3FYAA

Crystal structure of an r35a mutant of the restriction-modification controller protein c.esp1396i
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
75
structure length
75
Chain Sequence
ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDATYISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the restriction-modification controller protein C.Esp1396I.
pubmed doi rcsb
source organism Enterobacter sp.
molecule tags Transcription regulator
molecule keywords Regulatory protein
total genus 26
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3fyaA00
1WETA 1R63A 2AXZA 3G7DA 3DNVB 2PUGA 2L8NA 1AU7A 2IVQA 2JVLA 1S7EA 1IC8A 3BD1A 1RIOA 1CJGA 2MEZA 2XCJA 4FBIA 2PUEA 3ZKCA 2GZUA 3F51A 1RPEL 2D5VA 1YSEA 3BS3A 2BJCA 1JFSA 1LQCA 3GN5B 1ZZ7A 1WIZA 1ZZBA 1QP4A 2A6CA 2B5AA 3ZHIA 1PNRA 2PIJA 2EF8A 4I6TA 4MCXA 4PU4C 1ZZ6A 4PU8A 3GN5A 4I6UA 1WH6A 2LYRA 4X4DA 3OQOA 1EFAA 4IWRA 2OR1L 2LCVA 2KZ8A 1DW9A 3D1NI 4YARA 4I6RA 3UFDA 2WIUB 3U3WA 1QP7A 4X4BA 4X4GA 1OCTC 1SQ8A 4X4HA 4X4IA 3CROL 1R69A 2IV1A 1X57A 1PRUA 3SCGA 1E3OC 3QF3A 2CROA 3OQMA 5A7LA 4X4EA 1BDHA 1ZPQA 2O38A 3FYMA 2XI8A 3EUSA 1ZVVA 2KEIA 2LYSA 2EBYA 2BNMA 3QWGA 4O8BA 1ZS4A 3F52A 3MLFA 3FYAA 3GBFA 1Y7YA 3L1PA 2LYKA 4OB4A 1QPZA 2WUSR 1QP0A 1ZAYA 2IU7A 2PPXA 3RZZA 1QQAA 1ADRA 3SCFA 2ICTA 1UXDA 2EWTA 2XSDC 1PRVA 1WH8A 2GRLA 2ICPA 2LYQA 1DWKA 3BDNA 2BNOA 3JXBC 3R1FA 1JFTA 1ZZ9A 2PUBA 2CSFA 2AXVA 2JCGA 1O4XA 2R1JL 1NERA 3HZIB 2FJRA 4IA8A 2AWIA 1LCCA 1PERL 4J1XA 3QQ6A 1UXCA 1RZRD 3OMTA 4JQDA 3JXCL 2HINA 1L1MA 1GT0C 3ZHMA 3PXPA 2GRMA 2PUFA 2AUWA 1UTXA 2KEJA 1HF0A 3TRBA 4FN3A 4YBAA 1JH9A 2AXUA 2H8RA 2BNNA 2R63A 3CECA 1PRAA 4Z5CA 3JXDL 2XIUA 3KXAA 3OP9A 3O9XA 1LMB3 2HSGA 1B0NA 3B7HA 4YG7B 1LLIA 1X2LA 4JCYA 2KPJA 1LCDA 3KZ3A 3QYXA 3S8QA 4JCXA 1RZSA 4GQMA 4J1WA 1XWRA 1QQBA 4X4FA 4PU7A 2MQKA 4PU3C 1ZUGA 1RZRA 4YG1A 4IVZA 3SCHA 1BDIA 4NDWA 4GHJA 3VK0A 1OSLA 2LYPA 3FMYA 1VPWA 2PUDA 4F8DA 4Z59A 2IUOA 3G5GA 3H5TA 3KJXA 3LISA 2OFYA 2PUCA 3IVPA 1JWLA 2LYLA 4YG4A 1Y9QA 4X4CA 1CQTA 2PE5A 4Z5DA 5K98B 2L49A 2O49A 4Z58A 3CLCA 1ZZCA 3OQNA 2LYJA 1NEQA 2IVGA 4Y42A 2AW6A 2KEKA 4I8TA 3F6WA 4MCTA 2O4AA 1ZZ8A 3LFPA 1POUA 4Z5HA 2IVBA 2PUAA 2XJ3A
chains in the Genus database with same CATH superfamily
1WETA 5DTRA 3G7DA 4ER3A 2L8NA 1IC8A 4FBIA 2PUEA 3BS3A 1JFSA 1ZZ7A 3NZLA 2PIJA 2PXEA 4I6UA 4IWRA 2LCVA 3QOWA 3TELA 2WIUB 4X4HA 1X57A 2LLWA 3SCGA 3FYMA 2XI8A 3EUSA 2KEIA 1ZS4A 3MLFA 3FYAA 3MEJA 1QP0A 2ICTA 1WH8A 2LYQA 1DWKA 2BNOA 3JXBC 3QOXA 3R1FA 2JCGA 1O4XA 5DTMA 2FJRA 1LCCA 1PERL 4Q2JA 3JXCL 3A9ZA 1L1MA 2GRMA 1HF0A 3OWQA 1QZXA 4FN3A 2PXFA 2R63A 3KXAA 3PE5A 3B7HA 4YG7B 1LLIA 1X2LA 2VEOA 4JCYA 2KPJA 3KZ3A 3QYXA 3S8QA 3VWSA 1ZUGA 4IVZA 3VK0A 4EKIA 3LISA 2XXAA 1CQTA 2PE5A 4Z5DA 2XXQA 5K98B 2MXDA 5DT2A 3KL4A 2KEKA 2V3CC 2O4AA 2XJ3A 2M4HA 1R63A 4EZIA 3BD1A 2XCJA 2D5VA 2FFHA 2BJCA 1LQCA 5GAHi 4PU4C 1DULA 3D1NI 4YARA 3U3WA 4X4BA 4X4GA 1R69A 2IV1A 4ER0A 3M9LA 4X4EA 1BDHA 2O38A 3GUUA 1ZVVA 3QFIA 2LYSA 5DRYA 2HCNA 1Y7YA 1ZAYA 2J7UA 1QP4A 1PRVA 2GRLA 5DTQA 2PUBA 1NERA 4IA8A 4J1XA 3QQ6A 3OMTA 4JQDA 5DSXA 1GT0C 2LNMA 2PUFA 2KEJA 1UTXA 3TRBA 1U2ZA 1LMB3 2HSGA 1B0NA 3TEPA 4J1WA 1XWRA 5JUWA 4PU7A 2MQKA 4PU3C 1NW3A 1HQ1A 2LYPA 1VPWA 2IUOA 3IVPA 4EQZA 1Y9QA 4EK9A 1ZZCA 3OQNA 1NEQA 4Y42A 4I8TA 4MCTA 1ZZ8A 1POUA 4Z5HA 4ER7A 4EKGA 3R09A 3DNVB 4WVLA 3A9XA 1AU7A 2JVLA 1S7EA 1RIOA 2GZUA 3F51A 5GAGi 1ZZBA 1WIZA 2B5AA 3ZHIA 4MCXA 3GN5A 1EFAA 1WH6A 2LYRA 2OR1L 1DW9A 4I6RA 2YBDA 3UFDA 1QP7A 1OCTC 1SQ8A 3CROL 3GZDC 1E3OC 3QF3A 2CROA 3OQMA 5A7LA 2EBYA 2BNMA 2HFZA 4DE9A 2LYKA 2ODRD 2PXBA 2PPXA 1QQAA 1ADRA 1UXDA 2PXQA 2PXTA 3BDNA 2ICPA 1ZZ9A 2AXVA 2PXVA 2HCSA 3GZCA 2AWIA 4ER6A 1UXCA 4OBMA 4ER5A 4YBAA 2BNNA 2PXKA 1PRAA 3JXDL 2XIUA 3OP9A 3O9XA 3SX0A 3NXHA 4DE8A 4GQMA 4X4FA 2LLVA 1RZRA 1BDIA 4NDWA 4GHJA 3FMYA 4F8DA 4Z59A 3TFLA 2OFYA 2PUCA 1JWLA 2LYLA 4YG4A 3ME5A 2O49A 5DRTA 4Z58A 2LYJA 2IVGA 2AW6A 2IVBA 2AXZA 2PUGA 2IVQA 1CJGA 2MEZA 3ZKCA 1RPEL 1YSEA 2J7WA 3GN5B 2PXDA 2A6CA 3OKZA 1PNRA 2EF8A 4I6TA 4X4DA 1ZZ6A 3OQOA 2KZ8A 4X4IA 1PRUA 2JQEA 1ZPQA 3SR4A 2PXUA 3QWGA 4O8BA 3F52A 3GBFA 3L1PA 1QB2A 2XXPA 4OB4A 1QPZA 2WUSR 2IU7A 3RZZA 3SCFA 2XSDC 2EWTA 3LQXA 1JFTA 2CSFA 3DM5A 2R1JL 3HZIB 3NDBB 1RZRD 3A9YA 2HINA 3ZHMA 3PXPA 2AUWA 2L1PA 1JH9A 2H8RA 2AXUA 3CECA 4Z5CA 4HRAA 3G0TA 2PXPA 3GZDA 3UWPA 1LCDA 4JCXA 1MFQC 1RZSA 3ZPXA 1QQBA 4YG1A 3SCHA 3NROA 1OSLA 2PXLA 2PUDA 3G5GA 3H5TA 3KJXA 4X4CA 2L49A 3CLCA 3F6WA 3LFPA 2PUAA 4PU8A
chains in the Genus database with same CATH topology
1WETA 1R63A 2AXZA 3G7DA 3DNVB 2PUGA 2L8NA 1AU7A 2IVQA 2JVLA 1S7EA 1IC8A 3BD1A 1RIOA 1CJGA 2MEZA 2XCJA 4FBIA 2PUEA 3ZKCA 2GZUA 3F51A 1RPEL 2D5VA 1YSEA 3BS3A 2BJCA 1JFSA 1LQCA 3GN5B 1ZZ7A 1WIZA 1ZZBA 1QP4A 2A6CA 2B5AA 3ZHIA 1PNRA 2PIJA 2EF8A 4I6TA 4MCXA 4PU4C 1ZZ6A 4PU8A 3GN5A 4I6UA 1WH6A 2LYRA 4X4DA 3OQOA 1EFAA 4IWRA 2OR1L 2LCVA 2KZ8A 1DW9A 3D1NI 4YARA 4I6RA 3UFDA 2WIUB 3U3WA 1QP7A 4X4BA 4X4GA 1OCTC 1SQ8A 4X4HA 4X4IA 3CROL 1R69A 2IV1A 1X57A 1PRUA 3SCGA 1E3OC 3QF3A 2CROA 3OQMA 5A7LA 4X4EA 1BDHA 1ZPQA 2O38A 3FYMA 2XI8A 3EUSA 1ZVVA 2KEIA 2LYSA 2EBYA 2BNMA 3QWGA 4O8BA 1ZS4A 3F52A 3MLFA 3FYAA 3GBFA 1Y7YA 3L1PA 2LYKA 4OB4A 1QPZA 2WUSR 1QP0A 1ZAYA 2IU7A 2PPXA 3RZZA 1QQAA 1ADRA 3SCFA 2ICTA 1UXDA 2EWTA 2XSDC 1PRVA 1WH8A 2GRLA 2ICPA 2LYQA 1DWKA 3BDNA 2BNOA 3JXBC 3R1FA 1JFTA 1ZZ9A 2PUBA 2CSFA 2AXVA 2JCGA 1O4XA 2R1JL 1NERA 3HZIB 2FJRA 4IA8A 2AWIA 1LCCA 1PERL 4J1XA 3QQ6A 1UXCA 1RZRD 3OMTA 4JQDA 3JXCL 2HINA 1L1MA 1GT0C 3ZHMA 3PXPA 2GRMA 2PUFA 2AUWA 1UTXA 2KEJA 1HF0A 3TRBA 4FN3A 4YBAA 1JH9A 2AXUA 2H8RA 2BNNA 2R63A 3CECA 1PRAA 4Z5CA 3JXDL 2XIUA 3KXAA 3OP9A 3O9XA 1LMB3 2HSGA 1B0NA 3B7HA 4YG7B 1LLIA 1X2LA 4JCYA 2KPJA 1LCDA 3KZ3A 3QYXA 3S8QA 4JCXA 1RZSA 4GQMA 4J1WA 1XWRA 1QQBA 4X4FA 4PU7A 2MQKA 4PU3C 1ZUGA 1RZRA 4YG1A 4IVZA 3SCHA 1BDIA 4NDWA 4GHJA 3VK0A 1OSLA 2LYPA 3FMYA 1VPWA 2PUDA 4F8DA 4Z59A 2IUOA 3G5GA 3H5TA 3KJXA 3LISA 2OFYA 2PUCA 3IVPA 1JWLA 2LYLA 4YG4A 1Y9QA 4X4CA 1CQTA 2PE5A 4Z5DA 5K98B 2L49A 2O49A 4Z58A 3CLCA 1ZZCA 3OQNA 2LYJA 1NEQA 2IVGA 4Y42A 2AW6A 2KEKA 4I8TA 3F6WA 4MCTA 2O4AA 1ZZ8A 3LFPA 1POUA 4Z5HA 2IVBA 2PUAA 2XJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WET A;  1R63 A;  2AXZ A;  3G7D A;  3DNV B;  2PUG A;  2L8N A;  1AU7 A;  2IVQ A;  2JVL A;  1S7E A;  1IC8 A;  3BD1 A;  1RIO A;  1CJG A;  2MEZ A;  2XCJ A;  4FBI A;  2PUE A;  3ZKC A;  2GZU A;  3F51 A;  1RPE L;  2D5V A;  1YSE A;  3BS3 A;  2BJC A;  1JFS A;  1LQC A;  3GN5 B;  1ZZ7 A;  1WIZ A;  1ZZB A;  1QP4 A;  2A6C A;  2B5A A;  3ZHI A;  1PNR A;  2PIJ A;  2EF8 A;  4I6T A;  4MCX A;  4PU4 C;  1ZZ6 A;  4PU8 A;  3GN5 A;  4I6U A;  1WH6 A;  2LYR A;  4X4D A;  3OQO A;  1EFA A;  4IWR A;  2OR1 L;  2LCV A;  2KZ8 A;  1DW9 A;  3D1N I;  4YAR A;  4I6R A;  3UFD A;  2WIU B;  3U3W A;  1QP7 A;  4X4B A;  4X4G A;  1OCT C;  1SQ8 A;  4X4H A;  4X4I A;  3CRO L;  1R69 A;  2IV1 A;  1X57 A;  1PRU A;  3SCG A;  1E3O C;  3QF3 A;  2CRO A;  3OQM A;  5A7L A;  4X4E A;  1BDH A;  1ZPQ A;  2O38 A;  3FYM A;  2XI8 A;  3EUS A;  1ZVV A;  2KEI A;  2LYS A;  2EBY A;  2BNM A;  3QWG A;  4O8B A;  1ZS4 A;  3F52 A;  3MLF A;  3FYA A;  3GBF A;  1Y7Y A;  3L1P A;  2LYK A;  4OB4 A;  1QPZ A;  2WUS R;  1QP0 A;  1ZAY A;  2IU7 A;  2PPX A;  3RZZ A;  1QQA A;  1ADR A;  3SCF A;  2ICT A;  1UXD A;  2EWT A;  2XSD C;  1PRV A;  1WH8 A;  2GRL A;  2ICP A;  2LYQ A;  1DWK A;  3BDN A;  2BNO A;  3JXB C;  3R1F A;  1JFT A;  1ZZ9 A;  2PUB A;  2CSF A;  2AXV A;  2JCG A;  1O4X A;  2R1J L;  1NER A;  3HZI B;  2FJR A;  4IA8 A;  2AWI A;  1LCC A;  1PER L;  4J1X A;  3QQ6 A;  1UXC A;  1RZR D;  3OMT A;  4JQD A;  3JXC L;  2HIN A;  1L1M A;  1GT0 C;  3ZHM A;  3PXP A;  2GRM A;  2PUF A;  2AUW A;  1UTX A;  2KEJ A;  1HF0 A;  3TRB A;  4FN3 A;  4YBA A;  1JH9 A;  2AXU A;  2H8R A;  2BNN A;  2R63 A;  3CEC A;  1PRA A;  4Z5C A;  3JXD L;  2XIU A;  3KXA A;  3OP9 A;  3O9X A;  1LMB 3;  2HSG A;  1B0N A;  3B7H A;  4YG7 B;  1LLI A;  1X2L A;  4JCY A;  2KPJ A;  1LCD A;  3KZ3 A;  3QYX A;  3S8Q A;  4JCX A;  1RZS A;  4GQM A;  4J1W A;  1XWR A;  1QQB A;  4X4F A;  4PU7 A;  2MQK A;  4PU3 C;  1ZUG A;  1RZR A;  4YG1 A;  4IVZ A;  3SCH A;  1BDI A;  4NDW A;  4GHJ A;  3VK0 A;  1OSL A;  2LYP A;  3FMY A;  1VPW A;  2PUD A;  4F8D A;  4Z59 A;  2IUO A;  3G5G A;  3H5T A;  3KJX A;  3LIS A;  2OFY A;  2PUC A;  3IVP A;  1JWL A;  2LYL A;  4YG4 A;  1Y9Q A;  4X4C A;  1CQT A;  2PE5 A;  4Z5D A;  5K98 B;  2L49 A;  2O49 A;  4Z58 A;  3CLC A;  1ZZC A;  3OQN A;  2LYJ A;  1NEQ A;  2IVG A;  4Y42 A;  2AW6 A;  2KEK A;  4I8T A;  3F6W A;  4MCT A;  2O4A A;  1ZZ8 A;  3LFP A;  1POU A;  4Z5H A;  2IVB A;  2PUA A;  2XJ3 A; 
#chains in the Genus database with same CATH topology
 1WET A;  5DTR A;  3G7D A;  4ER3 A;  2L8N A;  1IC8 A;  4FBI A;  2PUE A;  3BS3 A;  1JFS A;  1ZZ7 A;  3NZL A;  2PIJ A;  2PXE A;  4I6U A;  4IWR A;  2LCV A;  3QOW A;  3TEL A;  2WIU B;  4X4H A;  1X57 A;  2LLW A;  3SCG A;  3FYM A;  2XI8 A;  3EUS A;  2KEI A;  1ZS4 A;  3MLF A;  3FYA A;  3MEJ A;  1QP0 A;  2ICT A;  1WH8 A;  2LYQ A;  1DWK A;  2BNO A;  3JXB C;  3QOX A;  3R1F A;  2JCG A;  1O4X A;  5DTM A;  2FJR A;  1LCC A;  1PER L;  4Q2J A;  3JXC L;  3A9Z A;  1L1M A;  2GRM A;  1HF0 A;  3OWQ A;  1QZX A;  4FN3 A;  2PXF A;  2R63 A;  3KXA A;  3PE5 A;  3B7H A;  4YG7 B;  1LLI A;  1X2L A;  2VEO A;  4JCY A;  2KPJ A;  3KZ3 A;  3QYX A;  3S8Q A;  3VWS A;  1ZUG A;  4IVZ A;  3VK0 A;  4EKI A;  3LIS A;  2XXA A;  1CQT A;  2PE5 A;  4Z5D A;  2XXQ A;  5K98 B;  2MXD A;  5DT2 A;  3KL4 A;  2KEK A;  2V3C C;  2O4A A;  2XJ3 A;  2M4H A;  1R63 A;  4EZI A;  3BD1 A;  2XCJ A;  2D5V A;  2FFH A;  2BJC A;  1LQC A;  5GAH i;  4PU4 C;  1DUL A;  3D1N I;  4YAR A;  3U3W A;  4X4B A;  4X4G A;  1R69 A;  2IV1 A;  4ER0 A;  3M9L A;  4X4E A;  1BDH A;  2O38 A;  3GUU A;  1ZVV A;  3QFI A;  2LYS A;  5DRY A;  2HCN A;  1Y7Y A;  1ZAY A;  2J7U A;  1QP4 A;  1PRV A;  2GRL A;  5DTQ A;  2PUB A;  1NER A;  4IA8 A;  4J1X A;  3QQ6 A;  3OMT A;  4JQD A;  5DSX A;  1GT0 C;  2LNM A;  2PUF A;  2KEJ A;  1UTX A;  3TRB A;  1U2Z A;  1LMB 3;  2HSG A;  1B0N A;  3TEP A;  4J1W A;  1XWR A;  5JUW A;  4PU7 A;  2MQK A;  4PU3 C;  1NW3 A;  1HQ1 A;  2LYP A;  1VPW A;  2IUO A;  3IVP A;  4EQZ A;  1Y9Q A;  4EK9 A;  1ZZC A;  3OQN A;  1NEQ A;  4Y42 A;  4I8T A;  4MCT A;  1ZZ8 A;  1POU A;  4Z5H A;  4ER7 A;  4EKG A;  3R09 A;  3DNV B;  4WVL A;  3A9X A;  1AU7 A;  2JVL A;  1S7E A;  1RIO A;  2GZU A;  3F51 A;  5GAG i;  1ZZB A;  1WIZ A;  2B5A A;  3ZHI A;  4MCX A;  3GN5 A;  1EFA A;  1WH6 A;  2LYR A;  2OR1 L;  1DW9 A;  4I6R A;  2YBD A;  3UFD A;  1QP7 A;  1OCT C;  1SQ8 A;  3CRO L;  3GZD C;  1E3O C;  3QF3 A;  2CRO A;  3OQM A;  5A7L A;  2EBY A;  2BNM A;  2HFZ A;  4DE9 A;  2LYK A;  2ODR D;  2PXB A;  2PPX A;  1QQA A;  1ADR A;  1UXD A;  2PXQ A;  2PXT A;  3BDN A;  2ICP A;  1ZZ9 A;  2AXV A;  2PXV A;  2HCS A;  3GZC A;  2AWI A;  4ER6 A;  1UXC A;  4OBM A;  4ER5 A;  4YBA A;  2BNN A;  2PXK A;  1PRA A;  3JXD L;  2XIU A;  3OP9 A;  3O9X A;  3SX0 A;  3NXH A;  4DE8 A;  4GQM A;  4X4F A;  2LLV A;  1RZR A;  1BDI A;  4NDW A;  4GHJ A;  3FMY A;  4F8D A;  4Z59 A;  3TFL A;  2OFY A;  2PUC A;  1JWL A;  2LYL A;  4YG4 A;  3ME5 A;  2O49 A;  5DRT A;  4Z58 A;  2LYJ A;  2IVG A;  2AW6 A;  2IVB A;  2AXZ A;  2PUG A;  2IVQ A;  1CJG A;  2MEZ A;  3ZKC A;  1RPE L;  1YSE A;  2J7W A;  3GN5 B;  2PXD A;  2A6C A;  3OKZ A;  1PNR A;  2EF8 A;  4I6T A;  4X4D A;  1ZZ6 A;  3OQO A;  2KZ8 A;  4X4I A;  1PRU A;  2JQE A;  1ZPQ A;  3SR4 A;  2PXU A;  3QWG A;  4O8B A;  3F52 A;  3GBF A;  3L1P A;  1QB2 A;  2XXP A;  4OB4 A;  1QPZ A;  2WUS R;  2IU7 A;  3RZZ A;  3SCF A;  2XSD C;  2EWT A;  3LQX A;  1JFT A;  2CSF A;  3DM5 A;  2R1J L;  3HZI B;  3NDB B;  1RZR D;  3A9Y A;  2HIN A;  3ZHM A;  3PXP A;  2AUW A;  2L1P A;  1JH9 A;  2H8R A;  2AXU A;  3CEC A;  4Z5C A;  4HRA A;  3G0T A;  2PXP A;  3GZD A;  3UWP A;  1LCD A;  4JCX A;  1MFQ C;  1RZS A;  3ZPX A;  1QQB A;  4YG1 A;  3SCH A;  3NRO A;  1OSL A;  2PXL A;  2PUD A;  3G5G A;  3H5T A;  3KJX A;  4X4C A;  2L49 A;  3CLC A;  3F6W A;  3LFP A;  2PUA A;  4PU8 A; 
#chains in the Genus database with same CATH homology
 1WET A;  1R63 A;  2AXZ A;  3G7D A;  3DNV B;  2PUG A;  2L8N A;  1AU7 A;  2IVQ A;  2JVL A;  1S7E A;  1IC8 A;  3BD1 A;  1RIO A;  1CJG A;  2MEZ A;  2XCJ A;  4FBI A;  2PUE A;  3ZKC A;  2GZU A;  3F51 A;  1RPE L;  2D5V A;  1YSE A;  3BS3 A;  2BJC A;  1JFS A;  1LQC A;  3GN5 B;  1ZZ7 A;  1WIZ A;  1ZZB A;  1QP4 A;  2A6C A;  2B5A A;  3ZHI A;  1PNR A;  2PIJ A;  2EF8 A;  4I6T A;  4MCX A;  4PU4 C;  1ZZ6 A;  4PU8 A;  3GN5 A;  4I6U A;  1WH6 A;  2LYR A;  4X4D A;  3OQO A;  1EFA A;  4IWR A;  2OR1 L;  2LCV A;  2KZ8 A;  1DW9 A;  3D1N I;  4YAR A;  4I6R A;  3UFD A;  2WIU B;  3U3W A;  1QP7 A;  4X4B A;  4X4G A;  1OCT C;  1SQ8 A;  4X4H A;  4X4I A;  3CRO L;  1R69 A;  2IV1 A;  1X57 A;  1PRU A;  3SCG A;  1E3O C;  3QF3 A;  2CRO A;  3OQM A;  5A7L A;  4X4E A;  1BDH A;  1ZPQ A;  2O38 A;  3FYM A;  2XI8 A;  3EUS A;  1ZVV A;  2KEI A;  2LYS A;  2EBY A;  2BNM A;  3QWG A;  4O8B A;  1ZS4 A;  3F52 A;  3MLF A;  3FYA A;  3GBF A;  1Y7Y A;  3L1P A;  2LYK A;  4OB4 A;  1QPZ A;  2WUS R;  1QP0 A;  1ZAY A;  2IU7 A;  2PPX A;  3RZZ A;  1QQA A;  1ADR A;  3SCF A;  2ICT A;  1UXD A;  2EWT A;  2XSD C;  1PRV A;  1WH8 A;  2GRL A;  2ICP A;  2LYQ A;  1DWK A;  3BDN A;  2BNO A;  3JXB C;  3R1F A;  1JFT A;  1ZZ9 A;  2PUB A;  2CSF A;  2AXV A;  2JCG A;  1O4X A;  2R1J L;  1NER A;  3HZI B;  2FJR A;  4IA8 A;  2AWI A;  1LCC A;  1PER L;  4J1X A;  3QQ6 A;  1UXC A;  1RZR D;  3OMT A;  4JQD A;  3JXC L;  2HIN A;  1L1M A;  1GT0 C;  3ZHM A;  3PXP A;  2GRM A;  2PUF A;  2AUW A;  1UTX A;  2KEJ A;  1HF0 A;  3TRB A;  4FN3 A;  4YBA A;  1JH9 A;  2AXU A;  2H8R A;  2BNN A;  2R63 A;  3CEC A;  1PRA A;  4Z5C A;  3JXD L;  2XIU A;  3KXA A;  3OP9 A;  3O9X A;  1LMB 3;  2HSG A;  1B0N A;  3B7H A;  4YG7 B;  1LLI A;  1X2L A;  4JCY A;  2KPJ A;  1LCD A;  3KZ3 A;  3QYX A;  3S8Q A;  4JCX A;  1RZS A;  4GQM A;  4J1W A;  1XWR A;  1QQB A;  4X4F A;  4PU7 A;  2MQK A;  4PU3 C;  1ZUG A;  1RZR A;  4YG1 A;  4IVZ A;  3SCH A;  1BDI A;  4NDW A;  4GHJ A;  3VK0 A;  1OSL A;  2LYP A;  3FMY A;  1VPW A;  2PUD A;  4F8D A;  4Z59 A;  2IUO A;  3G5G A;  3H5T A;  3KJX A;  3LIS A;  2OFY A;  2PUC A;  3IVP A;  1JWL A;  2LYL A;  4YG4 A;  1Y9Q A;  4X4C A;  1CQT A;  2PE5 A;  4Z5D A;  5K98 B;  2L49 A;  2O49 A;  4Z58 A;  3CLC A;  1ZZC A;  3OQN A;  2LYJ A;  1NEQ A;  2IVG A;  4Y42 A;  2AW6 A;  2KEK A;  4I8T A;  3F6W A;  4MCT A;  2O4A A;  1ZZ8 A;  3LFP A;  1POU A;  4Z5H A;  2IVB A;  2PUA A;  2XJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...