3FYSA

Crystal structure of degv, a fatty acid binding protein from bacillus subtilis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
282
structure length
282
Chain Sequence
SMNIAVVTDSTAYIPKEMREQHQIHMIPLQVVFREETYREEIELDWKSFYEEVKKHNELPTTSQPPIGELVALYEELGKSYDAVISIHLSSGISGTFSSAAAADSMVDNIDVYPFDSEISCLAQGFYALKAAELIKNGASSPEDIIKELEEMKKTVRAYFMVDDLAHLQRGGRLSSAQAFIGSLLKVKPILHFDNKVIVPFEKIRTRKKAISRIYELLDEDASKGLPMRAAVIHANREEEAAKIIEELSAKYPHVEFYNSYFGAVIGTHLGEGALGICWCFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fatty acid-binding protein
molecule keywords Protein degV
publication title Structure of a fatty acid-binding protein from Bacillus subtilis determined by sulfur-SAD phasing using in-house chromium radiation
pubmed doi rcsb
source organism Bacillus subtilis
total genus 97
structure length 282
sequence length 282
ec nomenclature
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02645 DegV Uncharacterised protein, DegV family COG1307
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1180.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein Tm841; Chain: A;domain 3 Hypothetical Protein Tm841; Chain: A;domain 3 3fysA02
3.40.50.10170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fysA01
3NYIA 1VPVA 3FYSA 3JR7A 3PL5A 2G7ZA 3FDJA 3LUPA 4X9XA 2DT8A 1PZXA 1MGPA
chains in the Genus database with same CATH superfamily
1H2HA 3S5JA 2Z6UA 4UZFA 4MQEB 3OZ7A 1ZCAA 1AJEA 1IM2A 1SAYA 1HR0B 1WXGA 4HTAA 4JLBA 4W1PA 5TT0A 4B45A 1N1GA 2WJIA 5AVRA 4XIJA 3ZEIA 3T34A 1BDIA 4C6HA 5LL6P 1EFPB 4HLNA 3ZDQA 3DMFA 1NVMB 3FDFA 2Q5FA 4AULA 5C37A 3A4VA 1XQ6A 3EDOA 3Q72A 4UE6A 3SZGA 2D00A 3P26A 4G41A 4PYKA 2YZGA 1EJ2A 5AI5A 1WCYA 1K6EA 3M5PA 1J06A 4DIFA 1ADJA 1CX9B 1QO0A 4GXRA 2VJDA 1GTG1 5CUQA 4IH4A 2VUTA 3PA8A 4TLEA 3ESBA 2DECA 3FDZA 1Z6GA 2MYNA 4DN6A 1MIHA 3TB6A 3IOYA 5A0FA 3VNAA 3BTUA 3SFVA 2H5EA 2FA9A 3NALA 4XUEA 5HFJA 2M6LA 5CAEA 4R31A 5HJ7A 3HP7A 1YHZA 2WK1A 2JLRA 4PFKA 5BXYA 2DPGA 1YVRA 3LK6A 4ZOAA 1M2EA 3HA7A 4FC7A 1A9RA 5AWFC 5IJ9A 1ULHA 4PC2A 2ZR8A 1M0WA 1V3QE 1UEXC 3QPUA 1WWKA 2J6IA 3SJ7A 5TVGA 4NNOA 1B6RA 4I1RA 4WA7A 1FXWF 4UTNA 1NXTA 4A2QA 5I48A 2UXBB 3CJQA 1CDZA 4DCVA 4KFUA 2YWRA 3HCPA 3S2YA 1FSPA 4RA6B 3KZXA 3RS8A 1AKWA 1SBNE 3THYB 1UPXA 1QP7A 2CFSA 2X14A 2YHIA 3BB1A 3E22B 3PSAA 4J0KA 3TMYA 4YP7A 2JZCA 1UPBA 4FD2A 4IG4A 3ZWMA 2IT1A 4JBYA 3EEQA 2DFNA 1J7JA 3RNLA 3ZUGA 2NU7A 1KGDA 4OQXA 1E2BA 4CU5A 3WNBA 1TJNA 1U0OC 4ESVA 1JSLA 2Q3HA 2I4NA 1N6PA 3JQGA 4XUDA 2BN4A 3WY9A 4X66B 3L6OO 1ZH4A 1A9XB 1NF3A 2IZ7A 3H2GA 4LYGA 4PO8A 1S3IA 1MOPA 2JCVA 2V7WA 1LF0A 4IF6A 3LWNA 2W48A 2IJGX 3MGBA 3VNBA 4YP9A 2XKKA 3Q3IA 3D7LA 3EPHA 4QXRA 5LBUA 3BE5A 1SD2A 3EC1A 4MEJA 4NCXA 2CLLB 5K20A 5CGQB 3KQMA 1GADO 3BEOA 3T7JA 3VSBA 1ZZEA 3DMYA 4XTRA 2FP4A 2A9JA 1A7UA 1UKYA 3CMMA 3TKAA 1W5BA 4WBNF 4CEIA 1BKYA 2W6ID 3LUDA 4ZQGA 4RY0A 3M6LA 4A6DA 4REOA 1O77A 1SELA 4P2BA 2MTBA 4D6YA 1KFEB 1KO4A 1SHKA 1DJLA 3AVOA 2OCXA 3OZWA 4YWJA 2C5FA 1GR0A 1XV5A 3A1TA 3ND7A 2Z0MA 2M6SA 2YJZA 3VHRA 5BPHA 4YS6A 4RKYA 1KP2A 1Y7TA 3DQZA 5CA1B 1Y6RA 4CCYB 2YMLA 1DHRA 1CJTC 3MLAA 2FN7A 4WCFA 4YT5A 3VPAA 2CCJA 4V0RA 3UB4A 1H2RS 2B36A 3OAAA 4AMBA 4U8GA 4BNIA 4RL4A 5TEWA 1A2BA 3GJ5A 5LWHA 5BMVA 1ZM9A 1K8XB 4KGDA 3DBLB 2IS2A 1BXRA 1O58A 1QWSA 2HAEA 4BNNA 1W75A 3F3YA 1UH5A 2GEKA 2XJ4A 1AUPA 4M38A 5EOVA 1EVIA 1WDMA 3ZV7A 3G1WA 3QLVC 2VEOA 2WKSA 2EWWA 1UZNA 1L4MA 5J43A 2I7CA 1PQ4A 1ZW1A 2CCGA 2QX8A 2Z2XA 3ABRB 3QWBA 4FIZA 5AKJA 4Z9FA 3MWEA 5M7EA 2EW8A 4MRAA 1M54A 4D96A 2VO1A 3RBZA 4CMKA 3GNSA 3CH5A 2HWUA 3PTZA 4BFUA 4UMVA 2PMCA 3JATA 1HURA 2ZB2A 4C3ZA 1HNZB 2FKAA 3O3NB 3SLKA 5EP2A 4PLGA 1CNFA 1QANA 2H4JA 3AFOA 1A9OA 3DGEC 3NNSA 3RUDA 1G6KA 3VPCA 3ZWQA 4MR8B 3RYHB 1E3QA 2FTKE 2WA1A 3FVQA 3M83A 3ORFA 4Q12A 5KTNA 1W0KD 5IDQA 1VRCA 5JW6A 2GJAA 1Z6PA 2NZ8A 2WNIA 3E7PA 4AWAA 3OPVA 4KNWA 3MILA 3OWXA 3AEQB 3G2HA 3HU1A 4I1IA 4C0WA 3B13B 1OWPA 2R4TA 2C4HA 2YY6A 5BURA 3R3HA 3EIQA 3LHIA 2BRUC 2O8VA 2WI8A 3G0BA 1KYIA 3LYHA 4FONA 1T3LA 4EI9A 1JLHA 4AJ4A 1LS1A 4EEKA 1YBMA 3IMFA 4MVJM 2WYUA 3M2PA 4NU5A 3MJ4A 2A5YB 4LSWA 4KLAA 3T61A 1CJMA 1T4GA 3AYZB 3CSDA 2VDRB 3OJWA 5H83A 4R0MA 4BVBA 3T1YB 4HI0E 1NW3A 1YC2A 3LJKA 3L1IA 3MS2A 3KJQA 3SEZA 3JQDA 1JDSA 1PWEA 1T5SA 1KZ7B 4RHTA 4QEDA 1YS7A 3LDAA 3RS2A 3PQ5A 3M4JA 2OLEA 1B93A 2PJZA 4FFBB 3SICE 2PLRA 3GFFA 2JIZD 3WAKA 5AKZA 1VIVA 5JD6A 1WS6A 3IT1A 3H13A 3O31A 2VT7A 2WG0A 5JE8A 3PQFA 4O2LA 1XZQA 3GZNB 4KQ1A 3T35A 2VHTA 2W8BB 2YWXA 5TEVA 4YXWD 1J1IA 4OH7A 1VKJA 3AOEA 2QA5A 2HU2A 2JW5A 5CFOA 2FSVA 1HEUA 4LW8A 1PG0A 2F3QA 4QASA 4WXMA 4ZRNA 4CGYA 5FWYA 4B6JA 4RD1A 4FGSA 1X80A 2VWGA 3MMPA 3PEWA 3TH5A 1XZHA 1WXQA 2QLFA 4L8YA 1UMCA 3PLNA 1ULBA 2V6GA 1FSGA 3VYTB 2AVDA 2H2FA 2VSOA 3R0JA 3SF8A 1ADGA 2PG3A 2IXAA 3V3TA 3SC6A 1NOIA 3B51X 1PFQA 1YZVA 2YYZA 3EGDB 4WBNB 3TSWA 4BN0A 2DJ5A 1HQKA 3DF9A 3O7WA 5KTTA 1WG8A 5CFPA 1K88A 4S1WA 4JP2A 1P3Y1 3F4LA 3A7DA 4B3DA 4MS3B 2PX0A 3W5JA 3SBDA 4WFJA 5L6LB 1NRIA 1SC3A 5JVDA 2ZT7A 1ENYA 4LDAA 1AKTA 5HBGA 4TL9A 4D57A 2C54A 1YFLA 2F3RA 3IP3A 1ZMBA 3DE7X 4F1WA 1QOQB 2WUWE 3GQBB 5F33A 3IQFA 2X8AA 2R6AA 3L7BA 4U2KA 3EF0A 3W90A 4HWTA 3E9DA 4DR7B 1RHUA 1KEKA 1I3MA 4WDQA 2WHYA 3LCUA 4IDGA 2IZZA 5MFPA 5K01A 3DZIA 3BCUA 4U9UA 2I3AA 1JI3A 3HRIA 4WFIA 5L7TA 1E6MA 1XEFA 4LA4A 5EC8A 1Y6JA 4IINA 4KACA 4O1MA 2JLQA 2XZLA 1MIOB 2AGVA 2VHJA 5C7YA 2V7VA 2BCEA 3FTDA 3JRXA 2IYOA 1NBMD 1AMOA 5ALZA 3LQKA 5CLGA 1CJUC 4FE7A 3IEKA 4ALNA 3MJSA 4F38A 5EJAA 4X1YA 1CRPA 4WGFA 5IUNC 1NP6A 2OC9A 3FPKA 4GMFA 4DMRA 1VHTA 3V1MA 1E4YA 2ODWA 4N54A 4NONA 1SKYE 4QYIB 4ZXFA 3IQHX 4Q3DA 3A4YA 1AM4D 2CVPA 4G67A 5I7AA 2BGWA 3ROZA 4IJ5A 1A8UA 3COWA 3CCFA 4UBMA 3LTNC 1XZNA 3H3JA 4CDNA 3ORHA 4ND6A 4WSOA 3ZZ0A 3GPLA 1J2RA 5DM2A 1N7HA 1V5IA 1ECCA 3BH6A 3JAKB 4NV1A 3R76A 3AI7A 3E8MA 3TJMA 3DNPA 2EZTA 4B75A 4K9SA 3PEEA 4GZLA 1MEEA 1E4OA 2J7PA 3LV8A 4JBLA 1C3JA 3A0UA 1JLRA 3JYNA 4PZLA 5ERXA 1V8FA 4A2WA 5CG1A 4KQCA 4J0DA 4NABA 2QQFA 2GM3A 3ONEA 2YIJA 1NVVQ 3ABSB 4ZQCB 1EQAA 1NUSA 2CC2A 1ZEJA 4ADSG 4BWGA 1J49A 3DE3X 3F5DA 3MJDA 2OR3A 4Q16A 2EKBA 1FNDA 1YSCA 2Z9DA 2O6HA 4U3JA 4P4TA 1C7FA 3BE6A 4N3GA 2ZCUA 1NMQA 1HYGA 4IXDA 3H42B 4AUMA 3ROFA 2OAQ1 3L06A 5ER6A 1PTJA 3CBGA 3Q88A 4ND2A 1ODFA 4JJKA 3ZCVA 1IQRA 3MB5A 3BCRA 1CD5A 1J0XO 3QZUA 3I34X 2XOEA 2OZLA 3HV2A 2Z58A 2J3IA 3TE7A 1JECA 2JKVA 2QQEA 2Q4DA 4NE2A 5M2QA 2O4CA 3L07A 4DVJA 1W87A 2Y9MB 1Z5PA 4ZVKA 1GQRA 3SZMA 3H2ZA 1C7EA 4JB0A 4ARAA 4EEXA 1L5OA 2D6FA 2JRCA 1FRNA 4CFYA 2IOHA 4ALJA 2X42A 1ONNA 3GVHA 1NXWA 2OLKA 2XEDA 4TWBA 4EKEA 3KAPA 1TYEB 4B6RA 2BTOA 1UBFA 4R51A 1IUNA 2CUZA 2QRVB 3IQZA 1LJ8A 3NJRA 3KHSA 4J0IA 1WO8A 1HE8B 1P2SA 3NBUA 4V0NA 1E32A 4FR0A 4LOLA 2YQ4A 4N5LA 4RD4A 4UZSA 5JECA 1YR6A 3ZHOA 2HSJA 2XUHA 4F1JA 3K1TA 4N0MA 4XEUA 2QTVA 5FJIA 3TQFA 2CV2A 4JC8A 1DIBA 4MCAA 5JJBA 2FLWA 2O7VA 4DLXA 1FJXA 1B6SA 2WV7A 5AH0A 1NUTA 4IHKA 3R09A 4IQ8A 2BEUB 3C15C 1ZC4A 3MMNA 3OIYA 2A4MA 3TRKA 4EATA 1CPYA 2WJAA 4OF4A 3NFYA 4RYDA 2G06A 5F77A 2IDMA 2FPUA 4NAUA 1P29A 4JVNA 3AG6A 3A1EA 3Q0TA 4DIBA 4TKLA 3Q2OA 3G2OA 2XY4A 1J97A 3T1VA 3WIBA 3TX6A 4EG6A 1WCV1 1ICEA 3SG0A 1IY2A 1DV1A 4ARBA 1N77A 4I3GA 4YHBA 1N2EA 3NWOA 3VPDA 4ROTA 4E2WA 1T2CA 3V8EA 1RQXA 1YR2A 5HKLA 3V4SA 3EIOA 2J5RA 3LX6A 1DUSA 3TIFA 2VDWB 2ZVDA 2BMVA 1ZH2A 4EG4A 5ILOA 4P92A 1G3RA 4YP5A 5TQ0B 2OEPA 2DGDA 4YRPA 1CRQA 2XA9A 2BZ0A 5C1DA 4P7KA 5AK5A 3AR4A 3QXGA 4UUMA 1SCBA 3OPXA 1R0WA 4PR3A 4CQNA 2PX5A 1Y3AA 3B6KA 2GILA 3UAZA 3BIFA 1KIAA 3RC8A 1VB3A 4NS1A 4FWTA 2C7BA 1OB5A 1N6NA 4W5JA 2UVPA 1D4AA 1L7XA 1PL8A 2IPOA 1I7PA 2B8JA 2J3JA 2CJWB 2YRXA 3E2MA 4NAVA 1DKOA 1U9ZA 3N07A 4UHEA 1C1DA 2OESA 2P3SA 3OICA 1TADA 2BKLA 2P3OA 2DR3A 2ZIUB 4R9VA 2LBPA 4XPIB 5CT8A 3STYA 1BEEA 3C1UA 1N7IA 1BE0A 2AYZA 1LPAB 2YL2A 1TPYA 4PCUA 3RD5A 1XP5A 2YYSA 1GKLA 3RS5A 3TQTA 1A2OA 3TQHA 1TVMA 3FF1A 1R27A 3OHSX 5ALEA 2AFIA 2GN6A 4J4BA 1WXEA 3ZGXA 3B2NA 2C7RA 4NCIA 4O6VA 5JNTA 2WUFA 2DWOA 5TS3A 5C8VA 2NO7A 1WQ4A 2NO6A 1GGHA 3INNA 4ZYYA 2WZQA 2GRAA 2G5TA 5AOBA 1NJSA 4PXAA 4UNIA 5JTTA 2GCPA 3UXMA 4PYQA 3Q7IA 3VV3A 4EI7A 2CV0A 4BCBA 1SBHA 1T3GA 4KWTA 5BN3A 3A3KA 3CR3C 3KEMA 4O02B 3KSDO 1R3DA 6YASA 1QLWA 3K9NA 1JHYA 4DCOA 1L4YA 4C0AC 4DKXA 1WZCA 1TKBA 1VPLA 5CPBA 3E5RA 1N2ZA 2NAPA 3AUJB 3D7RA 5G0TA 1E3WA 1VB5A 1GG9A 1G60A 1K6MA 1OTYA 2PD4A 1JJIA 1WHSB 5HF8A 2IZ1A 4LJ5A 2AV6A 1Y7IA 2VJMA 4QRIA 1LWNA 1E20A 5BWOA 4BNGA 2BISA 4L4UA 1TYZA 4S1OA 1CCWA 1ORHA 3IOBA 1JQAA 4XWKA 3H04A 1L5KA 1F0NA 2W43A 4QLOA 3KLNA 2H5JA 2NAFA 3Q3JB 4BFYA 2Q2WA 2HU5A 2NXEA 4XPZA 4QWMA 3AVWA 4UU0A 1QZTA 4DLVA 4IMRA 1JR2A 3HDYA 4DUZB 1CUVA 2FXIA 3S55A 2X5XA 5D85A 3GAAA 1QH0A 5AYVA 4PGAA 3RFTA 3DUFB 2YUTA 4BKOA 4DEYA 4TUYB 5LXTB 2JVKA 4JOSA 4QFMA 1TTQB 3OIVA 1TIPA 5K45A 2E6KA 2PWPA 5JZSA 4AD8A 2VPWA 4FT2A 1UFOA 3R0IA 1JHRA 2OGSA 4GOOD 4B2LA 1KP3A 2B1RA 1XMVA 2G63A 3WRXC 4LXIA 4EA7A 3HHEA 1RVV1 2PVCA 2VKTA 4EG3A 1GD1O 4R6WA 5EMKA 1Z63A 2BAGA 1LVGA 2Q9BA 2XNJA 3DAHA 3CEMA 3FGPA 1M1YE 2MYPA 3NDBB 4RVGA 4G25A 2VWPA 2VYVD 1HZZA 2VP5A 3KVVA 1C0PA 5COBA 4FNOA 4HZUA 3FWPA 1WKVA 4PGMA 4TWRA 3I76A 1ZNZA 2LDXA 2IEYA 4INOA 4UMDA 3WLPA 1ZVVA 3T4XA 4RH3A 3AJDA 3OE7A 3DV0B 2C4NA 3PE3A 2EDCA 1MO3A 2O7SA 3KVRA 4XB6B 1FTGA 5CK5A 2BI4A 2IUYA 3UB3A 3H2HA 4B6EA 4LY6A 2C8JA 3ZNQA 4C4XA 2KE5A 3QIVA 4X6UA 1R5OA 3NV9A 2W2KB 5BNIA 2OQIA 3E53A 2AW3A 1BWRA 2GCNA 4BP1A 2JARA 4EDFA 2DERA 1P2GA 4LMAA 5BV8A 3HEMA 4BZWA 3WGIA 1ZNWA 3I42A 3FN4A 3MWLA 4D9KA 1QH1B 5I3CA 3LGXA 2G9UA 2C2WA 4QU5A 5HDBB 1Z0DA 3CZPA 4PQGA 2QY6A 4CL3A 3CN9A 5TMBA 3CVWA 1OX4A 5IKEA 4LNUB 2EX4A 2VK1A 3FOCA 1BD3A 1SD1A 4AC9A 1U99A 3QFFA 4PIPA 3RVRA 1ZUIA 2ODEA 2PNFA 3CH4B 2EQ5A 2PR7A 3LPNA 4OGLA 2Z5VA 3BSFA 3KOXA 4WNAA 4HQ6A 2HSZA 1GSAA 1XCGB 2R85A 4ER7A 4QHYA 5CW2A 1YVEI 1OBFO 1JKXA 1FB5A 3B5EA 1X86B 1IWBB 2B99A 1CUYA 2R5NA 3NV7A 3V5NA 3MB8A 2FE1A 3WS7A 3ZIAA 1BVHA 4DXHA 2A88A 2CMGA 5CCEA 5EZ6B 3U7QA 3HTXA 1JLSA 1YQDA 3Q40A 4DNXA 2BWJA 3R24A 4D0NA 1W88B 3I30X 4J3FA 4B71A 2BR3A 4BE4A 1J5PA 3NPAA 3BHNA 1WPXA 1BTOA 1G21E 2B4QA 2FPIA 4TRJA 2B2NA 1E2LA 4NJEA 3RT1A 1NVXQ 3FUTA 3T54A 2G5PA 3SCZA 3KSUA 1V47A 3BE8A 1DINA 3CVXA 3MXTA 3I6MA 4OP1A 1PHRA 2DFKB 4INPA 3DFUA 4A10A 1P19A 3GRKA 4UNPA 1G17A 1OZAA 2C2GA 2HJ9A 3M1AA 5JCJA 1P1BA 2PBRA 1V5GA 4OMDA 4YYZA 1BCSB 2B5VA 1FF9A 4UBIA 4TZTA 3ORYA 3HKCB 1P1JA 1Y6ZA 1Y9EA 3BXOA 1SO8A 4HNTA 4OB7A 4AJPA 1KVUA 2XIJA 3FNRA 2AR0A 3OA0A 4MVJH 1YI0A 5KKCA 3CWQA 4OUDA 4NXMB 1TO1E 2DEUA 2N0SA 3NGXA 2R96A 4YXFA 1R4MA 4HR7A 1CE8A 4FSHA 4ND7A 3ZHYA 3HCDA 4R3WA 3SVTA 4G1EB 1R0ZA 2H0AA 5DNVA 1U1DA 2IV2X 1FJGB 1MABB 2WWTA 4HZGA 4CW7A 1E59A 1GZVA 2FOXA 1W48A 3CZAA 2VP2A 2XCOA 3D02A 2JIMA 2V6MA 1R4NB 1XZFA 3A1NA 3GNLA 3KU1A 4K2AA 3O93A 1E2UA 2FUG6 5KYWA 3NFRA 1F0YA 2YZNA 5FUYA 4HNAA 5E4YA 3T5TA 4DR3B 3MS7A 2QBYB 4ICIA 4FJ2A 1BGWA 3PUWA 4S24A 5EAIA 3ZDCA 2CL0X 5E6UA 1QVVA 2QTLA 1NM5A 1Y7LA 2J46A 3JQEA 2IYSA 1E3JA 1MPXA 1P73A 4FR2A 3AJEA 1PR2A 4IIGA 4OXRA 1LW7A 3H6HA 4WKOA 1UBGA 4I6GA 3WWCA 3HGTA 1U9YA 5ABPA 2A30A 3L4BC 1PLLA 4GD3Q 1DARA 1JRLA 2FMIA 4MPDA 3PC8A 3T7CA 2QRMA 2YXEA 4Q4HB 5DBIA 3UHAA 2GPAA 4NCKA 1T9GR 1DIAA 4QBFA 2FDCA 2IEDA 3E3OA 2HMUA 1CQWA 2RBEA 2V9PA 4LYFA 2J5BA 2QG9A 3Q1KA 4NULA 3WNCA 2OO5C 2P4HX 3GLFE 1BKSB 2Q5OA 4FBMA 3KKZA 1CY8A 2ATVA 2D8AA 3H8JA 5GGYA 4FILA 1DBWA 2ZI9A 2H00A 4R1PA 3RDPA 2X9VA 3BKXA 4HWOA 3TBKA 4MJ3A 4ECAA 1JFFB 5CYFA 3AIOA 3ZK7A 4FPXA 1PEAA 4C4OA 3LNTA 1SQ5A 2GJSA 3ZDZB 2PUTA 4RHUA 1VHQA 1V95A 2AOTB 2EHDA 2QVBA 5IM4F 1XZGA 3PUZA 4OQMA 4C3OB 2FJPA 4EK9A 5DP2A 1F06A 1GAJA 4QGSA 4YMHA 2X19A 3L8MA 2JF0A 2W2TA 3ACBA 3ETLA 1YOVB 1OBCA 3HPQA 3I9MA 1QYVA 4WN9B 1DKMA 1U31A 2D2FA 4ENUA 1U2DC 4LHEA 1XZKA 1ZL0A 3C45A 5C1OA 1BXGA 5YASA 3EN0A 2PR2A 1KKLA 1VA4A 3E18A 2DBRA 3M5CA 3WLLA 4HWPA 1PKEA 1WBJB 3CUVA 1U0SY 1USKA 5HKKD 3OJEA 2Q0HA 2FW6A 2WQZA 3B70A 2OAEA 3EIFA 2OZKA 3AKCA 3O4RA 3MQ4A 1V7QA 4LSZA 4J0HA 1VL1A 5BY2A 1JDUA 2NU9A 3TAXA 2O3QA 3BN3A 1PZXA 1N2JA 3HYTA 2VZLA 1J33A 1TRKA 1EFRA 3WLQA 2D13A 2ZSDA 1EWQA 3ZGYA 1TXGA 3B7PA 5I9MA 1Q0QA 1GCUA 3AU9A 2ENUA 4B80A 2R4QA 1ZUD1 2F3PA 1BMFD 3W5CA 3DL4A 1K5DA 3IPLA 3QHAA 1NC3A 1VLZA 1U8CB 3QYAA 1JALA 3EVTA 1E6EA 2Y1DA 4JY7A 2HA2A 4KL8S 4HUQA 2B1GA 3DAYA 3RRNA 3ELWA 3FE2A 4YGYA 4BX9A 4MW0A 4V1CB 3PA6A 1I7NA 4AM8A 1AHHA 3HRHA 2P4SA 3NHBA 2HA7A 2XUOA 3QFTA 1HDOA 2J4CA 4Z4GA 5CP8A 2Y1LA 3WYCA 1UAGA 2G4VA 1EYZA 1ZD8A 4V0MA 1VIDA 3SZUA 2ZITA 3W4JA 1QK3A 3ZI0A 4HV4A 1KQGA 3THWA 4JI4B 3JAMA 2OM6A 3CX6A 2WY2D 4PE5B 2FW9A 5FUBA 1FLDA 1ZRSA 4Y9TA 4ZZ1A 2O8BB 5EWJB 1JR4A 2FN3A 1T0HB 2AFVA 1UJCA 5DDIP 1AK9A 4NPCA 4LDJA 1RQNA 4D3FA 3ZGZA 1RIIA 5AVXA 4KE6A 2HMTA 3WSTA 3NM5A 1N8NA 1TNDA 4HDSB 5A3VA 4YUZA 1E3SA 4NHOA 5I5EA 1OLUB 1ZYUA 5HSGA 4XLZA 4QUDA 3TS1A 3WC4A 4ZHQB 1RW4A 4KMOA 1TM3E 2GYWA 3BGOS 1Q50A 4C4YA 1U0BB 1GA1A 4ARIA 2P3QA 5IBCA 3LDUA 3RYCA 1OH6A 4P31A 1QIKA 5DLYA 5T67A 1WVIA 3NH9A 1FFGA 4BPRA 1ZIYA 5FOSA 3S4YA 4NFSA 4DJFC 3GGJA 3LU1A 5TY0A 1JFTA 1RRMA 3LC2O 1T4CA 1XZBA 4S1PA 4CMJA 1YMVA 1FQKA 1ZOOA 3WFZA 5BSGA 4FUQA 2WJPA 1JW9B 3HPRA 4U7DA 3OJCA 1ML3A 3FI0A 4PQYA 1G4HA 2OA0A 3C3WA 4JA2A 1P31A 3ZWPA 4B73A 4YRIA 1XVTA 3H97A 3NBQA 5JWRA 4U39A 2R00C 3M5WA 3X1WA 1QS0B 221PA 2R1TB 2XPCA 4RGYA 3U4DA 2NP6A 3FVTA 1V41E 3GP5A 3P8ZA 1BMTA 3N2EA 5C3UA 1JNXX 2YVUA 4JC5A 5DJ5A 1NPTO 2Q1TA 3YASA 2DPHA 4EA9A 2DVMA 3PR1A 1P6UA 1HLDA 2DLDA 1Z5VA 2IUTA 2O0LA 2O07A 4FYKA 4TMVA 4CTNA 2GA9A 1V26A 3Q7RA 3ZG6A 4CFZA 4IDCA 3VR0A 5FUQA 1GRQA 2ZS7A 1AQUA 1CUEA 1E1NA 5COQA 4R9SA 3CNEA 2CZGA 2ZPAA 1D1PA 4UPEA 1IN8A 1QO7A 2FEMA 1UXGA 3C8ZA 1IN5A 2PKQO 2KJQA 2YWBA 4HGYA 1FLVA 2R87A 1KVTA 2QDXA 2XUIA 1GUZA 2I4LA 1EVJA 1G55A 1P18A 3G0DA 1V25A 1IN6A 2C0QA 4EAAA 4RF3A 1CQJA 1T5BA 4LTDA 1G16A 1MNAA 1YZNA 1KTVA 1G8GA 3F5SA 3N39C 1ZCJA 3QVSA 4U1RA 3WGZA 2X41A 1RYYA 3CZ4A 1NONA 3GG9A 1ZGJA 3K5PA 4G0QA 1CLUA 2HUPA 2AOWA 4MICA 3G2NA 3R5KA 4HQKA 2VAMA 1WMSA 1ZO8A 4D3SA 3L46A 3ECAA 1EUCB 4CPDA 4C78A 3UMMA 4UBOA 2J5QA 2ZE7A 3DTYA 2YFKA 2NPFA 4YAUA 1UBKS 2O2GA 2VTBB 2TMKA 3HR7A 4QQRA 1LI5A 1KL7A 1ZVQA 2G0AA 1RQRA 1UFKA 1Y82A 2B4TO 2I2FA 2PL3A 1BN7A 3DXFA 1N0VC 4JR0A 1SR8A 5TQJA 2ZI7A 1FQWA 1N6HA 5KDLA 1VKOA 3T7DA 3KKEA 4AJ1A 3U09A 2O2XA 2EQAA 3CH7A 2ZE6A 2FMFA 4NDAA 5DVZA 5K2MA 5T3UA 5HQTA 1D07A 2G4LA 1UWCA 2CDRA 2PGOA 2R9VA 3CCCA 4JJAA 1TAUA 4ZTZB 4TROA 2C3OA 2XMRA 4FHFA 4GMXA 3EXAA 4LCBA 5ES3A 5BV2P 5KIAA 3MRVA 5EZSA 2XQKA 1O8BA 4G4SO 1VI2A 2Q4RA 4WNIA 5AKEA 3OQBA 2V54A 1QK4A 2H7CA 1TO6A 1JIKA 4DZTA 3OPYI 1ZWKA 1II8B 4RZUA 5E9AA 3HA5A 3SEFA 4V2IA 2VYND 1A8HA 1AGYA 2XMGA 3GLSA 1EM6A 3P94A 1CY6A 4ZT5A 1AHNA 1REQA 5B55A 3GLGA 1VSBA 3HJGA 3QLTA 4JJGA 2IW3A 3PENA 3RYIA 4FINA 4HOYA 1XEXB 2Q45A 3QF4A 4MUGA 4XDGA 5I7EA 3D31A 3OQVA 4BGEA 1T36A 1IE3A 3I5UA 1SMKA 4I4TA 5B58T 5F7OA 3MINB 1N5DA 3FUVA 4KGVA 1Y63A 4ZAZA 1NXXA 3ZNPA 5I7FA 2GAJA 5B57C 3DYVA 1UAYA 3MT0A 4RQTA 4B3MB 3P9NA 3LUAA 1J2JA 4Y6GB 1YBHA 4R71A 1RJ9A 3TQQA 3BDAA 4JDUA 4ETMA 5JBQA 4A8TA 1CUDA 2WILA 4JYAB 3JQ7A 1X1AA 4TTPA 3FPGA 4R41A 3TG8A 2WYWA 3O8QA 4O08A 5F1KA 1V8DA 5KYYB 3HDJA 2P9FA 2HXSA 4H1VA 2IEZA 3T5GA 3IEVA 3CNBA 4BNYA 3WL5A 1SOAA 2ZROA 1WSBA 2WSYB 4R9UC 3BS4A 3E35A 3W6NA 4LYEA 1QU3A 2B9EA 4O2RA 2GPSA 2GTIA 1BVYF 3KTOA 4UCFA 3WNDA 4MWZA 1C2TA 2IPAB 3AUAA 3EEOA 5IU6A 1IM8A 5ALHA 2XMBA 5DYTA 3WFJA 4ARZB 1DQSA 4QYSA 3BHMA 1XYYA 2K5UA 3QPWA 3E5HA 5B4UA 1NBHA 3KQQA 2NXCA 2I55A 4NJMB 5CB4F 4KTTE 1DHTA 3ZHQA 3ANYB 1NU8A 1I6KA 4P83A 1VG9B 3I9V6 1ARZA 2XQGA 1UR5A 4EQ6B 4GPEA 2APJA 3C16C 3QY9A 4V0OA 1U80A 1S7GA 3OU6A 4TKUB 3DFFA 1CQIA 4KVAA 1JLLA 4MTLA 1GNSA 4GI7A 2FW1A 1E2KA 4RMNA 3PEVA 2HFJA 1E8DA 3JSXA 1OF1A 2RMKA 5FWXB 1BVUA 1SOMA 2EFCB 3NIBA 3TG2A 3BWDD 1JIIA 1WQ3A 4KXFB 4JUDX 3CJTA 2JZOA 1FUEA 5F12A 3NONA 2F8MA 4INZA 1N3IA 4RKRA 1IH8A 1YULA 3EUFA 1D7AA 1QGED 1EK6A 5J2UF 1TVKA 5DTRA 1E2PA 3QMPA 3GXOA 4ND1A 2JD1A 3AETB 1KAGA 3NLLA 1NVEA 4HWGA 1EG7A 3AVYA 4PZEA 4NPAA 4TV9B 4WI1A 2QM7A 3PF8A 3KV3O 2FPKA 5ESDA 5F5NA 3SHWA 3UOWA 7REQB 3T1TA 1GL3A 2R2AA 3W2TA 4DLKA 1BJKA 3NIFB 5KNCD 1OBHA 3EGXA 4AO6A 1DADA 3FVVA 5IKMA 5TQ2A 3AVPA 2WSLA 2QNRA 5DKFA 4A36A 2KSQA 3IKTA 1G3IA 3DZCA 2EL7A 5ALFA 4JJ8A 1VRWA 2ACWA 3K6JA 1X7DA 1E2QA 1JQLB 4R2HA 2CJXA 4YLGA 5K3FA 2NX2A 4RYLA 1GZ6A 3HJCA 8GPBA 3W4IA 4IV8A 5AVSA 4MWCA 2OGZA 3IRUA 3PTAA 3UUEA 1G8KA 2RK3A 4MARA 2WTXA 1GO2A 3MT8A 4DXAA 3WGNA 2QSJA 3KX2A 4NZNA 3NDRA 5JNRA 4KWEA 5K4GA 4LJ6A 4GSLA 5FLEX 2ZYHA 2YVQA 1SXGA 3E8XA 2WIAA 3LQFA 4TS3A 5LDHA 3B1XA 3CA8A 3N3BC 2B21A 1Z82A 3NHPA 5FFNA 3RTBA 4ARSA 3PYMA 3VNVA 4GWLA 3N7UA 2XTZA 3KUDA 3MT7A 2CL6X 3SIXA 3UENA 4GRIA 1KK3A 1PW7A 2AWNA 3ZEAA 4CEJB 5LSAA 3C70A 2ZZKA 3O26A 1TKRA 2RFLA 2E21A 2UYOA 5LMUB 3QQ5A 5FFFA 1V6CA 4WJLA 5HZGA 2P91A 3U7GA 1DKRA 2CNWD 3ZU2A 1Z4QA 4MKZA 4EPYA 4YCMA 5A5FA 4NICA 1KEVA 3SJZA 2DHCA 3IRVA 4M22A 3P2MA 3PUJA 2WYVA 4BC0A 1R6BX 4P8RA 2A94A 4TV8F 3IXQA 13PKA 1F9AA 4GP6A 4H7DA 4QQKA 5EA2A 4A8JC 1X74A 3K70D 3PGMA 1E1YA 2VHEA 3RABA 3U4IA 1FYDA 2A9KA 4G09A 4FYIA 4R3NA 1JWAB 4LNHA 5JH7A 2EC5A 3ZQUA 1MA3A 3GOQA 4A0QA 4RW0A 3MBKA 4TLAA 3DZFA 3QM1A 4KDCA 4MWTA 5DI3B 1V1JA 2XE8A 3WJ2A 4C0QC 4TLLB 3VA7A 1J9EA 2PUAA 1Y5MA 3H5AA 3STVA 4XLTA 2ONZA 2QMOA 2QRNA 3WIUA 3AIKA 3QUCA 3MSXA 1DBPA 4NWIA 5E2IA 5KI6A 2EFDB 2PQ6A 1M7HA 4PHCA 4EMBA 1XZEA 2XEXA 3SYMA 5CB4B 3KM0A 1SHTX 1YQQA 2LGJA 2Q5QA 3FWNA 1G20A 3OCCA 5D3QA 2PXHA 1WF6A 1KMHB 2Q3LA 4LYYA 5EP1A 2CMFA 2X1VA 4M55A 4HB0A 4RCVA 2VCYA 4LF7B 1WBBA 4BMDA 4DQ0A 1L8QA 1VBKA 4M8NE 3UUWA 4BNVA 2GBCA 1E2FA 2D7JA 3D3EA 3DVRX 4OYYA 4H60A 4RVSA 1MO5A 4XM0A 2JVIA 5A3QA 5EWMB 5F2EA 1KO8A 3DHVA 4YJHB 1TLTA 3UHPA 2RCYA 2Z8XA 4WZAB 4IEIA 4YQFA 4ZT6A 3E58A 1N3YA 5L51A 4IYRA 5EPOA 2ACVA 2DUJA 7MDHA 1WU8A 4LK2A 1KJQA 2WZCA 3KPJA 3O1HB 5CDHA 3HK2A 4Z1MD 3OEED 4YRGA 4OFBA 4MQ6A 4N7MA 3IMEA 1Y3DE 4BO8A 3M1YA 5C3MA 5B2FA 4ZDWA 4LS3A 2Q9AA 4MV5A 1OVGA 1E63A 2AKYA 3USES 1G42A 1LPSA 4A2PA 4GKKB 4AZ0B 1IQPA 4K40A 3DGFC 3O75A 4P93A 2VJQA 1Z6AA 5FPPA 4CT5A 4N76A 4FJ1A 2QZ4A 3SSAA 4PANA 2AXPA 3RUEA 2E1PA 3QEKA 4DHWA 4Q7EA 3SC2A 4FB4A 2YOHA 4CHTA 4QOIA 4YCDA 5HIAA 3NBMA 1SCUB 1IL0A 4V3CA 5I4IA 3SFZA 4BAZA 1PFWA 4DZZA 3EA4A 3Q98A 4IFBA 4RHYA 4P86A 4JBWA 2JGEA 4EEZA 4GVXA 3M6MD 1OAOC 1TKAA 1U94A 4TTRA 2BE9A 4KVFA 3ENVA 4IXTA 4CG2A 4D8XA 3FBTA 4L2IA 3SY8A 1RE1A 5FBRB 5LZ5A 3UB2A 3MOIA 4DR6B 4B35A 1DWUA 3UF0A 4F3NA 4F9EA 2JAPA 2RKWA 3JY6A 1F48A 1KSFX 3OLQA 3X1YA 2B83A 5EHZA 5ICGA 5JT1A 3BVPA 3IDOA 5EJ4A 5KNDH 5LOVA 4R98A 4HX9A 4P80A 4OA5A 2PQ2A 1NXOA 2ZWIA 5IJ0A 1N5LA 2YMMA 4G2NA 2AMJA 3LK7A 1GQYA 5FULA 1T29A 2A0KA 1J0AA 3H11A 4KI7A 3OOSA 2QE6A 1J0BA 2I4TA 2FWRA 3LKDA 3EH2A 3WBJA 4C2UA 3AC0A 1YKFA 3KOOA 5KSPA 1FL9A 1Q0SA 1ZLYA 3JVIA 1V48A 3KFVA 3PFGA 3PXAA 4UHDA 3UMVA 1A9PA 3HJHA 3K4QA 1VLJA 1SXHA 1QPBA 2PUWA 2V97A 2Z3ZA 3BZWA 3H4MA 5AM5A 3UOGA 4R6XA 2J87A 4V38A 1Q91A 3GPBA 4Q3CA 4XWYA 4AIRA 5CBPA 1R8JA 2GCOA 1XMOB 4OX9B 3I9KA 2XT0A 3GV0A 2QB5A 2X0KA 4GIBA 3EGIA 1L4FA 3LS2A 4JOQA 1BX1A 3G17A 4TV8B 1CZLA 1PU2A 4CRWB 1B74A 3PC2A 3LQRA 5LNK6 1IC6A 4B85A 2XUPA 1L5LA 2ZWAA 2PRSA 5HUHA 3OTQA 3GGOA 3MMZA 2SKDA 3UCXA 2ZB3A 3CB4A 4AS2A 5KOJA 4N4AA 5BVGB 3F8SA 3R20A 2Y27A 5A3JA 3P5BA 5C32A 1GL7A 1XROA 1ZUHA 4DMHA 4RDCA 1GCGA 1K2VN 4GR5A 1CZKA 2BFCB 5TR9A 3PNBA 1Q3KA 5KPJA 1RM0A 3LO5A 4BB9A 2XWSA 2FWMX 3WK4A 1NI3A 3DC7A 1HKUA 1P45A 3OPYA 5ENDA 3HCAA 4I55F 3DBRA 1WABA 2H5IA 4AO7A 4ZI7F 3KO8A 2BYTA 4FMCF 1HV8A 2PD6A 2PZKA 3TTTA 4L0DA 4LTNA 3RIYA 4BMVA 5JARA 4DLBA 3C3JA 1UZLA 2IHZA 1KO7A 4DC1A 5LP6C 3U40A 4DARA 4YRZA 1EFVB 4IICA 3TWOA 4US2R 3SEAA 3OMXA 4L74A 2EF1A 4MP8A 4TYQA 4TMKA 4Y6RA 1CUHA 3AUSA 4NCHA 3U4HA 4BBJA 3THXB 2OCYC 2YC4C 1Z07A 3D6VA 3CUEF 3WQQA 1AMUA 2ODAA 2P4EA 2IE8A 4JI2B 1XNQB 4PC1A 1Z75A 1CQXA 4BJHB 3O8DA 4QGGA 4QTTB 4WKGA 5H70A 3MMSA 1BYIA 1PDWA 4R2LA 1WSAA 1RLTA 2OXCA 1Z7BA 3ZTYA 4U63A 2VF8A 2GUGA 4LXXA 1I9CA 2FG5A 4J2TA 2CVHA 4OKIA 3X43A 4RPJA 2KBFA 4UOQA 3ONWA 1F17A 5DTEA 3FNQA 1JR6A 3CX3A 3WQRA 2FCRA 1JEYB 2BFAA 4DSNA 3PHIA 2BGTA 2X2EA 1H8EA 1TVEA 1EFKA 4IV5A 4ETIA 4FS3A 1H6AA 3GJ7A 3I2KA 3HXLA 1BDHA 2HQSA 4URVR 2ID7A 1A5BB 2AK2A 4I81A 4GWKA 4F5WA 3PGKA 4E11A 2VSYA 4N47A 1M34A 2NGRA 3BSWA 5ALKA 2RHWA 1NQTA 2BT4A 2Y0EA 1JHAA 1IEVA 2G7ZA 3BGWA 2FPSA 5F1PA 4DGSA 2P75A 1JJFA 5T41A 2V1UA 2OSVA 5EIEA 4HAXA 4AJLA 2DZDA 1XVAA 4HADA 4UU8A 3WQSB 5KWIA 3DW1X 2VSXA 1FMLA 4Z9XA 1XRNA 3K5WA 5IP5A 1PEKE 1LQUA 3QE9Y 3OMWA 3LKVA 2RI6A 4NU6A 2R7AA 1TECE 1G18A 2W6OA 4J1TC 1RYNA 3SXUA 1QCCA 2M2IA 4WKCA 2CLDX 2JFNA 1TJPB 4LRSB 1R4ZA 1HX7A 4PZCA 4BEBA 1P5HA 2PUFA 4KXYA 1A4RA 3W2HA 4CM9D 2PEYA 3JQ9C 3NM4A 4IDNA 2Q3EA 3EOAI 3G5UA 4PLHA 3QLUA 3S3TA 3EF3A 4OMFG 1VSUA 4HFJA 5K0GA 1Z9BA 1X0XA 3CVJA 4TM8A 1E1CA 2OV1A 4M6WB 4YCBA 3A70A 2IV7A 1TYCA 3MTBA 5C4GB 1VTKA 4HGNA 5AT1A 3VM6A 5ADWA 4ZHSA 3K9FC 4AS1A 2CSXA 2HJHA 1I2BA 3O8RA 2ZTUA 1V11B 3EC7A 4ESHA 1WULS 1QZ3A 3HFSA 1JUDA 1MMFB 5EPEA 1FDWA 2GEBA 3WLJA 1T8YA 4I19A 3AY7A 2V0GA 1NI4B 1X7YA 3BTVA 3VJLA 3DDNA 1R6TA 1CY7A 1D2NA 1RLIA 3DCNA 3I32A 3UIEA 4R2MA 3QU5A 4E5VA 2YJTD 2RH8A 3H75A 4NOJA 4W1SA 3CE6A 2WG2A 2F55A 2XCTB 1I4TD 4LDZA 4JBNA 4JWTA 2J3EA 1UWVA 2LIPA 1X7WA 2C82A 3BCSA 3F2IA 3KPYA 4FYYA 3S28A 1RHKA 2IFTA 3GLUA 3R5XA 4QDZA 1TZMA 2JBAB 3DVAB 2FFRA 4ND3A 1DLIA 3PUIA 1WP4A 3OETA 3L8FA 3PHJA 1J2TA 5CHYA 2CB0A 5CJJA 5J5VA 3RK0A 1EVYA 4C20A 2FFAA 2FUKA 5A4IS 3M49A 1ZD5A 2VZ0A 1HUQA 1PIWA 5HF9A 2FK8A 5EP4A 5B1YA 5LJLA 2CVQA 4G9BA 4F5DA 1Z7GA 3AKDA 3CX4A 4I9GA 5TC4A 2X0RA 2DWUA 3DOCA 2WHXA 4NE7A 1Y4DE 3MCTA 2XQFA 4I55B 5J2TA 1F38A 5C53B 4ZI7B 1WUKS 3I05A 4FMCB 2AJTA 2PVPA 1QU2A 2PPLA 4OJNA 2PUBA 2POQX 4PRZA 4WFQA 2O2JA 4CEHA 5FI0B 5L3SA 2PZGA 5FHQA 5IXJA 4MZXA 4RXMA 3AOGA 4L95C 5KQPA 3C3XA 5FEUA 3VZPA 1WMEA 2BFOA 3L04A 4DG8A 5GIOE 3V34A 4IDDA 3WZ2A 3VR6D 2JGIA 1K5HA 4XSHA 5HJ2A 2J67A 3GZTB 3VYSB 5HVNA 2HRDA 2P0AA 2YH2A 3D1VA 2RB5A 1UKEA 4QFBA 2MSEB 2R2GA 3PE4A 4DYDA 1X2BA 2CVZA 3S7TA 3U1VA 1Q7GA 1QFSA 4TYYA 1JX6A 3IKVA 4YPFA 2GGSA 3E9CA 4MYRA 3QA3E 4D9EA 4BUZA 4IQ0A 2CWWA 2A3RA 4ENQA 2XUKA 3B2QA 1YACA 1XTUA 1F2UA 2EFGA 4NXNB 4IKEA 5ALDA 4BFXA 3O92A 3NHJA 4A03A 1UDRA 2YW9A 4E7PA 4TTSA 2IEAA 3B1WA 3MMXA 1GKYA 4N39A 2R8ZA 3AR5A 4OP3A 4YV2A 3U4QB 1Q20A 4QTUB 3R6LA 2BVNA 3W2EA 4NG5A 4M8LA 4YBZA 5DRTA 4F9GA 4DDVA 5J4YA 3CG4A 5K0ZA 4D7AA 1NDQA 2HHJA 4EFDA 5TLSA 4BX0A 3BWVA 2FE4A 4FNMA 4N3NA 3W9SA 3ZZ1A 1OXTA 2JFZA 2QZJA 3ZIUA 5BW5A 4DR2B 3D6UA 3L6CA 4PC6A 3QHPA 3LPLA 5K0JA 4MRNA 1EU1A 3PNOA 1EUDA 1AQ6A 5A9TA 3WKAA 4IFIA 1ESDA 2BGJA 5I7WA 2QU7A 3KJXA 3KTAB 1YCGA 1NV8A 1C3OA 1EMDA 1MT0A 2NVUA 2PDAA 3LWBA 3M3PA 4UM7A 4HK4A 4BNTA 2B3TA 2D2EA 5IN5A 5IT9A 1FDRA 3PHGA 4FFNA 3KBBA 2G08A 4KXNA 4R54A 1SBIA 3QEMB 5SY9A 3EGWA 4HEJA 1UC4B 3M1IA 1PV2A 4CQLA 1U7DA 1BHJA 1RRFA 2J09A 2ZZNA 6ADHA 2I71A 4B3IA 4DV6B 2VK8A 1Z4NA 2VPPA 3FHCB 2YV5A 3G68A 3I37X 1M2NA 2W6IA 4U9IS 4L5IA 1KDYA 4O25A 4PVCA 4XKJA 2VDMB 3FYUA 3VDRA 1WZUA 3QITA 4JN6B 3QKSB 4BB6A 3S1AB 3QNUA 4IIUA 3AHIA 1ZM7A 3HEBA 5A9RA 4H6PA 2QOEA 3TPFA 3ZDDA 3QVLA 5EZYA 5FT9A 2F59A 5CM8B 2HYIC 5K3DA 4CV1A 3KKLA 2ZTMA 2EJWA 1VHWA 1HM5A 4HDNA 3BFKA 3CNHA 2Y93A 2Y1GA 4TN5A 3E48A 4FFOA 1E3TA 2XGGA 1SG6A 4YRRA 3TQRA 4LHSA 1OW3B 4ZA2A 5MGBA 4JI5B 2G1PA 1FUYB 4MIOA 3IAS1 4UBNA 3ZE7A 3U5ZB 2NZYA 2EYUA 3AB8A 3QKUA 3S27A 3WB0A 3KYCA 4C5BA 4EGCB 4P4UA 1IK4A 2R11A 4N18A 2VWHA 1LV7A 4CUZA 4F7WA 1Z7WA 5DSXA 4ZAYA 4HVLA 4OHWA 2RIRA 3ZE9A 1QGOA 3ETGA 4ZRDA 5JO9A 2G9NA 2JFQA 1PR0A 1KI4A 1YQWA 5FTJA 3VI4B 4FZJA 2AZXA 1JIVA 4J0GA 4NJOA 3WYGA 3CURA 4ZU3A 3INRA 5KU7A 2G07A 2RKOA 1UAAA 4TSFD 1T8PA 1FDIA 2R6FA 3MTQA 3QP9A 2Z2KA 1B0PA 1HK7A 4N5DA 3OCVA 2XMQA 4AJ9A 1HE4A 3FTEA 3GA0A 3SSNA 2IHJA 5JZBA 3Q9LA 3WK8A 2ZYSA 2C9CA 2I2DA 2LDBA 3DTVA 1XTTA 3HXKA 4QC2A 4QGFA 5EXXA 4DRYA 2DUWA 4YO7A 1PNRA 4ZO8A 3PZBA 4IDOA 2FJUA 1K7FB 2DMRA 1PT8A 3K0AA 2ZRQA 2D2IA 2I8CA 3P9RA 3ELYA 5E7IA 1D2GA 3HP4A 4X1KA 4G89A 2XGJA 4QM6A 1KZ4A 3D6MA 2NTVA 4B6PA 4CKYA 3O90A 4BNLA 2DCUA 3SKXA 4FHZA 4G5SA 4NMXB 5DM1A 5LR6A 4YREA 2LV8A 1Q0UA 1JLMA 4PEVA 2VPIA 3JD2A 5DEIA 3DWGA 4H3HB 4M0FA 3S8EA 1T8SA 4AZVA 2QTHA 3HWX1 1E9VA 3BGSA 1AOXA 3OZEA 4KWIA 4LTMA 4MWOA 3IAHA 2V7BA 2XQJA 4I36A 2I3BA 4J7CA 4MI6A 3ELDA 1BE8A 3X1MA 1SU8A 4L5CA 1YCDA 2QQ0A 3MWDB 4X20B 1KH3A 2Z5FA 3BMXA 1CR0A 1DQPA 1USWA 2AQ8A 2G9ZA 2R68A 3PUKA 4O5OA 1N6IA 1UBTS 5IF3A 4PZDA 2CBGA 1PZNA 1M1ZA 1R5JA 2KS6A 2XNDA 3KS9A 3NANA 3OOJA 3QVMA 4RCYA 5IW8A 1J20A 1E4EB 2WJ4A 2W90A 3RBVA 4XOIA 1RM3A 4NECA 2Y1CA 1YMUA 2B4AA 4JT9A 4LKRA 1Y1TA 3G0IA 4KNVA 3OCXA 1X13A 3LY8A 4YXWA 1IG0A 2IHVA 5CCBA 1JKIA 3AXSA 1NZJA 2BF7A 3D2AA 3R7WB 2BHTA 1PYOA 1HGXA 1Y7PA 2CDAA 2I2XB 2MSKA 2SICE 3G5AA 2CFCA 2C3PA 5A6SA 3R41A 1Q11A 3ZXIA 4FGJA 1BOOA 2X9LA 3VX4A 1NJFA 2V6FA 1E5VA 2D4AA 1IZZA 2OZVA 3HJTA 4FDAA 5CU7A 4D5GA 4DJDC 5FADA 1W7AA 2C59A 3HA2A 2XE7A 5KAPA 3K1AB 2H7VA 4FYJA 1C14A 3UEOA 1EE1A 3GFSA 1OFGA 5WRFA 2G76A 1VL8A 3CRZA 5EJ2A 3IXMA 2JAHA 3CT6A 1QTIA 3ICQB 2H3EA 1SWWA 2W6NA 3BWXA 3TLAA 2YFQA 4CM4B 2ZJ6A 3BDVA 2DLCX 3R1IA 2IUEA 3KR1A 2GEDA 1THZA 4UKDA 2WA2A 4RNDB 4OFWA 4WVLA 3KR9A 4O4IB 3MWGA 5G41A 4JD5A 1AA9A 4UM9D 521PA 4WZBA 3TNFA 4MVJE 4UARA 3ZXUB 3PPVA 4H77A 1COWD 2IU3A 4YJ3F 5L7WA 1QMPA 4YT8A 3DF7A 3U3OA 5ED4A 4FMPA 1P17A 1J24A 1HH4A 1RP7A 3S2EA 3T3GA 5K8TA 3DH0A 1JR3E 2F8LA 4MYTA 1ZEMA 1UXKA 1PVVA 1ZVMA 2WFZA 1H3EA 1SVOA 3IQWA 2VKQA 3EFEA 1KHTA 5E6RB 1SURA 4TQGA 5D87A 2GEFA 1OTHA 3UJPA 1L7AA 4LRYA 3M6FA 4DAOA 1RKVA 5FWNA 1QFJA 2VHXA 2CUTA 2FG7C 1UJBA 4U7JA 4JV5B 4ZVMA 1B41A 1NBMA 5JANA 2C04A 2E7ZA 2XF2A 2Y0DA 2A1UA 2Z1NA 1GNLA 1ZUWA 3VR3D 2YICA 2V7GA 4LXQA 5AJWA 3VNRA 5JSZA 1M2GA 2Z9CA 3TLGB 1KWKA 1T43A 1QV9A 1TTPB 4MV1A 4XCQA 4YTEA 2GM9A 3RO7A 5DE3A 3VC3A 4CMAA 1UDXA 1D2CA 4UTOA 1P7PA 5DO9A 4WXHA 5G1OA 4WK4B 3LL4A 2E9SA 1BOFA 3MUFA 3AB7A 3AFHA 4LV5B 2J41A 5TMEA 4OHUA 3QE2A 1JL3A 1DBVO 2YN2A 4AUNA 2G88A 2HM7A 1COZA 2Z3VA 2XCIA 3GYGA 4TTVA 1VJGA 1HDRA 4PZZA 4MV8A 1OLSB 1YBFA 2F4NA 4EY6A 2XB2A 2YBEA 3C3CA 1M0SA 3L8CA 2OVBA 3PDWA 4B9AA 1VJ5A 3HGQA 4QM7A 4D9FA 4TXNA 1EFTA 3QHQA 4M9CA 1M2VA 4EW1A 4GEGA 4Q9LA 3SC4A 2GVNA 3VISA 1A97A 1FRZA 2NYAA 3A9CA 5IXYA 3CW2A 6Q21A 3U44B 4EY8A 3U37A 1AMNA 2P9CA 3D5TA 2WE8A 4FYXA 3L0PA 3HNPA 4G65A 4M37A 5IFLA 2ZXFA 1V37A 3F74A 1RRCA 5E1MA 2V5VA 2MJLA 1VYVA 1K2WA 4RAQA 3KBOA 2V0NA 1ILWA 2E82A 4IILA 2BM0A 1E2GA 1EDBA 3EA0A 3GLRA 3R3WA 3UJ7A 3WDSA 1I24A 2GK4A 4EHFA 4F4UA 3CIFA 3PGJA 1Q0HA 1DAPA 4M1KA 1WOMA 2WF7A 4LJLA 3GT0A 4JODA 1W1IA 2JLWA 1Y8AA 2GPYA 4P1ZA 3QBVA 2X0JA 5JASA 3VR1A 5JADA 4ILEA 2Z2ZA 2W2NA 4JCOA 5FD8A 3Q1LA 4RZQA 4B3HA 4CIAA 2VJPA 5SY6A 1NVKA 1PQYA 3GC6A 5JAHA 4DA4A 3TIXB 1L3BA 1QIFA 3KXDA 3O84A 1O4WA 1ZD3A 4K6HA 4BNDB 1CJVC 4HBZA 4Q9NA 2PRIA 1KKMA 4BO1A 3RV3A 2AWOA 4CLHA 4WESB 1J8FA 3DMHA 3EG9A 3QRWA 3OT4A 4WZZA 5B6IA 4WWHA 2CGEA 3GJSA 2FQYA 3ZGOA 2GMWA 3L0OA 3O8OA 3QOWA 4LBWA 4MKXA 1FYEA 2PYDA 3NWJA 1MENA 2ZJFA 2AEJA 4JQYA 5KYUA 4UHFA 2P9BA 3AVVA 1NUPA 4Q4AA 4DYVA 4K26A 2F1JA 2OAP1 2G5CA 4XD7D 2J9FB 5CVUA 4PFQA 3HR8A 5LVAA 1VL6A 4BNJA 1WRBA 5LBIA 4RDXA 4LFAB 1KARA 3UMFA 1DBRA 1XEWX 3RW9A 1U04A 2FG6C 1O94C 3JZAA 1NBAA 4INJA 1VG8A 1U28C 4WOBA 4OXIA 3NNNA 1YQ9A 3QFCA 1N3LA 3PQ4A 4MS1B 5I9LA 4YJ3B 1YR3A 1V7CA 4M1TA 1RHQA 3V1NA 4EY3A 3KXKA 2NPOA 3WBKA 4I66A 2XHEA 4FT4A 1SOWA 1Z5ZA 1ENZA 4GLFA 3PPWA 3ZXXA 3O74A 3FHTA 1WE2A 2XVAA 2VZEA 3OZBA 5DGIA 2ZCJA 3OFND 4YMGA 2JVJA 5L4NA 4YX9A 1XVIA 1G6Q1 2P2SA 1A7KA 2Q4TA 2CCKA 1D2HA 2C84A 3K9GA 2DKNA 4G1FA 3Q3GE 3D6NB 3L6EA 4CM7A 4HX2A 1C9MA 3IAFA 5E38A 4OB8A 5LMNB 5ECYA 1ORDA 4JU9A 3FOEC 4CLOB 3FRIA 1I4EB 3OLYA 2CT8A 1ZC3A 3K0FB 4REQA 3EX7C 1UWLA 1Z0IA 2X15A 4GWGA 4FW9A 3P71T 3I61A 1XNGA 5DGHA 3QE4A 2G17A 4ZOBA 4PRLA 4QGHA 5B1IA 1QG6A 4IVRA 4LOKA 4BDSA 1QQ7A 5JAIA 4YUAA 2Q62A 3PVSA 1IEQA 4KDFA 4X6XA 4XARA 3CF4G 1ESMA 4GE3A 4QU9A 2QLTA 3M6VA 1M8GA 4IVNA 4JKIA 5IAGA 5JBIA 2R6HA 3J81A 3NHLA 4MVCA 1SN7A 4ZI3A 4D8VA 3LC0A 2NUAB 2XDYA 2CLOB 1H93A 3CC8A 3RF6A 1G5TA 2ZSAA 2QORA 4C7BA 2YN0A 2HY7A 3G02A 1YRLA 4ND4A 3TRJA 3IFSA 1MO4A 2IYRA 3F71A 3LMKA 2XBLA 4QGBA 3D4NA 1W25A 5LDDC 2GHIA 3VPFA 2RGNA 1BA3A 3BILA 1Y1QA 4PYNA 2IWRA 1GT91 1KDPA 3QF7A 2VR1A 5TE9A 2FRDA 2P0YA 3MTIA 5THXA 5BMVF 1D6SA 1BGXT 4P38A 3CUTA 4CV3A 4M7RA 5JO0A 2IF0A 3C0KA 2VDLB 4ZVLA 1S01A 4OLFA 1KS2A 3HVKA 4Q7JB 1N2CB 5CVCA 4URUR 5I47A 3C8DA 5KU1A 1YS2X 1LS6A 5F5LA 3T9AA 4TYNA 5IPFA 3V4PB 1RRPA 4FC6A 2FZKA 4Z7QB 1VBFA 2RGDA 1Q12A 5AKKA 1YJXA 2FF7A 3ZCRA 5FPKA 3WWEA 2QNBA 2CFIA 1GGEA 5CVTA 1Z5UA 5EMJA 2VJYA 1SBQA 3PWZA 2A92A 4TXJA 4JLWA 4CLRA 4YRQA 4EJFA 2WZDA 3ILSA 4FN5A 4O4LA 4TWJA 1GPNA 1J6UA 3JD4A 2GSDA 1A4IA 1NR7A 3L4SO 2D4HA 2WAMA 2I2AA 1ZR4A 5D51S 3IB3A 3DMTC 3SHOA 1UC9A 5LKAA 3FDZB 5FL7D 4WZAE 5E6SA 1ZDMA 4ZFNA 4ZCIA 5BR4A 5AUNB 4OQEA 2XJ9A 3CPSA 4OH1A 2GERA 2P6MA 1X9IA 1AO3A 4PXYA 3KQUA 4XJVA 3S8YA 5ALXA 1Z2CA 2BHNA 2J6HA 3MWKA 1F8GA 2VYVA 4KOAA 4R05A 4RGVA 4A82A 3RRMA 4OLBA 3NDIA 1SBTA 3STHA 4EWLA 1JT2A 3PK0A 4WINA 3C5CA 1DAOA 3Q2KA 4HYYA 3PXBA 4QSHA 1NXSA 3NKVA 4DS3A 2G25A 3L6UA 4B8YA 1JPNA 4HGPA 5CIWA 1N0HA 3JVVA 1ATIA 3SYTA 4H1WA 1GPYA 3K6KA 3I6ZA 4M83A 2O7QA 3CXRA 3F46A 2P9TA 2CLFB 4IJWA 4Q1BA 2F62A 3G2PA 1F8XA 2Y1XA 2WJYA 4G97A 2FPMA 1JV2B 3WJ1A 3DCYA 3ILHA 2PZ8A 4I50A 4YUVA 4AKTA 4KLZA 2RD2A 1W34A 3VTKA 2W71A 1OI4A 2HLDD 4AKIA 2NU7B 1AA6A 2HSWA 4WFKA 3G9QA 4CUKA 5B6JA 1H3NA 2ZKLA 3K0HA 5J5AA 4B48A 4HXYA 2Q1SA 1P9NA 1E66A 3NBFA 2YQ5A 2CHGA 1F4PA 1R9GA 3JQGB 5C4IA 1GITA 4P53A 2PA3A 3QVXA 4E03A 3D3KA 1RJWA 3EEYA 3L49A 4E1BA 4WK2B 3BH7A 2XNCA 5CYGA 3O7MA 4BNZA 1YHYA 3I4LA 3FVRA 3NT5A 1SUEA 1U0EA 1E99A 3AY6A 4P98A 1ZI9A 1U3WA 2FP4B 4G84A 4HEA6 1WXFA 2IUUA 4TGLA 3U49A 4CTKA 1GZ4A 1U5CA 1BA2A 3JWEA 5C2JB 4Y1GA 1LPBB 1Y8QA 3JYQA 3D54D 1PSDA 1RADA 3SYRA 3HCBA 3OJFA 1HETA 2C2YA 4BX3A 2O54A 1U0RA 4MGHA 1X1QA 4AW9A 3V4ZA 2QZPA 1II9A 3TNJA 3VMMA 2GCEA 1EK1A 1X8LA 5AVZA 1JHOA 2D7CA 3WHIA 2AN9A 2WLTA 5JVDF 3MJVA 4QL3A 2W58A 3IE2A 1R3UA 3KNZA 1Z15A 1S4MA 2GZRA 5HDQA 1N34B 1YTUA 4IYJA 1IY1A 4QX6A 3ZR4B 1UBMS 1RCFA 4WCFB 1B8OA 4FIDA 1F7UA 1Y81A 3GFBA 3MCZA 4M0DA 2P2GA 3CVOA 5EKDA 5F35A 5BSFA 1WW8A 2HC9A 4M9SA 4NFLA 2NV0A 3EG5A 4YROA 5BMVB 5JRJA 3GLIA 4H4DA 1PWXA 3N8KA 2IS1A 3PI7A 3MAGA 2XNSA 4Z0NA 1BXRB 3UICA 1L4HA 2FZEA 4CT0A 4FZ5A 3JW8A 4OJYA 4WDRA 5CLLA 5FI3A 3ZIDA 3BERA 4A27A 3G1UA 2DBZA 1RDFA 4EPXA 1IUOA 2WUDA 2ID9A 2D1QA 3CMCO 3LQ4A 2H1OA 2XOKD 4QTZA 4QREA 4JT2A 2Z56A 4FKZA 2QAJA 3MWEB 8MHTA 3NHZA 4FEGA 1JLKA 3QELA 4UQOA 3FBWA 4BJ6A 2H9AA 4BMZA 3I5MA 3SFTA 4XIFA 3SXJA 2CK3D 1K66A 3ROMA 5C46F 1JJ7A 3JATB 4LEIA 1XCJA 4D3XA 3ZLBA 2XBMA 3H5VA 3HCRA 2BIFA 1F60A 2NOAA 3OZSA 1V16A 4FGWA 2XZTA 3V00A 3FWYA 2P0EA 2W8ZA 4Q3BA 3ZHTA 2PMKA 2CNLA 4ZKEA 4B3GA 2WT4A 1TCUA 3CGGA 5GJVC 1RC1A 2Z4RA 4A0FA 3TTUA 1K0FA 1QXSA 4R1QA 5G02A 1WCXA 5CA0B 1QZZA 2EX1A 5IJAA 2C83A 3WL8A 1ONSA 3ED1A 4WNYA 3OA2A 4BWYA 1ZSNA 2V7QD 4DKJA 1W0CA 3B7GA 4WY8A 1A96A 2C98A 3PQ2A 1K1EA 1E0JA 3FUCA 5E4JA 2UVQA 1E2DA 4HAYA 2B0JA 3EZ9A 4YMVA 5K6AA 3A6PC 3FYSA 3KL2A 5HS6A 1ZP6A 4WHMA 3RC3A 3I6IA 3P97A 1F3OA 1ZN7A 1RSZA 1AKVA 1M0EA 3UHFA 4KOEC 3PUHA 4MR9A 1Z0FA 1SXPA 1PVDA 4Z8XA 2ECPA 3WXBA 4KLRA 4YCNA 3UXEA 2XRFA 5F1OA 3RVLA 2Y0CA 3QVWA 4N1AA 1E7WA 1TQDA 2QTTA 4D9NA 2ZRGA 3R5SA 4I2NA 1E2NA 3GDGA 3D3NA 4GLLA 3RAGA 1XTVA 2GKOA 3HM9A 3UWKA 1W96A 4FEEA 4HAIA 1DPFA 1X7ZB 3DFIA 3GYBA 4IKOA 2INGX 4L76A 3WGJA 3DO6A 2J3KA 3DCJA 1OUMA 5K7SA 5HKKA 1O08A 1XDUA 5GVSA 1Z2PX 3G9UA 1CRWG 4Z2YA 4I6EA 1TFRA 1NMZA 2RGAA 3FCOA 4KN9S 2X77A 3PV0A 5A04A 2IH5A 2BMDA 3ETNA 3W2IA 5LIRA 3B3AA 1W85B 1RYDA 1YBAA 4FYVA 4KK3A 5FWYB 1JMYA 1XRMA 1UT8A 2RJNA 1E58A 3QU9A 1HE2A 1T4BA 1X2EA 3NPMA 4EITA 1W35A 3GD5A 4CG0A 1UMCB 3PB3A 1EDZA 3ZXSA 1WR8A 5EXPA 4KW7A 4FOLA 1XDWA 3AI1A 3SF8B 2R8RA 1W0JA 3SLRA 3W3ZB 1PYDA 2ZJYA 4LAFA 5C8DA 2W70A 2AIRA 3VGPA 2XCRB 2YW2A 3Q3CA 5MDHA 3GRFA 3I1YA 3ROKA 3FPJA 4KV9A 2DWCA 3B38A 3B6ZA 1TU0A 2PZAA 2H8GA 3HLKA 4Y2QA 4LGMA 4Y9UA 4JB8A 4LRTB 3EZYA 4N3BA 1F5SA 1M2OB 3MNFA 5JVDB 1T2UA 1ENPA 4LX8A 4QJIA 3KOMA 3PYXA 2OB1A 2VF4X 4G5XA 4M2LA 1IPEA 3DMPA 4PPFA 4RIGA 2VAVA 1ADCA 5LUAA 1Z8FA 1PR9A 4ZANA 2V7EA 2ETXA 2O7NA 1JPVA 2YOFA 3KZOA 2GXSA 1WPRA 5CVVA 2P8SA 4AROA 1J1UA 4ENTA 2A5FA 1KVRA 1NTRA 2Y1OA 4DLPA 3SX0A 1DIRA 4BWVA 4H0NA 3CW8X 2P6RA 3KKNA 2B6NA 4IO1A 5CB8A 2QR5A 3QV1A 2LE0A 3ZCQA 1XGKA 2PGXA 4C7KA 4H7IA 1EZZA 2K2QB 5AJZA 2SBTA 4ZVRA 1DAGA 3KB1A 5LQCA 3JCZA 4QBIA 2ZXUA 2JK0A 3RSCA 1XJCA 1DRWA 4N3CA 3L79A 3RVSA 1ZK3A 1PLKA 3SDBA 5FOUA 5F9FA 4X1YB 1WY7A 3E8SA 2ABWA 5K3AA 3TTSA 2GRJA 1W29A 4KYTA 2Q6VA 3K0CC 2R25B 1EZ4A 2ZIZA 5J59A 3TQOA 2WNSA 2EEZA 2JGRA 3K6SA 1HF3A 3HJUA 3FDJA 2FWBA 2QUZA 3K53A 5EN4A 1N57A 4IXNA 3T1OA 4E09A 4EVIA 4HQ0A 2H9IA 2WKPA 1VL2A 2XTJA 2Y92A 3KL4A 1OIXA 4NY1A 1F5NA 3V2GA 2O2YA 3REFA 3WJ7A 4D3DA 4R68A 4DCJA 5I7UA 5M04A 3EZ7A 1J39A 1BIFA 3P4XA 4HAZA 1Q1EA 1S8OA 5AW9A 4ZJUA 5KVAA 4Q19A 1CNMA 1YQUA 4QUIA 4DM4A 4M7PA 4RBNA 2XRYA 1NG9A 4KIGA 4P7GA 5EHXA 3A6GA 1HLFA 1YWGO 4J3JA 3OTHA 9ATCA 2P40A 2PJDA 4U3JB 3CX8A 2VVTA 1BH2A 1IMOA 1PSZA 1U9IC 1J8YF 1Y3IA 2JH3A 1T1GA 3RLFA 3ZI4A 3IQXA 3ZJTA 4AKHA 5JALA 1QTRA 2DBYA 4AK9A 4CU2A 1SUFA 2ZI3A 1ULSA 4ZAFA 2KWIA 2G83A 4B2IA 2M98A 2AE2A 1PFGA 3P2IA 1SIUA 1ZK4A 3RHFA 4PNPA 2OZLB 4YRCA 1E5TA 2DR2A 3ICCA 2NYUA 3GP3A 1P9RA 1RWPA 4UBJA 2O1XA 4GL2A 3M3DA 1TW2A 3I0ZA 4DR4B 2BGIA 5JXHA 2OGUA 2YRFA 2XT9A 5A02A 1USGA 4Q93A 1KJZA 2Y9PB 5L3ZA 3UT6A 5HWSA 2G9RA 1XPJA 2WEKA 3IGFA 2FLKA 2PZLA 2TSYB 4C87A 4Z4IA 2GF9A 4TLBA 1X9HA 4I6JA 1IHXA 5U1PA 3VSEA 2VUUA 1E1RD 1XEAA 3HB1A 3ONDA 4Z4CA 5L3QB 3DB2A 3ROGA 1QP8A 1PDVA 3SZOA 5IM5A 1ZIOA 8AT1A 1EI9A 2C77A 3MWJA 5FXMA 2QN2A 3V8VA 3WWDA 4F93B 3ES9A 1N1EA 3AJAA 3KUUA 1NX9A 2NO5A 4ZMBA 4NQZA 1FA9A 2QTVB 1I2ZA 5LQUA 3FZGA 5LLSA 1QOZA 4BECA 1KIMA 1E1DA 1RPTA 2OWEA 1HMYA 4YRDA 5D86A 5ALQA 3ZDFA 4ND8A 5JXWA 1CHNA 2JFOA 2J9YB 3M9WA 4RKEA 4IY1A 5CH8A 3IUEA 4KCGA 4B9EA 2ADOA 2XAAA 1OASA 2AI1A 2JIDA 1V45E 1S9DA 5C8YA 4E6EA 2OECA 4JUFA 5F7JA 3H2BA 3B53X 1QC5B 2DCMA 4MEAA 2O50A 2Y8EA 4GMKA 4H27A 4M9XA 1NVTA 3M33A 4AZSA 1D4ZA 3UJ8A 2ZUUA 5F5XA 2NVBA 3BT7A 2WR8A 1UMKA 5JJIA 2CXXA 1CB0A 2I6FA 2D0DA 2O48X 1AGNA 1FSFA 2O3UA 3G59A 3FPBA 4G0PA 4TMTA 4XYEA 4FDMA 3T7TA 1LI7A 1CRZA 4BKPA 5G0VA 1CQPA 4RL6A 3TZBA 3HYSA 3X2SA 5KREA 4IG9A 3EVCA 1N78A 3S2GA 1DE0A 3ETJA 1BC5A 1FZQA 2JFVA 2C5LA 2H1HA 3JASA 2QT9A 1K7CA 3U7EB 1OV6A 4F5EA 2O1EA 4ZIRA 1U63A 1WEKA 1XLWA 1E8MA 3AEZA 3L1KA 2CUNA 3SYKA 4DMMA 2UVPB 1EE2A 1XDDA 3B52X 3CRNA 3DZKA 3IPCA 2EWMA 1OI3A 4GX5A 1DEHA 4AYXA 1HNXB 2R8YA 2WWFA 1C1DB 2AXEA 1QKJA 1RAHA 1X6VA 2PQMA 3PNSA 1A8IA 2ZRLA 3R9XA 4F9TA 4CM3A 3FFTA 3I8SA 1Y9ZA 1DP4A 4HCJA 4LWQA 4R01A 4QGAA 2VNKA 1HG0A 2NTYC 2ZDHA 5A9SA 3KQKA 3PIIA 2RHLA 1A71A 4DJJA 3T38A 2QTWB 1WUTA 2VPYA 5J4VA 3R6DA 3EWSA 1MX1A 3ESQA 2AFIB 4YFVA 1ECLA 1W4RA 3P9CA 2GI4A 3QU7A 3DKRA 1IMJA 1G2OA 1T24A 2GJ4A 5K6RA 4OK3A 1X1CA 2I6GA 2PZFA 2QD1A 1GN8A 2RHGB 1J00A 1I3NA 2I4RA 5KC9A 3L02A 1P5RA 5C5DA 3JYLA 1QLHA 2QN3A 3BJIC 4TXMA 2Z98A 1YZUA 4YUYA 4DV1B 4KR2A 2AZMA 1KFKB 3W6PA 4ZKDA 1UOQA 1I80A 1YZTA 3KOWA 5AXCA 1CFZA 1YJ5A 5AW5A 5BN3B 4A73A 2CBXA 1DX9A 2DBVO 1NY6A 2VIIA 3KEQA 3P52A 4C7XA 1DWQA 4M7OA 1R0SA 5L3VA 2FEAA 3VC1A 1THMA 4KAAA 2DU8A 2I91A 4NFYA 5E3HA 1E3WB 3K73O 1AUXA 3UN1A 2GM4A 2I4IA 2GF2A 4UPVA 4LF4B 2M32A 4ZU1X 3V4VB 2VJMB 2JJ2D 3K3PA 4QBKA 4FVTA 4PO9A 4F91B 1C1XA 3M9LA 3A1DA 4HDQB 1QZUA 5KB3A 3TR0A 4F6RA 4R7TA 2GLTA 1G3QA 1JWLA 3DVSX 4L15A 3K0KA 4LBZA 6PFKA 1G2IA 1PI3A 3DHYA 5J2TF 4NF2A 4QU0A 4KH0A 3M6WA 3HA3A 3OQIA 2C2KA 2A7XA 3CM0A 1EQUA 1G8JA 2VAXA 4HPJB 5DSZA 5ITSA 4Z3KA 4K9QA 4RS4A 4BNKA 4M21A 3GBVA 3SDZA 3KOYA 3QEJA 4EJ0A 2ZJZA 1P0PA 1SC4A 1PR5A 1PGQA 3LI2A 4HPWA 4ACAA 4Q4CA 3ILVA 3PD0A 1JKJA 1IIBA 4KRFA 3VR2D 5KNCA 2OBXA 2RI0A 4LOIA 2AEMA 3AXTA 2PUGA 3EVEA 1RWVA 2OG1A 4PPNA 5E3IA 2CB9A 2V74B 4IIDA 1JF8A 2I22A 1CJBA 1HSOA 1QDLB 4MW9A 5D3MA 3RRBA 5EGSA 4KUEA 5KWVA 4M46A 1Y6FA 4L6CA 2FEWB 3RUIA 2JLSA 1PJCA 2JCYA 1J7KA 3I1FA 4JUIA 2P62A 4X93A 4AX4A 4MWDA 2XB6A 4AMGA 4BLPA 5EMMA 2IOFK 1YDWA 2IUFA 3N5CA 1JILA 1G5QA 1T3SA 2XUQA 1IN7A 2OXIA 2Q7DA 4XVCA 2JA1A 5ICCA 4F3TA 1P0FA 4HZUB 2VSFA 1ACMA 1I8TA 3TXXA 4G56A 5DHAA 5DFAA 4BNWA 2HB6A 1PG5A 3GFTA 2QW1A 2XCUA 2C96A 3JD1A 3TGWA 1GGNA 2NP7A 4Y30A 5FPSA 3EAGA 2Q3FA 3T5DA 1PL7A 1ZI8A 3DT8A 1KETA 3UNXA 4DL9A 1IVYA 3D7MA 3HVJA 1FFYA 3LT1A 4G8DA 2J3QA 3B1ZA 4BQPA 5BYJA 1UDAA 3K31A 1UPAA 5FX2A 4N8SA 1TF5A 2DQ4A 1PJTA 2J9XB 4BKRA 1VRVA 4D0LB 5DHSA 3L7NA 5HA5A 3OF3A 4YECA 5BWNA 1TUBA 3HBFA 3OESA 2XRMA 3FY4A 3IEPA 4RM3A 3D7KA 5CNKA 3T7EA 3UK0A 4BVEA 4CCWA 2OYSA 1OSNA 1Z45A 1HI9A 2GN0A 2JLYA 1K3FA 3N7AA 3MD9A 2QN9A 4EELA 4PR0A 1Y1SA 1VZ3A 3FFWA 3IT0A 1H5UA 5JMOA 5NLLA 2ASEA 1E0DA 1VCNA 3G2JA 2WHPA 4UOEA 3UCFA 2GVDC 4NHEA 2PTHA 1EGVB 1ULTA 3R3JA 1VI5A 1J70A 3HKEA 3WGHA 1V71A 4JT8A 3CR8A 3TNYA 5KEIA 1U6IA 3OBIA 5SV2A 5EIAA 3RT7A 1M8KA 1PZFA 2QGZA 1D3AA 3WYFA 4XDHA 3NP9A 4J49A 4ZO6A 3U7QB 1YB2A 3ZNOA 1UK9A 3LYUA 4I1UA 2C2BA 3FLAA 1HL3A 3AHEA 3N0RA 2EKLA 3LDGA 2FPIB 1JIQA 4NZOA 4ZPJA 5AW8A 3PDHA 2EW2A 3M4XA 1QG4A 3UAGA 1T9HA 3LUJA 5ER9A 4YRNA 2ZIWB 1FJ2A 1OYYA 2AZDA 2CMKA 3AU8A 1PD0A 1Z2AA 2YASA 2H7XA 3F3SA 4WADA 4JJZA 4KITB 3MIIA 3PRYA 5JZOA 5G40A 1G3MA 1NI5A 2WFAA 5EIBC 2ZEJA 1BH6A 1M6NA 2BUAA 2JRLA 3H1FA 3TGPA 5E0KB 3UJAA 3KZCA 5CFQA 3S40A 4X65B 2NQ8A 3DOIA 4OUDB 5DP1A 3TSZA 4U2FA 1AGXA 2QX9A 1BU8A 2XI4A 3UW3A 4XYLA 1R4MB 1CE8B 3BMNA 4PW0A 1E0SA 1I1QB 2O1SA 3RVBA 4HNUA 3E70C 3ETDA 1WXXA 2NQTA 4RSHA 1K06A 4AF6A 5DHRA 3PNLA 3MUEA 1L4BA 2Y66A 4K9OA 4R1OA 3AHFA 2IU0A 5BMOA 5J2TB 2AVNA 3DXXA 3OEEA 2D0PB 1WDKA 5GZ1A 5KYWB 1RWWA 3VSCA 4HNAB 1MAUA 1XZ8A 4B5LA 4BV3A 1QQ6A 5CVJA 4KN8A 1C3LA 4F8JA 4XYGA 2ZK7A 4MQ4A 5E6UB 3V8RA 1S3SA 4YRTA 1XIVA 1XZDA 3V55A 2XSZD 2OBLA 3HACA 3KZKA 3HB7A 2AG1A 4HGRA 1IVNA 2X3FA 4NBSA 2Y4OA 4HH0A 4YRKA 3IVAA 4IFTA 5SYAA 1HDYA 3U7RA 3D3WB 3GCXA 4G5HA 1TKCA 3T9CA 1H9AA 2YFHA 1YAJA 4MVJD 1HTBA 3OZIA 3SKYA 5BQXA 2PJRA 4HNQA 2DQSA 3AF5A 3EBPA 3M6XA 5C7LO 4KC0A 4JB3A 4ZP1A 3TNDA 3RVDA 2AD5A 3NYQA 2Z2IA 2E5FA 3V48A 1XNHA 2BTQB 1GAWA 1JR3D 2JAUA 4MLCA 1T2FA 4IJQA 3DXYA 2BZSA 5U9CA 1AV6A 2HDNB 2R0QC 3KQSA 4QUBA 2JGJA 4P2GA 2PLAA 2EZ9A 3ZN2A 2A67A 3G89A 5JAMA 2XECA 2A9OA 1QE0A 1IBLB 4XWTA 4MV6A 2WAOA 4LSGA 1KERA 5ALLA 4Y2GA 1WKBA 4MB6A 1R9NA 2HA3A 1JZQA 3OC6A 5CT6A 4RPKA 4BHTA 2Q7XA 3GJ3A 4COKA 5ALVA 3D8NA 4LC1A 2HBYA 3SN6A 9GPBA 1MRSA 1LQ2A 2ZULA 3IVRA 4GL4A 4MQLA 3ZLVA 3X2EA 2YIVX 4DTCA 2QHXA 2I34A 1XVVA 3H3XA 2FLVA 1E5DA 2C4WA 2CUKA 1XAHA 3F5QA 4JP5A 1R7RA 3A1SA 1KOGA 1IULA 4RUKA 4X63A 3REQA 4HNVA 2ZCVA 3U1BA 1OCEA 3RSGA 4OXKA 1U7XA 1B15A 3DDWA 4NEQA 1M6HA 4ZT2A 5B3JA 1JQKA 2JFWA 1YB6A 4QE3A 1SHZA 1QGYA 3WK9A 3KXLA 4RH1A 2HSDA 3KT0A 1L1FA 3WZLA 3DLAA 3GFGA 4G0XA 4FCCA 4R83A 3GEPA 2IHKA 4XWGA 2NU9B 1EK0A 1ECJA 2FR8A 1I2DA 2GAAA 2C4VA 2VJKA 2ZBPA 4YV7A 3U81A 4F86A 4LJAA 3P9YA 3U7IA 2O4UX 3GA7A 3REOA 1YUMA 4MLPA 3I58A 4MUIA 1N9KA 3P2OA 2W4IA 1GPWB 3KEFA 3OZDA 1MQ9A 4EENA 1PGOA 2Y1KA 3VZBA 4FI3F 1B76A 5TPWA 1QF7A 1EXNA 5GPBA 2R7MA 1Z4JA 3IEIA 1S4QA 3TDNA 5J2UA 1KORA 1OBVA 2XH8A 4TTJA 5DOZA 3P9KA 5BWBA 1Y9JA 3MTJA 4HUQB 5HRCA 1G7TA 3WJAA 1WW2A 5CLIA 1DUIA 3HKDB 1TMGE 3TOSA 4EB3A 3JVEA 1JT9A 5BYBA 4DEXA 1T2NA 2QD5A 3OCZA 2A59A 2H48A 1EB8A 1CERA 3GCGA 3QNMA 5B1EA 3HL4A 1FYVA 2F9FA 2HKIA 2DAPA 5DLEA 5AM1A 2WWVD 1DI0A 1T8WA 2IPLA 3BOSA 3DFKA 4IFEA 4OXNA 3TRDA 4X8HA 1RLUA 4ILKA 4LZNA 1NJ2A 1PJ4A 1D1SA 3IBGA 3K1YA 4MLZA 2YJ3A 3PR2B 1NIJA 4EJ2A 5EJ6A 2X0FA 3M7IA 1N2CE 1XYVA 3ER6A 4KXMA 5DULA 1KJYA 4I4TF 2JAXA 3FUUA 3H9UA 3IAUA 2XZOA 3H0KA 4PX3A 4YAIA 5BSVA 3KXIA 4M9QA 3RYCB 3EXG2 2H59A 2DB3A 3S8MA 2DTXA 1BWPA 4JVOA 1VE6A 2DY1A 4GC5A 3GMSA 4QXQA 1T4CB 5EIBD 1QTNA 2BONA 3EQ9A 3N0WA 4CUJA 2FX2A 1ZXBA 3VYVA 1B16A 1HO3A 1XZMA 2DC1A 2LKDA 1NBOA 1N2HA 2P5YA 5F2OA 1VKRA 2FEKA 2FZGA 2Z8YM 5IAJA 1E6WA 3Q10A 2REBA 4MUFA 3UQZA 4IBOA 2BM8A 4I5IA 3SPXA 1UDWA 3ER9A 2H85A 2RHJA 4Q3LA 1UC5B 2FPPA 2NV6A 4ZODA 1P91A 3E9ZA 1P7CA 1RMTA 2EAUA 1M9NA 2ZTLA 3ILYA 5G53C 4YJDA 5ADUS 2X8JB 4TL8A 2PBLA 2VP6A 4X1IA 2HRZA 3INTA 2FF5A 1WDTA 3JWJA 4LY9A 4QKQA 1WAMA 1XMIA 4KQWA 4YAWA 2IS6A 3HG7A 3KUKA 3QGMA 3GRUA 4Q1CA 1AX9A 1IXRC 1IAVA 1MC5A 3DDSA 1SVMA 3ZZTA 1LZKA 1XFAA 2GYVA 1V7PC 4M87A 3H86A 3U9SA 3IHTA 3AP2A 3Q9NA 1KEZA 4R69A 1VSTA 3GEDA 4IV0A 1BFKA 2LCFA 1E9RA 1V8ZA 3Q7EA 1EGAA 3S99A 1CEEA 1X7GA 4BRSA 1H2ZA 3NEYA 3IL2A 2HREA 3HVHA 3A9RA 1SZCA 1I6MA 2FYTA 3QYFA 4GS5A 2GDJA 1BYUA 1GGKA 1T9GS 4LMPA 4V0QA 4EVSA 1RXCA 1NFQA 2XODA 5J1SB 3PNMA 2ET6A 2OBMA 4BVGA 1J23A 3TR6A 3HJNA 2V7XA 2ZAOA 3EY4A 4UFNA 5LQKA 1LB1B 1ZN8A 5CDSA 3HB5X 2B2CA 3RG8A 4PG7A 3D8TA 1EXWA 3KU4A 4TKVA 1RXSA 2I76A 4FFDA 1PL0A 3CZCA 1KAOA 4I5DA 1GGJA 4ZV9A 5G0WA 4BDTA 4DV5B 4NBLA 4WX2B 4NARA 3GRRA 3LLUA 3QG1A 4IXWA 4L57A 4JIGA 5A5GA 4RTLA 3H2IA 1Z22A 2PGDA 3FVWA 2ZTHA 4GOXA 4LE2A 4BLRA 4FYPA 2Q5CA 3M6IA 4GKBA 3QJ5A 1TK2A 3DR5A 2GXQA 2P68A 2J08A 2GZDA 4L75A 3SQDA 5JXJA 1U8FO 2EATA 3WKEA 4F9FA 2VQFB 1JGTA 3Q11A 2GYUA 1FUIA 3HYCA 1HLGA 2FHPA 2H1IA 4RV9A 1K7SN 2D5AA 5DHFA 4QVIA 4KPUB 2FDRA 4F4HA 4R4JA 1DTWA 4RF2A 1XD2A 3H9EO 3CLTC 1ZXLA 1UFVA 2PRKA 4IGAA 3R0ZA 3AF4A 1K3UB 1V3UA 3DOHA 1QG2A 5ALOA 1BQ3A 4JGBA 4BV9A 3RADC 5FFMA 3VC7A 3LXUX 3NTRA 1X1SA 1DFGA 2CHFA 1AK1A 3CIOA 4DW8A 4ERXA 3PFBA 1O0SA 4H18A 1JTVA 4OCZA 1SKQA 3T06B 2H1RA 5AJXA 4GQAA 4GXNA 4LY3A 3A6LA 3RFFA 4HGOA 4ED9A 1YZHA 2C4UA 3ZHSA 1C3VA 1REQB 2X76A 1MC8A 4W9NA 4C21A 1V1MA 2R7NA 2ORWA 3RYIB