3FY0A

Crystal structure of pak1 kinase domain with ruthenium complex dw1
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
293
structure length
292
Chain Sequence
SDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase PAK 1
publication title Targeting Large Kinase Active Site with Rigid, Bulky Octahedral Ruthenium Complexes
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 292
sequence length 293
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fy0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fy0A01
3C0GA 2VWWA 3KF7A 4ZJJA 4I5MA 3KQ7A 3OY3A 1TQMA 1YWVA 3ACJA 2PZPA 2Z7LA 4AFJA 2GS2A 2QI8A 4E6QA 3NW5A 3OOGA 3IDPA 3RK7A 3QHRA 2JFLA 3TT0A 4L01A 4GFOA 4NCTA 4UMQA 4XP0A 4BDCA 5I4NA 3D4QA 5ETAA 1O6YA 3B2TA 3VNTA 3ZBXA 5KZ0A 3GFEA 4R3RA 2ZV8A 3FE3A 4RVKA 4GL9A 4O96A 3MVMA 4FV5A 3FI4A 4CD0A 4DEEA 2ITQA 3PUPA 3DS6A 4TZRA 1H26A 1H0WA 2X1NA 3NW6A 4RSSA 3LFDA 3EYGA 3HA6A 4J99A 5F4NA 4CCBA 4EH2A 2CGUA 3DAJA 4RVTA 3ZLWA 5AP4A 4JG7A 2HENA 4DGGA 3NNWA 4X6RA 2JKMA 4PMPA 5IDPA 4KABA 5HIBA 4EH9A 3Q4CA 2P2IA 3RPVA 2VV9A 3UTOA 2PMOX 4JAJA 1H08A 4CEGA 4AAAA 4DE4A 4F08A 4O1PA 2IZRA 1AD5A 4GT4A 5LXMA 4IH8A 3MS9A 4GV1A 2EB2A 4YHFA 5J9ZA 3NCGA 4OUCA 5AUYA 1U54A 3DT1A 3EKKA 3DJ6A 4YHTA 5BYLA 4YJNA 1QL6A 5EW8A 2WQOA 5AIKA 3OOMA 3GOKA 3K5UA 4O27B 2YIYA 2GFSA 4HZRA 5CEQA 4F63A 3LFAA 3SQQA 2HW6A 3GU4A 5EG3A 2OFUA 5HD7A 3R0TA 2WQEA 3FUPA 5J5SA 3KC3A 3OUNB 2QURA 3WZEA 3VO3A 2CKOA 4RIWB 4C38A 3QQUA 3WE4A 1PJKA 4UXQA 5DNRA 3N4UA 4FKIA 3MA6A 4K9YA 3LPBA 4G5JA 4BTMA 4DN5A 4I23A 4YJSA 3V3VA 4AE9A 4EH4A 5L2TA 4MD7E 2VUWA 1PHKA 1UNHA 3AT3A 4GVJA 2HCKA 5CSWA 5ANIA 3ZRKA 4KB8A 1JSUA 3N4TA 2I0VA 5IUIA 3LM0A 5HX8A 3BE9A 4EH3A 3VUMA 4MD9E 3HMPA 3TNQB 5BVNA 4M8TA 4WNMA 3OCBA 4HJOA 3FXZA 3OWJA 4ANMA 3RVGA 2BRMA 2UW4A 4O7RA 2CKEA 2X7GA 4ZS0A 2R3MA 3KFAA 5CSHA 3VS5A 4BYIA 5HBJA 4FL3A 1BX6A 2J0MB 4C62A 3MH2A 2C3JA 2ZV7A 3FJQE 3IW7A 4D1SA 2HAKA 4AE6A 3NZ0A 3OCTA 1PYEA 4K0YA 3LW0A 2BTRA 3MDYA 1WBVA 2WPAA 4M14A 3KGAA 3Q04A 4IANA 4EJNA 2W05A 2A0CX 4ANLA 4FIIA 3H9OA 3ZFXA 3R7UA 2CCHA 2ITUA 4YZCA 5IA5A 4ZAUA 5C4LA 4NSTA 3WZJA 2ZJWA 3IW8A 2C3LA 3MH0A 1ATPE 1WVXA 3VBQA 2F2CB 4EBVA 5JFXA 3ALNA 4M69B 3D2KA 3BHUA 3OC1A 4OTRA 3TUCA 5HG5A 4QYFA 1FGKA 3PFQA 1H28A 4S33A 3ORMA 5K5XA 1I44A 4KRCA 1IASA 2Y4PA 4RC4A 3TTIA 4ZZOA 2X9EA 5K3YA 2C6OA 4I5CA 3BIZA 3ZUVA 5C8MA 3EKNA 4PV0A 1PXLA 3IKAA 4MNEB 3ZH8A 1RE8A 2OGVA 4DFYA 5CAQA 1PMNA 1IA9A 3IO7A 3SG8A 3A7JA 4YSMA 3Q3BA 3SG9A 2VTNA 3FLYA 4A06A 3FY0A 2ZYBA 4RFZA 2R3GA 4O21A 2C6KA 2F49A 4KNBA 3ZFMA 2XBAA 1OB3A 3KVXA 2CJMA 3Q9WA 2PL0A 2YEXA 3ZZWA 4BI2A 3R2BA 3VAPA 3MPMA 1RJBA 3DBFA 1GAGA 3UOJA 4DFZE 2C0OA 4RC3A 5BUIA 3A7HA 4PDSA 5GIPE 4RG0A 4C4IA 4FEQA 4D55A 4TW9A 3PXFA 5FP6A 4FTAA 2DWBA 2VTSA 2A19B 5L2SA 2Q0BA 2CKQA 5CEPA 2UZWE 5J8IA 5IQIA 3BKBA 3C0HA 4C35A 4DEAA 4FC0A 2J90A 4FVQA 3HEGA 4OLIA 4DBXA 5LMKC 4YO6A 5A9UA 3DLZA 1FMKA 2UZUE 2GS7A 3RAIA 5HLWA 4H3BA 4JR7A 3AMYA 4DG0E 4L6QA 3F5GA 2EU9A 3DDPA 2BTSA 4BYJA 4JBOA 3FI3A 1F0QA 1Q3DA 4ZSEA 5JN2A 3KCFA 5HGIA 2PMLX 3FZ1A 2ITNA 3FV8A 3QTRA 5DBXA 5AAFA 4IC8A 3C5IA 2BUJA 2YFXA 5M4UA 5HTBA 2I0YA 3BYSA 5FLFA 2UVXA 3ZUTA 4AA4A 2YM3A 1OITA 4ZJVA 5HU9A 4DA5A 4RJ5A 1L8TA 4ZLOA 2JKQA 2V5QA 3DQWA 3F7WA 3JPVA 3RMFA 3ZC5A 4TRLA 4AW5A 3Q9XA 4E73A 1WBNA 4FTOA 3AMAA 4FGBA 5EK7A 4W8DA 3PZEA 4GFGA 3FLQA 1XWSA 2PZ5A 3V8TA 3U51A 3CQWA 5E1SA 3EL8A 4ZP5A 5IH5A 4TYHA 4ZLYA 5K0XA 1Z5MA 5EKNA 3NUYA 1PXKA 3HV4A 4O7YA 3SRVA 5CU2A 4QP1A 4GYIA 3HAMA 4LI5A 4HPTE 5HOAA 3DKOA 4K8AA 2OZOA 1MRUA 3MJ1A 4G2FA 5DRDA 4H3QA 3EQHA 4UXLA 4A4XA 3FQSA 3WF5A 3H9RA 1PW2A 3ZO4A 1P4FA 5CVGA 3FHRA 3HLLA 4O22A 5CU0A 3O7LB 2W4OA 3WYXA 1U59A 2ZB0A 4WA9A 4EKKA 2VAGA 5L6WL 3IOPA 3PSBA 3R63A 1XH4A 3AD4A 5GIOE 1J91A 2W4JA 2ETMA 3DCVA 5E90A 3MPTA 4DC2A 3LM5A 4O2PA 3GC0A 3NIEA 4I1ZA 2BZKB 2R3FA 3EYHA 5AP7A 3WF9A 3S2PA 5CALA 5CXZA 2IW8A 4U9AA 2JKOA 2ZVAA 3B8QA 4CMTA 3PYYA 3F3ZA 4GYGA 4YNOA 3QD2B 2XJ2A 3TJCA 3PVUA 5CZHA 4DT9A 4PP7A 4DFXE 5L6OA 4D58A 2JFMA 2G2IA 3TACA 4QMXA 1U54B 4HYUA 2B9JA 3C4XA 3F5UA 3G15A 3MWUA 3HGKA 3FXWA 4I6BA 5TR6A 4A9RA 3QBNA 2C0IA 4NT4A 3DGKA 2DS1A 2X0GA 3E8NA 1SM2A 5DT3A 1XH6A 4QPMA 3GU8A 3QF9A 4GKIA 2WMTA 3QWKA 4DFBA 3RNIA 2C1BA 5KUPA 4EL9A 4LQMA 4XBUA 5EFQA 5B7VA 3W2RA 1TKIA 3ZXZA 1A9UA 3OS3A 2CNUA 3PDTA 2J9MA 3IOKA 4M97A 3F5PA 3E8CA 3OF0A 1W8CA 3HP2A 3W2SA 3SC1A 4FG9A 4EEVA 1OKYA 3NUXA 3I0QA 3UPZA 4KA3A 2WNTA 5DOSA 3GI3A 4PMMA 3ROCA 1KE8A 3FHIA 3UMXA 3EQBA 3T3VA 3SXFA 4BCPA 2ITXA 3GOPA 3RP9A 2XRUA 5I9YA 3BYVA 4IB5A 4KBKA 3EFKA 2JLDA 4IM0A 4R3PA 4RWIA 3KN6A 4FKGA 4NKAA 1XHAA 2XIZA 3GU7A 3UO4A 3QCQA 4BWXA 5AV3A 3B2WA 1Q97A 1YHVA 3L8VA 5HCZA 4DGNA 2PMNX 4DGMA 2JBPA 5EHLA 3D5WA 5IEXA 4GK2A 2BROA 4L53A 2X9FA 5LCJA 2WELA 4G6OA 5IA3A 3BGQA 4FIJA 1QPCA 5DH3A 4XV9A 3IK3A 4EWQA 3R1NA 3L8XA 4QMWA 3R7EA 3BPRA 3GCQA 5FBNC 3ROYA 5F95A 5LARA 5HE3A 1KOBA 3GU5A 4GVAA 1FVRA 3R02A 4R8QA 4BC6A 2C68A 3HKOA 2GTNA 3TKUA 4QPSA 2J0LA 1ERKA 4UWCA 1CSNA 3OT3A 4OTFA 4UEUA 1UU9A 1WMKA 2JD5A 4DGOA 4W4YA 3TG1A 4BIBA 5DHJA 5DMZA 4RZWA 4C61A 4CFUA 1RQQA 4QQ5A 5I9XA 4Q5EA 3C4FA 3MVHA 2XIYA 2W1IA 5HG8A 4F09A 3K54A 4O7TA 5CX9A 2W1GA 4IDTA 4CYJA 2OKRA 1IAJA 3DXPA 5EW3A 2XS0A 4ACGA 3UQFA 3QD0A 4CRLA 2NPQA 4QMZA 4XRLA 4IVBA 3M11A 2XMYA 2XA4A 3O0GA 5FEQA 3QALE 4GEOA 2WOUA 2G2HA 5KMNA 1OIUA 2WTDA 4UMUA 5CF5A 3KXNA 2FSLX 3G6GA 4LFIA 3OT8A 4PMTA 4D0WA 2QG5A 3QTUA 4M7IA 2WFYA 4YC8A 5F94A 3VUKA 4E4XA 4FK6A 3R83A 2PE1A 4WG4A 1PYXA 2GNLA 5CF6A 3E5AA 4UWBA 3L9MA 1H1PA 3VUHA 4F7SA 1MQBA 2W06A 4K33A 4KBAA 2QOFA 5TO8A 4QYYA 4CFNA 2KULA 2JKKA 1W82A 3RNYA 3R9NA 3SOAA 4II5A 5EQEA 3PJ3A 4BCKA 3F2NA 1LR4A 3MB6A 3V8SA 4DEBA 2RFSA 3G90X 4Z16A 3JXWA 5H2UA 5EW9A 3ERKA 1R3CA 2E9UA 2XYUA 2Y8OA 3DK3A 3IS5A 4UY9A 4X2JA 2BVAA 2IZTA 1H8FA 1PMEA 3ACKA 2WU6A 3UZPA 3C4WA 3OVVA 5ACKA 4L52A 4B9DA 3RPRA 4G3GA 5DT4A 2IWIA 4W9WA 5EOBA 3SVVA 3ID6C 2UZBA 3OZ6A 3QQFA 4E4MA 5CF8A 5AM6A 1YRPA 2XNNA 3CGOA 4MWIA 1GJOA 3F3VA 4M3QA 3VIDA 3ZBFA 3ZXTA 5LJJA 2X7OA 3DAKA 3TIZA 1UV5A 3EN5A 1GZKA 1L3RE 4FK3A 2YM8A 2JAVA 3DV3A 2RGPA 5ACBC 2VWYA 3GEQA 4MK0A 4ERKA 3P7CA 4AZWA 3ORTA 4XV2A 3LCSA 4U97A 4V04A 5E8XA 2UZEA 1STCE 3R8ZA 5IF1A 4IWPA 3R7IA 3SGCA 4TYHB 4AX8A 3MH3A 2IG7A 1JVPP 2Q0NA 3SRVB 4QP3A 4E7WA 2R0IA 2BR1A 4GG5A 3Q60A 4IXPA 3VBTA 1NY3A 4AUAA 4BCJA 2OICA 3ETAA 3KMWA 3EB0A 3LCDA 3MGYA 3FAAA 3ZTXA 4TKSA 4LV5A 1HCKA 4D2WA 4HYSA 3DFAA 3ORZA 3QXPA 4XYFA 4Z9LA 3I5ZA 4LMNA 4BDAA 3R1YA 1UU3A 1ZY4A 2C6TA 3WZUA 3I4BA 3NX8A 3ET7A 3LCOA 4AS0A 3HVCA 5CNOA 1B38A 4WG5A 4K18A 5HKMA 2XKCA 3W2CA 3AC4A 3MY5A 4ID7A 3VHKA 4FZ7A 5A3XA 4C2VA 4CG8A 4OTQA 4C3PA 4P5QA 3OFMA 3LFCA 4PDPA 2B53A 3S1HA 3T3UA 1Y6AA 2IVUA 2VU3A 3PP0A 3UP7A 4RA5A 3WF7A 3DKCA 4S2ZA 1GZNA 3II5A 3GCVA 3UVPA 4D2SA 4RZVA 2OU7A 3LFQA 1SMHA 2G15A 5KHXA 4X21A 3U4UA 2XK7A 5HO8A 4O0RA 2GS6A 2YIWA 3FLZA 1WBOA 3QZHA 2XEYA 2XK9A 4FTIA 5D41A 4GK4A 4ZSGA 4AGDA 2QOCA 2RG5A 2WGJA 4AW0A 4XV3A 5AM7A 2XEZA 3LXKA 4JX3A 2G2FA 4EOKA 5AEPA 4HZSA 1PXNA 4D2RA 5JZNA 4GG7A 3W8LA 4LRKA 3FMMA 4YURA 5FDPA 2PZIA 3ZM4A 3OEZA 3W16A 5HLPA 4ACMA 4IAYA 4UMPA 4D5KA 1XKKA 2ACXA 3Q5IA 2CLQA 2WOTA 5LVOA 3LFEA 5CT0A 3RCDA 4XG2A 4YC6A 4ZMEA 2EWAA 2EXMA 4GU9A 5J95A 5JT2A 2XVDA 2ZAZA 4TWCA 2VTRA 4FNYA 1B39A 3LMGA 3LFBA 4FV8A 4JQEA 4O1OA 4DEGA 1ZYCA 2BHEA 3PPZA 4I0RA 5CEMA 3NYOA 3IGGA 2JEDA 3FSFA 3PP1A 3MIYA 3A4PA 4OTPA 3LVPA 5CF4A 4NWMA 1OPJA 4QMTA 3NVKI 4K2RA 4QQCA 5ANDA 5E8YA 4AXAA 3NVMB 3QTWA 2FGIA 3ODYX 3ZRLA 4R1YA 4DCEA 3F3WA 4L8MA 4BDGA 3UDBA 2PULA 3MPAA 3HA8A 4F1OA 1Q62A 1YI3A 2GNJA 4JJRA 4Z3VA 4LGHA 2VGOA 4MBJA 3SV0A 4LV8A 3DTCA 4JRNA 3WZKA 4OW8A 5J5TA 1OI9A 3DFCB 4M15A 4FTUA 4FV4A 4ZOGA 5I9UA 5BVDA 5BVOA 2WTKC 3E88A 4F0FA 2ONLC 3KKVA 4DH1A 3TZ8A 5IPJA 3GQIA 2CKPA 4K6ZA 5E7RA 4D4SA 4E5WA 5ICPA 4XUFA 4MF1A 4GRBA 5LCKA 3NCZA 5T3QA 5A4TA 2UZNA 1JOWB 2GPHA 3A2CA 4ITHA 3CGFA 4U45A 3A4OX 3TDVA 2C3KA 4AGUA 4D2PA 2RSVA 4YPSA 2DUVA 2WXVA 3DU8A 3HMMA 4QOXA 4W4XA 5JEBA 2OK1A 2YDIA 3PA3A 4L68A 3NMUF 1BMKA 4E93A 4EQCA 5DVRA 4JLCA 5FWKK 2IZUA 4CZUA 3C13A 3I7BA 4YBKA 4FOCA 3LXPA 3T9IA 3OWLA 3WZDA 2R7BA 4OTWA 4ZTQA 4RLLA 4GIHA 1JKLA 5L2QA 3HMNA 4KBCA 2WMSA 3EMGA 4BIDA 4O0XA 5DFPA 2F7EE 4PF4A 3PVWA 3SW4A 5IMXA 2PY3A 4QYGA 2EXEA 4L42A 2H8HA 3Q4TA 4F1TA 3OWKA 2QOOA 4OBOA 3P9JA 2AUHA 2W9FB 2R3LA 3OTUA 4JQ7A 3EN6A 3VWAA 2Q83A 3KRLA 2BRGA 4R1VA 3D9VA 4G3CA 4XG9A 5HNGA 1CKPA 2JIVA 2QQ7A 3MVLA 1OPKA 4MTAA 4C59A 5L4QA 3THBA 4FTQA 4DFNA 5EHOA 3E8EA 3BEAA 4P7EA 3E87A 3R7OA 4FG8A 4YC3A 4TY1A 4OTGA 5TKDA 3U55A 4BL1A 3RWPA 2G01A 4CZTA 5DYJA 4MHAA 1ZY5A 2C3IB 3KXXA 5LMBA 2VWIA 4CGAA 4U43A 3F69A 2YCSA 3L9LA 3BU5A 1G5SA 4BGHA 4EHZA 1H00A 2ITYA 5IQAA 4AN3A 3COHA 1OBGA 2H96A 2BFYA 2W1ZA 4JR3A 2XNEA 3R1QA 2OSCA 3ZO3A 3DZQA 3RWQA 4EH5A 5AP3A 4CRSA 3VUTA 3TWJA 3UVRA 2XM9A 4KKEA 4BICA 1ZMUA 3PVGA 4L7FA 4JX7A 3KRRA 1M17A 2CCIA 3I0OA 5T6KA 4MCVA 5L8JA 3W32A 4YJQA 1URWA 3BLQA 5FDXA 4O82A 5L6PA 4DH8A 2C30A 1H24A 2OXYA 3DJ5A 5M07A 1MRVA 1VZOA 1IR3A 2WQNA 3Q6WA 2W17A 3KXHA 4QTBA 4WSQA 3I60A 1DI8A 3AD6A 3CQEA 4M0ZA 2C6DA 2RKUA 4L46A 4C3RA 3EOCA 3QRUA 4IX6A 5HI2A 4CFMA 4ARKA 3TEIA 4FEWA 3R9HA 3OW4A 4WNOA 5I9WA 2C6IA 2PVHA 3NUSA 2XKEA 3LLAA 4JIAA 3ZO1A 4IX4A 2CLXA 3BBTB 4KS8A 3PPKA 4I0TA 4X3JA 4ZEGA 4CNHA 3R73A 4G3FA 4WKQA 4AA0A 2F9GA 3NUAA 4F7LA 3MTFA 4G16A 1MRYA 3E7VA 4GH2A 4NEUA 4RRVA 1M2RA 1ZYSA 4V0GA 2G9XA 3T8OA 2Y4IB 2OJ9A 5HIEA 3OMVA 2Y6MA 4CV9A 4RIYA 4I3ZA 5HCXA 4O7SA 1QPDA 2V62A 2QLQA 4FTTA 4I6FA 5CNNA 3VS4A 4R78A 3NLBA 3QRJA 4AG8A 2JIIA 4K77A 1YVJA 1PMUA 3SXRA 2ETKA 3MJ2A 3R8MA 1XH7A 4F4PA 4BI0A 1JKSA 3OXIA 4IX5A 3D7TA 3EN4A 5LMAA 3QD4A 1R0EA 2C5YA 2J5FA 5T68A 5C4KA 2UZOA 3CXWA 2HW7A 4E6DA 4NK9A 2PE0A 3NAXA 5CYIA 5FXSA 1H0VA 4XG6A 4C4EA 4I92A 2OXDA 5BUJA 5BMMA 4HCUA 5I9VA 5J1VA 3BLRA 4RBLA 1WBPA 4NM0A 3UZRA 5H8BA 3W8QA 3KB7A 4ZSJA 2BZHB 5C8KA 5KMLA 1VYZA 5BYZA 3EQDA 4IVDA 1OKWA 1ZMWA 5HTIA 3MVJA 4XV1A 3RM6A 5CVHA 2WMVA 2YABA 5E8SA 3VQUA 3A7GA 3C1XA 3HRBA 4AN2A 3CPCA 4X3FB 1OIQA 4ERWA 3F3TA 3QL8A 4JOAA 4LYNA 5E91A 3PJ2A 2O64A 3EQPA 5JKGA 4LOQA 2EB3A 1Q24A 4EOPA 2XKFA 1IRKA 4ZY4A 3ZSGA 4U0IA 3FY2A 3DXQA 1OIYA 4CTBA 4FUYA 4PPAA 2ZM4A 4FNWA 5IQHA 4EYMA 5K4JA 1UA2A 5E8UA 2FSOX 1Z9XA 2C5XA 1XH8A 2JDRA 5EI8A 4LG4A 1URCA 4R7BA 3CTHA 3CY3A 2PUPA 2ITVA 1YDRE 4CLJA 4EKLA 3MA3A 4PPCA 4BBFA 2WTWA 4MKCA 4RVLA 3U6IA 5J1WA 2E9OA 4P5ZA 2V0DA 4KINA 3F61A 3VVHA 2VGPA 5E92A 3ZEWA 2VWZA 4LRJA 3O2MA 3LQ3A 5GJGA 5H3QA 3ZLYA 2O3PA 5M09A 4G17A 4QTEA 5EH0A 4FTJA 4E4NA 3BGPA 2VTHA 3R71A 1FBNA 3OCSA 3HV3A 2C6MA 3IW6A 2VWXA 3A8WA 4FKRA 2YJSA 3UIUA 1GIJA 1MP8A 3DA6A 4G5PA 4MX9A 5HNIX 3LMHA 4BFMA 3HYHA 2XKDA 2ZOQA 4IZ5A 3PE2A 2XCHA 2C5NA 2VO7A 3RAHA 4AQCA 5FEDA 5LQFA 2CDZA 1OIRA 5CENA 3GC7A 4R7HA 2YWPA 3DKGA 2VO6A 1O6LA 1ZWSA 3ENHA 4PP9A 2ZM3A 3NUUA 4QP9A 3SX9A 3WE8A 4E20A 3FZSA 1KOAA 1ZOEA 3WI6A 5AUVA 4FT5A 4C36A 1FINA 4QNYA 5B2KA 4RJ4A 2P0CA 3CD3A 2WTCA 1H1SA 3E63A 1OECA 5ETFA 4QMLA 1FOTA 2JDOA 5BVWA 3EWHA 4AF3A 1F5QA 5AP5A 1SZMA 2Z60A 3MN3A 4IFGA 4BKJA 4DH5A 5FG8A 3TV4A 4YSJA 3H0ZA 5CASA 5IISA 4IVAA 4NKSA 5FBOA 4X6QC 3EFJA 3OD6X 3OW3A 3LJ2A 2A4LA 4J71A 5J9YA 3MFTA 4G9RA 5KMJA 3CTQA 1TQIA 4HYHA 5ANEA 5B2MA 4XG8A 3O96A 3ZDIA 5EM6A 4GK3A 5C26A 5HBEA 5CXHA 1Z57A 1WVYA 3HRFA 4LOPA 4RIOA 2BCJA 3ZZEA 1APME 4AACA 4CT2A 4O0WA 5IU2A 3AXWA 2ZB1A 4YMJA 4V05A 3VBWA 4IEBA 2X2LA 1PKGA 4FF8A 2CMWA 3BHHA 3WIGA 4ASEA 3ZOSA 4EK4A 4DLJA 2V7AA 3DPKA 5HNBA 4EWHA 4EK8A 2ZV9A 2OF2A 4FTMA 3RZFA 2W9ZB 1O9UA 3HV6A 4OGRA 2VWUA 3O71A 3HZTA 2CGXA 4FR4A 5HVJA 4CSVA 3FMKA 4UYNA 2I0EA 3CP9A 2YDKA 4QYHA 4WRGA 2R3IA 4ANSA 3TM0A 3LFFA 3DTWA 1FVTA 4JDJA 4V01A 5HVYA 2ZMDA 4C3FA 2VTOA 2WO6A 2PUIA 3GT8A 4IAAA 4O0TA 4IVCA 4KIPA 3LXNA 2WEVA 1OVEA 5DRBA 4DEHA 3QKLA 4APCA 3VRZA 3QQLA 3AT4A 2RG6A 2VX3A 1REKA 4RT7A 3TKIA 3EHAA 1SVHA 4J53A 4WHZA 4HYIA 3PIYA 3Q32A 4TL0A 4OR5A 1KV2A 1WBWA 1YXVA 3FQHA 4G6NA 3Q5ZA 4QMSA 4IZYA 3ZUUA 4YUQA 3VS0A 3ORXA 3RPOA 4FSWA 4JI9A 2X4ZA 1UWJA 1KSWA 3PSCA 4I20A 5KMKA 5FRIA 4D4YA 3RI1A 4YBJA 4AT5A 4M0YA 3FL5A 4F9WA 5HORA 4IAKA 1FQ1B 4ANBA 1WFCA 3O17A 2IW9A 4ZY6A 4B8MA 4MXOA 1PXMA 4F9CA 3BHYA 3C4CA 4EK3A 4R3CA 3WILA 2PHKA 4BHZA 2JDVA 4V0GB 3FL4A 3HNGA 4WO5A 3POOA 2ITPA 4YNEA 4AFEA 3D14A 4XRJA 3E93A 4RIYB 5J7HA 2P2HA 2J0JA 2J0IA 3SDJA 4DTBA 3RJCA 1OL1A 3MH1A 4KD1A 4KIOA 5KE0A 2I1MA 1JKTA 2F2UA 2AYPA 4PQNA 4S34A 4FKLA 3SKCA 3ATTA 1GOLA 2QCSA 4XNEA 3AGMA 3R8PA 2OJFE 3QCYA 3RHKA 2PU8A 3D7TB 4MAOA 3EZRA 3TCPA 3NUNA 5KCVA 5EHYA 2QC6A 4FEUA 2FH9A 5DR6A 2CGVA 2YERA 5IG1A 2GNFA 4OBPA 4C2WA 3QRKA 5E9EA 3A7IA 4L3PA 5IDNA 1PKDA 3L1SA 3VS6A 2ITZA 1YXTA 5IH6A 4A9YA 4XCUA 1CDKA 4C4JA 2PTKA 2G1TA 3POZA 4H05A 4XS2A 4YTCA 4H36A 3DLSA 4TNDA 4U40A 5FD2A 1NVRA 3NW7A 3P79A 3R30A 3S95A 3VRYA 3NGAA 4J8MA 3TNIA 5CANA 3PLSA 3UODA 4USEA 2I7QA 4ZZMA 4PMSA 4Q9ZA 2X6EA 2XM8A 3FZTA 4S32A 4YZNA 5AUXA 4FIGA 3ZM9A 2PZYA 3QUPA 4FVPA 3CY2A 4PTEA 5HCYA 3WF8A 4F1MA 3EFLA 3NNVA 5M56A 4BWPA 2VN9A 3MB7A 2ZDUA 3IONA 3FBVA 3BHVA 5HTCA 4ZSLA 1NVQA 4HNFA 4FICA 4GUEA 5LWMA 4FKOA 5JGAA 1HCLA 2HY0A 4ZZNA 3R28A 4KIKA 4EC9A 4Y73A 2XB7A 2B1PA 4J98A 3FI2A 4A7CA 2R7IA 4ANQA 1JSTA 3W10A 4RFYA 2OH4A 4F99A 3BU3A 4NFMA 2ESMA 2OIBA 5EM8A 5I3OA 3R21A 3ORLA 4E6AA 4MD8E 4J97A 1KE6A 3FXXA 1WZYA 2W7XA 4YGAA 2QR7A 2B52A 3REPA 2HZNA 4FV1A 2WAJA 4CKIA 2HOGA 1EH4A 3EH9A 5AMNA 3I6UA 2Z7RA 4RLKA 4FUXA 5LMKA 3QX4A 2P55A 2DYLA 4HW7A 4RJ6A 1BL6A 3F6XA 3DB8A 5E8TA 4N4SA 2YM5A 4FOBA 4S31A 5HESA 4BRXA 4QQTA 4U80A 2CNVA 3QYZA 4NIFA 2B55A 5HO6A 5EDPA 3NDMA 5DT0A 5CY3A 4QT1A 2FSMX 5KX8A 1Q4LA 2ITTA 3VBYA 4ZSAA 3FWQA 5TE0A 2UW6A 3ODZX 4I22A 2C1AA 2H34A 3FMJA 3H3CA 3G0FA 3ZYAA 5M57A 4JBVA 3BU6A 1UVRA 4NZWB 3RAKA 4EQUA 3E62A 3U6JA 4IE9A 3UOLA 4BI1A 2GQRA 4ZMFA 5EYKA 2Z02A 2HZ4A 2WMAA 4WNPA 1AQ1A 4Y72A 4BIEA 3DK6A 4R6VA 4YHJA 2XNPA 4EC8A 1BL7A 5AX9A 1H1RA 4YJOA 1VEBA 1QMZA 1XBAA 5KMMA 4O7NA 1OKVA 2R3PA 3MTLA 4F70A 3BQCA 5AUTA 3UO5A 3PJCA 5ANGA 1OPLA 2GCDA 3FC2A 5E8WA 3DXNA 3DBQA 4XOYA 5IA4A 3BWFA 2XIXA 2YM7A 2BZJA 4HVSA 3CE3A 5K5NA 1GY3A 3RAWA 4O0YA 5C03A 3ZSHA 3VUIA 5DWRA 2LGCA 4EZ7A 3PZHA 5D7AA 2VTPA 2X8DA 3AOXA 3BI6A 4AN9A 4IX3A 3W2PA 2YM4A 4F64A 4IMYA 2C69A 1OM1A 5BYYA 3FLNC 1QCFA 5C1QB 1Q8TA 4FTLA 4D4VA 4O38A 3PWDA 4RQVA 4TN6A 5CU3A 4RA4A 1OKZA 5C8NA 4JL9A 3FC1X 4XMOA 3GU6A 3DJ7A 5M55A 3ORPA 2OO8X 4BDJA 4IW0A 3ORNA 5BVEA 2YISA 3M1SA 4HGSA 3QXOA 2SRCA 2X39A 3ELJA 3ZU7A 1BI7A 3F5XA 4FSQA 2VNWA 3RPSA 5KMIA 5ITAA 2PK9A 4UV0A 5LWNA 3NIZA 4MXYA 4IWDA 5CU4A 1H1WA 1LEWA 3ZONA 4B8LA 1SVEA 3BZ3A 5CEKA 1SYKA 3TI1A 3PY0A 4YTFA 4TYEA 3GC9A 3QLFA 3MSSA 5AAEA 2WTJA 3IQ7A 3PVBA 3RTPA 5CS6A 5BVFA 2IW6A 4RWKA 4J52A 3G5DA 3V01A 3KK8A 3QRTA 3H0YA 4GCJA 3FMHA 3RK9A 5CT7A 2VNYA 4BDHA 4ZK5A 4FI1A 5AA8A 5AP6A 4BCQA 1UU8A 3MI9A 2BAQA 4RX5A 3ULZA 3R7VA 3UZTA 3JR1A 3PWYA 3PPJA 1CM8A 3HDNA 4AOJA 1UNLA 5J9LA 3IW5A 4TYJA 3GB2A 3ORKA 4IAIA 3LIJA 3H10A 4XJ0A 4LUEA 3I1AA 5BMSA 4NL0A 4CCUA 5FTQA 4CKJA 4G6LA 4IAFA 3GCPA 2GU8A 5EYCA 3KL8A 3MBLA 3P23A 4MH7A 3K2LA 1PXPA 3OEFX 3LJ1A 3VS7A 5BUEA 5M4FA 5C27A 4MXCA 3QU0A 3FPQA 2OZAA 4PUZA 4KWPA 2OH0E 4FSTA 3GUBA 3VJNA 3E3BX 5M51A 4F6UA 5M4IA 3EN9A 4CYIA 2RFEA 1B6CB 2OJIA 4FYOA 5L2WA 4H58A 4PX6A 5KBRA 4FV2A 5JZJA 2HK5A 3QA8A 4CMOA 3PJ8A 1S9IA 1R78A 4QP6A 4RC2A 2YAAA 3OY1A 4NM3A 4D9TA 1YXSA 4DLIA 4PNKA 1GZ8A 5DEWA 4C4GA 3GP0A 2XYNA 2W96B 2X4FA 5AUWA 1KUTA 1ND4A 2CN8A 3KN5A 4FIFA 4O6LA 2AC3A 4BCMA 5CWZA 4DG2E 2R3NA 3BE2A 4NW5A 4D9UA 3NS9A 2XNOA 4J96A 4O7WA 4FT3A 2NRYA 3PXZA 3QA0A 4O84A 3MIAA 4FV7A 5FGKA 5B0XA 2WTIA 3DB6A 1OUKA 3G9LX 2BIYA 2OF4A 1NA7A 2WZJA 2WIHA 2YIQA 3BGZA 1NW1A 1JAMA 3U8WA 1RW8A 2Y9QA 2VTTA 4G3EA 3UIMA 4EORA 4DBNA 4UN0C 4CVAA 2CGWA 4W9XA 3UP2A 3UC4A 4O83A 4D2TA 1K3AA 4EYJA 2OFVA 5D9HA 1BKXA 4ZTMA 2VO3A 3DBCA 2R3KA 5IQFA 5AR8A 1W0XC 4BDBA 2Z2WA 3KRJA 4Y85A 2IZSA 4Z7HA 2IVSA 4E1ZA 1WCCA 3LJ0A 5DE2A 2XK4A 3PXYA 3A99A 2HELA 3NAYA 4FKQA 5K4IA 4JXFA 4IADA 1DM2A 2X81A 3FPMA 1PMVA 1YWRA 3QGYA 3DK7A 4JT3A 2OLCA 2A27A 5DR9A 4GIIA 3FSKA 4FKWA 5KBQA 3EQIA 3PIZA 1XJDA 4EHVA 4KIKB 2AC5A 5KNJA 2EVAA 4O6EA 3MYGA 3RK5A 3FQEA 4FSYA 4A9TA 4LL0A 1J1CA 3V51A 4N70A 3NEWA 4UYAA 4N0SA 4QMQA 4DITA 4XHKB 4ORKA 4HNIA 4EZ3A 3QD3A 5FXRA 1REJA 4N6ZA 4YZMA 5L3AA 3NNUA 2RIOA 2E9PA 3KF4A 4HGTA 4PY1A 5BVKA 3UIXA 2E9NA 3KRXA 4BBMA 4NW6A 3GENA 4R5SA 4ENYA 5IQCA 5CSPA 2P33A 3LQ8A 1T46A 4U6RA 4EH6A 5F9EA 3ATSA 4M69A 5FEEA 3H30A 2ITWA 2W1EA 5D12A 2J2IB 3VW8A 3SD0A 3LLTA 4O2ZA 4NIFB 1J1BA 3QX2A 3ZEPA 5GZAA 1H4LA 4YTIA 5JH6A 4TPTA 4CQGA 4OTIA 5EYMA 4RWLA 4CXAA 4DEIA 3UQCA 4FNXA 5AA9A 1I09A 4KRDA 3V5WA 2W1CA 2B9HA 2V7OA 1HOWA 4P4CA 4RWJA 3VW6A 1J7LA 3G51A 2IVTA 5E8ZA 4JAIA 3V6RA 2YZLA 2QU6A 2JC6A 5CU6A 4ACHA 4F6SA 4YR8A 4BWKA 1SVGA 5IA1A 4IWQA 2O2UA 3C50A 3VQHA 3I81A 4FIEA 2NO3A 4QP7A 2XBJA 3LZBA 2IJMA 4WUAA 5IQGA 3EQFA 1M14A 1U5RA 2F57A 2OG8A 1E9HA 3OBGA 4FBXA 4LGGA 4FTCA 4Y46A 3E8DA 1Q8ZA 2BMCA 5BPYA 2W0JA 3QC4A 3V5TA 5HX6A 3QZFA 4HGEA 5HU3A 4D4RA 4QTDA 4F6WA 2BHHA 2Y0AA 3BWJA 3ZHPC 3JVSA 2GNGA 4TWPA 2YN8A 2PZRA 3COMA 3HUCA 4U79A 5H9BA 5M4CA 2A2AA 2GNHA 1Y8GA 3QWJA 3UG2A 3W1FA 4HVHA 5IEYA 5IMEA 3V5QA 4PDOA 4LMUA 2PYWA 2PVLA 4UZDA 5AWMA 2WHBA 4JDIA 2O0UA 1S9JA 2JIUA 3BBWA 1SNUA 4CG9A 3C51A 2XK8A 3VHEA 4E5AX 1YXUA 1U4DA 4I4FA 3BELA 2QODA 5DA3A 3OP5A 4J95A 4Q9SA 4EH7A 4MWHA 1JLUE 3R9OA 3P7AA 3N4VA 3O50A 4FMQA 4MQ2A 4QO9A 4EUUA 5JFWA 2JDSA 3PY1A 4YJRA 3A7FA 4GKHA 3VF9A 4UMRA 4R7IA 1CKJA 3NRMA 5BX0A 3W55A 1V1KA 2PVMA 5CQWA 2W5BA 4IHPA 3QTIA 5DLSA 3MV5A 4H39A 5CAUA 1YOMA 4F9YA 5IZFA 4I5HA 4GMYA 4DTAA 4EJ7A 5HG7A 3UC3A 4LUDA 5HLNA 3COKA 3LMIA 3K5VA 3FLWA 4XOZA 5IQDA 1IA8A 3MW1A 3A8XA 3BYMA 5HHWA 3TZMA 5IA0A 3S00A 1JQHA 3HV7A 1VR2A 5TF9A 3AQVA 4BGQA 4MQ1A 4QMMA 1X8BA 5FM2A 4EOSA 1PXJA 3TL8A 3PY3A 4JRVA 2VO0A 3LXLA 2REIA 2WQMA 4MVFA 5B2LA 5LVLA 4AZEA 4QPAA 1P5EA 2QO7A 4C34A 4FL1A 1M7NA 3BCEA 4E5BA 3PXQA 4X0MA 4JVGA 4XG4A 2HYYA 3TKHA 3DOGA 5FUTA 5HQ0A 1V0PA 3FMLA 5G1XA 4NYEA 3ZMMA 2J50A 3FMDA 1LUFA 3FKOA 4C8BA 4NTTA 3QQHA 4FZ6A 4FA2A 1WBTA 3NR9A 3W33A 3QFVA 3DKFA 4FGRA 3D15A 4QMNA 1G8SA 5CSVA 4QMUA 4OT6A 4U8ZA 2GTMA 2J5EA 5DIAA 4AZSA 4C0TA 5EKOA 2QOQA 3F88A 4GJ2A 4BZDA 4K1BA 4YO4A 4CTCA 4HVDA 3R1SA 1KE7A 1W98A 2X6DA 3BEGA 4I94A 1CKIA 2OZAB 3SA0A 4L67A 4IJPA 3H4JA 4G34A 3AT2A 3F9NA 3U87A 4B6LA 2YLEA 4FZAB 5HD4A 3O7LD 2YZAA 4EOOA 5M06A 5AR7A 2VWBA 3G9NA 3TTJA 4AU8A 4PDYA 2QHNA 4KSPA 4F65A 5ANJA 3L9PA 4YLKA 3UIBA 2R9SA 1JBPE 4WBBB 2W99B 5KO1A 1DS5A 5CZIA 2VTLA 2VX1A 4EOLA 4BVUA 2GHLA 2I6LA 4LRMA 2BKZA 2NP8A 4Z55A 4FEXA 4ZY5A 3Q52A 4XBRA 2YCFA 4FX3A 4FSRA 2GNIA 4H1JA 3OBJA 5CAPA 2QKWB 2UW9A 2ONLA 2PVYA 3R6XA 3JUHA 4EOQA 3KMMA 2PVFA 3Q9YA 1MQ4A 3CD8A 4JNWA 5EDRA 2R3OA 2XK6A 3P08A 4MBLA 4XEYA 3AC2A 3QCSA 4GU6A 5FXQA 2IVVA 3ANRA 3PTGA 5D10A 4DH7A 4M13A 4J1RA 1JPAA 2XF0A 4FTRA 4R5YA 5I5ZA 3R01A 5A46A 1XR1A 2HY81 4P2KA 3V5JA 3HDMA 4F9BA 3PA5A 2XIRA 3QQKA 4L43A 2J7TA 4FKTA 4FKVA 4JQ8A 4AA5A 3RINA 3RGFA 4MXXA 4ZTHA 4TNBA 1J7UA 2P3GX 3FMNA 1CMKE 4YTHA 5E1EA 4C57A 5FTGA 3EN7A 1M2QA 3E7OA 4QD6A 4XLIA 4DT8A 3KY2A 3EZVA 1GZOA 4JS8A 3VN9A 4FT0A 4MYGA 3LAUA 4IACA 3SLSA 4FSZA 4HPUE 5EDQA 2R3HA 3HMIA 3UVQA 3W18A 2HXQA 3O51A 5JGDA 2YCRA 2GDOA 4I21A 3PRFA 5AR4A 5GHVA 3KVWA 3UNJA 2A1AB 4U42A 4UBAA 1ZMVA 4BCGA 4L00A 3FMEA 3CS9A 1Y57A 5DR2A 5K0KA 1P14A 4RJ8A 5ETIA 4K11A 3QZIA 1H01A 3OG7A 3RCJA 3ZSIA 5M53A 1A48A 1XO2B 4AGWA 5GZ9A 4BCFA 5I9ZA 2BAKA 4A9UA 2Y7JA 4E3CA 3EQCA 4QTCA 5ANKA 4AT4A 2ZMCA 4ONAA 3PLAE 3O8PA 1KWPA 3D7ZA 3D0EA 2XNGA 5JFSA 3TUBA 1K2PA 4RX9A 3ZS5A 1YKRA 3QLGA 3VF8A 4F0GA 4NH1A 3BX5A 3I79A 4XH6A 5L8KA 3TNPC 1YHWA 4E26A 5HICA 4Y83A 1H07A 3HP5A 3G0EA 3UMWA 3A62A 4OT5A 3D83A 3OCGA 3TNHA 2OBJA 4G1WA 1Q99A 1U46A 1J3HA 2B0QA 5CEOA 4WBOA 4ASDA 1JWHA 4MXAA 4X2GA 3HUBA 2PSQA 5AR5A 2QD9A 3UG1A 4EOMA 4EQMA 2ZV2A 3OHTA 2HXLA 5AJQA 3MFUA 4S30A 3HL7A 3RM7A 4EH8A 4L45A 1TVOA 3V6SA 1YDSE 3CSVA 3F3UA 4IDVA 2RFDA 4MXZA 3VBXA 2C0TA 4WRSA 2HWOA 2W1FA 3E64A 2I0HA 4J7BA 4GW8A 4RIXA 4DGLC 3HECA 4J8NA 1IG1A 5CSXA 3HMOA 4TWOA 5AV1A 4O7VA 4DEDA 4GJ3A 4UB7A 2R0UA 4XG7A 4RX7A 4BCIA 3S4QA 1ZYJA 5DN3A 5KKRC 2B7AA 4QRCA 1P4OA 2WMXA 3RPYA 1E1VA 4YJPA 4CQEA 4O7LA 3HX4A 2QOKA 2WMQA 2YITA 3IDCA 3ULIA 3V5PA 4I4EA 2BILB 4FKSA 4M66A 2FYSA 5AFVA 3QTXA 4L7SA 3WF6A 5IUGA 2E2BA 1R0PA 4HCTA 3Q9ZA 3P86A 1V0BA 2BDJA 2UZDA 3QQGA 3MFSA 2O65A 1ZYDA 4E8AA 4DG3E 5AR3A 3VULA 3FZRA 4KIQA 3R8LA 1V0OA 4YPDA 3KREA 1VYWA 5IEVA 5AP1A 5GINE 4W4VA 5JRQA 3ZC6A 5J87A 4UX9A 1PRYA 5A4LA 2UV2A 3BV2A 2CNQA 3VJOA 2FA2A 2WMWA 3M2WA 3U6HA 4E6CA 1ZRZA 4EI4A 3PE1A 4G31A 2C6LA 5C01A 5CI7A 2H6DA 3CTJA 1TQPA 2H9VA 3PJ1A 2XNBA 3VC4A 2OI4X 2OW3A 4A4OA 1Y8YA 3ZFYA 2QR8A 3R9DA 4BF2A 4DTKA 3AGLA 2VZ6A 3NYXA 5H8EA 4OTHA 5FTOA 3RZBA 2WQBA 5KMOA 2VTIA 4NM7A 2GQGA 3KK9A 1FGIA 1Q41A 3UYTA 4AP7A 4BB4A 3SOCA 4ZTSA 3UO6A 4WSYA 3RHXA 2WU7A 2X2MA 3EQRA 4EK6A 2R5TA 5CQUA 2QO9A 4KKGA 3VUDA 5L8LA 1XQZA 1YI4A 3KULA 4IZAA 2F7ZE 4FVRA 4JG6A 5HEZA 1UU7A 2EXCX 2YAKA 4PL4A 1JNKA 5J7BA 2XZSA 5HE2A 3TZ9A 3ZLXA 1NT2A 2XRWA 4IJ9A 4U3ZA 4BDEA 4B4LA 4FKJA 2UW5A 5FP5A 3TIYA 2W1HA 5AV4A 4YP8A 2UUEA 3CR0A 4HVIA 2WD1A 3FI8A 5JGBA 4NU1A 2Z8CA 2JAMA 2OJGA 1F3MC 3DAEA 2X2KA 4RGJA 1U5QA 5D1JA 2FUMA 4ACCA 2QKRA 3NPCA 3GCUA 5DG5A 4ASXA 3HAVA 3R7GA 4LGDA 4GT3A 3SW7A 4UZHA 3A60A 2QOBA 4QMPA 3RALA 3ITZA 2R3QA 1AGWA 4RMZA 5AX3A 1Y6BA 2E9VA 3CJGA 4NJDA 1LEZA 3PRIA 2QOIA 5A4EA 1OL5A 5A4QA 4AOTA 1YWNA 2JDTA 3KRWA 3GGFA 3Q2MA 4RQKA 2XH5A 3UBDA 5M44A 4ASZA 3TDWA 3TJDA 1NVSA 2OXXA 5A14A 4IQ6A 2P4IA 4MF0A 4X7QA 5EYDA 3E92A 3CPBA 4ANOA 4B7TA 2B9IA 2YM6A 5AR2A 4C4FA 2XP2A 3D94A 5I3RA 2OJJA 3UNKA 1LPUA 3GC8A 4L3LA 4AW2A 4YLJA 1PF8A 1Q8UA 1MUOA 5TOZA 3WYYA 1BUHA 1T45A 5IKWA 3QKMA 4O0VA 5IUHA 1ZZ2A 4NTSA 2R4BA 4Q2AA 2GSFA 4BY9E 4USDA 2FVDA 2RF9A 4TTHB 4D1XA 2WTKB 1KV1A 3TUDA 1PXIA 1O6KA 1OL7A 3KXMA 2UZLA 1QPEA 1PXOA 4QP4A 5HE0A 4BKZA 4RJ7A 5AUZA 3P0MA 3T9TA 2FO0A 3CLYA 3QTQA 3VBVA 3IGOA 5GJDA 3DDQA 5CLPA 3UJGA 3DNDA 4TYIA 4X2NA 4FNZA 1R39A 2HZ0A 4HCVA 3D2IA 4U44A 5HVKA 4JIKA 4FSMA 4MBIA 3F2AA 2UW7A 3BLHA 2Y4IC 2DQ7X 4ALWA 4QQJA 4BTJA 4H1MA 4BCOA 2I40A 4QMOA 2QLUA 3BHTA 3NWWA 4F0IA 1ZARA 4OAVB 3QUDA 4QMYA 3FLSA 5TT7A 1OGUA 3GQLA 3PXRA 2QVSE 4F9AA 3P78A 1Q61A 5EQYA 5C9CA 3FEGA 3CJFA 4DFUA 4MNFA 4BZOA 4ZTLA 4DFLA 3FZOA 3VS3A 2FB8A 3ZLSA 4AGCA 2ERZE 3COIA 3Q96A 4PTCA 4DYMA 4EUTA 5K9IA 4R77A 4FE2A 1OMWA 2B54A 4WIHA 3U9CA 4GS6A 3AC5A 5A54A 5AV0A 3BV3A 5I0BA 1DAWA 1H1QA 1VJYA 4CV8A 4RPVA 5LOHA 2J51A 4XLVA 4F7NA 4AZVA 4RJ3A 4Y5HA 4C33A 3QCXA 3L8SA 3LOKA 2VD5A 5DEYA 2QG7A 4YU2A 3C4ZA 4OBQA 4X3FC 4A07A 3RKBA 3PSDA 4A9SA 3RBWA 3PG3A 2VTMA 3SXSA 5AP2A 4XX9A 3N9XA 5GJFA 4F7JA 5E8VA 3CIKA 2VRXA 3BRBA 5EM7A 3NNXA 3IDBA 2PPQA 4Y8DA 2R3RA 3EIDA 3LKMA 4RX8A 1LP4A 3CKWA 4CFWA 3OTVA 4L3JA 4IBMA 1CTPE 2PMIA 1FMOE 2PVRA 3QUEA 4TXCA 2BDWA 2CPKE 2CHLA 4PRJA 4O91A 3QQJA 4YLLA 3AD5A 3TNWA 1ZAOA 3R00A 4M12A 3TV7A 3K3IA 4BZNA 4YJTA 5JFVA 3QAME 4H3PA 4QMVA 1ZLTA 2ITOA 3BYOA 3D5UA 3WARA 4ANNA 4CMUA 1G3NA 3OXZA 4I24A 4RIXB 2YA9A 4ZIMA 3Q53A 3DZOA 3TN8A 3JY0A 4ALVA 4PPBA 5LVNA 4O81A 1E1XA 4HGLA 4IB1A 5CVFA 3FKLA 5JQ5A 2YWVA 5BNJA 2GQSA 1YDTE 3U54A 4IFCA 4QP2A 2WIPA 4E4LA 2BKKA 3G2FA 4U5JA 5LVPA 1SNXA 3I7CA 3NUPA 3FYJX 2UW0A 2BIKB 4ALUA 2B4SB 3R7YA 5CAOA 4EOIA 4IB0A 1ZOGA 5GNKA 5HIDA 2GFCA 1DAYA 3FYKX 2QONA 2VTAA 4B0GA 2R64A 4FZFB 3NYNA 3DBEA 2VX0A 2W5AA 2YLFA 3DBDA 4N57A 4IM2A 3QHWA 3E3PA 1GIIA 1Q3WA 2XJ1A 2BFXA 4ZTNA 1PY5A 2UZTA 3F7ZA 4QYEA 1XBCA 1IEPA 2IPXA 3C4EA 4I6HA 2RL5A 3HV5A 1JKKA 4FTNA 4FV0A 4AWIA 3QZGA 3H9FA 1KE5A 5D11A 3G6HA 3A61A 3PA4A 3AG9A 4CT1A 2BDFA 3I6WA 2R3JA 4L9IA 3ORIA 3BYUA 2PUNA 5FQDC 3OROA 4ITIA 4D2VA 5EI2A 3DNEA 1YOJA 3IG7A 3SAYA 4U41A 4FEVA 2J4ZA 3PIXA 4WUNA 4X2FA 2XCKA 5HBHA 2UVYA 2W1DA 2Z7QA 2X7FA 2Y6OA 1XH9A 4UALA 3ENMA 3CBLA 4X2KA 3PG1A 3QKKA 5AV2A 4DH3A 3KULB 5JQ8A 2UVZA 5A4CA 2V55A 3VUGA 4LL5A 5HO7A 1UNGA 4FT9A 3IECA 3VS1A 3FKNA 1Y91A 3UNZA 4FV6A 2QNJA 3ANQA 3MY1A 4KSQA 4JBQA 5IH4A 1W84A 2HWPA 4AOIA 4QTAA 3LE6A 4FYNA 5AIRA 1FPUA 3G33A 2ZM1A 4FKPA 4C7TA 1G8AA 3CKXA 4EOJA 4BGGA 2WEIA 3F2RA 4FT7A 4IM3A 5E4HA 4DHFA 4D5HA 4ACDA 3QYWA 1UKHA 4BDDA 2IO6A 4CLIA 4WOVA 3R04A 3LQ5A 4U81A 4USFA 3GBZA 5BQ0A 3ZRMA 4DAWA 4ITJA 2HZIA 3IW4A 2XJ0A 5HG9A 1J7IA 1BI8A 4DINA 3Q4ZA 2C47A 3LFNA 4FKUA 5CI6A 4BTKA 1QPJA 3JYAA 4BR3A 3LCTA 2PVKA 3HRCA 5ETCA 5G6VA 1FVVA 1YHSA 4LOOA 4NM5A 3WBLA 4C02A 2C6EA 3CCNA 3ZCLA 3Q2JA 4FG7A 1WVWA 1BYGA 4IC7A 1UWHA 4CFVA 3IPHA 1Q8WA 3Q6UA 3QTZA 2ERKA 5EOLA 2NNWB 1R1WA 2PVNA 3TZ7A 3S3IA 4FODA 5J79A 1M2PA 4C37A 5A6OA 3P4KA 4PWNA 1UKIA 2WMBA 3W2QA 4I6QA 3MY0A 4JDHA 4NCTC 3U4WA 2VWVA 3UPXA 4ZXTA 4IIRA 4XP3A 3I5NA 2LAVA 4RIWA 3OXTA 5EI6A 2C4GA 4O0UA 2J0KA 4BTFA 4U7ZA 4QP8A 5DI1A 4BCHA 4L44A 3OWPA 5AP0A 1XBBA 3WIKA 5AADA 3P5KA 4CZYB 4QNAA 1H25A 2R2PA 3KCKA 1YQJA 3C9WA 4C58A 4D0XA 4UWYA 3OUKA 1ZXEA 2C5OA 4HVGA 3LHJA 3UOKA 1K9AA 4D28A 2C5VA 2J6MA 5L2IA 4FTKA 3R8VA 4KKHA 2X8EA 5EM5A 5CTPA 2XUUA 1ZZLA 4BKYA 3LCKA 4X3FA 5GZ8A 2NRUA 4GUBA 4FV9A 2YIXA 2O63A 4W8EA 4AW1A 3O8UA 3UGCA 3V8WA 4JDKA 3MESA 4YZ9A 4YZBA 5M08A 4JG8A 3KU2A 3KEXA 5F1ZA 4TYGA 5JK3A 4YJVA 4BHNA 2WMRA 4I41A 4AT3A 3AC1A 2V22A 3MFRA 1BLXA 1Q5KA 3K3JA 2F4JA 4M67A 4U3YA 5HE1A 4B99A 4BCNA 2W4KA 4JBPA 4OTDA 1OUYA 4FV3A 3EL7A 4APPA 3KA0A 3UE4A 1NXKA 3DQXA 4C4HA 2UZVA 5H8GA 2W5HA 5ANOA 4MEDA 2XK3A 1W7HA 4N6YA 4BDKA 4I0SA 3QGWA 4FZDB 3TXOA 4BDIA 1YI6A 5KHWA 2CN5A 4IB3A 2UW8A 3WOWA 5AAGA 2JGZA 3V5LA 5JMSA 4KS7A 1YOLA 3P1AA 2JBOA 3CC6A 4RVMA 1GNGA 4KUJA 2OIDA 5KKRB 4OAUC 3SHEA 3JY9A 2YIRA 2CSNA 3GCSA 2ETRA 3UOHA 2YHVA 3Q4UA 4O0SA 1OL2A 3B8RA 4PL5A 4HOKA 3F82A 3ZDUA 4PL3A 2BPMA 4NFNA 2PE2A 4KAOA 4PTGA 3TV6A 4EHEA 3PXKA 4Q5HA 2GMXA 2YJRA 1WBSA 4IZ7A 4MNEA 4ZTRA 2O5KA 5D7VA 2XNMA 3BQRA 2WMUA 3JVRA 4BN1A 3LFSA 3GNIB 2QO2A 3AC3A 3C0IA 3KXZA 2GHMA 1DI9A 4G3DA 4GT5A 4TWNA 4NJ3A 1P2AA 4AZFA 4EHGA 3EQGA 1JSVA 3KXGA 2YDJA 4PNIA 2WKMA 1YXXA 2XIKA 3UYSA 2BZIB 5CAVA 3FDNA 2QOLA 3C7QA 2PUUA 4ENXA 3AC8A 3ALOA 1M52A 3GXLA 1H27A 4YJUA 4FSUA 4BBEA 4I93A 2BALA 5HZNA 3R2YA 2WB8A 1OZ1A 1W83A 2BRNA 2F7XE 4IWOA 3UQGA 5IQEA 1YW2A 2BRBA 5JSMA 2WTVA 3R9RA 4W4WA 2YACA 3N51A 3EFWA 4CKRA 2BRHA 2PVJA 3FZPA 4FIHA 4Y5QA 1A06A 3M42A 5FM3A 3CQUA 2GHGA 2B9FA 2KTYA 2QOHA 2FSTX 2UW3A 2VTQA 4UMTA 4WT6A 4CFXA 4IAZA 4EBWA 4Z7GA 2OIQA 1Q8YA 2OWBA 1OBDA 4Y95A 4ZJIA 2ZDTA 2EUFB 3GFWA 3R22A 4XP2A 2YCQA 3F66A 4EZ5A 3W2OA 5EQPA 2HIWA 3EJ1A 4GSBA 3ZO2A 3NYVA 5LVMA 4EONA 4M84A 4WNKA 4ZLZA 3R8UA 4AZTA 4TT7A 3C5UA 4XG3A 5DPVA 2BAJA 2IN6A 3CEKA 3O23A 3D5VA 3KMUA 3QTSA 3AMBA 4D1ZA 1IAHA 5IQBA 2QU5A 2JITA 4WG3A 2PWLA 4WD5A 3GVUA 1WAKA 5KZIA 3DY7A 4I5PA 4CFFA 5JRSA 1XH5A 2Z7SA 1M7QA 3V04A 4LM5A 3O8TA 3QC9A 1ZYLA 3U9NA 4A4LA 3L9NA 5AUUA 3S0OA 4RFMA 3QRIA 4NUSA 5IA2A 4DF3A 1KE9A 4YZDA 3P7BA 2QHMA 4GFMA 5F20A 1RDQE 4O7ZA 3VS2A 2RFNA 3L8PA 2VTJA 2X8IA 4ZS4A 4FL2A 5A6NA 5CEIA 4DCAA 3JS2A 4M68A 5DGZA 4G9CA 1GIHA 2O8YA 1ZOHA 3D5XA 3NSZA 4P90A 1OL6A 4FSNA 4O86A 4EK5A 4BDFA
chains in the Genus database with same CATH superfamily
3C0GA 2VWWA 3KF7A 4ZJJA 4I5MA 3KQ7A 3OY3A 1TQMA 1YWVA 3ACJA 2PZPA 2Z7LA 4AFJA 2GS2A 2QI8A 4E6QA 3NW5A 3OOGA 3IDPA 3RK7A 3QHRA 2JFLA 3TT0A 1XMMA 4L01A 4GFOA 4NCTA 4UMQA 4XP0A 4BDCA 5I4NA 3D4QA 5ETAA 1O6YA 3B2TA 3VNTA 3ZBXA 5KZ0A 3GFEA 4R3RA 2ZV8A 3FE3A 4RVKA 4GL9A 4O96A 3MVMA 4FV5A 3FI4A 4CD0A 4AXDA 4DEEA 2ITQA 3PUPA 3DS6A 4TZRA 1H26A 1H0WA 2X1NA 3NW6A 4RSSA 3LFDA 3EYGA 3HA6A 4J99A 5F4NA 4CCBA 4EH2A 2CGUA 3DAJA 2AQXA 4RVTA 3ZLWA 5AP4A 4JG7A 2HENA 4DGGA 3NNWA 4X6RA 2JKMA 4PMPA 5IDPA 4KABA 5HIBA 4EH9A 3Q4CA 2P2IA 3RPVA 2VV9A 3UTOA 3ML1A 2PMOX 4JAJA 1H08A 4CEGA 4AAAA 4DE4A 4F08A 4O1PA 2IZRA 1AD5A 4GT4A 5LXMA 4IH8A 3MS9A 4GV1A 2EB2A 4YHFA 5J9ZA 3NCGA 4OUCA 5AUYA 1U54A 3DT1A 3EKKA 3DJ6A 4YHTA 5BYLA 4YJNA 1QL6A 5EW8A 2WQOA 5AIKA 3OOMA 3GOKA 3K5UA 4O27B 2YIYA 2GFSA 4HZRA 5CEQA 4F63A 3LFAA 3SQQA 2HW6A 3GU4A 5EG3A 2OFUA 5HD7A 3R0TA 2WQEA 3FUPA 5J5SA 3KC3A 3OUNB 2QURA 3WZEA 3VO3A 2CKOA 4RIWB 4C38A 3QQUA 3WE4A 1PJKA 4UXQA 5DNRA 2IEWA 4FKIA 3MA6A 3N4UA 4K9YA 3LPBA 4G5JA 4BTMA 4DN5A 3W0NA 4I23A 4YJSA 3V3VA 4AE9A 4EH4A 5L2TA 4MD7E 2VUWA 1PHKA 1UNHA 3AT3A 4GVJA 2HCKA 5CSWA 5ANIA 3ZRKA 4KB8A 1JSUA 3N4TA 2I0VA 5IUIA 3LM0A 5HX8A 3BE9A 4EH3A 3VUMA 4MD9E 3HMPA 3TNQB 5BVNA 4M8TA 4WNMA 3OCBA 4HJOA 3FXZA 3OWJA 4ANMA 3RVGA 2BRMA 2UW4A 4O7RA 2CKEA 2X7GA 4ZS0A 2R3MA 3KFAA 5CSHA 3VS5A 4BYIA 5HBJA 4FL3A 1BX6A 2J0MB 4C62A 3MH2A 2C3JA 2ZV7A 3FJQE 3IW7A 4D1SA 2HAKA 4AE6A 3NZ0A 3OCTA 1PYEA 4K0YA 3LW0A 2BTRA 3MDYA 1WBVA 2WPAA 4M14A 3KGAA 4I6LA 3Q04A 4IANA 4EJNA 2W05A 2A0CX 4ANLA 4FIIA 3H9OA 3ZFXA 3R7UA 2CCHA 2ITUA 4YZCA 5IA5A 4ZAUA 5C4LA 4NSTA 3WZJA 2ZJWA 3IW8A 2C3LA 3MH0A 1ATPE 1WVXA 3VBQA 2F2CB 4EBVA 5JFXA 3ALNA 4M69B 3D2KA 3BHUA 3OC1A 4OTRA 3TUCA 5HG5A 4QYFA 1FGKA 3PFQA 1H28A 4S33A 3ORMA 5K5XA 1I44A 4KRCA 1IASA 2Y4PA 4RC4A 3TTIA 4ZZOA 2X9EA 5K3YA 2C6OA 4I5CA 3BIZA 3ZUVA 5C8MA 3EKNA 4PV0A 1PXLA 3IKAA 4MNEB 3ZH8A 1RE8A 2OGVA 4DFYA 5CAQA 1PMNA 1IA9A 3IO7A 3SG8A 3A7JA 4YSMA 3Q3BA 3SG9A 2VTNA 3FLYA 4A06A 3FY0A 2ZYBA 4RFZA 2R3GA 4O21A 2C6KA 2F49A 4KNBA 3ZFMA 2XBAA 1OB3A 3KVXA 2CJMA 3Q9WA 2PL0A 2YEXA 3ZZWA 4BI2A 3R2BA 3VAPA 3MPMA 1RJBA 3DBFA 1GAGA 3UOJA 4DFZE 2C0OA 1TFFA 4RC3A 5BUIA 3A7HA 4PDSA 5GIPE 4RG0A 4C4IA 4FEQA 4D55A 4TW9A 3PXFA 5FP6A 4FTAA 2DWBA 2VTSA 2A19B 5L2SA 2Q0BA 2CKQA 5CEPA 2UZWE 5J8IA 5IQIA 3BKBA 3C0HA 4C35A 4DEAA 4FC0A 2J90A 4FVQA 3HEGA 4OLIA 4DBXA 5LMKC 4YO6A 5A9UA 3DLZA 1FMKA 2UZUE 2GS7A 1VLRA 3RAIA 5HLWA 4H3BA 4JR7A 3AMYA 4DG0E 4L6QA 3F5GA 2EU9A 3DDPA 2BTSA 4BYJA 4JBOA 3FI3A 1F0QA 1Q3DA 4ZSEA 5JN2A 3KCFA 5HGIA 2PMLX 3FZ1A 2ITNA 3FV8A 3QTRA 5DBXA 5AAFA 4IC8A 3C5IA 2BUJA 2YFXA 5M4UA 5HTBA 2I0YA 3BYSA 5FLFA 2UVXA 3ZUTA 4AA4A 2YM3A 1OITA 4ZJVA 5HU9A 4DA5A 4RJ5A 4O4CA 1L8TA 4ZLOA 2JKQA 2V5QA 3DQWA 3F7WA 3JPVA 4O4BB 3RMFA 4TRLA 3ZC5A 4AW5A 2ZFYA 3Q9XA 4E73A 1WBNA 4FTOA 3AMAA 4FGBA 5EK7A 4W8DA 3PZEA 4GFGA 3FLQA 1XWSA 2PZ5A 3V8TA 3U51A 3CQWA 5E1SA 3EL8A 4ZP5A 5IH5A 4TYHA 4ZLYA 5K0XA 1Z5MA 5EKNA 3NUYA 1PXKA 3HV4A 4O7YA 3SRVA 5CU2A 4QP1A 4GYIA 3HAMA 3AKKA 4LI5A 4HPTE 5HOAA 3DKOA 4K8AA 2OZOA 1MRUA 3MJ1A 4G2FA 5DRDA 4H3QA 3EQHA 4UXLA 4A4XA 3FQSA 3WF5A 3H9RA 1PW2A 3ZO4A 1P4FA 5CVGA 3FHRA 3HLLA 4O22A 5CU0A 3O7LB 2W4OA 3WYXA 1U59A 2ZB0A 4WA9A 4EKKA 2VAGA 5L6WL 4FJVA 3IOPA 3PSBA 3R63A 1XH4A 3AD4A 5GIOE 1J91A 2W4JA 2ETMA 3DCVA 5E90A 3MPTA 4DC2A 3LM5A 4O2PA 3GC0A 3NIEA 4I1ZA 2BZKB 2R3FA 3EYHA 5AP7A 3WF9A 3S2PA 5CALA 5CXZA 2IW8A 4U9AA 2JKOA 2ZVAA 3B8QA 4CMTA 3PYYA 3F3ZA 4GYGA 4YNOA 3QD2B 2XJ2A 3TJCA 3PVUA 5CZHA 4DT9A 4PP7A 4DFXE 5L6OA 4D58A 2JFMA 2G2IA 3TACA 4QMXA 1U54B 4HYUA 2B9JA 3C4XA 3F5UA 3G15A 3MWUA 3HGKA 3FXWA 4I6BA 5TR6A 4A9RA 3QBNA 2C0IA 4NT4A 4QDVA 3DGKA 2DS1A 2X0GA 3E8NA 1SM2A 5DT3A 1XH6A 4QPMA 3GU8A 3QF9A 4GKIA 2WMTA 3QWKA 4DFBA 3RNIA 2C1BA 5KUPA 4EL9A 4LQMA 2X0PA 4XBUA 5EFQA 5B7VA 3W2RA 1TKIA 3ZXZA 1A9UA 3OS3A 2CNUA 3PDTA 2J9MA 3IOKA 4M97A 2A98A 3F5PA 3E8CA 3OF0A 1W8CA 3HP2A 3W2SA 3SC1A 4FG9A 4EEVA 1OKYA 3NUXA 3I0QA 3UPZA 4KA3A 2WNTA 5DOSA 3GI3A 4PMMA 3ROCA 1KE8A 3FHIA 3UMXA 3EQBA 3T3VA 3SXFA 4BCPA 2ITXA 1G8KA 3GOPA 3RP9A 2XRUA 5I9YA 3BYVA 4IB5A 4KBKA 3EFKA 2JLDA 4IM0A 4R3PA 4RWIA 3KN6A 4FKGA 4NKAA 1XHAA 2XIZA 3GU7A 3UO4A 3QCQA 3AKJA 4BWXA 5AV3A 3B2WA 1Q97A 1YHVA 3L8VA 5HCZA 4DGNA 2PMNX 4DGMA 2JBPA 5EHLA 3D5WA 5IEXA 4GK2A 2BROA 4L53A 2X9FA 5LCJA 2WELA 4G6OA 5IA3A 3BGQA 4FIJA 1QPCA 5DH3A 4XV9A 3W0PA 3IK3A 4EWQA 3R1NA 3L8XA 4QMWA 3R7EA 3BPRA 3GCQA 5FBNC 3ROYA 5F95A 5LARA 5HE3A 1KOBA 3GU5A 4GVAA 1FVRA 3R02A 4R8QA 4BC6A 2C68A 3HKOA 2GTNA 3TKUA 4QPSA 2J0LA 1ERKA 4UWCA 1CSNA 3OT3A 4OTFA 4UEUA 1UU9A 1WMKA 2JD5A 4DGOA 4W4YA 3TG1A 4BIBA 5DHJA 5DMZA 4RZWA 4C61A 4CFUA 1RQQA 4QQ5A 5I9XA 4Q5EA 3C4FA 3MVHA 2XIYA 2W1IA 5HG8A 4F09A 3K54A 4O7TA 5CX9A 2W1GA 4IDTA 4CYJA 2OKRA 1IAJA 3DXPA 5EW3A 2XS0A 4ACGA 3UQFA 2XARA 3QD0A 4CRLA 2NPQA 4QMZA 4XRLA 4IVBA 3M11A 2XMYA 2XA4A 3O0GA 5FEQA 3QALE 4GEOA 2WOUA 2G2HA 5KMNA 1OIUA 2WTDA 4UMUA 5CF5A 3KXNA 2FSLX 3G6GA 4LFIA 3OT8A 4PMTA 4D0WA 2QG5A 3QTUA 4M7IA 2WFYA 4YC8A 5F94A 3VUKA 4E4XA 4FK6A 3R83A 2PE1A 4WG4A 1PYXA 2GNLA 5CF6A 3E5AA 4UWBA 3L9MA 1H1PA 3VUHA 4F7SA 1MQBA 2W06A 4K33A 4KBAA 2QOFA 5TO8A 4QYYA 4CFNA 3PUFC 2KULA 2JKKA 1W82A 3RNYA 3R9NA 3SOAA 4II5A 5EQEA 3PJ3A 4BCKA 3F2NA 3UDTA 4AAYA 1LR4A 3MB6A 3V8SA 4DEBA 2RFSA 3G90X 4Z16A 3JXWA 5H2UA 5EW9A 3ERKA 1R3CA 2E9UA 2XYUA 2Y8OA 3DK3A 3IS5A 4UY9A 4X2JA 2BVAA 2IZTA 1H8FA 1PMEA 3ACKA 2WU6A 3UZPA 3C4WA 3OVVA 5ACKA 4L52A 4B9DA 3RPRA 4G3GA 5DT4A 2IWIA 4W9WA 5EOBA 3SVVA 3BL7A 2UZBA 3OZ6A 3QQFA 4E4MA 3BLAA 5CF8A 5AM6A 1YRPA 2XNNA 3CGOA 4MWIA 1GJOA 3F3VA 4M3QA 3VIDA 3ZBFA 3ZXTA 5LJJA 2X7OA 3DAKA 3TIZA 1UV5A 3EN5A 1GZKA 1L3RE 3UDZA 4FK3A 2YM8A 2JAVA 3DV3A 2RGPA 5ACBC 2VWYA 3GEQA 4MK0A 4ERKA 3P7CA 4AZWA 3ORTA 4XV2A 3LCSA 4U97A 4V04A 5E8XA 2UZEA 1STCE 3R8ZA 5IF1A 4IWPA 3R7IA 3SGCA 4TYHB 4AX8A 3MH3A 2IG7A 1JVPP 2Q0NA 3SRVB 4QP3A 4E7WA 2R0IA 2BR1A 4GG5A 3Q60A 4IXPA 3VBTA 1NY3A 4AUAA 4BCJA 2OICA 3ETAA 3KMWA 3EB0A 1TZDA 3LCDA 3MGYA 3FAAA 3ZTXA 4TKSA 4LV5A 1HCKA 4D2WA 4HYSA 3DFAA 3ORZA 3QXPA 4XYFA 4Z9LA 3I5ZA 4LMNA 4BDAA 3R1YA 1UU3A 1ZY4A 2C6TA 3WZUA 3I4BA 3NX8A 3ET7A 3LCOA 4AS0A 3HVCA 5CNOA 1B38A 4WG5A 4K18A 4O4FA 5HKMA 2XKCA 3W2CA 3AC4A 3MY5A 4ID7A 3VHKA 4FZ7A 5A3XA 4C2VA 4CG8A 4OTQA 4C3PA 4P5QA 4O4EA 3OFMA 3LFCA 4PDPA 2B53A 3S1HA 3T3UA 1Y6AA 2IVUA 2VU3A 3PP0A 3UP7A 4RA5A 3WF7A 3DKCA 4S2ZA 1GZNA 3II5A 3GCVA 3UVPA 4D2SA 4RZVA 2OU7A 3LFQA 1SMHA 2G15A 5KHXA 4X21A 3U4UA 2XK7A 5HO8A 4O0RA 2GS6A 2YIWA 3FLZA 1WBOA 3QZHA 2XEYA 2XK9A 4FTIA 5D41A 4GK4A 4ZSGA 4AGDA 2QOCA 2RG5A 2WGJA 4AW0A 4XV3A 5AM7A 2XEZA 3LXKA 4JX3A 2G2FA 4EOKA 5AEPA 4HZSA 1PXNA 4D2RA 5JZNA 4GG7A 3W8LA 4LRKA 3FMMA 4YURA 5FDPA 2PZIA 3ZM4A 3OEZA 3W16A 5HLPA 4ACMA 4IAYA 4UMPA 4D5KA 1XKKA 2ACXA 3Q5IA 2CLQA 2WOTA 5LVOA 3LFEA 5CT0A 3RCDA 4XG2A 4YC6A 4ZMEA 2EWAA 2EXMA 4GU9A 5J95A 5JT2A 2XVDA 2ZAZA 4TWCA 2VTRA 4FNYA 1B39A 3LMGA 3LFBA 4FV8A 4JQEA 4O1OA 4DEGA 1ZYCA 2BHEA 3PPZA 4I0RA 5CEMA 3NYOA 3IGGA 2JEDA 3FSFA 3PP1A 4LV7A 3MIYA 3A4PA 4AXEA 4OTPA 3LVPA 5CF4A 4NWMA 1OPJA 4QMTA 3NVKI 4K2RA 4QQCA 5ANDA 5E8YA 4AXAA 3NVMB 3QTWA 2FGIA 3ODYX 3ZRLA 4R1YA 4DCEA 3F3WA 4L8MA 4BDGA 3UDBA 2PULA 3MPAA 3HA8A 4F1OA 1Q62A 1YI3A 2GNJA 4JJRA 4Z3VA 4LGHA 2VGOA 4MBJA 3SV0A 4LV8A 3DTCA 4JRNA 3WZKA 4OW8A 5J5TA 1OI9A 3DFCB 4M15A 4FTUA 4FV4A 4ZOGA 5I9UA 5BVDA 5BVOA 2WTKC 3E88A 4F0FA 2ONLC 3KKVA 4DH1A 3TZ8A 5IPJA 3GQIA 2CKPA 4K6ZA 5E7RA 4D4SA 4E5WA 5ICPA 4XUFA 4MF1A 4GRBA 5LCKA 3NCZA 5T3QA 5A4TA 2UZNA 1JOWB 2GPHA 3A2CA 4ITHA 3CGFA 4U45A 3A4OX 3TDVA 2C3KA 4AGUA 4D2PA 2RSVA 4YPSA 2DUVA 2WXVA 3DU8A 3HMMA 4QOXA 4W4XA 5JEBA 2OK1A 2YDIA 3PA3A 4L68A 3NMUF 1BMKA 4E93A 4EQCA 5DVRA 4JLCA 5FWKK 2IZUA 4CZUA 3C13A 3I7BA 4YBKA 4FOCA 4BJJA 3LXPA 3T9IA 3OWLA 3WZDA 2R7BA 4OTWA 4ZTQA 4RLLA 4GIHA 1JKLA 5L2QA 3HMNA 4KBCA 2WMSA 3EMGA 4BIDA 4O0XA 5DFPA 2F7EE 4PF4A 3PVWA 3SW4A 5IMXA 2XAMA 2PY3A 4QYGA 2EXEA 4L42A 2H8HA 3Q4TA 4F1TA 3OWKA 2QOOA 4OBOA 3P9JA 2AUHA 2W9FB 2R3LA 3OTUA 4JQ7A 3EN6A 3VWAA 2Q83A 3KRLA 2BRGA 4R1VA 3D9VA 4G3CA 4XG9A 5HNGA 1CKPA 2JIVA 2QQ7A 3MVLA 1OPKA 4MTAA 4C59A 5L4QA 3THBA 4FTQA 4DFNA 5EHOA 3E8EA 3BEAA 4P7EA 3E87A 3R7OA 4FG8A 4YC3A 4TY1A 4OTGA 5TKDA 3U55A 4BL1A 3RWPA 2G01A 4CZTA 5DYJA 4MHAA 1ZY5A 2C3IB 3KXXA 5LMBA 2VWIA 4CGAA 4U43A 3F69A 2YCSA 3L9LA 3BU5A 1G5SA 4BGHA 4EHZA 1H00A 2ITYA 5IQAA 4AN3A 3COHA 1OBGA 2H96A 2BFYA 2W1ZA 4JR3A 2XNEA 3R1QA 2OSCA 3ZO3A 3DZQA 3RWQA 4EH5A 5AP3A 4CRSA 3VUTA 3TWJA 3UVRA 2XM9A 4KKEA 4BICA 1ZMUA 3PVGA 4L7FA 4JX7A 3KRRA 1M17A 2CCIA 3I0OA 5T6KA 4MCVA 5L8JA 3W32A 4YJQA 1URWA 3BLQA 5FDXA 4O82A 5L6PA 4DH8A 2C30A 1H24A 2OXYA 3DJ5A 5M07A 1MRVA 1VZOA 1IR3A 2WQNA 3Q6WA 2W17A 3KXHA 4QTBA 4WSQA 3I60A 1DI8A 3AD6A 3CQEA 4M0ZA 2C6DA 2RKUA 4L46A 4C3RA 3EOCA 3QRUA 4IX6A 5HI2A 4CFMA 4ARKA 3TEIA 4FEWA 3R9HA 3OW4A 4WNOA 5I9WA 2C6IA 2PVHA 3NUSA 2XKEA 3LLAA 4JIAA 3ZO1A 4IX4A 2CLXA 3BBTB 4KS8A 3PPKA 4I0TA 4X3JA 4ZEGA 4CNHA 3R73A 4G3FA 4WKQA 4AA0A 2F9GA 3NUAA 4F7LA 3MTFA 4G16A 1MRYA 3E7VA 4GH2A 4NEUA 4RRVA 1M2RA 1ZYSA 4V0GA 2G9XA 3T8OA 2Y4IB 4DDGA 2OJ9A 5HIEA 3ZU7A 3OMVA 2Y6MA 4CV9A 4RIYA 4I3ZA 5HCXA 4O7SA 1QPDA 2V62A 2QLQA 4FTTA 4I6FA 5CNNA 3VS4A 4R78A 3NLBA 3QRJA 4AG8A 2JIIA 4K77A 1YVJA 1PMUA 3SXRA 2ETKA 3MJ2A 3R8MA 1XH7A 4F4PA 4BI0A 1JKSA 3OXIA 4IX5A 3D7TA 3EN4A 5LMAA 3QD4A 1R0EA 2C5YA 2J5FA 5T68A 5C4KA 2UZOA 3CXWA 2HW7A 4E6DA 4NK9A 2PE0A 3NAXA 5CYIA 5FXSA 1H0VA 4XG6A 4C4EA 4I92A 2OXDA 5BUJA 5BMMA 4HCUA 2XALA 5I9VA 5J1VA 3BLRA 4RBLA 1WBPA 4NM0A 3UZRA 5H8BA 3W8QA 3KB7A 4ZSJA 2BZHB 5C8KA 5KMLA 1VYZA 5BYZA 3EQDA 4IVDA 1OKWA 1ZMWA 5HTIA 3MVJA 4XV1A 3RM6A 5CVHA 2WMVA 2YABA 5E8SA 3VQUA 3A7GA 3C1XA 3HRBA 4AN2A 3CPCA 4X3FB 1OIQA 4ERWA 3F3TA 3QL8A 4JOAA 4LYNA 5E91A 3PJ2A 2O64A 3EQPA 5JKGA 4LOQA 2EB3A 1Q24A 4EOPA 2XKFA 1IRKA 4ZY4A 3ZSGA 4U0IA 3FY2A 3DXQA 1OIYA 4CTBA 4FUYA 4PPAA 2ZM4A 4FNWA 3O5AA 5IQHA 4EYMA 5K4JA 1UA2A 5E8UA 2FSOX 1Z9XA 2C5XA 1XH8A 2JDRA 5EI8A 4LG4A 1URCA 4R7BA 3CTHA 3CY3A 2PUPA 2ITVA 1YDRE 4CLJA 4EKLA 3MA3A 4PPCA 4BBFA 2WTWA 4MKCA 4RVLA 3U6IA 5J1WA 2E9OA 4P5ZA 2V0DA 4KINA 3F61A 3VVHA 2VGPA 5E92A 3ZEWA 2VWZA 4LRJA 3O2MA 3LQ3A 5GJGA 5H3QA 3ZLYA 2O3PA 5M09A 4G17A 4QTEA 5EH0A 4FTJA 4E4NA 3BGPA 2VTHA 3R71A 1FBNA 3OCSA 3HV3A 2C6MA 3IW6A 2VWXA 3A8WA 4FKRA 2YJSA 3UIUA 1GIJA 1MP8A 3DA6A 4G5PA 4MX9A 5HNIX 3LMHA 4BFMA 3HYHA 2XKDA 2ZOQA 4IZ5A 3PE2A 2XCHA 2C5NA 2VO7A 3RAHA 4AQCA 5FEDA 5LQFA 2CDZA 1OIRA 5CENA 3GC7A 4R7HA 2YWPA 3DKGA 2VO6A 1O6LA 1ZWSA 3ENHA 4PP9A 2ZM3A 3NUUA 4QP9A 3SX9A 3WE8A 4E20A 3FZSA 1KOAA 1ZOEA 3WI6A 5AUVA 4FT5A 4C36A 1FINA 4QNYA 5B2KA 4RJ4A 2P0CA 3CD3A 2WTCA 1H1SA 3E63A 1OECA 5ETFA 4QMLA 1FOTA 2JDOA 5BVWA 4BJJB 3EWHA 4AF3A 1F5QA 5AP5A 1SZMA 2Z60A 3MN3A 4IFGA 4BKJA 4DH5A 1XMLA 5FG8A 3TV4A 4YSJA 3H0ZA 5CASA 5IISA 4IVAA 4NKSA 5FBOA 4X6QC 3EFJA 3OD6X 3OW3A 3LJ2A 2A4LA 4J71A 5J9YA 3MFTA 4G9RA 5KMJA 3KIOC 3CTQA 1TQIA 3NFGB 4HYHA 5ANEA 5B2MA 4XG8A 3O96A 3ZDIA 5EM6A 4GK3A 5C26A 5HBEA 5CXHA 1Z57A 1WVYA 3HRFA 4LOPA 4RIOA 2BCJA 3ZZEA 1APME 4AACA 4CT2A 4O0WA 5IU2A 3AXWA 2ZB1A 4YMJA 4V05A 3VBWA 4IEBA 2X2LA 1PKGA 4FF8A 2CMWA 3BHHA 3WIGA 4ASEA 3ZOSA 4EK4A 4DLJA 2V7AA 3DPKA 5HNBA 4EWHA 4EK8A 2ZV9A 2OF2A 4FTMA 3RZFA 2W9ZB 1O9UA 3HV6A 4OGRA 2VWUA 3O71A 3HZTA 2CGXA 4FR4A 5HVJA 4CSVA 3FMKA 4UYNA 2I0EA 3CP9A 2YDKA 4QYHA 4WRGA 2R3IA 4ANSA 3TM0A 3LFFA 3DTWA 1FVTA 4JDJA 4V01A 5HVYA 2ZMDA 4C3FA 2VTOA 2WO6A 2PUIA 3GT8A 4IAAA 4O0TA 4IVCA 4KIPA 3LXNA 2WEVA 1OVEA 5DRBA 4DEHA 3QKLA 4APCA 3VRZA 3QQLA 3AT4A 2RG6A 2VX3A 1REKA 4RT7A 3TKIA 3EHAA 1SVHA 4J53A 4WHZA 4HYIA 3PIYA 3Q32A 4TL0A 4DHIB 4OR5A 1KV2A 1WBWA 1YXVA 3FQHA 4G6NA 3Q5ZA 4QMSA 4IZYA 3ZUUA 4YUQA 3VS0A 3ORXA 3RPOA 4FSWA 4JI9A 2X4ZA 1UWJA 1KSWA 3PSCA 4I20A 5KMKA 5FRIA 4D4YA 3RI1A 4YBJA 4AT5A 4M0YA 3FL5A 4F9WA 5HORA 4IAKA 1FQ1B 4ANBA 1WFCA 3O17A 2IW9A 4ZY6A 4B8MA 4MXOA 1PXMA 4F9CA 3BHYA 3C4CA 4EK3A 4R3CA 3WILA 2PHKA 4BHZA 2JDVA 4V0GB 3FL4A 3HNGA 4WO5A 3POOA 2ITPA 4YNEA 4AFEA 3D14A 4XRJA 3E93A 4RIYB 5J7HA 2P2HA 2J0JA 2J0IA 3SDJA 4DTBA 3RJCA 3NFFB 1OL1A 3MH1A 4KD1A 4KIOA 5KE0A 2I1MA 1JKTA 2F2UA 2AYPA 4PQNA 4S34A 4FKLA 3SKCA 3ATTA 1GOLA 2QCSA 4XNEA 3AGMA 3R8PA 2OJFE 3QCYA 3RHKA 2PU8A 3D7TB 4MAOA 3EZRA 3TCPA 3NUNA 5KCVA 5EHYA 2QC6A 4FEUA 2FH9A 5DR6A 2CGVA 2YERA 5IG1A 2GNFA 4OBPA 4C2WA 3QRKA 5E9EA 3A7IA 4L3PA 5IDNA 1PKDA 3L1SA 3VS6A 2ITZA 1YXTA 5IH6A 3UDSA 4A9YA 4XCUA 1CDKA 4C4JA 2XANA 2PTKA 2G1TA 3POZA 4H05A 4XS2A 4YTCA 4H36A 3DLSA 4TNDA 4U40A 5FD2A 1NVRA 3NW7A 3P79A 3R30A 3S95A 3VRYA 3NGAA 4J8MA 3TNIA 5CANA 3PLSA 3UODA 4USEA 4AQKA 2I7QA 4ZZMA 4PMSA 4Q9ZA 2X6EA 2XM8A 3FZTA 4S32A 4YZNA 5AUXA 4FIGA 3ZM9A 2PZYA 3QUPA 2NYAA 4FVPA 3CY2A 4PTEA 5HCYA 3WF8A 4F1MA 3EFLA 3NNVA 5M56A 4BWPA 2VN9A 3MB7A 2ZDUA 3IONA 3FBVA 3BHVA 5HTCA 4ZSLA 1NVQA 4HNFA 4FICA 4GUEA 5LWMA 4FKOA 5JGAA 1HCLA 2HY0A 4ZZNA 3R28A 4KIKA 4EC9A 4Y73A 2XB7A 2B1PA 4J98A 3FI2A 4A7CA 2R7IA 4ANQA 1JSTA 3W10A 4RFYA 2OH4A 4F99A 3BU3A 1G8JA 4NFMA 2ESMA 2OIBA 5EM8A 5I3OA 3R21A 3ORLA 4E6AA 4MD8E 4J97A 1KE6A 3FXXA 1WZYA 2W7XA 4YGAA 2QR7A 2B52A 3REPA 2HZNA 4FV1A 2WAJA 4CKIA 2HOGA 1EH4A 3EH9A 5AMNA 3I6UA 2Z7RA 4RLKA 4FUXA 5LMKA 3QX4A 2P55A 2DYLA 4HW7A 4RJ6A 1BL6A 3F6XA 3DB8A 5E8TA 4N4SA 2YM5A 4FOBA 4S31A 5HESA 4BRXA 4QQTA 4U80A 2CNVA 3QYZA 4NIFA 2B55A 5HO6A 5EDPA 3NDMA 5DT0A 5CY3A 4QT1A 2FSMX 5KX8A 1Q4LA 2ITTA 3VBYA 4ZSAA 3FWQA 5TE0A 2UW6A 3ODZX 4I22A 2C1AA 2H34A 3FMJA 3H3CA 3G0FA 3ZYAA 5M57A 4JBVA 3BU6A 1UVRA 4NZWB 3RAKA 4EQUA 3E62A 3BL9A 3U6JA 4IE9A 3UOLA 4BI1A 2GQRA 4ZMFA 5EYKA 2Z02A 2HZ4A 2WMAA 4WNPA 1AQ1A 4Y72A 4BIEA 3DK6A 4R6VA 4YHJA 2XNPA 4EC8A 1BL7A 5AX9A 1H1RA 4YJOA 1VEBA 1QMZA 1XBAA 5KMMA 4O7NA 1OKVA 2R3PA 3MTLA 4F70A 3BQCA 5AUTA 3UO5A 3PJCA 5ANGA 1OPLA 2GCDA