTXA 1ZUAX 2AQOA 2GWGA 3W7RA 1CXEA 4ERAA 1ZB5A 2PN0A 1TIMA 5EGRA 1VRXA 4TOQA 1KFJA 4IMGA 4LF1A 4L64A 1V6XA 3I10A 3ATZA 1MZHA 3GFZA 1O6IA 4WEVX 4XIAA 1VP5A 3PJUA 1EJUC 1TTJA 3FVDA 2HZGA 4BKNA 5J6EA 1JZ7A 1RA0A 2YW3A 1J8VA 1E9ZB 4CU8A 1OFAA 4ZE4A 2OSYA 4CN1A 4CUCA 1XJBA 4PEKA 3W00A 4A8NA 1EJTC 1FQ0A 4ZTYA 3ZR4A 1MSSA 3DN5A 1EP2A 2N87A 2EULA 3L2MA 4OWGA 3L67A 3EEGA 1E6NA 3W2MA 5K4XA 2I5GA 2YFNA 3KCJA 3IJ8A 1IR1A 2EAWA 2YBUA 3K4DA 4A29A 2P1FA 2XIIA 3LV5A 2G5WA 4J2MA 3FKKA 5BWFA 1WZMA 3S6DA 1ZJBA 1C8XA 4K6AA 2OXNA 2MF9A 3TCZA 2FB3A 1OB0A 3KCOA 1TJ1A 1VFFA 3NXFA 3DHDA 2L5HA 4JY9A 1U5JA 4LXFA 4K1WA 1F74A 4DBWA 5CQ1A 3QEZA 9XIMA 2XH7A 3PY2A 1VFOA 4DIAA 2CCRA 3RX2A 2ACSA 1KA9F 5DF0A 4EPBC 3WNMA 1ZNNA 5BU9A 2HE8A 3QSTA 4K68A 3H4XA 4W8BA 2Q3OA 3NOYA 3VFCA 3IPWA 2Z6JA 5CPNA 3VZYA 3CGNA 2CEQA 3S6OA 4KETA 3NGFA 2J7GA 4IL0A 1BKHA 4H9ZA 1YDVA 2PDHA 1UIOA 4KGJA 1L8PA 2QF8A 1AJ2A 3N2BA 3W2JA 1JZ4A 3GPKA 2VCBA 1BRLA 3TYZA 1SR0A 1UC5A 4Z42C 3FAPA 1XIBA 3KUMA 1UA3A 2KZHA 5IM51 4XAYA 2XIMA 2R1LA 4UQDA 1QW7A 2GDQA 4GH3A 3UG3A 2F61A 2H8XA 1JCYA 5D9MA 2WNNA 3PA7A 1EPVA 1UOZA 1LUCB 5CPOA 5CH9A 1Q6HA 1V4YA 2FDMA 3I4EA 1AQMA 3LTSA 4F8XA 2C14A 4ACZB 5MKGA 3QV6A 4RUBA 1TZ7A 1N8FA 3SECA 1YEYA 4OE7A 4O50A 2Y6ZA 3L0NA 1GVEA 1GW1A 1B57A 2OZ0A 3P0WA 2CNCA 5KZEA 2OT1A 4K39A 4GI4A 1CXLA 2VRJA 4O2TA 3M07A 2WZHA 1XLAA 4JYEA 2CLMA 4LVFA 1XFBA 3BLOA 1YW1A 4UFHA 5F2LA 2C79A 4TVDA 1F6PA 4LVAA 1HT6A 2EPKX 1VLWA 1EKOA 1YE4A 1V6UA 2WM1A 2IUZA 1JQXA 1LRNA 4MAVA 5A8GA 3ARSA 1PUDA 1UBSA 2ZZ5A 4JFKA 1P48A 3FY1A 3F2CA 5I06A 3T55A 4IPJA 4NAEB 3U9IA 3LZ3A 3A12A 4U33A 5LGXA 4HSHA 3HJEA 3RGCA 5CSYA 3P82A 3M9YA 3ZVHB 4ACYA 3M46A 2OWCA 1BEUA 1J0HA 4LS2A 2PDQA 1X39A 1M65A 4MPKA 1OEPA 3W29A 1DWFM 5TQLA 4QTGA 4EXAA 3OZMA 1VPQA 3N4AA 3PZIA 2XUCA 4G56A 2VCCA 2V68A 1EGZA 2J77A 5JIWA 3VM7A 5ECVA 2ZXQA 3EOLA 2E1WA 4Z1BA 1JVNA 3WMSA 2GGJA 2PRHA 2E4TA 4DF2A 4MJMA 1J0YA 5FF7A 2ZKMX 1JYNA 1JD9A 5JH1A 3ZVIA 4YS1A 2CLFA 3WELA 3DYMA 1QRQA 3ITVA 1ZP3A 4CQBA 1H5YA 2QJHA 3RIKA 3A9BA 2WVVB 5F2MA 5C2XA 4EF9A 4RDZA 4L4OA 3TC7A 4PMOA 1ICQA 4QJ4B 2QEZA 2ISVA 3AQUA 1J12A 2F21A 1MO0A 1OX5A 1J0ZA 4B5XA 5IXEA 3EOSA 2L2SA 2TMDA 1WUEA 1YW5A 2OVLA 4YLWA 1OZMA 1AK5A 4BS0A 4F2TA 4JFLA 1SZEA 1GT8A 3QY7A 4FXSA 4CVUA 3D3FA 1DYSA 1GZJA 4KRTA 1JUKA 2UBPC 3N29A 5DMLA 5A69A 2IW0A 2VYOA 1NIUA 1V02E 3O5JA 1G9HA 1VYRA 2PAJA 4UTUA 4HA4A 4PRRA 4JCLA 5ECUA 4ICMA 4NRSA 5AY7A 1M68A 1E44A 3W70A 2E67A 1LLWA 1YQ2A 3K4AA 1QXLA 1E9YB 3L5AA 1O1ZA 3WH0A 4IX2A 4CNOA 4NZCA 1OFOA 4NJIA 3QN3A 1FWAC 2JIEA 3GM8A 1R3TA 4P7NA 1MFVA 4X0VA 5CC6A 1DORA 1SFSA 3KLLA 3UG8A 4XUYA 4LOCA 1Q6CA 2QCCA 1GQIA 3VKAA 1UWRA 4RW5A 1KXQA 3ZOAA 3LBOA 2V9DA 4GGHA 3GHTA 3PUDA 1UP3A 1UWIA 1A5KC 4BI7A 1QK0A 2R82A 2X2GA 3GU9A 3S5OA 3WQGA 4TMCA 4L6HA 3PTMA 4TMBA 3TYBA 3B0PA 2LLEA 3A3HA 5HPCA 4AH7A 4LH8A 1Q6DA 2ZE0A 1K6WA 4K8EA 1EX1A 3SCOA 3THCA 5B7YA 3PP7A 1PHQA 2HRWA 1Q85A 2RUSA 3UCCA 3KTSA 1W9BM 2PV1A 3KP1A 2BNJA 3SR7A 3W1PA 5LA1A 4LS0A 3AWNA 3VX0A 3G5EA 3RILA 4CLMA 1Y0OA 4JBRA 4PH6A 4ZB5A 4J3SA 1HG3A 1XC6A 4RXFA 1A53A 3SY8A 2NUWA 4JN7A 3LQLA 1FKLA 2WBGA 3ZLFA 2Z2UA 1RJRA 4Q8NA 4JTUA 4IT4A 5AFDA 2EPOA 1S2CA 4RV8A 3WLRA 3QGAC 4I7UA 4PL2A 3P67A 5DN1A 4UNIA 3ARWA 3TU9A 3BO9A 3TFCA 4UOZA 3GIQA 2IXUA 3OB8A 4XZIA 4ZQRA 5I0DA 3TCSA 1GZ1A 4JTKA 2A3LA 5FL0A 4IFKB 1VBRA 1XFCA 4IWWA 3CL8A 4KF1A 1B1YA 4O12A 3B0UX 1DQXA 1TV4A 3LPFA 3RN6A 1UR3M 4MZ1A 1K6AA 1E51A 3C86A 3DI1A 2CXGA 2QJNA 3GZAA 3RX3A 3EWYA 1WZAA 4CNUA 5HWMA 4UNKA 1GPWA 3ZJKA 3G1XA 1QAPA 9XIAA 2J7DA 3VZZA 3RJYA 3W25A 5A2CA 3EKZA 5G1MA 4ZTXA 4AYSA 4BEQA 2PBOA 5HTGA 3UZWA 3W87A 4RNFA 4NY2A 4XD3A 3VTRA 2G3MA 4ZQOA 1BXCA 1OD8A 3B8DA 1IT8A 2TRSA 3I7RA 2ZADA 4XZLX 1TIWA 3GG0A 3DYOA 3FA3A 1X98A 3O6CA 3A4AA 4LEQA 3BGAA 5HATA 1V3HA 1Q7MA 1PTDA 3LXCA 1R3VA 4CD4A 2VGBA 5CZJA 4GQQA 1FKXA 3JYMA 2J78A 3I3BA 4DM2A 4QRNA 2OFJA 1OZQA 1W3TA 2X40A 2Q5AA 4H7ZA 1YATA 1J18A 3R7MA 2O9TA 1XW8A 3L4VA 4LBRA 4DO6A 5FEZA 2VXNA 2XH0A 4Z1YA 4GI6A 3C2RA 4RW3A 4C65A 4V1YA 1W3KA 5AC7A 1J9YA 1XIDA 3EX4A 3G1RA 1QHZA 1KFEA 4DZ3A 1LBMA 1K3UA 3NQFA 4EWND 4EOUA 1I8JA 3G1DA 3TMLA 2J47A 2M2AA 1VFSA 3VYLA 5DT7A 4AAJA 3HPSA 5FJTA 3CJPA 1QW9A 1E3ZA 4JTGA 4WOZA 3W7NA 1GOWA 3TYEA 1PDYA 1W8SA 1NOFA 3PZVA 4YVXA 1J79A 3NZQA 3N9SA 1D6OA 5HNNA 5DT5A 2PPOA 4GNKB 4J28A 3C0SA 4GMEA 3HTWA 2ZZ6A 3NQ2A 4DJFD 4Q8TA 3B05A 4R7OA 4BR1A 1BKSA 2QLYA 2ZRWA 4W9QA 4KEVA 1FFRA 2BV9A 5E5CA 2E6YA 2WZEA 1FCUA 3VUPA 2FGBA 3M7SA 4HPNA 1M1BA 2DUAA 5DMMA 1FWHC 1TJ0A 4WR3A 1Z32X 2J7CA 5DY2A 3IWPA 4PMRA 2J13A 4W9OA 3TYCA 3HB9A 4QDPA 4INFA 1IXQA 2FZBA 4AHOA 5D8ZA 5AHFA 2YJQA 4GIVA 3DHPA 3B03A 1QPNA 4HA0A 5CC5A 1VZWA 4IJRA 3WJWA 5FD0A 2Q02A 1G7UA 3O63A 4LAMA 2E5BA 3AYSA 5A8NA 3W28A 3TK7A 4NVTA 2CXEA 5ABEA 1EB3A 3SUSA 4H6KA 1H2JA 3W07A 1OCJA 1KCLA 4B5SA 3W76A 2UWFA 5L6UA 1TWDA 3KEHA 3N15A 4UQAA 3L7RA 4LUTA 4TX9A 1L6WA 7REQB 4D6FA 1LWIA 2E7FA 4KIEA 5GVJA 3TQVA 3FLUA 2Z1KA 1TPH1 3LNPA 3U48A 1W56A 3PR9A 1W5OA 4HTBA 3AMCA 2B7OA 2NLYA 2ISWA 4TTUA 4LUSA 2PMQA 4GABA 1XD0A 3W1LA 4IPPA 1R46A 4RE2A 1GVQA 5XIAA 3LBMA 3ZWTA 3OVPA 3S2MA 1QPQA 3LCIA 1GK8A 1XIMA 4PUKA 2CLPA 2WNWA 4O4WA 2ZCGA 1A0EA 2WSRA 1WOAA 2H8ZA 5F1VA 4PODA 4XVEA 1QR7A 2JK2A 3TAKA 3WQPA 3LM3A 3B97A 3A4XA 3B4YA 4QCEA 4AZIA 3W88A 1EWDA 3F1QA 3WEOA 3CIWA 3PRDA 4NYYA 4J40A 2VZTA 2VC7A 3MQTA 4W87A 3QOMA 4MUPA 4ADUA 5KINA 5K9XA 5A2BA 3WNPA 4H83A 4OECA 3NRKA 3BANA 1FA2A 4GA8A 3IVUA 3KRSA 1HL2A 1OFRA 1UC4A 1XM3A 5K2ZA 1UH4A 3NO1A 1DXIA 4A3RA 4LANA 1FDJA 4QGCA 3SFKA 1UWTA 4GY7A 1ISWA 1YLVA 1JCJA 4QLKA 4C6EA 3EKLA 3U2OA 1K9EA 1IV8A 2OZ3A 5CC3A 4AHQA 5K9DA 1PEZA 2UV8G 3CM4A 1UUQA 4ERIA 5HWBA 2H9AA 1KBKA 3BW3A 5CLTA 4ODLA 4LTSA 2DG3A 1OIFA 3P2VA 2CFFA 2DZSA 2VNCA 1ZPTA 2XP3A 2HMCA 3W83A 1H51A 1GTEA 1NTHA 4FR6A 3QW4B 3UI5A 3NA8A 4EP8C 4R88A 5HNRA 2GJPA 3H7VA 5AYBA 2XG9A 3NVTA 4B5VA 4HNVA 3MY9A 4BQ4A 1OABA 1MNZA 1SFJA 4LAKA 4O17A 1TMQA 1UASA 2QCDA 5J8LA 1N7KA 1KTNA 2GJXA 1AUSL 2XZ9A 4X22A 4NKCA 2XWDA 3M0VA 3CPRA 3MPGA 2ZVRA 4QEHA 4Q8VA 4IMEA 4S3FA 2FTWA 4K7VA 3UXAA 2DY3A 4ORIA 3TIMA 2Q3RA 3BLFA 2E0PA 3EWZA 1JF6A 1XYLA 3VDBA 1XIFA 4HN8A 2XIBA 2HBXA 4RXGA 1KGWA 3WQ6A 5DRIA 3WLSA 3RLGA 3W37A 4D8LA 5G2WA 4B4FA 4L61A 5KZDA 3KBMA 4DJDC 3MUZ1 4M19A 3LPPA 4M6PA 1FVPA 1E56A 1PIIA 4QCFA 3QZ6A 4WRHA 1OWQA 2VD9A 3I3DA 4YCOA 2BG5A 2JF7A 2GYIA 5DCEA 3AMKA 1V5XA 4DZ2A 1PV8A 1ME8A 3TVAA 4H04A 3WUFA 4TR9A 3GFXA 4LY8A 2FQIA 1L6GA 1JYWA 1H1ZA 3H7RA 3TXZA 3FJNA 4I90A 2J8GA 3V0TA 3SZ8A 3LHTA 2WANA 3VD4A 3B9OA 1MW2A 5CGTA 1FKIA 4EPKA 3CUFA 3UZ5A 3B8WA 1LWJA 2YL8A 4DT4A 4IMFA 3WJYA 3ZXWA 5A6LA 4JNZA 1ITQA 1Z89A 1VYPX 2J8TA 1GUVA 5EMLA 2VUNA 4UFKA 3CQ0A 2NVDA 1O94A 3AIBA 1J5SA 1Q2SA 4PB3A 4JFMA 3L23A 4ECLA 1YPIA 2E9MA 1FHUA 4LB4A 5BRPA 1LLZA 3TUUA 3LA4A 3MCNA 4JN8A 4MWAA 3O5QA 3C0LA 3A5FA 5E1QA 4J5NA 2XGIA 3EWXA 1UP2A 5AKQA 1E6XM 2J9ZA 1E0UA 2VT0A 1VR6A 4I9JA 2YGYA 2HBVA 4GACA 1VFUA 2F6KA 3DFSA 3EPOA 4WDUA 3I7SA 4DJDA 3Q2DA 1YXDA 3T6CA 2PZ0A 2BVDA 4ALDA 1EDTA 2ZZ1A 1XCFA 3N11A 2BOEX 3SGGA 3O5OA 2QAPA 1XLDA 5F2GA 1UYQA 1SJAA 2VL4A 3LTPA 1EDGA 3C2VA 4AWUA 2D2HA 1L1PA 5FCZA 4FS9A 1FTXA 2XFRA 1OBAA 3MSDA 1RQHA 4ZXLA 1PIGA 3C2OA 7TAAA 1RY8A 2YX0A 2V82A 4JZ5A 2FB2A 3QYSA 4WLCA 1MMFA 4KFPA 3S1XA 2DT3A 3LPOA 4HNNA 4N9EA 3S2JA 1XUZA 1ME9A 2Z7KA 3TONA 3AXIA 1HX0A 1DP0A 1W2PA 1TPDA 2R9RA 3TTOA 3IACA 1J4EA 4ERGA 2YIHA 1I6NA 3IIVA 3BGGA 5LZLA 1VD6A 3O5EA 3O5IA 3P84A 2MPHA 4H8VA 4NILA 1UZHA 2E6FA 2V81A 3CT7A 1LORA 2PZNA 3AROA 3KDNA 5EPDA 2WOQA 1LBLA 2VO5A 2XPBA 3VOIA 3VDHA 4AC1X 2Y7FA 3KZPA 3LCWA 2P50A 4AZCB 2AGKA 4KW2A 4JXCA 1QATA 2LGOA 1TV3A 4FZIA 3ZLHA 2GL5A 1OGBA 1JNEA 3R12A 3UWEA 1C8YA 1TE1A 3CHFA 4O1BA 4ZL1A 2JEQA 4AWEA 3NIYA 2OGJA 3NZRA 3EB3A 5F4SA 3JYJA 4PB4A 1U33A 4IMDA 4UXDA 1PAMA 3O07A 3VNJA 3THDA 2WCSA 3OU8A 2YL9A 5C8BB 1TUFA 4KFNA 3MKVA 3PB2A 2V0TA 3EMCA 4LPCA 3V0SA 2VEPA 2VQUA 4ZQNA 1EX5A 2ZRZA 1YXCA 4D9PA 3QPYA 3CEPA 3GZ3A 4TW7A 4UTWC 3R1ZA 4YIWA 2Z29A 4JYFA 3SB0A 4B92A 3N4FA 4UQ9A 1E1CB 4B3ZA 4E8CA 2YXOA 3ARQA 3C3NA 3VIIA 1GKPA 3NOEA 3AUOA 4HK7A 4CCCA 3KBVA 4DH0A 3USZA 1JDDA 4I9AA 4D2JA 1U30A 4DI8A 4FIQA 1FH8A 1XH2A 1IWBA 1ECQA 4W7VA 3PC0A 1ISYA 3EDEA 1UOKA 3UI6A 3NQEA 1JCTA 3GYEA 4EAMA 2IPJA 5FAJA 4UCFA 2J6VA 1D2KA 4HK5A 4DWSC 3PPHA 1K77A 1CPUA 1BG4A 2C7FA 3OGVA 1UR1A 1BYBA 2BMBA 1T8QA 4JKLA 4H9UA 1KFBA 4UFJA 3TZNA 3WDQA 1AW1A 2FGLA 2VX4A 5EMUA 2VEIA 1PWMA 1YDNA 4KFOA 1TRIA 1V0MA 4M6QA 4AMCA 4AZHA 5BMWA 2WSYA 1FKFA 3T4CA 3O5PA 3WLOA 2GQAA 3OBAA 4DAIA 2ZC1A 4QHRA 4JS3A 1EC9A 2YXXA 4DRQA 3NXLA 2G37A 3BMXA 4JKKA 1S2AA 3D0CA 3TE9A 1F8IA 1E9IA 3UYIA 2POZA 3AXKA 2I16A 3PBUA 5G5IA 3AC0A 5J04A 3C2FA 1R85A 5A94A 4E2DA 3MVTA 1S5TA 2ZBTA 2FTYA 3FXYA 4H7VA 4HCLA 3SSZA 4V33A 8XIMA 4NJJA 2ZUMA 2WK2A 2XIJA 2HWGA 3AIUA 2VX5A 4BQ2A 3AIRA 3LS9A 1DHKA 2WKJA 1WB0A 4WK9A 1HW6A 4C6MA 3LGEA 3CL7A 4MLJA 3SRKA 2Q8LA 4JFVA 1LL7A 2PCQA 2Y89A 2PU1A 4NYUA 1LF1A 3TDFA 4CNNA 2QUTA 5EYWA 4S2CA 4J3VA 4YNGA 1CT5A 2V3DA 4JR5A 2YLAA 4MWAD 4PGLA 1H7OA 4C91A 3WF0A 3W2UA 2GPTA 4E4PA 2EPNA 1JPKA 1I60A 1JUBA 3W7QA 1HTIA 3KCEA 2PTDA 5A8MA 4GQBA 2FKPA 3LY0A 1WDDA 3DFPA 3QF0A 2VC5A 7A3HA 5ABFB 1UWUA 2PTXA 2I1OA 1S1RA 1LQ2A 2ZTKA 4I5XA 4FSAA 1RBLA 2D0HA 4A4AA 3IAQA 3WD1A 5BOEA 1TJRA 2BVTA 1IEXA 3EBVA 1SJCA 3GYCA 3PWIA 3U7VA 1B4KA 4MY9A 3C5QA 3GVGA 1MDRA 2Y7DA 3BCFA 4Y9MA 2GGIA 5A8QA 1THFD 1QUMA 3LG3A 4BI6A 2UZ9A 5LIYX 4DLFA 1BRLB 4O11A 1H1YA 3SDOA 1HUVA 4B3LA 2PURA 4ZODA 2Z00A 3GXFA 3QZEA 3WH9A 1CECA 3E6EA 4MF4A 5AVNA 1XINA 2WKLA 4IQEA 4S3KA 2CWNA 1MXGA 1Z41A 1ML1A 1TPUA 4HA1A 4F4RA 3VMNA 2G8ZA 4HHLA 3RMJA 1TV8A 2D9FA 4GK8A 3GXMA 3GNDA 1RV8A 3LV6A 4F3HA 1E43A 1HF6A 2ESCA 3CUIA 4RDYA 4LAXA 3M0JA 1KXTA 1XQLA 3VAVA 4GI8A 4YTSA 3INPA 4L9ZA 3VMPA 2NXHA 4CQ9A 3GU0A 1ROTA 1TTQA 4M7TA 1W9DM 1SZGA 3WLIA 3R43A 4B16A 1WAUA 1W31A 4HU4A 4CKQA 2PDBA 1DWIM 3I7QA 4CQ8A 3W7LA 3TTEA 1ZCNA 3OQ8A 5K9CA 4US6A 1LOSA 4IIGA 3RMEA 1KB3A 3FGCA 2CESA 2QZRA 3WDPP 3CIXA 4NJGA 1EFZA 2IPWA 1J4RA 3APYA 1NY1A 1GQKA 1CIUA 5G4HC 2Z2BA 4YWSA 4Q33A 3FXGA 3M64A 1LL6A 1A80A 2WSKA 1C9DA 1RCXB 1S5MA 3WD2A 1TV5A 4QSHA 3CYVA 1NFPA 2OYMA 3KHDA 5FJPA 1A5LC 4AG0A 1C7TA 2J8FA 1N8IA 3CZKA 3U2CA 1NFBA 1RH9A 2QR6A 2YLLA 3WLHA 3HGSA 1ZZMA 3WD3A 1Q7ZA 3HG2A 3RCYA 2VP8A 4R7WA 1KM5A 4A21A 4JOMA 1TFVA 1TUXA 3TZFA 1O66A 4UR8A 5HT1A 4NJKA 1VHNA 2DJLA 1M5YA 2XVPA 4HQVA 4P8VA 3VIFA 4AF0A 1RR2A 4UTTA 2GVGA 1A4MA 4QEEA 1TVNA 2JKAA 4L6DA 2Y8UA 4IG2A 2INFA 2YBVA 1HKIA 3MP5A 2RSEA 3GAYA 1U5HA 4MB5A 5HINA 1UD6A 4UIOA 2D20A 3AS2A 3AHVA 1Q6GA 2FZNA 2VFDA 3G1VA 1J4IA 3MSRA 2WVVA 1W1YA 3NGJA 1YTKA 4JAWA 4RKAA 2J24A 5I77A 2Y78A 3F7JA 3AXHA 4NNCA 4H2HA 4AZ5A 1E4IA 2O9RA 3C2YA 3TSBA 5I3IA 2G50A 3UR7A 3S1UA 2E9BA 4O52A 1CB2A 1VFMA 2Y0FA 1FWNA 2AL1A 4I5RA 7CGTA 4V15A 2W66A 4ZOAA 2PC4A 2CLLA 2VZSA 4ZPWR 3LGGA 1B3VA 3LX9A 3QTPA 2G4JA 4XO6A 2DZTA 3VOJA 3UR2A 4JHZA 3AHYA 1E5JA 4B5UA 1BYCA 3C8FA 4MNMA 2PODA 4TV5A 1S39A 3UVAA 1OM0A 1K7EA 2E40A 3NAVA 5LNUA 3RXZA 3E49A 1P1MA 4Q3MA 2EG6A 3GC4A 5BYWA 4Q4RA 3A23A 5M2FX 1FUYA 2FMNA 2HK0A 4AD5A 3O6YX 4JFJA 4LAYA 3A3XA 3PZGA 2Z1SA 3ORWA 4AVNA 1P6CA 1I2NA 3CB8A 3KBNA 2ZZ7A 3P8IA 2OQHA 3ITGA 1H62A 1LL4A 2YFOA 1OFEA 4LYKA 2RDWA 4PBFA 1I1WA 4GUGA 1OGSA 4F48A 1W3HA 4LCRA 3K1GA 2CBIA 1KT1A 4PMVA 3WQ4A 4B4HA 3HGJA 1A5UA 2QVNA 2AGTA 4AX7A 1J5TA 2SFPA 1NWTA 2EPMX 1F9CA 1Q66A 1B90A 2V5JA 4C6PA 2DPEA 5FF2A 4D8ZA 3LZ5A 1D7JA 3SI9A 3V4BA 1WZLA 3ZIZA 1J93A 2Z1VA 3SGZA 3LCGA 1EGVA 3ELFA 4OHQA 3H70A 2OEMA 1Q8AA 3FKRA 4UQBA 2W0UA 6REQB 4J4KA 3GXDA 2R1PA 4PC8A 1EHNA 2CITA 4UOJA 3W7JA 4EVZA 3VD3A 4DJFA 1UIPA 3B9NA 1DQWA 1W5QA 5EB8A 3REQA 1POJA 4IMAA 1VCGA 3W4RA 2E8YA 3HMJG 3M5XA 2WSQA 4R9OA 4NX0A 1BF2A 3CK5A 1VFLA 2D3LA 4RNHA 1PDZA 3AWOA 4PSRA 3L4ZA 5TIMA 3BQ5A 3DU0A 4KEZA 3KAFA 3UJEA 3GC2A 3RCMA 3B04A 3UYCA 3C2EA 3W1UA 3L66A 1FKBA 4E2BA 3GVVA 4IFKA 3PWGA 2VRQA 4AX6A 2PU0A 4ML9A 3BC9A 3ZQ9A 3H22A 3ISIX 4C6DA 3F4VA 1RY0A 3AJXA 2VEMA 1RXOB 1SO6A 4LYQA 3RGTA 1EPXA 2V30A 1YE6A 3AMLA 3FA4A 4MFDA 2DG9A 1TA3A 1GVYA 2FPTA 4IXHA 3PK7A 2EBNA 5CBJA 2X1UA 3L0GA 1K8CA 3E2VA 4G9PA 1BF6A 4XZNX 5A6TC 4RZ4A 5H2ZA 4FXRA 3BGJA 3QGVA 3V1PA 4EPDC 2QJIA 4HPGA 1V6VA 3W86A 5H8MA 1BGAA 2DSUA 2OPJA 1AH0A 2E9LA 3MYOA 1V7AA 5GPRA 2HK1A 3O5KA 3FAXA 4JQAA 4S3GA 3KRZA 4ZQPA 1HJSA 1FKHA 1UR0A 4WHBA 4O13A 3GDTA 3GIYA 3RRAA 5EFFA 4DRPA 1JUEA 1XICA 2GQ9A 3T2QA 1HKJA 1OGGA 4NZ5A 1BVZA 2A0NA 3ICJA 1NU5A 1QBAA 1N1AA 1P5QA 4QJ3B 3FIGA 3UY8A 1PKNA 1WDRA 1FKTA 1RCQA 2ICSA 3LXBA 3MTWA 2P76A 3BW2A 4BQ3A 4HSNA 3NG3A 1ZQ5A 2QXWA 4UZUA 5HUAA 2F6UA 3CZGA 3LOTA 3MSYA 5CBBA 1D8WA 4HNCA 1AG1O 2Y8VA 2GOUA 5CAHA 2VX7A 3WYZA 3TDBA 3GHSA 1R2SA 2O9PA 3FHAA 4DRSA 1OX4B 4IFRA 4AVFA 1XL9A 1NQ6A 3M43A 3FEMA 2X30A 4GYJA 4AFYA 4GE8A 4XAGA 7TIMA 4IUGA 3N1AA 1AFSA 4QE4A 4RK8A 2RGMA 3AZSA 1TJPA 2A6LA 4N4QA 1XIIA 4JFTA 3WLPA 2F4EA 3TJIA 3KX6A 5LNWA 2CBVA 4YXGA 1HVXA 3ABSA 4JIPA 3MU7A 3QR1A 4GJJA 1H41A 3S8HA 2D2GA 2OR2A 1SVDA 3QQWA 1W32A 2E25A 2PC8A 3FSTA 1VENA 5HXMA 4LUJA 4KCTA 3W74A 1MUMA 4LV4A 1I45A 3L5MA 4DYEA 4XKYB 2O9OA 3W6YA 1AD1A 2QDHA 3B0VC 2AQWA 5DXYA 2PBGA 3KOYA 5L9FA 3LHYA 2CZ5A 3UJ2A 4WGHA 5AC5A 1XIHA 3EX6A 4AD2A 1NMVA 2C13A 3TQPA 4ODKA 1ZLPA 4C7FA 3W7PA 1ZBCA 3R0KA 4TV6A 1M7PA 5D75A 3IKGA 1R5YA 3WL1A 1FWEC 1HO4A 3FNDA 4LT9A 3KVLA 3AIQA 3NL2A 1QOPA 4XUGA 3W7MA 2VVSA 4PSPA 4QLLA 2X05A 4M3PA 1RPKA 1G01A 1LWHA 2D2JA 4MADA 2WMGA 4XAPA 2Z28A 3NZGA 1OFBA 5FEPA 3D47A 3RK8A 1BGGA 1OF6A 1LQ0A 1OHLA 1BHGA 3UPBA 1UKSA 3NYDA 1BVNP 1EIXA 3FYOA 3CV2A 1FKJA 1FX6A 3H8AA 4GCXA 1TR1A 2VUYA 4CD6A 4FI4A 2HNHA 4AVOA 1S2UA 1AQHA 4PMYA 4XKMA 4LVGA 4GVHA 1GW9A 4HMNA 3WBXA 3GSMA 1JZ2A 4AEOA 1KM3A 3ZFHA 4NJHA 2ZQ0A 3NSMA 3TTQA 3EB4A 4PMQA 1CB7B 5E93A 1GYNA 1Z9AA 3H6OA 3N4EA 4GO8A 4Q4PA 2QCEA 4TVUA 3M44A 1ADDA 1L6SA 1SMDA 3ERPA 4UTLA 1SGJA 3UZZA 3BH4A 2NX9A 3RR1A 3VIHA 1ZBKA 2RUCA 4QIBA 3BTNA 4JQ3A 4AUBA 4U10A 2I9UA 4BJHA 1H49A 2Y88A 5LNRA 1JVWA 1EYEA 3MT1A 4Q8UA 2NSOA 2QCDB 4AEFA 2QV5A 1PZ1A 4MZYA 3QBUA 3KBSA 2FGZA 3VIJA 3FV9A 2KX9A 4D6DA 2ZUWA 3GW0A 4ATDA 4I6KA 4QQUA 3VNKA 3WLLA 4L7ZA 1Z44A 1XPGA 4IIFA 3VX1A 4L9YA 5C9UA 1W1TA 4ZOCA 1FWFC 2CLOA 4CGTA 1T96A 1M7JA 2C18A 1WOBA 3WLKX 4NX5A 4PMUA 4JQ2A 1RSCA 4E2VA 4KCVA 5B8IC 3E2QA 3POCA 2KR7A 3NQMA 2ZXBA 3DGBA 3DHUA 1MFUA 3B7XA 4C6NA 4C1LA 3UPWA 3NO3A 2Y63A 2HS6A 1U1HA 3N2CA 3CLWA 2BY2A 3APGA 4QAWA 2XP5A 3EAUA 3AFBA 4NT0A 3PJWA 1MW1A 2R8WA 1IWAA 3UF9A 1F5ZA 1OCQA 4IPLA 3HFTA 3TOPA 4EX4A 5LIWX 3ARTA 4AY8A 2WV8A 1Q6FA 2ZOXA 2PWHA 2ZQSA 5HOSA 4RCXA 4XD4A 1UZDA 1EP3A 1DTUA 1GORA 5U4NA 3W71A 1E6QM 3UG5A 1OX4A 1J6YA 4MPQA 5H6HA 5CPSA 2ZQUA 4U31A 4LJ3A 4DUVA 3O5LA 5AYYA 2HVOA 3ALGA 3BLIA 3OLIA 3ZT5A 3MMTA 4OTKA 3URQA 4CCZA 1UD8A 4FP1A 4PFMA 3EGJA 3A9IA 3CPUA 1KXVA 3TLQA 2Z26A 3PF3A 4A2SA 4HNLA 2E6AA 1S3TC 4H7CA 3G2GA 3BL3A 5CJ5A 4XISA 2EPHA 4U5IA 4LRTA 4HKPA 4DRNA 2XJ7A 1J96A 3V18A 3OZYA 4DX3A 3RR4A 4QE5A 2PLKA 3QR3A 5MHBA 2FYMA 2R14A 1ZAIA 2J74A 4HZ8A 4I7WA 2A3EA 2WPBA 3N6QA 1KTCA 1QI5A 1ICPA 3E02A 7ENLA 4QNEA 3MUAA 5K3VA 4DBUA 1F6YA 1AH4A 4GUHA 4NXKA 3PANA 1POKA 3EXRA 3NQVA 1UUOA 4ZS6A 2C16A 4K3ZA 2ZR5A 3AZRA 1X1ZA 3IGXA 4Z17A 1YBQA 5D8WA 4MYXA 3ZR6A 1MZRA 3LI0A 3JVAA 3SCRA 5D2XA 3UI4A 4XAZA 4G7EB 2YA1A 1TJ2A 1XI3A 3P5YA 1EUAA 3T78A 1KWKA 1US3A 1B3XA 2B7PA 2PWVA 1TTIA 3HM7A 1MYRA 4E4FA 1QTWA 5F2IA 2YYUA 4B5WA 3BG9A 3U5UA 5CZTA 2J7EA 3WK1A 3U5YA 4ITZA 3B8TA 2ZWYA 3ODKA 2BGSA 1TPEA 5H91A 1QU4A 4Q8OA 3I6TA 4WJ8A 3IUIA 2J79A 4DO4A 2NUYA 1N8WA 5DFAA 3BLPX 1UW9A 2NUXA 1CI1A 3QMTA 2RDXA 5C9ZA 3G3DA 3QKEA 2O7QA 1YMYA 3VD7A 1FWRA 3FA5A 1VPYA 2FFCA 3E2SA 4TNSA 1EJ7L 2YL6A 4XSMA 3B06A 1NDVA 2QIIA 1JZ3A 4FAMA 2EO7A 2BOGX 4PMXA 3DKJA 5LNVA 1HXJA 2W27A 2QCMA 1C8QA 3Q4DA 2QAFA 1FWTA 4URIA 1TV7A 3U0HA 4EXQA 3L12A 2YL5A 3TSMA 1KGXA 1MNSA 1K8XA 3M0IA 1J2BA 1QWGA 3DECA 4RDVA 2XVGA 1A49A 5AHNA 4CD5A 3N9KA 1D7IA 3PZ9A