3FY0A

Crystal structure of pak1 kinase domain with ruthenium complex dw1
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
293
structure length
292
Chain Sequence
SDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase PAK 1
publication title Targeting Large Kinase Active Site with Rigid, Bulky Octahedral Ruthenium Complexes
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 292
sequence length 293
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fy0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fy0A01
3D83A 1JKLA 3W1FA 3FKLA 3TZ8A 3QKKA 4CLJA 2VTJA 1P14A 2E9VA 3UPXA 3FLQA 2X8EA 3KQ7A 2BZJA 3D7TA 3D5VA 3FLNC 4BVUA 3OWLA 4QMNA 4BKZA 4F6WA 5KKRB 4ANSA 2HY0A 2R2PA 2WFYA 5DE2A 3AC5A 3NYVA 1XH7A 4WBBB 5HU9A 3FZOA 5L6PA 2C3KA 2O2UA 3KK9A 4QYFA 3HZTA 4BTJA 3OBGA 4MAOA 4IAIA 3VULA 4ZIMA 3EQBA 4IZAA 4I92A 5HCYA 4W8DA 2X2MA 1Q8UA 4O0YA 3RP9A 4EWQA 2IJMA 3ZXZA 5IPJA 3DBFA 3MB7A 4RVMA 3ZOSA 2R3QA 1A06A 3QHWA 5E91A 4EHZA 3LPBA 1PY5A 4DG3E 1F5QA 1PXIA 2C30A 3BELA 1OL6A 4GW8A 5D7VA 4EZ3A 1YWNA 5IQCA 3JY9A 4EOPA 4F64A 2DS1A 3LXLA 4UALA 5HD4A 3HMPA 3UQCA 2YAAA 4YTCA 5HTBA 3AC3A 1LP4A 2J9MA 1ZZLA 2W7XA 4YHFA 3QD3A 4WT6A 4XG4A 2J6MA 3LFSA 1YKRA 4IX3A 3R8ZA 1HOWA 4A9RA 4YSMA 4TRLA 3BE9A 4Y5HA 2R0UA 2RL5A 3FZPA 3PP0A 4FZDB 1H25A 5EG3A 5IDPA 5HIEA 1CKPA 3LE6A 3U54A 4W9WA 3EL8A 3RI1A 4IHPA 1BL6A 3ZFYA 2VZ6A 4ARKA 2A4LA 3IK3A 4Z3VA 4ZSEA 4ZP5A 3RKBA 4FKTA 4AX8A 2GQSA 3EQCA 4IZ7A 5IA5A 3QX4A 3SD0A 5CEPA 5CI7A 4NWMA 1WBNA 3DCVA 5L2QA 1Q8YA 2XBJA 3BU3A 4FODA 4RWJA 2WOUA 4IJ9A 4J7BA 3PUPA 3E8EA 3M42A 4U45A 1XO2B 5D1JA 5DWRA 5BUJA 4L01A 3MVJA 4EOLA 3FI8A 4FYOA 2CNVA 2EU9A 4L46A 3IW6A 1MQ4A 3OOMA 2HZ0A 1W7HA 2XNBA 3VS2A 4OTHA 4EOOA 3EWHA 4UXQA 5E8ZA 3W2CA 4C7TA 3ID6C 2UW7A 4NM0A 3FAAA 2JKMA 3OXZA 4NIFA 4JIKA 5DBXA 3R8UA 4DFYA 2C47A 2B52A 3MIYA 1ZOEA 5DOSA 2I6LA 3DY7A 2UZVA 2YWVA 3EQGA 5IZFA 3DKOA 4FK6A 4BYJA 5IKWA 5A4TA 4OTQA 4I5PA 3RNIA 5K4JA 3TTIA 3EJ1A 4GK2A 2NPQA 4D1SA 3IDPA 2GNJA 4KBKA 2CSNA 5AIKA 4GS6A 1Y6BA 4FEVA 3CE3A 3BHTA 1JSTA 1Z57A 2VTNA 3N9XA 3TWJA 3FKNA 5HG5A 3OS3A 1U4DA 3LFAA 3D5WA 3SV0A 4ACMA 4ALVA 4GT4A 4TNDA 5IQDA 2VTSA 4YHJA 3WBLA 4DH7A 2X8IA 4JRNA 5E4HA 4D2WA 2W1HA 2YWPA 3ZZEA 5CQUA 2GPHA 4AE6A 4N6YA 4ZS0A 3EL7A 2KULA 4G31A 3FHIA 2WTJA 4CZUA 3Q32A 4O2ZA 1NY3A 4RIOA 2R5TA 4ZLOA 4FT0A 4IC7A 4F9CA 3TZ7A 4CCBA 1SVGA 5LVNA 3TNHA 5ACBC 2ZJWA 3Q6WA 4FVQA 3SW4A 4L6QA 1B6CB 1S9JA 4FTMA 4KB8A 3D5UA 2OK1A 1GZKA 4XMOA 1SVEA 4YLKA 4BR3A 3KRLA 2EXCX 4DCAA 3NDMA 5FEQA 4N4SA 3NRMA 4OT6A 3VS3A 4C36A 4MNEA 3KFAA 1VZOA 4EQUA 4GH2A 1H28A 2B53A 3MVMA 4ONAA 5CI6A 3MGYA 4UMTA 2R4BA 2P55A 5DG5A 3SHEA 2QG7A 4FV8A 4JAIA 2QOBA 2WQMA 5BX0A 3ATSA 4FF8A 3A99A 4N70A 1PMVA 4GMYA 3U9NA 2A1AB 4MCVA 1HCLA 4FIFA 5E92A 3C0IA 3FMNA 4DITA 3F3ZA 3PPKA 1Y91A 3PVUA 1IA8A 4XHKB 4CGAA 3PIXA 3UDBA 3FZ1A 3ZZWA 3WIKA 4IX6A 4BFMA 4BCKA 2PPQA 2PUNA 4H3PA 4IAYA 2X2KA 5CU4A 5HGIA 3IGOA 4FKWA 4YTIA 4B4LA 3UOJA 3MESA 4LUDA 3PG1A 2BZKB 3ZUUA 1REKA 4PL5A 4O1PA 3ZBFA 3TJCA 4FT9A 3PYYA 3HGKA 2HW7A 1B38A 4ITIA 5FQDC 3KMMA 2E9UA 3VAPA 5KCVA 3MPAA 3KL8A 5CSWA 3KCFA 4GEOA 3A7GA 3I5ZA 2YDJA 3PZHA 2PZPA 2UW5A 4PDPA 4X2JA 5J8IA 1A9UA 3ZTXA 3U55A 5I0BA 5CF8A 5E1EA 4MBLA 4K0YA 4C4JA 5CS6A 3VWAA 4EBWA 5HO7A 2GNFA 5FRIA 4BWXA 3QCYA 2VO0A 4WSYA 5EFQA 3E5AA 4WRSA 4D2SA 2PWLA 4JDIA 2XK4A 3C50A 1OECA 5K5XA 1YRPA 3KRJA 5G6VA 2V7OA 3FXZA 4XV2A 4CSVA 3R9RA 2X9FA 2BHEA 4FT5A 4BRXA 3JS2A 4NIFB 4E5WA 3OHTA 4G17A 4ZTRA 3TNWA 3AC2A 3VIDA 4DGMA 4XUFA 5LWMA 2HOGA 4NW5A 4BDHA 2ONLA 4BTKA 4CD0A 4CYIA 5B2LA 2IN6A 1V0OA 1P5EA 2XNNA 5GJFA 3UODA 3JR1A 4ENYA 5I5ZA 4P5ZA 3NUYA 4UMUA 2J0KA 2I40A 4YUQA 3QRIA 1M2RA 5DN3A 3C4FA 4X2FA 5AV2A 4AQCA 1STCE 1GOLA 3OD6X 3K5VA 3F5PA 4G34A 4USDA 1UA2A 4E6CA 2ZDUA 2R3IA 3MFTA 3GEQA 4PMSA 4RQVA 3PJ2A 3RPVA 2QLQA 3NGAA 3O8PA 3R7UA 5CAPA 1PXNA 2JAVA 5B2MA 4EK6A 1G5SA 3NCGA 5HTCA 4YP8A 5M4UA 4UWYA 4CFFA 3W2OA 4YNEA 2X8DA 2XM8A 3PXZA 4YZBA 5ICPA 3PSDA 4MF0A 2Z8CA 3HRCA 3V5QA 3FUPA 3PJ1A 4ASDA 4O0XA 4FK3A 3DZQA 5AP6A 5HU3A 3L9NA 5GZ8A 1BYGA 3Q9ZA 4HCTA 4EK8A 4KNBA 3RZFA 4E4MA 4GKHA 4IIRA 5K9IA 4DH1A 4W4YA 4D2PA 2YERA 1YI6A 3EN5A 2XF0A 4U43A 1KV2A 3QRUA 4JG7A 5BMSA 2RGPA 4MNEB 4Y95A 4XBRA 2WO6A 4RPVA 3TTJA 3O96A 5E9EA 1R78A 2ITZA 2YCQA 2QOKA 3O17A 2OKRA 3Q9YA 2CGXA 1OM1A 2XEYA 3DJ7A 3UZRA 4O2PA 4KBCA 4XP3A 3PWYA 5B2KA 4Z16A 4QQTA 3H0ZA 3BYVA 2UW4A 3KREA 2IO6A 5E8TA 3A60A 4KKGA 3UG1A 4P5QA 5GZAA 3R8LA 3GGFA 4F9YA 2R3FA 3PXKA 2ZM3A 4DEGA 2WPAA 4KSPA 4C2VA 3LCDA 2GQGA 3V5JA 4ALUA 4YNOA 3LQ3A 4IZYA 2H34A 3DK7A 4TT7A 4FSUA 4XNEA 1UVRA 3QYZA 3C4WA 5H3QA 2Z7LA 5DFPA 3HEGA 3R01A 1YOLA 5FDXA 4YTHA 2OXDA 4IH8A 1LEZA 3Q5ZA 2PMNX 4LFIA 2Y0AA 3TNPC 4BWPA 2PVYA 4E3CA 3LFEA 5E1SA 5M08A 4YZCA 3PVGA 4F6SA 2WMTA 2YJRA 2WMRA 2YIXA 4H1MA 2UVXA 4J98A 2GHMA 3UIMA 4I0SA 4O0RA 1XBAA 4HGSA 5TO8A 2Y6MA 4F09A 1H07A 3PIYA 3P5KA 2R7IA 4RLLA 3NZ0A 2BTSA 3BLQA 3COHA 1DAWA 2WXVA 3A7HA 3GXLA 4G16A 2VX0A 1UV5A 1BX6A 4UB7A 4E26A 4TNBA 4JR7A 1XH5A 4RFYA 1PXKA 1M2PA 5M4FA 5M56A 3H9FA 1OL7A 2F7EE 3QCQA 3C7QA 4OTGA 3EN9A 2X7GA 1ERKA 4RMZA 4AZWA 3HNGA 2C3LA 3V8TA 4RIWA 4F70A 4QMXA 2AYPA 3R00A 3R73A 3PA3A 4JRVA 4ZTHA 4IWOA 4QMUA 3VN9A 1DI9A 4D0XA 5AWMA 1WBPA 4WA9A 4R3RA 5DEWA 1UNHA 5CYIA 3F5XA 4G3GA 5IQBA 2XUUA 4Q9SA 1K3AA 4Z7HA 3CR0A 4AT5A 4CG8A 3FY0A 4IX5A 3QRKA 3W10A 2FB8A 1Z9XA 2FVDA 3BHUA 3WARA 5FDPA 4H05A 3QA8A 4C59A 3QRJA 3ROCA 5TE0A 2OFVA 2OBJA 3CTHA 3ZFXA 4OGRA 1ZOHA 2BPMA 1APME 3LXKA 4W4VA 3DV3A 3ZHPC 4R6VA 4M0YA 2E9PA 4HGLA 4U3ZA 3WZUA 5AUWA 1XH6A 4RRVA 2JITA 4BZOA 4AA5A 4DG2E 3DK6A 3RALA 2W99B 3TV7A 4QMQA 3F61A 4OTPA 3BYUA 2BHHA 1PYXA 4GU6A 3ZMMA 4MNFA 2C5YA 5I9VA 5JEBA 3FQEA 4L43A 3ZC6A 2B54A 4S32A 3LFQA 4HPTE 3LFCA 3WOWA 3FI4A 3GU7A 3KN6A 4Q5EA 2JBPA 5EDPA 1RW8A 2C3IB 4FV5A 5AP1A 3VF8A 4BYIA 3QTZA 5C01A 4C3PA 3NPCA 4EOQA 4ZTLA 3GP0A 2CJMA 3FMJA 3EQHA 1XKKA 4V01A 4AWIA 3UVPA 4ZMFA 3P7CA 2XYNA 3DB6A 5F4NA 5FM2A 3T9TA 3ZM9A 5C4KA 2XK9A 4IAZA 3OUKA 2JGZA 2PE2A 3C13A 1U54A 4QTEA 3E88A 1K9AA 2R3HA 4XCUA 3FC2A 3ATTA 2J0LA 3BE2A 2ZM4A 3HVCA 3R1YA 4Q2AA 5F95A 4ZY6A 2ETRA 1P2AA 5AAFA 5L8JA 3W16A 2W4JA 4NUSA 2IPXA 1QPJA 4D1XA 4FV7A 2FA2A 2WTWA 4UEUA 5M53A 2WD1A 3TIZA 5DI1A 5CTPA 3A7IA 2JBOA 4FEUA 3IW8A 4D28A 4EHVA 4AN2A 5EKOA 3QTXA 2ITUA 4QP9A 4DFUA 4C4IA 3MFUA 1KE5A 5HD7A 1CKJA 3TJDA 3AC8A 3EIDA 3NAYA 3KK8A 5CU2A 3UPZA 4NL0A 4AFJA 4CYJA 3R2BA 1Q8ZA 2Y4IB 2B4SB 3PTGA 4B9DA 5KX8A 5ANIA 3S95A 4IJPA 4I3ZA 4RFZA 4YZ9A 2VO3A 5KHXA 3MSSA 4D2VA 5HKMA 1OL5A 3TACA 4KKHA 1ND4A 4BDKA 2XNPA 3BYOA 3W8LA 3IECA 4BZNA 4FV6A 4GJ2A 3C51A 5AR7A 4II5A 3GOKA 5CSHA 3GU6A 3MJ1A 2QKWB 2C5XA 4CZTA 4CT2A 4JVGA 3WZDA 2V62A 2XVDA 4J53A 3TIYA 3RPSA 4LV8A 3PLAE 4FTLA 4XS2A 3D14A 3GNIB 4BI2A 4TTHB 4L42A 3OCTA 4RA5A 1WBOA 4S31A 3I6WA 2VTTA 3UNKA 4TZRA 3VBVA 3COKA 4RWLA 1OIQA 4HYHA 1PXLA 4S33A 4AXAA 3U51A 3CQWA 3WF8A 4XRJA 2R3KA 3FI2A 4RIWB 4CMUA 3NVMB 3RPOA 2DUVA 4GG7A 3S1HA 2CKQA 2WQEA 4QMSA 3Q6UA 4I4EA 2GMXA 3RNYA 4EWHA 2I0HA 3F2AA 5CENA 3H0YA 2B7AA 4RX7A 3ZUTA 3HKOA 3P86A 2QU6A 4FKQA 3ACKA 2LAVA 4BKJA 3SX9A 3FYJX 1CTPE 2W5HA 3HAVA 3A4PA 1H00A 4F99A 4RIYA 2OF2A 3FMKA 3E63A 3BYSA 3T9IA 4BWKA 5BVNA 3COIA 4JX3A 3B2TA 4ZZMA 3LVPA 3WI6A 4L3PA 4IB5A 4AW1A 5CAUA 4EKLA 2OWBA 4D58A 3LFFA 2QR7A 3JYAA 2WU6A 3DT1A 3ZSHA 4YU2A 1OPJA 4BI0A 3BEAA 4MBJA 3MVLA 2J0MB 5IEXA 2CKOA 3LFNA 5CAQA 2FSMX 2QOOA 5FBNC 5TR6A 3SRVB 1PKDA 4BY9E 1JNKA 4L7FA 4O0VA 3LFDA 1H8FA 5FGKA 3E62A 1ZY4A 2WTCA 2HY81 5BYLA 4YJUA 3HRFA 1U54B 3VBQA 2YM3A 2O8YA 3FZRA 3Q2MA 4S2ZA 2CNUA 5CX9A 4BCIA 2W1ZA 2YISA 1MQBA 1ZYLA 4RJ5A 5A6OA 4RLKA 4GT3A 2Q83A 3W2QA 3VQHA 2VTOA 2VWYA 1Y8YA 3MY5A 5GZ9A 4AT3A 4UYNA 2GS2A 2QURA 4EK3A 3UTOA 4XV9A 4S34A 5FP5A 1VJYA 4TYGA 4KSQA 5DIAA 3U9CA 3OWJA 5L8LA 3QCXA 2V5QA 4W9XA 5BVOA 4I23A 4ASEA 4HYIA 4BKYA 5CEMA 4G6LA 4OUCA 4YBJA 5DPVA 3VRZA 2X4FA 3QHRA 3SAYA 4B8LA 1OVEA 5CANA 3ORPA 3RINA 2W05A 3DKGA 2W1DA 4FTCA 3HV5A 1FMKA 4QMYA 4QYYA 1GZOA 5ACKA 3U6IA 4F4PA 4AZTA 4FV2A 1U5RA 3OW4A 3EH9A 3THBA 3LFBA 4MXYA 4B0GA 1FGIA 3DXPA 4MVFA 5DNRA 4XG7A 5DR9A 1UNGA 3VQUA 4IVBA 3T3UA 2ITQA 3AD5A 4LUEA 5LWNA 3L8VA 4YJNA 4FX3A 4F9BA 3GCSA 4QP7A 4ACGA 2XK8A 5KMLA 1H1PA 1WVWA 3DTWA 5I9UA 4D4RA 4RJ6A 3Q5IA 1Q3DA 2HAKA 4IVDA 1QL6A 3UBDA 5JQ5A 4S30A 4BIDA 3N51A 4PP7A 3MW1A 2R3RA 4IW0A 4HVIA 5EW9A 1Y57A 2WMAA 5D12A 1NT2A 3AD6A 3ENMA 4RVTA 2UZUE 1BI8A 4PPCA 3VJNA 3QTIA 4BDCA 2BRBA 1MRUA 2YLFA 4Y83A 4QNAA 4NKSA 3LQ5A 3R6XA 5AUVA 3ORKA 1NVQA 4FV3A 3WF6A 5CXHA 2OO8X 2Y9QA 3NEWA 1GZ8A 5A46A 3NUSA 3ZH8A 2JDRA 4DFLA 3OY1A 5GHVA 4IANA 4FZ6A 4E20A 4KA3A 4M66A 5JH6A 3O8UA 3W2SA 3C0GA 3G6HA 3EQRA 4FV9A 5J1WA 1OPLA 1QCFA 4QYHA 3UIUA 4TWCA 4ERWA 3F9NA 5IQEA 4LYNA 4GT5A 4M15A 2QR8A 3EYGA 3BRBA 1J91A 3R1QA 5DA3A 5IMEA 4QQ5A 3R8VA 3TV4A 3DB8A 5IQFA 3WYXA 4C62A 4JDHA 3BPRA 3GC8A 3SA0A 1PHKA 3VUTA 4YJVA 1Q97A 5KMMA 5HIDA 3A8WA 5IMXA 2QOQA 2HYYA 3RK5A 1KV1A 2BDWA 3R83A 2BROA 4QMOA 5JSMA 1W82A 3FJQE 5K5NA 4QTCA 4V0GA 5DT3A 4PNIA 2UVZA 4BN1A 3BGZA 2C6MA 3F5UA 3LMGA 4ZY4A 2QLUA 2YAKA 4NFNA 5K0KA 5E8UA 3UVRA 3ZUVA 5AV1A 3TN8A 5LMKA 4BDEA 3EKKA 4CFMA 4DEHA 3IQ7A 2J5EA 2FYSA 5CAOA 5K3YA 5HX6A 3KVXA 1H27A 4TWNA 2OZOA 2GDOA 3KGAA 4O82A 1JKKA 4F63A 4O7SA 1AQ1A 4O27B 4QMLA 1GIHA 4E7WA 4LGGA 2QKRA 1X8BA 2VRXA 1KWPA 3GBZA 1VEBA 4FZAB 3WF9A 2BDFA 5D10A 4PUZA 3RHKA 3NIEA 3VBWA 3TXOA 2YZAA 3QWKA 4G1WA 5I9ZA 3RJCA 1XJDA 3OEFX 1ZAOA 2JDSA 3R7OA 1PJKA 2VTLA 3OTVA 3H9OA 1Q99A 2F2CB 2RFDA 4MD7E 5L3AA 5AP2A 4QP3A 1PRYA 1R3CA 3T8OA 3U6HA 2CN5A 4K8AA 4KABA 3E3BX 4YPSA 4TYHB 5TOZA 3D0EA 3UOKA 3O71A 4IWPA 3A7JA 3C5UA 4E73A 3D4QA 2ZMCA 3DA6A 3I1AA 3ZSIA 3K2LA 3UOLA 1W84A 3ZBXA 4EHEA 5A4EA 2VU3A 3KXGA 3HV4A 4FTKA 2QONA 4GUEA 5K4IA 2Z7SA 1ZWSA 4F1OA 1FMOE 1M7NA 3NSZA 3L8XA 4AAAA 2GNGA 2VX3A 5J79A 3W33A 2XCHA 4GJ3A 1UNLA 4PTGA 2XNGA 1ZYDA 3SXRA 3MH2A 4IQ6A 3G0EA 4FKOA 4ITHA 2FSTX 4CKIA 5AX9A 4CRLA 4FR4A 5LCKA 1PMEA 3PJ3A 3SOAA 1OUYA 4KIKB 2CPKE 1TQMA 5A9UA 3KXZA 4PWNA 4CT1A 3SG8A 3QTWA 2ZV7A 4I6QA 5T68A 5TF9A 5CSPA 2E9OA 4DT9A 5GIPE 2BAJA 3BHVA 3DQXA 4Y8DA 3ZO4A 4DH5A 4GU9A 5J1VA 5HLWA 2JAMA 4NCTC 3EB0A 1YDTE 2XK7A 3GFWA 5DHJA 3UOHA 4ZLYA 3OBJA 1A48A 2ITOA 3R71A 4U81A 4BCGA 2PZYA 3R28A 4MWHA 4RFMA 4FT7A 5ETCA 3K5UA 3V51A 5EHOA 2X6EA 4Q9ZA 2YLEA 4IE9A 2C5VA 2ZB0A 3CJFA 5BNJA 2BRGA 3QX2A 2VGOA 3VUHA 4FIIA 3CKXA 4C61A 2CCHA 2JIUA 3G33A 4UWCA 3LJ0A 1R0PA 4DTAA 2WKMA 4PDOA 5EOBA 5EW3A 5EQYA 1WFCA 2YM8A 5AM6A 4E8AA 5A4CA 4EOMA 4FTQA 2VTAA 2F2UA 2YDKA 5HCZA 2IZSA 4NKAA 4V0GB 3CD3A 1I44A 2ZOQA 4ZAUA 3FHRA 4FUXA 4I20A 2OU7A 3L1SA 4FKLA 4MTAA 5LVLA 4AP7A 4CKJA 5I4NA 2WMUA 2VTHA 5M06A 4OR5A 3FEGA 2WTVA 3FXWA 3HV6A 4UY9A 1OGUA 1H0WA 2JD5A 2QHMA 3KRRA 5EI6A 4BGGA 4CTCA 1Q3WA 3BV2A 2WTKC 5I9WA 3CPBA 5ANEA 3RVGA 3BV3A 3R7VA 2UUEA 4XG3A 2C0OA 4I5MA 1SNUA 5HG9A 5M44A 3GOPA 3PPZA 2ZVAA 4I41A 4NTSA 4IM0A 3T3VA 2VTMA 3MV5A 4DH8A 2F4JA 2WMSA 5IF1A 2W4KA 4IAAA 4QMMA 3L9LA 2EUFB 4QMWA 5EM8A 5GINE 4XG8A 2CGUA 4KIQA 4FC0A 2PSQA 2IW9A 4QMPA 1W98A 3QYWA 1KSWA 4QMZA 4AU8A 4FKRA 3MBLA 4RJ3A 3PDTA 4FZ7A 3NW7A 4J97A 4PPBA 4FEWA 5CQWA 4OBPA 2XH5A 2W1FA 3ZU7A 4U80A 5JGAA 3OT8A 3NVKI 4TL0A 5CVGA 3PXRA 5FTOA 4AS0A 3ZLYA 3UC3A 2CGWA 3VS0A 4NH1A 2IG7A 5LMAA 2PVFA 5BUIA 4U79A 5A4LA 3VW6A 4FKSA 4ORKA 4DG0E 4QT1A 4EK5A 4MD9E 3UMXA 2Q0BA 3EYHA 5JK3A 2BRHA 1J3HA 3ALNA 4ZSLA 4FSRA 3TT0A 4CNHA 5AP3A 2EWAA 2O64A 2C68A 4O0WA 1MRVA 4LRKA 2R3LA 5JZJA 2NRYA 4FTJA 3EZVA 1H1QA 4BBEA 3UP7A 3QKLA 2W1EA 3BHHA 5JRQA 4R7IA 3B8QA 1IEPA 3OWPA 4I4FA 4XEYA 2B55A 3ZO1A 1NXKA 3QZIA 4YJQA 5L8KA 3OOGA 3PG3A 4FBXA 3QBNA 4FTOA 4IC8A 4N0SA 1GNGA 3IW7A 1DI8A 3IG7A 4RJ7A 4BCMA 2ZMDA 1GZNA 2WIPA 3C9WA 5AP7A 5C03A 3RHXA 1YQJA 4UX9A 5BMMA 4D2TA 3PVWA 2XJ1A 2YFXA 4GKIA 3IDCA 3V5TA 3PXFA 1NVSA 1YHWA 1OI9A 2CHLA 2W06A 2WQBA 2XA4A 4AGDA 4EEVA 2B1PA 2IVVA 3TI1A 3ZXTA 1WAKA 4U42A 4BDFA 2PUUA 4JQ7A 3PLSA 3VUIA 4AN9A 1PMNA 3HUBA 3ULIA 4HPUE 5M09A 1O6KA 3DDPA 3DFAA 1ZMWA 1B39A 4NJDA 5D7AA 5C26A 3G9LX 5LARA 4D1ZA 4E6AA 3MPTA 1NVRA 3UO6A 1EH4A 4ZTQA 4LL5A 3L9PA 1U59A 3R02A 4EZ5A 1FBNA 4UN0C 2C3JA 3DNEA 2QG5A 2CN8A 5DLSA 3TG1A 3F69A 3UO5A 1BI7A 4FKPA 2VWUA 3F5GA 4QPAA 3Q4ZA 5CEKA 4U9AA 3CJGA 4L9IA 4WG4A 4DLIA 1Q61A 1XR1A 2PTKA 3HP2A 3VHKA 5KBQA 2UZOA 1OKYA 3PPJA 4FTNA 3IS5A 1CMKE 1UWJA 2GS6A 4QP4A 3UNZA 5KHWA 2QQ7A 1OB3A 1ZY5A 3W55A 3OZ6A 1KOBA 3QF9A 2H9VA 5DRBA 3TUDA 4GUBA 3QD2B 4RC2A 5CNOA 5FM3A 3NW6A 1LPUA 2JIVA 4GK3A 3O0GA 3UQFA 2J90A 5H8EA 3KXXA 3MFSA 2CKPA 3V04A 3ZYAA 1URCA 4IM3A 3SOCA 4FKUA 5J9LA 4X3JA 3CGFA 4QYGA 3R1NA 3V6RA 2VN9A 3VS7A 3ERKA 2WMVA 3R9OA 1IR3A 2EXMA 5IQAA 1DS5A 2PZIA 4P90A 2PVJA 4PL4A 2UW6A 3EN7A 2P2HA 3FL4A 3CIKA 4DBNA 1TVOA 3RM6A 4QP6A 3IOPA 2P2IA 3FV8A 3NNVA 4FSTA 1U5QA 2HK5A 4R1VA 3RAKA 4JNWA 4L7SA 1RE8A 3P79A 2ITTA 3AXWA 3OW3A 1OPKA 1H24A 4BDGA 3QLGA 3HL7A 5A54A 4L8MA 2BKKA 2BZHB 4U7ZA 3VVHA 4H58A 2YN8A 5CEOA 5AR2A 4D9TA 4FICA 3FMLA 4FGRA 4ALWA 2PE1A 4YBKA 1XBCA 2B0QA 3Q04A 2OG8A 2XYUA 5DH3A 4C3RA 1M7QA 2Y6OA 1PXOA 2VWZA 3FPQA 3VS1A 1JLUE 4TW9A 3DAEA 5BVKA 3Q9XA 4QD6A 4J99A 4EBVA 5HEZA 2WMBA 4DEIA 5IEVA 2RFSA 2XK6A 3HV7A 1GJOA 4O7ZA 2W9FB 4U6RA 3FPMA 3BI6A 3QC9A 3CQEA 4EH7A 1YW2A 4KKEA 3BQRA 4I93A 3WF7A 4C8BA 4FKVA 4OTIA 4LM5A 4HZSA 4MXAA 4MXZA 1KE6A 4CV9A 4WG3A 4FTUA 3ITZA 3NNUA 4IACA 2PK9A 4NT4A 2OJJA 4WOVA 5HG8A 4F7SA 4EOSA 5H8BA 5CU0A 4BDAA 1S9IA 2IVUA 2C69A 5IA2A 3DZOA 4I5CA 4O91A 5DR2A 5LVPA 5AUXA 4Y46A 4R77A 4LMNA 2I1MA 3PSCA 4OTRA 5AP4A 5D11A 2E9NA 4K11A 3QFVA 4H3BA 4K77A 4KRCA 2F9GA 3BIZA 3KEXA 2HENA 4HYSA 5FLFA 4F0IA 4OTFA 4LGHA 4ZOGA 4JDJA 3MH3A 4U44A 4A9SA 3W8QA 4CQEA 4XRLA 4BHNA 2VV9A 4FSZA 4X21A 4F7JA 3CY2A 1ZXEA 3C0HA 3TV6A 4AA4A 2WNTA 5JGDA 4J71A 3R9NA 3AOXA 2UZDA 1OKWA 3DLZA 3AMAA 1FVTA 2G2FA 3LIJA 4KINA 4WKQA 3IOKA 2PU8A 4DC2A 2C0IA 2OSCA 4PTCA 3V8WA 1FVRA 1H08A 3CBLA 3MA6A 4ENXA 2XM9A 3WE8A 4A06A 4EK4A 3Q4CA 4DEEA 2H6DA 2C6EA 4D5KA 3R9DA 4OT5A 2XRWA 3E8NA 4H3QA 3E8CA 4F1MA 2HW6A 3P78A 4LOPA 5A14A 5HBHA 1BL7A 3BLHA 4AOIA 5KZ0A 4FEQA 2BR1A 4O22A 3KN5A 4TKSA 2RG6A 4XH6A 4EQMA 2PZRA 3CCNA 3LOKA 3RK7A 5EH0A 4HNFA 2F7ZE 1G8SA 2C6IA 3FY2A 4G5PA 4C33A 3HX4A 4UBAA 2B9FA 4EUUA 3ORZA 3QU0A 4RZVA 1FGKA 3FQHA 2R3OA 2GCDA 3KXMA 4DBXA 1OZ1A 4GSBA 4IDTA 3MYGA 3SRVA 3N4TA 4RA4A 2YM4A 3R8MA 3JUHA 4TN6A 4YZDA 4BCFA 2IW6A 4FGBA 1R0EA 4V04A 4F1TA 4BCOA 5C8MA 4QOXA 2Q0NA 4RIXB 1V0BA 1L3RE 5IDNA 2ITWA 3NR9A 4ANNA 5IH5A 2F7XE 2HIWA 3KY2A 4Z7GA 5A6NA 4RT7A 4A4LA 2YACA 2W1GA 3CKWA 4LL0A 3AT3A 4IVAA 4IB0A 4PQNA 3CXWA 3B8RA 4GVJA 3A4OX 3DOGA 2CMWA 3HA8A 3LCTA 4C57A 4BGQA 5EI2A 5JZNA 1XBBA 5H8GA 4IM2A 3NYOA 2X7OA 2VGPA 5M4CA 3FKOA 5GNKA 3QQKA 2JFLA 1JPAA 4MX9A 2Z2WA 3TNIA 5J9YA 1FPUA 3VBTA 3HV3A 3I5NA 3GCVA 4LOOA 4WUNA 4YPDA 2PE0A 2ITXA 3CEKA 4FMQA 2VTRA 2X0GA 4AUAA 4C4FA 4DA5A 3GC7A 1YOMA 4CVAA 5C8KA 4ZJIA 3UQGA 3RPYA 4M97A 2YA9A 1OITA 4KWPA 3N4UA 4BHZA 4PMPA 3MFRA 4FVPA 3OF0A 3Q4TA 3HMOA 4BBFA 5L6OA 4FE2A 3BU6A 3F6XA 1ZYSA 4PP9A 2IVSA 3F3VA 4YC6A 5E8WA 4MK0A 5EYDA 1RDQE 3CS9A 3Q2JA 4AOTA 3QQLA 4QMVA 3C5IA 2GNIA 4UMQA 3ZRLA 3ZLWA 3LQ8A 4XX9A 5HLNA 2EB3A 2OGVA 3G15A 5HE0A 4FSYA 4G6NA 4LRMA 5J95A 3ZM4A 4PF4A 1P4OA 2BFYA 5EM5A 2ONLC 1XH4A 3GCQA 5H9BA 2GQRA 4PPAA 2VTIA 1V1KA 3E87A 3LLAA 3OCBA 3ODYX 1YXVA 3IW4A 5HG7A 4K2RA 3O7LD 4JI9A 5ETAA 1U46A 2PY3A 5JFWA 3MWUA 3PXYA 3FXXA 5ANJA 2XCKA 3JXWA 4HOKA 4AE9A 4AZEA 2JKQA 4F0GA 1QPEA 3ACJA 3VHEA 2QOHA 3S00A 3WF5A 4CFVA 3UYTA 5CZIA 3NUAA 4JDKA 1Q41A 5JFSA 5K0XA 2YZLA 4L52A 4BZDA 2VWIA 4AZVA 1SVHA 4M12A 4YJOA 4HGEA 3IO7A 3B2WA 4GG5A 5AR8A 4LRJA 1O6LA 4GK4A 2HWPA 3EFKA 3IONA 3R1SA 4XBUA 2UVYA 4AZFA 4FVRA 4FA2A 3DJ6A 3VBXA 2BMCA 4KBAA 4QTAA 3FLZA 3VUDA 2CKEA 2XB7A 3U87A 2YCRA 2GTNA 1Q62A 3W18A 5J7BA 4QMTA 4NW6A 5BVDA 3CD8A 4PRJA 2VX1A 3PE2A 1YWVA 2AC5A 3JVRA 2DWBA 2X81A 3GVUA 4A07A 4P7EA 2CLXA 1RJBA 2R3GA 2YEXA 2Z7QA 3ET7A 4Y85A 4Y5QA 4HW7A 5L2SA 3GFEA 4Q5HA 5HNIX 4O0UA 1JWHA 3D94A 4B8MA 4QP8A 2OIDA 4CZYB 3P4KA 5EKNA 3BLRA 4JBPA 2GNLA 4CEGA 2UV2A 5IUGA 4AACA 4OBOA 3VS4A 3HECA 2JIIA 1JBPE 1OIYA 3F7ZA 5IEYA 3BCEA 3LXPA 4C2WA 5D41A 4NSTA 4OTDA 5KMJA 3C4ZA 4M69A 4WSQA 1WMKA 4A9YA 4EOJA 1Q8TA 2XK3A 2OH4A 4FV4A 5T3QA 3VBYA 4EC9A 2ZAZA 1ZARA 2EB2A 3HUCA 5EQEA 1GAGA 3NNWA 4M14A 4A9TA 3C4CA 2C6OA 4Z55A 5IU2A 4G3CA 2OJ9A 2QODA 5FD2A 3AT2A 4JJRA 5GIOE 4NK9A 3EZRA 3GENA 3NUXA 2GTMA 5AADA 3MS9A 4TYHA 5LVOA 4XV3A 1UU8A 4GYIA 4U8ZA 2R3NA 4BL1A 1WBSA 2X39A 2RFNA 4DFZE 4EH4A 3FYKX 4AA0A 2VNWA 3NW5A 3CPCA 3QL8A 5BVEA 4I94A 4E4LA 3R2YA 3MTLA 2ESMA 5DT0A 1PXJA 3FQSA 1P4FA 1Q4LA 3PJCA 3AMBA 3P9JA 4U41A 5HE1A 3DAJA 3ANQA 4MYGA 4WO5A 4BDBA 4R3CA 4BC6A 4FV0A 2BAQA 2BIKB 3OUNB 3QTQA 1Q8WA 2VNYA 5F20A 3A2CA 3R7IA 5IA4A 3ZEWA 1ZLTA 2OH0E 4WNPA 4U40A 2IZUA 3QQFA 3OT3A 3O50A 2J7TA 3ZDUA 5T6KA 3IKAA 4N57A 3WILA 1JOWB 4KIKA 2YIRA 3KVWA 4Y72A 3MY1A 2IW8A 4AN3A 2IZTA 4ZZNA 3ORTA 4O7LA 4O0TA 5HVYA 5HX8A 5FTGA 5C27A 3EHAA 1PMUA 3OCGA 4CQGA 3PWDA 3UE4A 4OLIA 5EYKA 4X2GA 4LG4A 4BIBA 1F3MC 2UW0A 2NP8A 3S3IA 1IAJA 3KRXA 4BBMA 2OIQA 2V7AA 4WG5A 5AP0A 5BQ0A 1JKSA 4C4HA 2YCFA 4RG0A 3O7LB 3DQWA 4YJRA 3PE1A 3FE3A 3E64A 3FSFA 4KD1A 4O84A 1HCKA 2QU5A 2AC3A 4RJ8A 3QUEA 4L44A 2XIYA 5HESA 4BICA 2XKCA 5IQIA 2ZV8A 1VYZA 5IA3A 3LCOA 5AR4A 1Y8GA 1TKIA 3GU8A 3A8XA 3QALE 4HVSA 3FBVA 4DEBA 2QOFA 4ZSAA 3ZRMA 4GFMA 5KMOA 4M84A 2UZLA 3MI9A 5L2TA 3SW7A 4C34A 1H1WA 1DAYA 4AGUA 4GCJA 1Q24A 4HYUA 5HLPA 5ITAA 3R04A 1ZMVA 3RBWA 3UZTA 3KULA 4X7QA 3D7ZA 4E6QA 2R3MA 5C1QB 5C8NA 2PUIA 4U0IA 2G9XA 2OICA 1UWHA 3O8TA 3PY0A 4HZRA 4KUJA 5JN2A 1JVPP 3DK3A 4XP2A 4NM3A 4YZNA 5DR6A 1KE7A 2YIWA 4UZHA 2WU7A 5HICA 2BAKA 4BB4A 4EH2A 3BU5A 1W8CA 3O51A 4WNKA 2PVMA 5IA1A 4YO4A 2LGCA 3HLLA 3LW0A 3WE4A 2W9ZB 2YM7A 2XMYA 4K18A 4TPTA 5AR5A 4EOKA 4ZS4A 2VWXA 4B99A 2P4IA 3FMHA 4R7BA 3QWJA 5CXZA 1PF8A 2QOCA 4IADA 2BKZA 2W5AA 3LCKA 2HELA 4EI4A 4QO9A 3R30A 4FTTA 3H30A 2ETMA 3AC1A 1YXTA 4YO6A 1ZYCA 3S4QA 3H10A 4OTWA 4XJ0A 2YIQA 4DEDA 4EH8A 4BCPA 4EH6A 1CM8A 1PXPA 4K6ZA 3ULZA 2WTKB 4NEUA 4E93A 4L68A 3UNJA 5M57A 2QOIA 4OW8A 4M69B 1FINA 3QQJA 3VUKA 4FIEA 1YOJA 3GT8A 4TYEA 3SVVA 5L6WL 1IRKA 1FOTA 2R3JA 4FNWA 1M17A 4UV0A 2VTQA 3QQUA 3HYHA 1O6YA 2ZV2A 5CT0A 2Y4PA 4NZWB 4C37A 3DDQA 3P1AA 5CSXA 1W83A 2WMWA 3DAKA 1OBDA 4MKCA 1LEWA 3KRWA 4TYJA 1VR2A 1CKIA 4FG8A 2ITPA 1XHAA 2WIHA 2UZNA 3EQIA 5AFVA 4UXLA 2XNEA 3NCZA 3V01A 3ORXA 4H1JA 4MF1A 4BGHA 3PA4A 4XLIA 3H3CA 3FMMA 5H2UA 3QRTA 4AF3A 2OF4A 5J87A 3IGGA 3E93A 2JFMA 4RZWA 2BFXA 4AGWA 4FEXA 4XG6A 3ZFMA 3DFCB 4FOCA 5AMNA 2YIYA 3R9HA 2EVAA 5E8VA 3ZC5A 5KMNA 2BCJA 4YHTA 5AA8A 5IISA 4F9WA 3ORMA 4D55A 3FWQA 4X3FC 3UO4A 1MUOA 2XEZA 4I21A 2BZIB 2NO3A 5KE0A 2RFEA 5CU3A 2C6LA 4MHAA 5LQFA 4LOQA 3TDVA 1SNXA 2J0IA 2ITYA 3MVHA 2G2HA 2GS7A 1H4LA 3OTUA 4IVCA 3SDJA 5JT2A 4USFA 3FL5A 3NWWA 1OUKA 3DJ5A 4K1BA 4BDJA 4C58A 4MEDA 4PDSA 2W1IA 4KS7A 5HORA 5EOLA 2XJ0A 5ANGA 5EHLA 1BUHA 4K9YA 5BVFA 4ZMEA 3JPVA 2VO7A 4DHFA 2VTPA 2P0CA 1MP8A 4AT4A 3VF9A 4D2RA 3OEZA 5AAGA 4XP0A 3QCSA 1WBTA 4ERKA 5J9ZA 3BGQA 4JAJA 5AV4A 3KMWA 3PFQA 3UVQA 2OXYA 3EKNA 2C6TA 1W0XC 2WMQA 3EQFA 2A27A 3K3JA 3F2RA 1QPCA 2NNWB 5ANDA 3WIGA 3QC4A 5BYYA 5LXMA 3HMIA 3AMYA 3LHJA 3VUGA 4JBOA 2OXXA 3GU4A 4I6HA 2WHBA 2XBAA 3QQGA 4EZ7A 5CAVA 3KULB 3R7GA 4NFMA 5AEPA 1DM2A 2WZJA 4JQEA 4L53A 1H1RA 1YI3A 4EH9A 3ZLXA 3ZO2A 3BQCA 2CDZA 3GU5A 4MQ2A 3PVBA 4X2KA 5M55A 3MH0A 3DBDA 4FSQA 2QO2A 3WZKA 5JQ8A 2CNQA 4GYGA 3NUUA 3GC0A 4U3YA 3FLSA 3Q52A 3MIAA 4DGNA 3FMEA 2WELA 5HIBA 2PVLA 4FKJA 5IA0A 5TKDA 4A7CA 4RC4A 5AUZA 4NYEA 2B9JA 4U97A 3KKVA 2FUMA 5FP6A 4A4XA 3AG9A 1OKZA 2O63A 3LJ1A 4G9CA 4YGAA 3VS6A 2R0IA 3DBCA 4D0WA 5KZIA 4EONA 1J7IA 4ACDA 4UMRA 4E4XA 5IH4A 4R5SA 3RWPA 3F3UA 3EOCA 3MDYA 2DQ7X 3HMMA 4DGOA 3LXNA 2WB8A 1NA7A 5KKRC 2GSFA 1PYEA 1MRYA 2XRUA 5AX3A 4JX7A 4KS8A 4ANOA 2YDIA 4YC3A 1AGWA 3H9RA 4G2FA 5AIRA 4ASZA 4O7TA 2PYWA 2GFCA 2QC6A 3PJ8A 2G15A 5FBOA 3SGCA 3D7TB 4O81A 2PMOX 4EORA 2ETKA 2YM6A 3KXNA 4IWDA 4PX6A 5EYCA 4O83A 3NMUF 5AUYA 4FTIA 3TKIA 5LJJA 3QXPA 4JBQA 4PNKA 5I3OA 1J7LA 3OXTA 2QOLA 2Y7JA 2C6DA 1G3NA 4GIHA 4Z9LA 4ZK5A 4BIEA 4CFUA 3VO3A 1E9HA 3SXSA 2J51A 3TNQB 4YJSA 4EQCA 2J5FA 1QPDA 4IXPA 3D2IA 2JDOA 3WZJA 4YTFA 3V5LA 3A61A 4WRGA 3RK9A 4BDDA 4DAWA 2I0YA 4F0FA 2ZDTA 2GHLA 5AUUA 2XNMA 4QQCA 4J1RA 4WNMA 2IZRA 3NUNA 1RQQA 4O96A 4O1OA 4ZJJA 2HWOA 1ZRZA 1M52A 5HHWA 3U8WA 3PZEA 3EFLA 4DCEA 4FOBA 3Q9WA 1CSNA 2GNHA 2OW3A 3CTQA 3DXNA 4F7NA 3FC1X 4RX9A 3BEGA 5J7HA 5E8SA 4FKIA 5C4LA 4FKGA 3QZFA 4PL3A 4CMOA 3BYMA 2W5BA 3TKUA 4L3JA 3E8DA 2Z02A 1REJA 2BDJA 3N4VA 4FIHA 3P23A 2ERKA 2WQNA 4C4EA 1H01A 5L4QA 2B9IA 5FWKK 2H96A 5E8XA 2YM5A 3EN6A 4LQMA 2QO7A 4BTFA 2A2AA 3II5A 5TT7A 2FO0A 3RM7A 4LI5A 1OMWA 1YHSA 4RVLA 3Q53A 5EW8A 5HNGA 4R78A 3LM0A 3RAIA 2BILB 4XG2A 3V5PA 4EYMA 5CSVA 3RPRA 4FG7A 2J2IB 4CRSA 4AFEA 1AD5A 3RAWA 3I0QA 3SC1A 4H36A 4QTBA 2BIYA 3QZHA 3VC4A 3HAMA 3F3TA 4I0TA 5EM7A 3JY0A 4YURA 3EQDA 3PY3A 3NS9A 4X2NA 1UKIA 4WIHA 5DVRA 4FUYA 3I81A 2QCSA 2VWBA 4YLJA 5FEDA 2FSOX 5JRSA 4LMUA 3POZA 5DGZA 2YJSA 2RIOA 1R39A 3GCPA 1OL1A 5IQHA 1PW2A 4EJNA 4IEBA 4NU1A 5CF4A 2FSLX 2GHGA 5B7VA 2Z7RA 4IAFA 4TXCA 3OMVA 3RGFA 2C1AA 3LKMA 5KBRA 3TEIA 4PV0A 1LR4A 2VWVA 4J96A 2PMLX 2OJFE 2PVNA 2REIA 4QQJA 4CFWA 4I22A 4JIAA 2BRNA 2KTYA 4M13A 4C35A 2R9SA 4OAUC 3G9NA 4GRBA 5LMKC 2OZAA 3K3IA 3LLTA 4RQKA 2X1NA 3GCUA 3KC3A 4V05A 1ZYJA 4IX4A 4J52A 3UP2A 2PHKA 3BKBA 3JVSA 3BHYA 3MN3A 3AT4A 2UZTA 4PMMA 5F1ZA 5EI8A 3VJOA 2Y8OA 3F82A 1WBWA 4EJ7A 4FTRA 5DT4A 2BRMA 3F3WA 2G01A 3RAHA 2WQOA 4WUAA 3ZDIA 5IUHA 3G90X 3NIZA 3QGWA 4E1ZA 2CLQA 2HZNA 4ITJA 1FVVA 2R7BA 4EH3A 2AUHA 4U5JA 3L9MA 5FXSA 5DRDA 2PVKA 2UW3A 3DXQA 2VWWA 5F94A 3R8PA 5J5TA 4RIXA 4E5BA 3PIZA 3QLFA 2J50A 5HO8A 3I79A 5KMIA 3KCKA 2HCKA 4DF3A 4RBLA 2C5NA 1NW1A 3DBQA 2A19B 1Q5KA 2SRCA 5AM7A 4USEA 2P33A 4IAKA 4JLCA 3G5DA 3HMNA 4RSSA 4DFNA 4HVHA 4M8TA 1OIRA 2X9EA 4X0MA 5CU6A 4C3FA 2B9HA 3IW5A 3GQLA 5HBJA 3KXHA 5LMBA 5ANKA 4D4VA 3F2NA 3COMA 3CLYA 2QD9A 2PVRA 3QD0A 4O6LA 4E6DA 4D4YA 3SKCA 5FXRA 1WVXA 4BCJA 4L67A 3AC4A 3FSKA 1JSUA 3GQIA 2JKKA 2I0VA 2VUWA 2XKEA 4ANQA 2ZB1A 4IB1A 4OAVB 2JC6A 4JXFA 4XOYA 3BBWA 4WD5A 2WTDA 4TWOA 5DMZA 3LMIA 2J0JA 2O3PA 4ID7A 5LVMA 4NTTA 3HDNA 3KF7A 3QAME 5EK7A 4D9UA 3I7CA 4EC8A 3EQPA 2YABA 3QTUA 5HOAA 4BI1A 4FIGA 4O6EA 4M7IA 1T45A 5JMSA 2BUJA 4FV1A 4FSMA 2ZM1A 2OI4X 2JLDA 1O9UA 2W17A 4QYEA 3O2MA 3PRFA 4D4SA 3CSVA 3ROYA 3BX5A 5HNBA 2YITA 4FL2A 2NRUA 3HDMA 4QPMA 4CXAA 1JAMA 5KUPA 4YLLA 4DTKA 3LM5A 1TQPA 2R3PA 5BYZA 4O0SA 4X6RA 3O23A 4HJOA 4W8EA 2XNOA 3C4XA 2FH9A 5CNNA 3SQQA 2PL0A 4JQ8A 3CP9A 3DGKA 2PVHA 4TWPA 4ASXA 4DFBA 2XZSA 5CT7A 2ACXA 4UYAA 2J4ZA 2VD5A 2O65A 5HBEA 4MXCA 5HCXA 5HZNA 2JEDA 5EYMA 2PULA 4O7VA 1V0PA 3L8SA 4O21A 5CF5A 3ENHA 3LCSA 4QPSA 1L8TA 1T46A 4I1ZA 1YWRA 3S0OA 1K2PA 4P4CA 5AA9A 1TQIA 3Q60A 4FZFB 4YJTA 4ZTNA 3ZCLA 4DH3A 3LZBA 4HVGA 5IH6A 2P3GX 1KE9A 2O5KA 4EYJA 3QTSA 4LV5A 2C6KA 4O38A 5FTQA 1IASA 2OZAB 2JDVA 4APCA 4EL9A 4QP2A 4CFXA 5J5SA 4DE4A 5JFVA 1LUFA 4AW0A 3Q4UA 3MJ2A 3AGLA 4I5HA 4ZJVA 4JL9A 5EHYA 4WHZA 4IDVA 1I09A 2O0UA 4NJ3A 3D15A 2R64A 3CGOA 1J1CA 4RX8A 2C0TA 3C1XA 5E90A 3OWKA 4UWBA 5L2IA 5AV0A 1PXMA 3A7FA 3EMGA 2V22A 4XYFA 5JGBA 1KOAA 4PMTA 4PY1A 5CVHA 3EFJA 4TYIA 3LJ2A 3OVVA 3QGYA 2ERZE 5AV3A 2UZWE 4G3DA 4HGTA 3R7EA 1UKHA 3ALOA 4QNYA 4RC3A 3EN4A 2IVTA 1OL2A 3NAXA 1OBGA 1GIIA 4OBQA 4UZDA 4C4GA 3TL8A 3KMUA 3W32A 3SLSA 1WZYA 3R63A 3F66A 2CCIA 3I60A 3MA3A 2WOTA 2RKUA 3I6UA 3MPMA 3QQHA 4MWIA 5DEYA 1UU9A 1YXSA 2W96B 3D5XA 3RWQA 3ZONA 4H39A 3I0OA 4HCVA 3NNXA 3P0MA 2IWIA 4IFCA 3CC6A 5AP5A 4O7YA 4ACCA 4EHGA 3ANRA 3ZRKA 4KIOA 4D5HA 4EH5A 4MQ1A 2QI8A 2RSVA 3QXOA 5E8YA 2E2BA 3ZS5A 4B7TA 5KNJA 3A62A 3TKHA 4GFGA 1YDSE 2V0DA 3SG9A 2XIXA 3G0FA 2H8HA 3HP5A 1BLXA 3G51A 3IPHA 1H0VA 3QZGA 4RWKA 1IAHA 4I6BA 4CTBA 2X4ZA 3RMFA 3PP1A 3R22A 2UW9A 4DEAA 3KB7A 4E5AX 1M2QA 3TZMA 4ZY5A 3G6GA 3LMHA 5C9CA 4YZMA 2QVSE 5CEIA 3PSBA 4DN5A 4BCHA 3MY0A 4CKRA 3ORNA 3S2PA 4I24A 3KU2A 4YJPA 3DKCA 4EOIA 5ETIA 2OLCA 4G9RA 4Y73A 3Q3BA 3DNDA 4R8QA 3R7YA 5FUTA 4DGGA 4GL9A 5CASA 1QMZA 2YHVA 4RVKA 2W1CA 4YR8A 3QUDA 3NYNA 2X2LA 4QP1A 3HRBA 4R3PA 4M0ZA 3ODZX 4QTDA 2GU8A 5CALA 4FG9A 1XH8A 4O7NA 3D2KA 3AD4A 4G3FA 4ZXTA 4GVAA 4R1YA 5HO6A 3GC9A 2UZEA 4GV1A 3UG2A 4HNIA 1SMHA 5ETFA 4ZSJA 4K33A 2WAJA 3RCDA 4ANBA 5DYJA 4ZTSA 4CV8A 4JS8A 2XIKA 4XV1A 1XH9A 4CMTA 3IDBA 2ITVA 5I9XA 4G5JA 3TUBA 3FDNA 2PMIA 3OP5A 4JT3A 5HE3A 3BWJA 5AR3A 3P7BA 3TM0A 2G1TA 2ZV9A 4YC8A 2XKFA 3M1SA 3M2WA 4WBOA 5IUIA 3H4JA 5LCJA 4X3FA 4AOJA 3OROA 3F7WA 5F9EA 4P2KA 2OFUA 4HCUA 3P08A 3VS5A 4F9AA 5AUTA 4YSJA 4RWIA 4FL3A 3MB6A 4JG6A 1F0QA 2UW8A 3FLYA 3VNTA 4QRCA 3I4BA 4FNZA 4IWQA 3EFWA 2BVAA 1YXXA 3F88A 4NCTA 3V3VA 3OY3A 1WVYA 4A4OA 1ZOGA 3OG7A 3BZ3A 1J1BA 2HXQA 2W0JA 3WYYA 2PZ5A 3FZSA 3BGPA 4CLIA 3ZSGA 3P7AA 4X6QC 2XS0A 3BWFA 4DGLC 4M67A 3ZEPA 3W2PA 1WCCA 2QHNA 1SYKA 4O7WA 1Z5MA 4KRDA 4J95A 4CFNA 4YMJA 4MBIA 2C4GA 3HA6A 1FQ1B 2XIRA 3UC4A 5HE2A 3QKMA 3OXIA 3U6JA 3GB2A 4IMYA 3DLSA 5HI2A 4PTEA 3FLWA 1YDRE 1YHVA 3DBEA 3DTCA 4J8MA 4C38A 3QD4A 3TZ9A 3E7VA 3PXQA 4C0TA 3SXFA 4MD8E 4W4XA 4MXXA 3D9VA 5EQPA 3V5WA 3MTFA 1IA9A 4I6FA 4NM7A 3TDWA 4DT8A 2WGJA 3W2RA 3M11A 2BTRA 1PKGA 4FTAA 2XJ2A 4KAOA 2RG5A 4AW5A 2BALA 4L45A 5D9HA 1BMKA 4APPA 3UMWA 2W4OA 4ZSGA 4XG9A 5M07A 4L00A 3U4UA 5LOHA 5HQ0A 5I3RA 3UGCA 4AW2A 4CCUA 2UZBA 1R1WA 2X6DA 3U4WA 4DINA 3UIBA 5CWZA 4UMPA 5CLPA 4CG9A 3RZBA 3GUBA 1VYWA 4KIPA 4DTBA 5CEQA 4PDYA 3PY1A 5FG8A 4DYMA 1CDKA 3DKFA 4GIIA 4XOZA 5GJDA 1SZMA 3QTRA 4IBMA 4RJ4A 3UJGA 3VUMA 2Y4IC 4B6LA 2ITNA 4J8NA 3I7BA 3G2FA 4JG8A 1Y6AA 3POOA 3CQUA 3NLBA 4GFOA 4XLVA 3PRIA 4MXOA 1E1XA 1XWSA 1UU3A 1IG1A 2G2IA 1OIUA 3KF4A 4FNYA 4JR3A 4NM5A 3ZO3A 2GFSA 4IFGA 2F57A 4JBVA 1ZZ2A 4LGDA 5CVFA 2YCSA 3R0TA 5JFXA 4O7RA 1H26A 5IG1A 5CZHA 4FT3A 2F49A 4EKKA 3QA0A 3ETAA 5BPYA 1WBVA 1H1SA 3NX8A 3UYSA 5KMKA 3R21A 3QUPA 1JKTA 1JQHA 4FI1A 5EDQA 4FL1A 3KA0A 2OJGA 4ANMA 4ZEGA 4F65A 3WZEA 2OJIA 5M51A 1KE8A 3ORIA 3ELJA 3MH1A 5GJGA 3OFMA 4IZ5A 2HZIA 4WNOA 4F08A 2VO6A 1BKXA 5EM6A 3CY3A 1OKVA 2EXEA 4MH7A 4X3FB 5G1XA 4G3EA 5B0XA 3E3PA 3FZTA 3DS6A 5FXQA 5HTIA 2A0CX 5CY3A 5A3XA 3BBTB 1XQZA 4BDIA 3RCJA 4DFXE 3V8SA 2WTIA 4DLJA 4ZTMA 1GY3A 4BTMA 3RTPA 5BUEA 3TUCA 2V55A 4O86A 2WEIA 4BCQA 4BF2A 4FIJA 4A9UA 3K54A 3ORLA 4HVDA 4G6OA 3AGMA 3DU8A 3CTJA 5L2WA 3OCSA 3NYXA 2HXLA 3FMDA 3VRYA 4AZSA 1JSVA 2XP2A 1SM2A 3DPKA 4FSNA 2C5OA 2OIBA 4F7LA 3OC1A 4ZZOA 4EUTA 5I9YA 4FSWA 3TCPA 2JKOA 4R7HA 1YXUA 4W4WA 5BVWA 3GI3A 4R5YA 3VW8A 4E4NA 5M4IA 1YI4A 1GIJA 3ZLSA 4RX5A 4ZLZA 3AQVA 1KUTA 5HVKA 2PUPA 1YVJA 1E1VA 1URWA 3PA5A 1ATPE 3Q96A 3FI3A 2WMXA 2VAGA 3LAUA 4RIYB 1M14A 2Z60A 4M3QA 4N6ZA 5ANOA 5HVJA 5A4QA 5IQGA 2RF9A 2JDTA 2QO9A 4F6UA 2FGIA 2ZYBA 4FYNA 5FEEA 5AAEA 2HZ4A 4M68A 4JOAA 3UZPA 2C1BA 3E92A 3V6SA 4L3LA 4I0RA 4AG8A 5CF6A 4C02A 5EDRA 1J7UA 2XKDA 2I7QA 5E7RA 5KO1A 4AGCA 4FNXA 4ACHA 5JKGA 4BCNA 3REPA 2DYLA 4TY1A 2XIZA 3NUPA 4RGJA 4IB3A 3L8PA 3UIXA 3C4EA 1G8AA 2QNJA 1UU7A 2WEVA 4ANLA 3E7OA 5AJQA 2X7FA 1ZMUA 2CGVA 2I0EA
chains in the Genus database with same CATH superfamily
3D83A 1JKLA 3W1FA 3FKLA 3TZ8A 3QKKA 4CLJA 2VTJA 1P14A 2E9VA 3UPXA 3FLQA 2X8EA 3KQ7A 2BZJA 3D7TA 3D5VA 3FLNC 4BVUA 3OWLA 4QMNA 4BKZA 4F6WA 5KKRB 4ANSA 2HY0A 2R2PA 2WFYA 5DE2A 3AC5A 3NYVA 1XH7A 4WBBB 5HU9A 3FZOA 5L6PA 3BLAA 2C3KA 2O2UA 3KK9A 4QYFA 3HZTA 4BTJA 3OBGA 4MAOA 4IAIA 3VULA 4ZIMA 3EQBA 4IZAA 4I92A 5HCYA 4W8DA 2X2MA 1Q8UA 4O0YA 3RP9A 4EWQA 2IJMA 3ZXZA 5IPJA 3DBFA 3MB7A 4RVMA 3ZOSA 2R3QA 1A06A 3QHWA 5E91A 4EHZA 3LPBA 1PY5A 4DG3E 1F5QA 1PXIA 2C30A 3BELA 1OL6A 4GW8A 5D7VA 4EZ3A 1YWNA 5IQCA 3JY9A 4EOPA 4F64A 2DS1A 3LXLA 4O4CA 4UALA 3BL9A 5HD4A 3HMPA 3UQCA 2YAAA 4YTCA 5HTBA 3AC3A 1LP4A 2J9MA 1ZZLA 2W7XA 4YHFA 3QD3A 4WT6A 4XG4A 2J6MA 3LFSA 1YKRA 4IX3A 3R8ZA 1HOWA 4A9RA 4YSMA 4TRLA 3BE9A 4Y5HA 2R0UA 2RL5A 3FZPA 3PP0A 4FZDB 1H25A 5EG3A 5IDPA 5HIEA 1CKPA 3LE6A 3U54A 4W9WA 3EL8A 3RI1A 4IHPA 1BL6A 3ZFYA 2VZ6A 4ARKA 2A4LA 3IK3A 4Z3VA 4ZSEA 4ZP5A 3RKBA 4FKTA 4AX8A 2GQSA 3EQCA 4F78A 4IZ7A 5IA5A 3QX4A 3SD0A 5CEPA 5CI7A 4NWMA 1WBNA 3DCVA 5L2QA 1Q8YA 2XBJA 3BU3A 4FODA 4RWJA 2WOUA 4IJ9A 4J7BA 3PUPA 3E8EA 3M42A 4U45A 1XO2B 5D1JA 5DWRA 5BUJA 4L01A 3MVJA 4EOLA 3FI8A 4FYOA 2CNVA 2EU9A 4L46A 3IW6A 1MQ4A 3OOMA 2HZ0A 1W7HA 2XNBA 3VS2A 4OTHA 4EOOA 3EWHA 4UXQA 5E8ZA 3W2CA 4C7TA 3ID6C 2UW7A 4NM0A 3FAAA 2JKMA 3OXZA 4LDTA 4NIFA 4JIKA 5DBXA 3R8UA 4DFYA 2C47A 2B52A 3MIYA 1W2DA 1ZOEA 5DOSA 2I6LA 3DY7A 2UZVA 2YWVA 3EQGA 5IZFA 3DKOA 4FK6A 4BYJA 1ST4A 5IKWA 5A4TA 4OTQA 4I5PA 3RNIA 5K4JA 3TTIA 3EJ1A 4GK2A 2NPQA 4D1SA 3IDPA 2GNJA 4KBKA 2CSNA 5AIKA 4GS6A 1Y6BA 4FEVA 3CE3A 3BHTA 1JSTA 1Z57A 2VTNA 3N9XA 3TWJA 3FKNA 5HG5A 3OS3A 1U4DA 3LFAA 3D5WA 3SV0A 4ACMA 4ALVA 4GT4A 4TNDA 5IQDA 2VTSA 4YHJA 3WBLA 4DH7A 2X8IA 4JRNA 5E4HA 4D2WA 2W1HA 2YWPA 3ZZEA 5CQUA 2GPHA 4AE6A 4N6YA 4ZS0A 3EL7A 2KULA 4G31A 3FHIA 2WTJA 4CZUA 3Q32A 4O2ZA 1NY3A 4RIOA 2R5TA 4ZLOA 4FT0A 4IC7A 4F9CA 3TZ7A 4CCBA 1SVGA 5LVNA 3TNHA 2ZFYA 5ACBC 2ZJWA 3Q6WA 4FVQA 3SW4A 4L6QA 1B6CB 1S9JA 4FTMA 4KB8A 3D5UA 2OK1A 1GZKA 4XMOA 1SVEA 4YLKA 4BR3A 3KRLA 2EXCX 4DCAA 3NDMA 5FEQA 4N4SA 3NRMA 4OT6A 3VS3A 4C36A 4MNEA 3KFAA 1VZOA 4EQUA 4GH2A 1H28A 2B53A 3MVMA 4ONAA 5CI6A 3MGYA 4UMTA 2R4BA 2P55A 5DG5A 3SHEA 2QG7A 4FV8A 4JAIA 2QOBA 2WQMA 5BX0A 3ATSA 4FF8A 3A99A 4N70A 1PMVA 4GMYA 3U9NA 2A1AB 4MCVA 1HCLA 4FIFA 5E92A 3C0IA 3FMNA 4DITA 3F3ZA 3PPKA 1Y91A 3PVUA 1IA8A 4XHKB 4CGAA 3PIXA 3UDBA 3FZ1A 3ZZWA 3WIKA 4IX6A 4BFMA 4BCKA 2PPQA 2PUNA 4H3PA 4IAYA 2X2KA 5CU4A 5HGIA 3IGOA 4FKWA 4YTIA 4B4LA 3UOJA 3MESA 4LUDA 3PG1A 2BZKB 3ZUUA 1REKA 4PL5A 4O1PA 3ZBFA 3TJCA 4FT9A 3PYYA 3HGKA 2HW7A 1B38A 4ITIA 5FQDC 3KMMA 2E9UA 3VAPA 5KCVA 3MPAA 3KL8A 5CSWA 3KCFA 4GEOA 3A7GA 3I5ZA 2YDJA 3PZHA 2PZPA 2UW5A 4PDPA 4X2JA 5J8IA 1A9UA 3ZTXA 3U55A 5I0BA 5CF8A 5E1EA 4MBLA 4K0YA 4C4JA 5CS6A 3VWAA 4EBWA 5HO7A 2GNFA 5FRIA 4BWXA 3QCYA 2VO0A 4WSYA 5EFQA 3E5AA 4WRSA 4D2SA 2PWLA 1XMLA 4JDIA 2XK4A 3C50A 1OECA 5K5XA 1YRPA 3KRJA 5G6VA 2V7OA 3FXZA 4XV2A 4CSVA 3R9RA 2X9FA 2BHEA 4FT5A 4BRXA 3JS2A 4NIFB 4E5WA 3OHTA 4G17A 4ZTRA 3TNWA 3AC2A 3VIDA 4DGMA 4XUFA 5LWMA 2HOGA 4NW5A 4BDHA 2ONLA 4BTKA 4CD0A 4CYIA 5B2LA 2IN6A 1V0OA 1P5EA 2XNNA 5GJFA 3UODA 3JR1A 3W0MA 4ENYA 5I5ZA 4P5ZA 3NUYA 4UMUA 2J0KA 2I40A 4YUQA 3QRIA 1M2RA 5DN3A 3C4FA 4X2FA 5AV2A 4AQCA 1STCE 1GOLA 3OD6X 3K5VA 3F5PA 4G34A 4USDA 1UA2A 4E6CA 2ZDUA 2R3IA 3MFTA 3GEQA 4PMSA 4RQVA 3PJ2A 3RPVA 2QLQA 3NGAA 3O8PA 3R7UA 5CAPA 1PXNA 2JAVA 5B2MA 4EK6A 1G5SA 3NCGA 5HTCA 4YP8A 5M4UA 4UWYA 4CFFA 3W2OA 4YNEA 2X8DA 2XM8A 3PXZA 4YZBA 5ICPA 3PSDA 4MF0A 2Z8CA 3HRCA 3V5QA 3FUPA 3PJ1A 4ASDA 4O0XA 4FK3A 3DZQA 5AP6A 5HU3A 3L9NA 5GZ8A 1BYGA 3Q9ZA 4HCTA 4EK8A 4KNBA 3RZFA 4E4MA 4GKHA 4IIRA 5K9IA 4DH1A 4W4YA 4D2PA 2YERA 1YI6A 3EN5A 2XF0A 4U43A 1KV2A 3QRUA 4JG7A 5BMSA 2RGPA 4MNEB 4Y95A 4XBRA 2WO6A 4RPVA 3TTJA 3O96A 5E9EA 1R78A 2ITZA 2YCQA 2QOKA 3O17A 2OKRA 3Q9YA 2CGXA 1OM1A 2XEYA 3DJ7A 3UZRA 4O2PA 4KBCA 4XP3A 3PWYA 5B2KA 4Z16A 4QQTA 3H0ZA 3BYVA 2UW4A 3KREA 2IO6A 5E8TA 3A60A 4KKGA 3UG1A 4P5QA 5GZAA 3R8LA 3GGFA 4F9YA 2R3FA 3PXKA 2ZM3A 4DEGA 2WPAA 4KSPA 4C2VA 3LCDA 2GQGA 2XAOA 3V5JA 4ALUA 4YNOA 3LQ3A 4IZYA 2H34A 3DK7A 4TT7A 4FSUA 4XNEA 1UVRA 3QYZA 3C4WA 5H3QA 2Z7LA 5DFPA 3HEGA 3R01A 1YOLA 5FDXA 4YTHA 2OXDA 4IH8A 1LEZA 3Q5ZA 2PMNX 4LFIA 2Y0AA 3TNPC 4BWPA 2PVYA 4E3CA 3LFEA 5E1SA 5M08A 4YZCA 3PVGA 4F6SA 2WMTA 2YJRA 2WMRA 2YIXA 4H1MA 2UVXA 4J98A 2GHMA 3VONA 3UIMA 4I0SA 4O0RA 1XBAA 4HGSA 5TO8A 2Y6MA 4F09A 1H07A 3PIYA 3P5KA 2R7IA 4RLLA 3NZ0A 2BTSA 3BLQA 3COHA 1DAWA 2WXVA 3A7HA 3GXLA 4G16A 2VX0A 3UDTA 1UV5A 1BX6A 4UB7A 4E26A 4TNBA 4JR7A 1XH5A 4RFYA 1PXKA 1M2PA 5M4FA 5M56A 3H9FA 1OL7A 2F7EE 3QCQA 3C7QA 4OTGA 3EN9A 2X7GA 1ERKA 4RMZA 4AZWA 3HNGA 3R7EA 2C3LA 3V8TA 4RIWA 4F70A 4QMXA 2AYPA 3R00A 3R73A 3PA3A 4JRVA 4ZTHA 4IWOA 4QMUA 3VN9A 1DI9A 4D0XA 5AWMA 1WBPA 4WA9A 4R3RA 5DEWA 1UNHA 5CYIA 3F5XA 4G3GA 5IQBA 2XUUA 4Q9SA 1K3AA 4Z7HA 3CR0A 4AT5A 4CG8A 3FY0A 4IX5A 3QRKA 3W10A 2FB8A 1Z9XA 2FVDA 3BHUA 3WARA 5FDPA 4H05A 3QA8A 4C59A 3QRJA 3ROCA 5TE0A 2OFVA 2OBJA 3CTHA 3ZFXA 4OGRA 1ZOHA 2BPMA 1APME 3LXKA 4W4VA 3DV3A 3ZHPC 4R6VA 4M0YA 2E9PA 4HGLA 4U3ZA 3WZUA 5AUWA 1XH6A 4RRVA 2JITA 4BZOA 4AA5A 4DG2E 3DK6A 3RALA 2W99B 3TV7A 4QMQA 3F61A 4OTPA 3BYUA 2BHHA 1PYXA 4GU6A 3ZMMA 4MNFA 2C5YA 5I9VA 5JEBA 3FQEA 4L43A 3ZC6A 2B54A 4S32A 3LFQA 4HPTE 3LFCA 3WOWA 3FI4A 3GU7A 3KN6A 4Q5EA 2JBPA 5EDPA 1RW8A 2C3IB 4FV5A 5AP1A 3VF8A 4BYIA 3QTZA 5C01A 4C3PA 3NPCA 4EOQA 4ZTLA 3GP0A 2CJMA 3FMJA 3EQHA 1XKKA 4V01A 4AWIA 3UVPA 4ZMFA 3P7CA 2XYNA 3DB6A 5F4NA 5FM2A 3T9TA 3ZM9A 5C4KA 2XK9A 4IAZA 3OUKA 2JGZA 2PE2A 3C13A 1U54A 4QTEA 3E88A 2R3HA 1K9AA 4XCUA 3FC2A 3ATTA 2J0LA 3BE2A 2ZM4A 3HVCA 3R1YA 4Q2AA 5F95A 4ZY6A 2ETRA 1P2AA 5AAFA 5L8JA 3W16A 2W4JA 4NUSA 2IPXA 1QPJA 4D1XA 4FV7A 4QDVA 2FA2A 2WTWA 4UEUA 5M53A 4AAYA 2WD1A 3TIZA 5DI1A 5CTPA 3A7IA 2JBOA 4FEUA 3IW8A 4D28A 4EHVA 4AN2A 5EKOA 3QTXA 2ITUA 4QP9A 4DFUA 4C4IA 3MFUA 1KE5A 5HD7A 1CKJA 3TJDA 3AC8A 3EIDA 3NAYA 3KK8A 5CU2A 3UPZA 4NL0A 4AFJA 4CYJA 3R2BA 1Q8ZA 2Y4IB 2B4SB 3PTGA 4B9DA 5KX8A 5ANIA 3S95A 4IJPA 4I3ZA 4RFZA 4YZ9A 2VO3A 5KHXA 3MSSA 4D2VA 5HKMA 1OL5A 3TACA 4KKHA 1ND4A 4BDKA 2XNPA 3BYOA 3W8LA 3IECA 4BZNA 4FV6A 4GJ2A 3C51A 5AR7A 4II5A 3GOKA 5CSHA 3GU6A 3MJ1A 2QKWB 2C5XA 4CZTA 4CT2A 4JVGA 3WZDA 2V62A 2XVDA 4J53A 3TIYA 3RPSA 4LV8A 3PLAE 4FTLA 4XS2A 3D14A 3GNIB 4BI2A 4TTHB 4L42A 3OCTA 4RA5A 1WBOA 4S31A 3I6WA 2VTTA 3UNKA 4TZRA 3VBVA 3COKA 4RWLA 1OIQA 4HYHA 1PXLA 4S33A 4AXAA 3U51A 3CQWA 3WF8A 4XRJA 2R3KA 3FI2A 4RIWB 4CMUA 3NVMB 3RPOA 2DUVA 4GG7A 3S1HA 2CKQA 2WQEA 4QMSA 3Q6UA 4I4EA 2GMXA 3RNYA 4EWHA 2I0HA 3F2AA 5CENA 3H0YA 2B7AA 4RX7A 3ZUTA 3HKOA 3P86A 2QU6A 1G8JA 4FKQA 3ACKA 2LAVA 4BKJA 3SX9A 3FYJX 1CTPE 2W5HA 3HAVA 3A4PA 1H00A 4F99A 4RIYA 2OF2A 3FMKA 3E63A 3BYSA 3T9IA 4BWKA 5BVNA 3COIA 4JX3A 3B2TA 3PUFC 4ZZMA 3LVPA 3WI6A 4L3PA 4IB5A 4AW1A 5CAUA 4EKLA 2OWBA 4D58A 3LFFA 2QR7A 3JYAA 2WU6A 3DT1A 3ZSHA 4YU2A 1OPJA 4BI0A 3BEAA 4MBJA 3MVLA 2J0MB 5IEXA 2CKOA 3LFNA 5CAQA 2FSMX 2QOOA 5FBNC 5TR6A 3SRVB 1PKDA 4BY9E 1JNKA 4L7FA 4O0VA 3LFDA 1H8FA 5FGKA 3E62A 1ZY4A 2WTCA 2HY81 5BYLA 4YJUA 3HRFA 1U54B 3VBQA 2YM3A 2O8YA 3FZRA 3Q2MA 4S2ZA 2CNUA 5CX9A 4BCIA 2W1ZA 2YISA 1MQBA 1ZYLA 4RJ5A 5A6OA 4RLKA 4GT3A 2Q83A 3W2QA 3VQHA 2VTOA 2VWYA 1Y8YA 3MY5A 5GZ9A 4AT3A 4UYNA 2GS2A 2QURA 4EK3A 3UTOA 4XV9A 4S34A 5FP5A 1VJYA 4TYGA 4KSQA 5DIAA 3U9CA 3OWJA 5L8LA 3QCXA 2V5QA 4W9XA 5BVOA 4I23A 4ASEA 4HYIA 4BKYA 5CEMA 4G6LA 4OUCA 4YBJA 5DPVA 3VRZA 2X4FA 3QHRA 3SAYA 4B8LA 1OVEA 5CANA 3ORPA 3RINA 2W05A 3DKGA 2W1DA 4FTCA 3HV5A 1FMKA 4QMYA 4QYYA 1GZOA 5ACKA 3U6IA 4F4PA 4AZTA 4FV2A 1U5RA 3OW4A 3EH9A 3THBA 3LFBA 4MXYA 2IEWA 1FGIA 4B0GA 4MVFA 5DNRA 4XG7A 5DR9A 3DXPA 1UNGA 3VQUA 4IVBA 3T3UA 2ITQA 3AD5A 4LUEA 5LWNA 3L8VA 4YJNA 4FX3A 4F9BA 3GCSA 4QP7A 4ACGA 2XK8A 5KMLA 1H1PA 1WVWA 3DTWA 5I9UA 4D4RA 4RJ6A 3Q5IA 1Q3DA 2HAKA 4IVDA 1QL6A 3UBDA 5JQ5A 4S30A 4BIDA 3N51A 4PP7A 3MW1A 2R3RA 4IW0A 4HVIA 5EW9A 1Y57A 2WMAA 5D12A 1NT2A 3AD6A 3ENMA 4RVTA 2UZUE 1BI8A 4PPCA 3VJNA 3QTIA 4BDCA 2BRBA 1MRUA 2YLFA 4Y83A 4QNAA 4NKSA 3LQ5A 3R6XA 5AUVA 3ORKA 1NVQA 4FV3A 3WF6A 5CXHA 2OO8X 2Y9QA 3NEWA 1GZ8A 5A46A 3NUSA 3ZH8A 2JDRA 4DFLA 3OY1A 5GHVA 4IANA 4FZ6A 4E20A 4KA3A 4M66A 5JH6A 3O8UA 3W2SA 3C0GA 3G6HA 3EQRA 4FV9A 5J1WA 1OPLA 1QCFA 4QYHA 3UIUA 4TWCA 4ERWA 3F9NA 5IQEA 4LYNA 4GT5A 4M15A 2QR8A 3EYGA 3BRBA 1J91A 3R1QA 5DA3A 5IMEA 4QQ5A 3R8VA 3TV4A 3DB8A 5IQFA 3WYXA 4C62A 4JDHA 3BPRA 3GC8A 3SA0A 1PHKA 3VUTA 4YJVA 1Q97A 5KMMA 5HIDA 3A8WA 5IMXA 2QOQA 2HYYA 3RK5A 1KV1A 2BDWA 3R83A 2BROA 4QMOA 5JSMA 1W82A 3FJQE 5K5NA 4QTCA 4V0GA 5DT3A 4PNIA 2UVZA 4BN1A 3BGZA 2C6MA 3F5UA 3LMGA 4ZY4A 2QLUA 2YAKA 4NFNA 5K0KA 5E8UA 3UVRA 3ZUVA 5AV1A 3TN8A 5LMKA 4BDEA 4O4EA 3EKKA 4CFMA 4DEHA 3IQ7A 2J5EA 2FYSA 5CAOA 5K3YA 5HX6A 3KVXA 1H27A 4TWNA 2OZOA 2GDOA 3KGAA 4O82A 1JKKA 4F63A 4O7SA 1AQ1A 4O27B 4QMLA 1GIHA 4E7WA 4LGGA 2QKRA 1X8BA 2VRXA 1KWPA 3GBZA 1VEBA 4FZAB 3WF9A 2BDFA 5D10A 4PUZA 3RHKA 3NIEA 3VBWA 3TXOA 2YZAA 3QWKA 4G1WA 5I9ZA 3RJCA 1XJDA 3OEFX 1ZAOA 2JDSA 3R7OA 1PJKA 2VTLA 3OTVA 3H9OA 1Q99A 2F2CB 2RFDA 4MD7E 5L3AA 5AP2A 4QP3A 1PRYA 1R3CA 3T8OA 3U6HA 2CN5A 4K8AA 4KABA 3E3BX 4YPSA 4TYHB 5TOZA 3D0EA 3UOKA 3O71A 4IWPA 3A7JA 3C5UA 4E73A 3D4QA 2ZMCA 3DA6A 3I1AA 3ZSIA 3K2LA 3UOLA 1W84A 3ZBXA 4EHEA 5A4EA 2VU3A 3KXGA 3HV4A 4FTKA 2QONA 4GUEA 5K4IA 2Z7SA 1ZWSA 4F1OA 1FMOE 1M7NA 3NSZA 3W0OA 3L8XA 4AAAA 2GNGA 2VX3A 4DDGA 5J79A 3W33A 2XCHA 4GJ3A 1UNLA 4PTGA 2XNGA 1ZYDA 3SXRA 3MH2A 4IQ6A 3G0EA 4FKOA 4ITHA 2FSTX 4CKIA 5AX9A 4CRLA 4FR4A 5LCKA 1PMEA 3PJ3A 3SOAA 1OUYA 4KIKB 2CPKE 1TQMA 5A9UA 3KXZA 4PWNA 4CT1A 3SG8A 3QTWA 2ZV7A 4I6QA 5T68A 5TF9A 5CSPA 2E9OA 4DT9A 5GIPE 2BAJA 3BHVA 3DQXA 4Y8DA 3ZO4A 4DH5A 4GU9A 5J1VA 5HLWA 2JAMA 4NCTC 3EB0A 1YDTE 2XK7A 3GFWA 5DHJA 3UOHA 4ZLYA 3OBJA 1A48A 2ITOA 3R71A 4U81A 4BCGA 2PZYA 3R28A 4MWHA 4RFMA 4FT7A 5ETCA 3K5UA 3V51A 5EHOA 2X6EA 4Q9ZA 2YLEA 4IE9A 2C5VA 2ZB0A 3CJFA 5BNJA 2BRGA 3QX2A 2VGOA 3VUHA 4FIIA 3CKXA 4C61A 2CCHA 2JIUA 3G33A 4UWCA 3LJ0A 1R0PA 4DTAA 2WKMA 4PDOA 5EOBA 5EW3A 3UDZA 5EQYA 1WFCA 2YM8A 5AM6A 4E8AA 5A4CA 4EOMA 4FTQA 2VTAA 2F2UA 2YDKA 5HCZA 2IZSA 4NKAA 4V0GB 3CD3A 1I44A 2ZOQA 4ZAUA 3FHRA 4FUXA 4I20A 2OU7A 3L1SA 4FKLA 4MTAA 5LVLA 4AP7A 4CKJA 5I4NA 2WMUA 2VTHA 5M06A 4OR5A 3UDSA 3FEGA 2WTVA 3FXWA 3HV6A 4UY9A 1OGUA 1H0WA 2JD5A 2QHMA 3KRRA 5EI6A 4BGGA 4CTCA 1Q3WA 3BV2A 2WTKC 5I9WA 3CPBA 5ANEA 3RVGA 3BV3A 3R7VA 2UUEA 4XG3A 2C0OA 4I5MA 1SNUA 5HG9A 5M44A 3GOPA 3PPZA 2ZVAA 4I41A 4NTSA 4IM0A 3T3VA 1ST0A 2VTMA 3MV5A 4DH8A 2F4JA 2WMSA 5IF1A 2W4KA 4IAAA 4QMMA 3L9LA 2EUFB 4QMWA 5EM8A 5GINE 4XG8A 2CGUA 4KIQA 4FC0A 2PSQA 2IW9A 4QMPA 1W98A 3QYWA 1KSWA 4QMZA 4AU8A 4FKRA 3NFGB 3MBLA 4RJ3A 3PDTA 4FZ7A 3NW7A 4J97A 4PPBA 4FEWA 5CQWA 4OBPA 2XH5A 2W1FA 3ZU7A 4U80A 5JGAA 3OT8A 3NVKI 4TL0A 5CVGA 3PXRA 5FTOA 4AS0A 3ZLYA 3UC3A 2CGWA 3VS0A 4NH1A 2IG7A 5LMAA 2PVFA 5BUIA 4U79A 5A4LA 3VW6A 4FKSA 4ORKA 4DG0E 4QT1A 4EK5A 4MD9E 3UMXA 2Q0BA 3EYHA 5JK3A 2BRHA 1J3HA 3ALNA 4ZSLA 4FSRA 3TT0A 4CNHA 5AP3A 2EWAA 2O64A 2C68A 4O0WA 1MRVA 4LRKA 2R3LA 5JZJA 2NRYA 4FTJA 3EZVA 1H1QA 4BBEA 3UP7A 3QKLA 2W1EA 3BHHA 5JRQA 4O4FA 4R7IA 3B8QA 1IEPA 3OWPA 4I4FA 4XEYA 2B55A 3ZO1A 1NXKA 3QZIA 4YJQA 5L8KA 3OOGA 3PG3A 4FBXA 3QBNA 4FTOA 4IC8A 4N0SA 1GNGA 3IW7A 1DI8A 3IG7A 4RJ7A 4BCMA 2ZMDA 1GZNA 2WIPA 3C9WA 5AP7A 5C03A 3RHXA 1YQJA 4UX9A 5BMMA 4D2TA 3PVWA 2XJ1A 2YFXA 4GKIA 3IDCA 3V5TA 3PXFA 1NVSA 1YHWA 1OI9A 2CHLA 2W06A 2WQBA 2XA4A 4AGDA 4EEVA 2B1PA 2IVVA 3TI1A 3ZXTA 1WAKA 4U42A 4BDFA 2PUUA 4JQ7A 3PLSA 3VUIA 4AN9A 1PMNA 3HUBA 3ULIA 4HPUE 5M09A 1O6KA 3DDPA 3DFAA 1ZMWA 1B39A 4NJDA 5D7AA 5C26A 3G9LX 5LARA 4D1ZA 4E6AA 3MPTA 1NVRA 3UO6A 3TYKA 1EH4A 4ZTQA 4LL5A 4QEBA 3L9PA 1U59A 3R02A 4EZ5A 1FBNA 4UN0C 2C3JA 3W0SA 3DNEA 2QG5A 2CN8A 5DLSA 3TG1A 3F69A 3UO5A 1BI7A 4FKPA 2VWUA 3F5GA 4QPAA 3Q4ZA 5CEKA 4U9AA 3CJGA 4L9IA 4WG4A 4DLIA 1Q61A 1XR1A 2PTKA 3HP2A 3VHKA 5KBQA 2UZOA 1OKYA 3PPJA 4FTNA 3IS5A 1CMKE 1UWJA 2GS6A 4QP4A 3UNZA 5KHWA 2QQ7A 1OB3A 1ZY5A 3W55A 4I6LA 3OZ6A 1KOBA 3QF9A 2H9VA 5DRBA 3TUDA 4GUBA 3QD2B 4RC2A 5CNOA 5FM3A 3NW6A 1LPUA 2JIVA 4GK3A 3O0GA 3UQFA 2J90A 5H8EA 3KXXA 3MFSA 2CKPA 3V04A 3ZYAA 1URCA 4IM3A 3SOCA 4FKUA 5J9LA 4X3JA 3CGFA 4QYGA 3R1NA 3V6RA 2VN9A 3VS7A 3ERKA 2WMVA 3R9OA 1IR3A 2EXMA 5IQAA 1DS5A 2PZIA 4P90A 2PVJA 4PL4A 2UW6A 3EN7A 2P2HA 3FL4A 2AQXA 3CIKA 4DBNA 1TVOA 3RM6A 4QP6A 3IOPA 2P2IA 3FV8A 3NNVA 4FSTA 1U5QA 2HK5A 4R1VA 3RAKA 3ML1A 4JNWA 4L7SA 1RE8A 3P79A 2ITTA 3AXWA 3OW3A 1OPKA 1H24A 4BDGA 3QLGA 3HL7A 5A54A 4L8MA 2BKKA 2BZHB 4U7ZA 3VVHA 4H58A 2YN8A 5CEOA 4AQKA 5AR2A 4D9TA 4FICA 3FMLA 4FGRA 4ALWA 2PE1A 4YBKA 1XBCA 2B0QA 3Q04A 2OG8A 2XYUA 5DH3A 4C3RA 1M7QA 2Y6OA 1PXOA 2VWZA 3FPQA 3VS1A 1JLUE 4TW9A 3DAEA 5BVKA 5BV3A 3Q9XA 4QD6A 4J99A 4EBVA 5HEZA 2WMBA 4DEIA 5IEVA 2RFSA 2XK6A 3HV7A 1GJOA 4O7ZA 2W9FB 4U6RA 3FPMA 3BI6A 3QC9A 3CQEA 4EH7A 1YW2A 4KKEA 3BQRA 4I93A 3WF7A 4C8BA 4FKVA 4OTIA 4LM5A 4HZSA 2X0QA 4MXZA 1KE6A 4MXAA 4CV9A 4WG3A 4FTUA 3ITZA 3NNUA 4IACA 2PK9A 4NT4A 2OJJA 4WOVA 5HG8A 4F7SA 4EOSA 5H8BA 5CU0A 4BDAA 1S9IA 2IVUA 2C69A 5IA2A 3DZOA 4I5CA 4O91A 5DR2A 5LVPA 5AUXA 4Y46A 2X0PA 4LMNA 2I1MA 3PSCA 4OTRA 5AP4A 5D11A 4R77A 2E9NA 4K11A 3QFVA 4H3BA 4K77A 4KRCA 2F9GA 3BIZA 3KEXA 2HENA 4HYSA 5FLFA 4F0IA 4OTFA 4LGHA 4ZOGA 4JDJA 3MH3A 4U44A 4A9SA 3W8QA 4CQEA 4XRLA 4BHNA 2VV9A 4FSZA 4X21A 4F7JA 3CY2A 1ZXEA 3C0HA 3TV6A 4AA4A 2WNTA 5JGDA 4J71A 3R9NA 3AOXA 2UZDA 4KUJA 1OKWA 3DLZA 3AMAA 1FVTA 2G2FA 3LIJA 4KINA 4WKQA 3IOKA 2PU8A 4DC2A 2C0IA 2OSCA 4PTCA 3V8WA 1FVRA 1H08A 3CBLA 3MA6A 4ENXA 2XM9A 3WE8A 4A06A 4EK4A 3Q4CA 4DEEA 3W0QA 2H6DA 2C6EA 4D5KA 3R9DA 4OT5A 2XRWA 3E8NA 4H3QA 3E8CA 4F1MA 2HW6A 3P78A 4LOPA 5A14A 5HBHA 1BL7A 3BLHA 4AOIA 5KZ0A 4FEQA 2BR1A 4O22A