3FYSA

Crystal structure of degv, a fatty acid binding protein from bacillus subtilis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
282
structure length
282
Chain Sequence
SMNIAVVTDSTAYIPKEMREQHQIHMIPLQVVFREETYREEIELDWKSFYEEVKKHNELPTTSQPPIGELVALYEELGKSYDAVISIHLSSGISGTFSSAAAADSMVDNIDVYPFDSEISCLAQGFYALKAAELIKNGASSPEDIIKELEEMKKTVRAYFMVDDLAHLQRGGRLSSAQAFIGSLLKVKPILHFDNKVIVPFEKIRTRKKAISRIYELLDEDASKGLPMRAAVIHANREEEAAKIIEELSAKYPHVEFYNSYFGAVIGTHLGEGALGICWCFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein degV
publication title Structure of a fatty acid-binding protein from Bacillus subtilis determined by sulfur-SAD phasing using in-house chromium radiation
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Fatty acid-binding protein
total genus 97
structure length 282
sequence length 282
ec nomenclature
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02645 DegV Uncharacterised protein, DegV family COG1307
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1180.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein Tm841; Chain: A;domain 3 Hypothetical Protein Tm841; Chain: A;domain 3 3fysA02
3.40.50.10170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fysA01
3FDJA 3LUPA 4X9XA 2G7ZA 1VPVA 1PZXA 2DT8A 3FYSA 3NYIA 1MGPA 3PL5A 3JR7A
chains in the Genus database with same CATH superfamily
2ZJ5A 4QXOA 2X22A 4XIYA 3G2QA 4HAXA 4KMRA 1MAUA 1H5NA 1V2HE 3ZZTA 2QI9F 1U8CB 2JI6A 5KVSA 5TGTA 5KNDD 2QAIA 4N41A 2W6MA 3VR1A 5G4LA 2AN9A 1U02A 4F6RB 5IM4F 4R81A 5BSWA 2QUIA 3O8OB 5F7ZA 7MDHA 4LJ7A 4YRNA 1T4MA 4D43A 4J75A 4ER3A 1K8XB 5JAHA 2RAUA 3M3DA 9ATCA 1J0DA 1E2LA 3C6ZA 2NU6A 5TARA 2PWZA 2RGUA 3GCWA 5KJFA 2JVJA 3ESBA 3QKRB 3MQ4A 3C87A 3L49A 2B6NA 3PI7A 2HCJB 4LVCA 5HZGA 1VMEA 2D1RA 4GT1A 1X80B 2Y93A 4AJJA 3J81k 2Z95A 2QZJA 2XGJA 1ZM9A 2OD2A 2UV8A 4H7DA 4MITA 2JLWA 1L5HB 1OYYA 2B0CA 2VAPA 1KRWA 3BG5A 3GRUA 1A7KA 2PMKA 3IUMA 3TH5A 3DYBA 3FJOA 4K9DA 4UOZA 1S2DA 4NQRA 4RZ3A 5UKDA 1F14A 8LDHA 3IODA 3M9XA 4DQXA 4UJ5A 3PEVA 3PICA 4TTJA 1SUDA 1EFVA 1M5UA 2YHBA 3IEPA 4ARVA 5HVNA 2PKXA 1MP0A 5JFTA 1XZQA 4UZSA 1TW3A 3JD0A 1E4OA 5BQ5A 2VHVA 2IU0A 3RARA 1KFBB 2XT6A 3EXIB 2OPHA 3TRIA 3K72B 5U1PA 2BHLA 2QD2A 4HAWA 3TGPA 4E51A 3IP6A 2QP4A 2XOEA 5K6AC 4C0KA 2ZCVA 1J8DA 1QH1A 1B43A 1M34E 3HCEA 5D7NA 3QKRA 2X8BA 4UPVA 3RKRA 2E6KA 4B8YA 3LC1O 3V8BA 1E2HA 1ZU5A 4I1VA 5NLLA 1SHZA 1GAEO 2JGDB 3JZIA 4M55A 4BO5A 5TMPA 4OHYA 4D8UA 1GTL1 4MARA 5IWAB 2JKYA 2G28A 1JKJA 3E0QA 4KQKA 3ITKA 1L5HA 5ISMA 4KVGA 4KXMA 2OXIA 4FSHA 3W5DA 4B3SB 4WTOA 5EC8A 1B4DA 2HBRA 1XNHA 3AIKA 4YRKA 1I24A 4Q7JB 5CA1A 3A2KA 2PYIA 1NQAO 4FWBA 4FFLA 4YQZA 1YJQA 1KDVA 2VF5X 1S1CA 1VBMA 4F8YA 1Q3HA 1PEDA 1YR9A 2QM7A 1YDFA 5FUWA 3X1KA 4DUGD 4EVQA 1J2UA 2AC2A 5IMBA 4CDGA 4I2VA 2R25B 4QXAA 4RSMA 1NW8A 5M5BA 1SXIA 3PNYA 4QE3A 3M6VA 2WTBA 3BIXA 4QLBA 4RDCA 4UREA 4YASA 4YP6A 1N6NA 4H2DA 1JBQA 1RI2A 1MEOA 3G2IA 2XF8A 4QG3A 1WVIA 1EWYA 3H5OA 4UMVA 2YWJA 4IS3A 1BHQ1 3DVSX 1Y1KE 4UXJA 4UBOA 4XWTA 1Q6ZA 2M1ZA 1FVHA 3BREA 3M5WA 2HIGA 4YI3A 4A0SA 2I29A 5LQUA 2ZYIA 2EJWA 1RHMA 4Q9AA 1UDCA 1U04A 1Z4LA 3FZQA 5DGTA 1AGYA 5B6JA 4NHOA 5F4BA 1U3CA 4MRRA 1S3IA 3PGLA 4M38A 4ZRMA 3DEZA 4IDPA 4NEGA 3AZPA 3WAKA 4X1IB 4IILA 4OA5A 4MSUA 3SICE 4C0LA 3OOEA 4TWJA 1W7AA 2M98A 2QN8A 4MQ6A 3DM9B 1YQDA 3C1OA 4UJ3A 3I76A 1FJGB 3IV9A 1WB5A 3GLTA 4GG1A 2C00A 4MKHA 3RFXA 2XNHA 1DJOA 4UHFA 1J6UA 1XZNA 1HDCA 4H1UA 1LV8A 1QTRA 1FRQA 4TMTA 2Y67A 3QXHA 1AY0A 5ARDA 3U4QA 3KB6A 1NZDA 3JQGB 3L7KA 2REOA 2JFOA 1NBEA 4YMIA 4UBJA 4O33A 3ROKA 1E2IA 2AT1A 1LW6E 4G01B 1ADCA 1BA3A 5KYUA 1ML4A 4GGPA 1HE3A 1P9LA 3FNQA 1G4UR 3REQB 2Z8XA 4ZARA 1L5QA 1SD2A 2P5YA 2F8MA 1NV8A 5A71A 5I7OA 3CQ9A 2QN7A 4JJKA 4MMYB 3BK2A 1UAYA 4X1IA 2HMTA 4PZ0A 1F1JA 4QDXA 5K0FA 1XNQB 5C8ZA 3TFWA 1G3IA 2XVYA 1IN4A 4B6QA 2UZ1A 5FD8A 1HT1E 4B33A 5FBVB 3QYJA 4MLPA 1F2TB 1ZH8A 3K16A 5D5HA 4BDTA 3QBTA 5TX7A 5ITVA 1W5AA 4PZZA 5TT0A 2Y9MB 5HKBA 2BFCA 1MZVA 3T52A 4E5UA 4FFWA 1U2EA 2YS7A 1T2AA 3AX6A 2XRMA 3R7SA 1ECFA 1IE3A 3H3XA 1WY7A 5ALRA 3UK1A 4NU0A 5ECDA 3I53A 4WOKA 3UT6A 4CCAA 2BUAA 2J7PA 5H83A 5DF1A 2QRNA 4PSVA 1FMCA 4EUFA 2OR3A 5GAJA 4Q3EA 3ADPA 2XUGA 1OXXK 1BS2A 2XYVA 4IHAA 4R05A 4Z0TA 4OV6B 1YR1A 1W30A 2NXWA 1WXGA 2O7VA 4IZIA 3W2GA 1PJSA 2R1TB 2DETA 1F8GA 2PBFA 1VYTA 2O2CA 5FUBA 5AO9A 4C07A 4TT3A 4L76A 4DLVA 2O23A 5JZVA 2W2QA 2ZRJA 4LE0A 2RH5A 1FXUA 2QQ5A 1USGA 1KJNA 1G20E 1NI3A 1AS2A 1S8NA 1TZKA 2D7JA 3OCYA 3VDMA 2BP7A 4B4VA 1SQ5A 1XD9A 3LDAA 2H4ZA 3MFQA 2CN1A 2GEKA 2HAEA 1NX6A 4WIAA 3EMKA 1B8UA 1HLGA 4LY3A 3QPWA 3VYWA 2HOQA 3IXLA 3K35A 3LNCA 2B2CA 1MIHA 2WMYA 4LJ9A 2XI4A 4JBIA 1NGSA 2EATA 3TJZA 1IQPA 2LTAA 3HCAA 3VUFA 2G8LA 3G6WA 4HI0E 1E89A 1UMKA 1YL5A 3EMVA 2JW5A 2FVXA 5FO1A 2X13A 4JBLA 1LSJA 1YE5A 4BE4A 2XMZA 2LV8A 3NV7A 1RWKA 4RF2A 3RHFA 5JUWA 5KHOC 3KV3O 3TSZA 2IHNA 2J3JA 4L9WA 3LKVA 4YV7A 4FHDA 2ZUVA 2AJCA 3NGXA 5HKAA 1TM3E 4NDZA 3HCPA 4M0UA 1XVTA 2I4MA 5GVRA 1GKIA 3DZKA 1HBJA 1Z4IA 3A6ZA 4WINA 2X0RA 1AZSC 1GQ2A 1X1SA 2M9MA 2CFIA 2IYSA 1KS2A 3K0HA 1H2XA 2YL2A 3OFSA 4GWLA 2O6HA 4JSYA 5T4FA 3KYCB 1W1WA 3W5UA 2BN4A 2J5QA 1IVNA 2J48A 4JKYA 5FA5A 3TIVA 1UKEA 3ZIAD 3Q7RA 3IH5A 1BXZA 4BBZA 2LRHA 3TLGB 4TUYB 5DPMA 2J9FB 1LJ8A 1RWXA 2TSYB 3OIWA 5KOHA 2C4MA 1TNDA 5JS7A 4CEHB 3OU6A 1V9SA 3SIXA 3C6BA 4Q7KA 3DZFA 3UHAA 1Y34E 3PNKA 1BXGB 4RCYA 3PDCA 4RIHA 2Z9CA 3UT0A 1ZOLA 2B82A 5AVZA 3AVTA 1JG4A 1DB3A 3LW7A 1E2EA 3NDPA 1Q0UA 3DDOA 3FRJA 4J8PA 4NR0A 4UTNA 3AQIA 3QHAA 4ARIA 3IURA 4YMGA 3NM4A 1KOGA 4ZK6A 3A4IA 2UYYA 1ZRMA 2UKDA 1GAWA 4NPCA 3RQIA 4DZZA 1NLYA 1YVEI 5JTTA 2VNSA 3O2QB 2GLUA 5EMHA 5H0IA 1A95A 1F3LA 1JPUA 2H1LA 3ETEA 3QJGA 4GI2A 3UUGA 1GL9B 1C3XA 3QFSA 1GITA 4F9FA 3K0FB 5I7VA 5ITSA 2FDRA 4URUR 1ID8A 4BZZA 3QA9A 5I7SA 4CGYA 2VNJA 1D1SA 1H2BA 3LT0A 2YZKA 3FIUA 3GMSA 2HO5A 4FE3A 1MENA 2G6BA 5FB3A 4ZVTA 1R00A 4F84A 3F46A 4Z7OB 3QELA 2C20A 4QWWA 4FBMA 1FRNA 2CMDA 3TIGA 1L7PA 1VJ5A 2E0IA 3ILHA 3MJRA 3B3QA 4Y6RA 3OTOB 3INRA 3T41A 3OP4A 1MH9A 2NSYA 5A5FA 4DV4B 2FSFA 1IN1A 2XSZA 1XHFA 4FS8A 4XRRA 3M4ZA 4ZT4A 1G3QA 3GMTA 3W8FA 4UM9D 3G79A 3SEAA 4C9BA 3ZY4A 2K5UA 3VU3A 2M2IA 2PT7A 1QE0A 3OQ6A 2FFAA 1X9IA 2IE8A 2P2CA 4A27A 3SHVA 2VEOA 1EUCA 3RABA 3V6LA 4HO1X 4E70A 2BJWA 3PNMA 1H65A 4ZRNA 4MV4A 1SCKA 2GYYA 2AFIE 2YASA 1Z08A 3A1FA 1X3LA 1CCWA 5EN4A 4ZHSA 2G83A 2XVMA 2Z2XA 2AQKA 4KLNA 4L9AA 1KFEB 1N9KA 3WBBA 3FYUC 1QVAA 3H42B 1Z68A 1UBUS 1MG0A 3L7YA 1PEAA 2ZRPA 3CJRA 1N2BA 1XKLA 2NYAA 3DCIA 4L9RA 4RD3A 5FP0A 2OHGA 2Q8QA 2XZTA 1AGNA 1F0YA 2I55A 2PVCA 2ZI6A 2ACWA 1T1SA 4DG9A 5EJ5A 2FLKA 4AJOA 4F92B 1UK7A 4UUBA 2B30A 3LF1A 5C0OE 4UU7A 1W36B 3ZDYB 4TMKA 5BN5B 1JPNA 1YQQA 3K92A 4LGMA 1UBNA 5IVIA 3ZU3A 4GPAA 4HN4B 1V95A 1UM9A 2L18A 3LT2A 3SM3A 1US8A 3VZPA 1I3NA 4ZJYA 4RVGA 1EUDA 2K4MA 5E4JA 4U2CA 2H0RA 3VJRA 1OD6A 1P0PA 1SPBS 2GQ0A 3AY6A 4ZEOA 2R47A 4ZMSA 5C80A 3RRMA 5IWCA 2V7XA 4PFJA 4GOXA 1L7OA 4R71A 3ERCA 1QC5B 1YVUA 4EDFA 3KAKA 1RW4A 5K4GA 1B23P 2XCQA 2OO7A 2ZFUA 3JS5A 4W5JA 5DBHX 2IWHA 2GPWA 1S7CA 5JH7F 6ABPA 4W1QA 1NQWA 2BEWA 4FFBB 1EGAA 1T2DA 3ON5A 4BNNA 2HLDA 1LPSA 3R3XA 3GEDA 4MPJA 3OM0A 2R6ZA 3P20A 2DERA 4JP5A 4Y2UA 2GZMA 3ZE1B 2I7CA 4MI6A 3Q41A 4C7BA 2VHYA 3EUWA 2HWXA 4O08A 1VCOA 4DJEC 4Z1MD 1JLHA 2QX6A 2RCNA 4O2BF 3CSSA 3HWRA 1IHUA 4FW8A 1RJEA 4Q82A 4KDCA 1JZQA 1PKXA 3TD9A 3X44A 3ZGVA 4AO6A 3CW2A 3OAAD 5LZ7A 4K9RA 1UIMA 1XLWA 4RLSA 5K20A 2VDQB 2A30A 1CUEA 4OI2A 5A5VA 2ZXUA 3PSHA 5BYBA 4N82A 2PKQO 1LK5A 2VDVE 3TR5A 2E4YA 3KQPA 2VT2A 3IDZA 3AQ4A 3OPYI 3U4IA 1TA4A 1YS2X 2CY0A 4OYRA 2W4QA 3W4IA 2H7XA 3PHLA 1GDTA 4B71A 1Q1AA 5C18A 3A9CA 1TVMA 4WGFA 2XMCA 3ZXYA 2K2WA 3F6CA 4ND3A 4TVBA 1AG9A 3BK7A 4OHRA 4YT2A 4NAHA 3E35A 1VJDA 3QI7A 3DE2X 2Y76A 2M1XA 1WXXA 1TUIA 3ZJ4A 2C59A 3WISA 4A5OA 2F7SA 3S0JA 2ZANA 1A3CA 1DLIA 1KA9H 4IEEA 2H5IA 2IV7A 3F74A 1QYRA 3QPAA 2H4XA 4E94A 2AC4A 1FE8A 2OXCA 5DCWA 5EHIA 2CD9A 3K4HA 3L18A 3NRJA 1E0KA 4GL4A 4NBRA 3OJWA 3OT1B 4HZGA 4A92A 3VKFA 3RODA 2QTTA 1RYNA 3DUFB 2Y66A 3S5UA 1QIIA 1VSVA 4CG0A 1AUOA 1NVVQ 1PWZA 5BQOA 2OA0A 1ULSA 3K2BA 4EKNB 2V4ZA 3HUEA 1FDTA 1MH1A 5E3IA 1ONNA 2B2NA 3USES 3Q8KA 2Q2WA 4I5EA 2FP3A 4PLYA 1VHLA 4OKSA 4UQPA 2XODA 2PH1A 3LYAA 4CKWB 4A26A 3IQEA 5HBRA 2FWRA 2SCUA 4OKIA 3AUTA 2XGMA 3KOYA 4JEIA 2FMXA 2HJ9A 2QF7A 2AFVA 3EISA 3QU7A 4H16A 1NUAA 4H7KA 4O0MA 5ABPA 5KDOA 2PZ8A 3DKRA 3PT9A 4G1EB 2G4LA 3AXSA 3C6YA 3L1HA 1NAHA 2Q3HA 1OWMA 4G5OA 3OPYB 2VJLA 1W4AA 1Z8FA 1GL7A 2HF2A 2DUNA 3H19A 3RT1A 5I4KA 4YDSA 1T9AA 3FR7A 3N8HA 1FFDA 1ABEA 1JFRA 1Y4ZA 2G71A 1JDTA 2WU0A 3EEYA 3KQTA 4BO8A 3AI7A 2VHWA 4M54A 1CUDA 1WL8A 4MA0A 3NVDA 5HXAA 4NBVA 3VNQA 4B83A 1K1EA 1PJLA 3ORFA 1UJ6A 1R6XA 1MR3F 2H9AA 1GRRA 2OLKA 2Q5FA 3N39C 4GZMA 4TXMA 1J90A 2HR1A 3IA7A 4N01A 2YKGA 2QTMA 3L5KA 1QK5A 3OBBA 1Y6QA 1XZFA 3HS3A 4PRZA 5TQ0B 2OGUA 5A5EA 2BEJA 3NXSA 4V0QA 1EDEA 1HQDA 1B74A 3KZMA 4FDLA 4ND1A 1UT6A 2PXHA 3WSWA 3LOPA 1Y9ZA 4LXQA 4P2GA 1C7JA 4HDQB 5KNCA 3FYHA 3OQIA 1OVGA 5LQAA 1XN4A 4X71A 3HKDA 3QMVA 1LH0A 3WRWA 2XTNA 1RPTA 4FLMA 3BILA 3W5JA 1GPJA 1XHLA 3DEKA 4DR6B 1SU8A 2A35A 4N12A 5AQ1A 5KWJA 3SS8A 2BGTA 5DWVA 5BRNA 3ECAA 4ND5A 2IYTA 2X1LA 5HIMA 2CDNA 5DEIA 2JJ2D 1NBHA 3D6TB 3D6HA 3I34X 1IY0A 4N49A 1DFGA 3KDPA 1R6BX 2A5GA 4YO8A 3HO6A 2WJ6A 4ETMA 2AK3A 4C89A 3EZ9A 1I8TA 3DEAA 3NOXA 4ZJPA 2IOHA 2ZYDA 1LI4A 3RVJA 5A3JA 4IHJB 1JSCA 5D7BA 2ZEJA 2NU9A 5A06A 4OJMX 3GFFA 3Q5GA 5FIUA 4OHMA 2WINI 2IUEA 4KV9A 3LKZA 3UK6A 3DSRA 1ESDA 4BLOA 5JJBA 2BWJA 3QNWA 2FH5B 4XWGA 4DLRA 1BVYF 4Q93A 4O4JF 4C7VA 4RIFA 4DSTA 3QUQA 4TZ6A 1NQOA 1BX0A 3CURA 5JDCC 3L43A 2GI4A 4R2MA 3ZD9A 4NCBA 1XE3A 1LNSA 3GB9A 1EX6A 1PT7A 2FFBA 3W4JA 1NRXA 1P18A 1QFJA 1RC1A 2VN8A 5HJ2A 3TCXB 4P6VF 1M1ZA 4AKTA 1USVA 2DFLA 2A9QA 3FY4A 2ATVA 1Z4NA 3NEPX 5IULC 2HQBA 3RSLA 1FNSA 3EDMA 4URWR 5EMNA 5D00A 4Z4CA 2CDCA 2FAXA 3FNRA 3P4UA 4G9BA 3MIZA 2JLQA 2H0AA 1FU4A 2PT5A 2KMLA 5LOVA 1YS6A 4KFUA 4N5DA 1KSHA 3E5RA 1V16A 1ZGJA 3AO0B 3F7OA 4EA6A 2G77B 5TVKA 3VJKA 2ADMA 3UFXA 2ZATA 2N0SA 5K3OA 4D25A 3EEQA 2IS4A 3EAQA 2WJJA 1QGUB 3D2CA 1IN7A 1YZVA 1MB0A 2CF6A 1JIIA 4GZ3A 2JLAA 1IOZA 2POQX 1JAZA 3TL2A 5IJ0A 2O8CA 5HE9A 1NQTA 1S2OA 1H3FA 2GM5A 2OKCA 2V8BA 2ZT7A 3H9CA 3I2IA 4R1NA 2HO4A 1MC1A 1T26A 3GZNA 3SYKA 3LW8A 4AZTA 3MJ4A 1DV1A 2WP8J 3EODA 2IZ6A 1U11A 3QFFA 1TZCA 4S2UA 5ECWA 3OEWA 1NJ8A 5DYIA 1QK4A 3H83A 1XPRA 1ICIA 1R4MB 1R50A 3L8ZA 1R0BA 3VI4B 3VSEA 4JLOA 2GM3A 1DKPA 1G7TA 5I48A 4KOEC 4YJHB 1E5QA 1TRKA 5L4LA 3FM9A 3MOIA 2BIFA 3N8GA 4OQXA 1TYCA 4N0PA 4CM1A 1QP7A 4OHUA 2BTOA 1E1KA 1JEQB 1GPDG 2P9TA 3IQIX 3DP7A 4UFOA 1KL7A 4TKVA 3TECE 2QDKA 3R7WA 2HA5A 2JCVA 2ZAIA 4IJ5A 2JDID 2ENUA 3S7ZA 2OUIA 3G0BA 3HGQA 2ZITA 1C9MA 1PZXA 1WQ4A 3K6JA 4PNZA 3SBXA 5H68A 5KQSA 2NTYC 1ZN7A 4RWEA 3D4BA 4M0PA 3RVMA 3T7AA 4DN6A 4YMVA 4PWZA 1T9DA 4PLWA 4GX1A 2PVSA 1XZBA 2V45A 5I9BA 5C8XA 3NHPA 5DLQC 1C8KA 3IAFA 3PKIA 3PD7A 2FMFA 4Q01A 5T5QA 3ZS9A 1NVVR 2I6SA 4PS1A 3ZGNA 2D1YA 2VYFA 2ZE8A 5IU6A 4FSXA 1JPJA 3OZWA 3W6PA 4R1UA 3RSHA 5HIJA 4RK5A 1YH3A 2R65A 1GTG1 4W5HA 3KIPA 4MB2A 2I2BA 4UTXA 5IVKA 2JAXA 5IDVA 2HU2A 1KOJA 2YWFA 1FL9A 3KOWA 3KKMA 3KVNA 4CM4A 2PS3A 1DOZA 2ZWPA 1J8YF 4YQFA 2BDTA 2LUOA 3UOGA 2WHYA 5DBOA 1DC3A 3O74A 4IJUA 4N8SA 2GHTA 1A5AB 2OXEA 1TPZA 2WA2A 3FPBA 4IDFA 4IXTA 2QPTA 4ZDWA 3PENA 5BYJA 3WZ2A 5LDDC 5JOQA 1ECCA 4NK5A 5IKEA 3PB3A 5FOSA 4F12A 1ZUHA 2AJLI 4DZTA 5G53C 3VFDA 1G6OA 5B5SA 2WM8A 4WY2A 2QLMA 2GCOA 2P7IA 4Q6BA 5HFNA 1KGDA 3RU7A 1KFCB 3EDQA 3ZQJA 2ZU0C 4J3FA 5CGQB 4DGQA 5AP9A 3ZJTA 5B3JA 3KQQA 4I9FA 3E5MA 1E7MA 4BUCA 2A1TS 1ANKA 4IUDS 4TLEA 5PNTA 5KJCA 2PR7A 5CVCA 2O14A 3PUJA 3ABQB 3LLUA 3A6PC 5HUHA 2QG9A 2WKWA 1CQJB 2XT9A 1TCVA 1VBFA 2AN5A 1UMCB 4UXIA 4AXBA 3AYZB 4A03A 4BFVA 2BFEB 3D8RA 4H6WA 1J22A 2EBFX 4IG4A 1VLLA 2LCFA 1T8SA 2JVIA 2Q6LA 3LAWA 4O3MA 3QA3E 4N3NA 2BYTA 1IRXA 1SZPA 3ITEA 2NZVG 1ZH4A 3WJ2A 4HVCA 4QREA 3MS7A 1PK8A 2EFDB 3K9CA 1JI0A 4DCVA 2CV0A 1PEYA 2IDKA 4BMVA 5HGXA 3A6DA 2JGMA 2JCGA 3LPLA 1MJNA 2XCOA 4QOJA 4CQMB 4F5YA 1JUDA 2WWGA 5CLIA 3LZDA 2H08A 4OYLA 3ILSA 1SBZA 3PC6A 1XNRB 1H2EA 1QZZA 4B34A 5HRUA 3KNZA 3LTEA 1ACLA 4ZO9A 4E2WA 3N1UA 3KZVA 3BBLA 3HZHA 4BEBA 1ZM4A 3SJUA 2NVOA 4MJXA 1N3YA 4V2IA 3RJ5A 2JHPA 1FS5A 2XGGA 2YCBA 4ABTA 4BJ3A 4BASA 4XQEA 2P9BA 3N5CA 4E5KA 3EVAA 3B20A 4I19A 4I6GA 4RF5A 3G68A 1MIOB 1M7HA 4H7JA 5K3FB 1AE1A 3M89A 5BR4A 1O58A 4BVBA 2F90A 2GO7A 4FHFA 1SG0A 1WUJS 4FYPA 2G1UA 2O7QA 4YPVA 1C4OA 3TTYA 3MMSA 2AD1A 4CV0A 1TEXA 3LBIA 3SP1A 4DQ0A 3ETDA 3A14A 3PX3A 2XZLA 1RRKA 3BGVA 3H5AA 5LMUB 3DAHA 2I2AA 1OX4B 2KE5A 3GEGA 1XTQA 3B2QA 3JQ9C 4EHJA 4OXIA 1ZOSA 3NLLA 4P3XA 1DAIA 1WZNA 4YUXA 3OWOA 3P0JA 2J09A 1DT5A 1IOWA 3E2PA 1DBRA 2O8NA 1GPBA 1ZPDA 2NVWA 4OQYA 4MPRA 4DFDA 2REXB 4JJ6A 1SZJG 1V45E 3L8EA 3OOYA 2BFDB 4JMLA 3PXBA 6LDHA 1T4DA 1HWYA 3WBKA 1AV7A 3A3YA 1AXEA 1T9BA 4KHPB 3EXFB 4N9QA 5E9JA 4EIWA 4OMDA 1MIOA 1AK9A 1PBNA 1V7PC 4IINA 2PFKA 4KTTE 3K9LA 1EHIA 1EBBA 1YIOA 1M8JA 2A2ZA 3NFRA 4LCJA 5BOSA 1W9HA 2FP4A 4BIIA 4PZCA 5LLSA 1U65A 3AFMA 5H4GA 4PPYA 2X2OA 4RU1A 4BNGA 2GJAA 4R16A 1M5RA 1QFYA 1DKLA 4G2TA 4PAGA 3JVUA 1V3VA 5JD3A 4W5TA 1QV9A 5K3DA 4F8JA 2XUFA 3V8QA 3CV3A 1MQSA 3QFHA 2XY4A 4CMEC 1N92A 1QANA 2FYTA 4KPFC 1CR1A 1MU0A 4CTJA 2CE7A 2BY4A 2JA2A 1I51A 2VPIA 4KFSA 4OB7A 1H2HA 3EA0A 4PG5A 3ORQA 4X7BA 5J5AA 2VJCA 1A8SA 3ZDEA 1N77A 3RFUA 4NKRA 5IM4A 3N2LA 2GN8A 4L4YA 4PXAA 1GVNB 1JAYA 1U0JA 4BRUA 4E13A 3KPVA 4E12A 3I0MA 4DMLA 3MOGA 5CCDA 1OMOA 3CEJA 2ZWAA 3L84A 2VP0A 4Y2HA 4DIKA 1M2FA 3STYA 3SXUA 4RULA 2O8EB 1T8WA 3HCWA 4D02A 1KPIA 4BNFA 1GILA 5A2GA 1WDTA 2IHTA 3KD2A 1WSBA 3TBHA 5GOZA 1VM6A 2ATCA 2IEGA 2UYCA 3CLSD 2FEOA 3RG8A 1HZZA 2QY6A 4IGFA 5C7LO 3AUSA 1KFJB 2XEXA 5JAZA 1CJVC 2YCLA 4DT1A 2DHRA 5ESWA 4ZI7A 4EAQA 3I3OA 4HWGA 4MVJH 1XTBA 1DCMA 1TIBA 1Y9AA 1YE8A 2AR9A 5TPZD 4L3WA 1B93A 4MYUA 1NN1A 2VKTA 5I4IA 1WMAA 1NF8A 4EQZA 1FS4A 1N2JA 4AF6A 2N47A 2Y1DA 3BQMB 4E2XA 4EA8A 1B8PA 4PGHA 3KT8A 3ILXA 1MVOA 1UKAA 1ZO8A 2ZSDA 5AKJA 1SJ9A 4W8OA 4B8WA 4IXNA 4KXWA 2Q5IA 1CERA 4XFDA 2X9VA 1NY5A 1MN6A 1TZ2A 4F3TA 1CZNA 4EITA 3U3RA 2WIBA 3C3XA 3BS4A 5WRFA 4L4UA 2Z6VA 3I5XA 2FMKA 5ALUA 3JALB 1XZ8A 4MKRA 3R0VA 3AEQB 3E8MA 1F6DA 4JV5B 1OT5A 3H9EO 4PHGA 3KYIB 4BLRA 3ZXUB 5HJ5A 2CYBA 1P0IA 3ZDCA 1CP2A 3KX2A 1EFAA 1XELA 5BV8A 2FWIA 2YN0A 4BX0A 2XUKA 3B9QA 1GZ7A 1L5GB 4DDVA 4Z51A 2G3YA 4HWOA 4XX0A 4KKXB 5L4NA 1XXLA 2J08A 1F38A 1UXIA 2P4HX 2CUNA 1SO8A 5TMDA 1V5EA 3AF1A 4DIBA 3D6NB 3HUDA 5IAJA 1L5MA 4BNDB 4K05A 4UEOA 5LXTA 1ZMBA 1GFSA 3UOAB 2XITA 3QVGA 4POAA 4KAJA 4KLRA 4OXXA 1YZYA 1IK4A 2WF6A 4NY1A 3FOCA 4C76A 4HQLA 2WTAA 4PYRA 1ZI6A 5E1BA 1QQAA 4ZVMA 4LRXA 1PIWA 2X3YA 3GNQA 4ZCPA 1CQZA 1USIA 1N6LA 1H4VB 2IYYA 2YV4A 5B2FA 4F6LA 3UJ7A 4DCGA 4DDWA 1FU7A 1FFYA 1BCSB 5IABA 5AOVA 3JARB 5SZKB 5BN4B 3EA4A 1IN5A 3TCKA 1UAAA 3OJOA 1VI2A 4FI3C 2OGZA 5HS6A 3SC3A 3GH1A 3ZY5A 1ST2A 2QVLA 3I6BA 5CX1A 3SSNA 3U62A 4DABA 4DLLA 4PQYA 2V5AA 4AZ3A 1BW9B 3GLQA 2C0PA 3QF4B 4UNPA 1OBVA 3I0NA 5GPBA 4IFTA 1JT9A 1QU3A 3EZNA 1D0VA 4LS3A 2O5VA 4MZXA 2YWXA 1P5JA 4BFCA 1BFDA 5CA0B 4H27A 5GTDA 3UUWA 2O3RA 4MUYA 3UYKA 1SY7A 3ZWCA 2EBWA 2O54A 4H3SA 3FVTA 1M2OA 2Z9DA 3OJFA 3HCDA 4D81A 3RNOA 1QVZA 1ZW1A 4PZPA 1WY5A 3MERA 3IQFA 1OLUA 4Y9TA 2OQRA 3SYRA 4OM8A 2XE4A 5U4XA 3TLXA 1CY4A 1ZX1A 3U7JA 3ZV5A 2QNIA 2C78A 2P68A 4FMCB 2HPVA 1U5AA 1U5BA 2VH1A 3W9BA 3U7RA 2EBHX 3C3CA 4G0MA 3L41A 4AJNA 1ZNQO 3C5CA 2ZPAA 2UDPA 2PZGA 1E66A 3EGOA 3S2FA 3L4EA 4LWOA 1OKKD 2IHBA 3SI7A 3WRXA 4WZAA 2OG2A 5IDWA 1NL3A 2QJRA 4RZUA 3INNA 3RTGA 1EX9A 4W9NC 1T1IA 2EERA 2I1WA 2J6BA 2MIIA 2QAGA 2XW6A 3A4NA 3PDHA 5DCUA 4O4HB 2GPTA 4UHEA 1EVJA 3ESXA 4Y18A 1HOXA 5LM3A 1RLIA 1P91A 1ZK0A 4EYKA 4AS3A 2VKQA 3VNVA 5I6DA 5KBYA 3EPRA 1RZVA 4H3KB 2J4FA 4YT4A 2AB0A 4WDQA 2WIKA 4LNUA 4PGGA 4YUWA 2W2KA 2Q1YA 4MYRA 4FR0A 2PTHA 1NWHA 2RBGA 3TD6A 3I1YA 2A92A 1X38A 4YX9A 2LE0A 1I30A 3K05A 3P9YA 3GAAA 4RH3A 4C08A 3AKZA 3CLSC 4GMFA 2C3MA 5DHTA 4KVZA 2ZS9A 3ZHXA 4PIMA 1E5DA 2DUJA 2VH2A 2QTHA 1Z26A 3RFTA 4C04A 1W29A 3R3JA 1RYDA 1CB0A 5F2NA 3N3AC 2QRUA 4RV9A 3SSOA 4QFMA 3QW2A 4I5FA 4C1NA 2WWVD 4HBZA 1WO8A 2R8ZA 2YFQA 4ZU3A 3S44A 3T0GA 1FQOA 1M6HA 1R7RA 1Z73A 2DBRA 2YBDA 3KKNA 3PE6A 4Q4AB 5BNFA 3WK7A 2Z5FA 3AINA 3X0DA 4L0CA 4HYYA 4CEIB 4CKBA 2ZR8A 1DC8A 1HSOA 1KI8A 1LKZA 3PS9A 2P41A 1G9TA 1H6DA 3AJRA 2R6GA 1ONSA 1QRRA 1T36B 2HLHA 5FLKA 1FFWA 3EXEB 1SQ6A 3PWZA 1N2CE 1XQ9A 1U0BB 3NHLA 4TV8A 1M34B 4H17A 4B7ZA 3QX7A 1SCQA 3KQSA 3C16C 3IMKA 3A4YA 3A05A 3HYNA 1V5FA 3O82A 4HH0A 4KVFA 2CLSA 4C03A 1D04A 3FFAA 1PL8A 4L6CA 4U4AA 2AX4A 2XQJA 4MQMA 3CA8A 3SS7X 1PLJA 2ZRKA 3RREA 3H99A 4GZ6A 1QV7A 3HU5A 1EUQA 1EU1A 2APJA 2DQSA 2O2ZA 4Z9AA 2D3TA 2O0HA 1NNUA 2NNLD 4IW3B 4J2TA 4QTYA 5IDXA 5TSDA 5LQRA 4MUNA 4Y2SA 2NSJA 1ZRHA 2WU8A 3TOVA 1T25A 3ANNA 4Q15A 2RHRA 4B4OA 2PUWA 2ZBQA 1IZYA 2OO5A 2EFYA 3AG5A 1VHWA 2CEAA 2FZCA 2HGZA 4NESA 2C2ZA 4PPNA 2H4FA 1X1EA 5IC4A 3EC1A 2HJSA 1DINA 1EA7A 2CJXA 4L8WB 3PTAA 3EXEA 2OZPA 1RIFA 4HATA 3GUCA 4IQ8A 4Z4FA 3PTZA 4FB5A 2QNBA 4DDUA 1SC4A 3T9EA 1Z0AA 1Z25A 1N8TA 4I6JA 4JX9A 2DH5A 1OTYA 4HRXA 1U7TA 3C3JA 1W49A 2VDMB 1EWKA 3QVLA 3G13A 4Q4DA 2VYVA 4A2QA 4YAEA 1EK2A 1SUWA 2OCKA 4F46A 4MI1A 2P67A 5DDIP 1JEYA 1IZ8A 4AXXA 1CIVA 1MV5A 4ZICA 1RAFA 3UAVA 2PLRA 1KZYC 2QD1A 3D3QA 1V4VA 2AIRA 1OLXB 3KUUA 3O26A 2ZAYA 3JVDA 1PP4A 4F5WA 5CB0A 1CWUA 3FYUB 4P7JA 3D3EA 3LV8A 4CI0B 1A4UA 4YCBA 4QGAA 3RVQA 2FPUA 3ZHTA 4OAOA 1U1FA 3MWFA 3TSWA 3AFIA 5T7BA 1DBPA 5T67A 3I92A 1G7SA 3T1NA 4I1PA 2HA4A 3JTMA 2OV4A 5EKXA 3FFTA 4N6OA 3U6KA 3KKQA 1IUPA 5CB4A 1YZFA 4YJ3B 3U7QB 1U0FA 4JZYA 3TKYA 4EUSA 5K0CA 3HMQA 1KDYA 2QR2A 2RKWA 3DEJA 1RKBA 4M1TA 4BKPA 1ZK3A 1IBKB 1E3JA 3JPWA 2JCXA 2RHMA 1JKFA 3R5HA 3ZV7A 3M6WA 5K2MA 4TN1A 5JPIA 3OA2A 1HNXB 4R8LA 3L8DA 3A4LA 4KE8A 3QKSB 5DX8A 5FTNA 3VZSA 1O6BA 4EF5A 2OUKA 5C1DA 2H48A 2HWKA 4L1KA 4OSPA 3LPCA 3JXEA 2EIHA 5JS6A 2WIFA 3KJGA 2NN3C 4DQKA 4OSEA 3OTQA 4BBPA 1ACMA 2ODQA 2P3OA 3OLQA 1W48A 2X0IA 2A6PA 1D2AA 2WAAA 3DTVA 4K9LA 4KGDA 4XR9A 3ULKA 4OQ4A 1AK2A 1DG3A 1EM8B 3RIGA 1E2JA 3F7NA 2XMDA 1QRDA 2Y0CA 3KKEA 4BKMA 3EZXA 5B1SA 2AUTA 4XD2A 3GWGA 4UM7A 1IN8A 5AM3A 3HJTA 3GLFA 2OP0A 4OJTA 4DV5B 4INPA 5JD6A 2VQSA 1KEEA 1JDPA 1J8FA 1E7QA 2C4VA 2CGEA 2JRLA 3EULA 1HO3A 4DA8A 2YXNA 2JARA 4FD3A 1GCUA 3I9FA 3NBYC 1PNOA 1X1CA 2OPBA 3I6ZA 4JFRA 3U48A 3ZQUA 3VGJA 3X1ZA 3EN0A 1VZ2A 2O2EA 3DOHA 5ALTA 5D8DA 3PRKE 3BAZA 5G02A 4A6XA 4BMPB 3WYEA 4IHJF 3QBJA 1N2SA 5E7MA 2NZWA 4NDNE 2QRMA 4RJ2A 4WH0A 2IIPA 2XNJA 4N4AA 2Z6UA 5L3SA 5A0TA 3IAM1 5B55A 2VPPA 1NVGA 1NFRA 3QV2A 4H7PA 4U1RA 2OY0A 5EJAA 1G20B 1HF3A 3PIIA 5AXAA 4AIIA 4XWWA 1P45A 1C7FA 1AJEA 1V25A 3SDZA 1QHSA 2V7WA 2CLFB 4TZKA 3AHEA 3CPHA 4JLBA 4V0RA 4OHFA 4Y2TA 4F2HA 5KS2A 1WM1A 5CK5A 1WETA 4J0FA 1PR9A 4RGVA 1G3MA 1VG9B 2A57A 2FK8A 2RG1A 1XLVA 4U5XA 2MDTA 1O0SA 4K40A 5AHKA 1LNZA 4OMCA 5BVHB 3V6MA 3QEMA 4INZA 1ADGA 1X3SA 1PT6A 4EEKA 4YT5A 4IIJB 4O2BA 2BEUB 1LPAB 4OX9B 2UVPA 4HGOA 3UJ9A 1QB7A 3IQGX 1OB2A 5FHRA 2C4WA 1J56A 3JYLA 3MLAA 2UZ4A 3NHYA 2YHAA 3PCXA 5F7JA 4DQLA 1R8JA 1DP4A 3QE3A 1KJJA 3AL2A 4M9XA 4K0RA 1SUAA 1R88A 2F8TA 2CJFA 2JFZA 2QX8A 3BTUA 1ZUIA 5FWXA 1Z12A 2C4HA 3II6X 3NTQA 4I46A 2CJWB 4G0YA 3K0CC 2BF4A 5A05A 4CHGA 1TC1A 3V7YA 3L6BA 3H11B 4CN8A 1GN9A 2GPAA 1A4IA 4UM8B 2JBAB 1Z45A 4LQDA 3TQOA 1TLLA 1M2HA 1U2TA 1JHDA 5KTYA 4OG2A 2H8KA 1KR2A 1T13A 1NU6A 1Y9JA 2GTHA 4IVRA 4LJKA 1YZGA 1TEVA 1UXOA 1XKQA 2KM1A 3DO8A 4FFNA 4GC9A 4LY0A 4N7BA 3F7MA 3KQMA 5HFJA 1E61A 1DELA 1JDJA 1G5IA 2KSQA 4LXXA 4M9ZA 5TT1A 1OI7A 3WX0A 3W5BA 3C3PA 1KSFX 1JHMA 4U02A 5JHHB 1ISJA 3K6SB 1MQ9A 4QGFA 4EYEA 1TQ8A 4YMWA 1LWOA 1NJGA 1Z8NA 3ZJUA 3DQQA 1FZTA 1JVSA 4NPHA 3FYCA 2I3AA 3ZGYA 1FRFS 1KAEA 5THXA 3RROA 5J4YA 5EJ2A 2BISA 2FN8A 3FLAA 4PRLA 2OYRA 4EY5A 5IF3A 1GQSA 4UM9B 1ZMRA 5LMNB 3S1LA 4B6PA 3SPXA 3R6LA 4RVDA 3QVVA 4I2NA 4UDYX 4X62B 1JXOA 3OSUA 4RM2A 1P5HA 1T4CA 2WEKA 1SUIA 2W6ZA 5DXAA 2ZBFA 5JU6A 5BOVA 3K9GA 4HAYA 3GFQA 2GJ8A 1KK3A 1VGVA 4HLUC 2DWOA 4JGIA 2W2LD 3SHWA 2C7GA 4R7GA 1TGYA 3B60A 3MCUA 4GNKA 4FZVA 5TJHA 4JQOA 5LB4A 3UCEA 3T3DA 3RHZA 5LP6A 5K7SA 1YQUA 2ZVQX 3A1VA 1J99A 5T4HA 4RA6A 3BD9A 1PBTA 2CDRA 1MO6A 1N5RA 3CBQA 4KI0A 2P0YA 1JL3A 4P3OA 4CLOB 8ADHA 4S24A 1V9LA 2YZNA 2YWEA 1E58A 1NX9A 4PYMA 3L7JA 4DNFA 4JCOA 3L4KA 1C2YA 5CHEA 4M9QA 3W6NA 3FB4A 2FW1A 4QUJA 4MQBA 1JBKA 1TZJA 2VDWA 3RPEA 1RD4A 4CL3A 3ZX5A 3BB1A 4RPGA 4DKJA 5CMLA 1CQXA 2FV8A 5SV2A 5HPYB 1GV0A 1Y3BE 4Q34A 2FFRA 3KTAB 5DO9A 4YRIA 2ZROA 2C94A 3E82A 1D8AA 3ZQKA 4LZZA 3H8JA 4ZVQA 5CVJA 2AFIB 2JIOA 5JJKA 3PTLA 1MJGM 1PKEA 1LZKA 1PV2A 1RIIA 3AG6A 3Q0EA 4C06A 4EFLA 3K1JA 3R5FA 1JLRA 1W46A 4OOFA 2I7TA 2RHBA 2PS1A 2X40A 1RWOA 3IDQA 2D4HA 3G0DA 4NJEA 2JLBA 3RYFB 4BLSA 4E88A 3LDFA 3A6JA 3MGKA 5CM9C 4XE5A 5EE3A 5EIHA 2QQGA 3ZE6A 2ZP1A 2NACA 3ITNA 3KXLA 4K9OA 5J4VA 3ZE2B 1CYEA 1U94A 1GTZA 1XZCA 5IUKC 2O3QA 1K0FA 3G8BA 1XLTA 3QH4A 5F7OA 5J2UF 2J3DA 3M9WA 2BM1A 4BB5A 1UDWA 2V8OA 2C9OA 1OBFO 4M8LA 2IZ5A 4HLNA 4KAXA 1RPJA 1JB1A 4YHHB 1IXKA 1N3IA 1SGWA 4HZIA 1NATA 4QTUB 4HXGA 4PFSA 3TQHA 4AYXA 4TWAA 4XIJA 1KP2A 1NM5A 1OOEA 2HNAA 1MA0A 2YX1A 3K5WA 4TTIA 2PD3A 4TTRA 3V7WA 4Z4QA 5JYEA 1PN3A 3C14C 4WMLA 3LY8A 1NHWA 2CHFA 3T7CA 1CP3A 2ARKA 1S2MA 2IHKA 5JTUA 2WUGA 4H4DA 2QPAA 1UKCA 3VC7A 3UGKA 4ETIA 2HZ7A 3N28A 3AT1A 4YXWD 3SG0A 4HB4A 1YJ5A 1ZIXA 1H23A 4ZCMA 5CEJA 5FAKA 2AKEA 3GEPA 1O9GA 4KO4S 4I6EA 1JA9A 2MSEB 3PYMA 4PBTA 3RYHA 2YXDA 1NN3A 2ZKIA 5CITA 5KTRA 4PCUA 4UUOA 3BXHA 1ZCAA 1ZP6A 2XMRA 2GAFA 1U7UA 3U4HA 3G8AA 2O0LA 3OFNA 1E5VA 4RELA 1E6KA 1MABA 4JUCA 2RC6A 3BXXA 1ES9A 4BY9E 2FMIA 1HUQA 1XNJA 2P5SA 3GG2A 1JR3E 3AHHA 4DRXB 5HW0A 3CYFA 1NR1A 5BSTA 4DMRA 5JG7A 3UGTA 3I28A 1KO1A 3GCDA 4R8RA 1OJ7A 2HHLA 3DB1A 2LKDA 5KCMA 3VZRA 3ZWNA 2IZOA 4DBLC 2Q4OA 3AY0A 2QD3A 2O3JA 1E60A 3JQRA 2VHXA 2WJHA 1FFHA 1ULBA 3H04A 2CBGA 2FEPA 1C9YA 4MJ3A 3W06A 3WRVA 4TZ0A 1UPTA 2O50A 5F5NA 3E9QA 1AX9A 4PAWA 1CY8A 1S2GA 1H8HA 4KMOA 2PGNA 2XXJA 1RWMA 4Y1RA 3QUTA 3FUXA 3JZFA 3CRZA 2GLTA 3R77A 2ZR7A 4IAOA 4RS4A 1SBTA 3HDHA 1YDHA 4OJQA 2A0WA 4YVFA 5KMGB 3DM5A 2A8YA 2PX5A 1ZG3A 2F1IA 1E2GA 2F9MA 4PG7A 4BFSA 5F2KA 5KQLA 4DR1B 5KWEA 1JR3D 1WCIB 1GGVA 4UNNA 1NMYA 3MT0A 3TPCA 3S68A 4BIMA 4EW3A 1JWLA 1R0XA 2YZ2A 4NE9A 4DE5A 1USUA 4B2IA 9LDBA 1BE0A 1KAMA 3LCUA 3LHDA 4DNXA 2VHZA 3OPVA 5JBIA 3BL6A 4YCMA 2LD4A 4QEDA 4KKVA 5AM5A 3IVMA 3TLYA 4K6FA 1E1NA 2VXBA 4ZTUB 4XVUA 3FCUB 2KBEA 2R79A 4MS3B 1KIAA 2ZZNA 4OLFA 3E05A 4BP1A 5E0OA 5ULLA 3RG2A 2QXTA 2RAFA 1QE5A 1R4NA 3W6ZA 2MR5A 4O5OA 3ESAA 4WD3A 4BECA 4JXXA 1DAHA 4UATA 3A4TA 4II2A 1DO0A 3H13A 5K03A 1E9EA 3OZIA 4DRYA 2Y1CA 5AW8A 1QFZA 1KAHA 2GM9A 3D7KA 1OWLA 3LDUA 3ROMA 4HSEA 1K7FB 3ST7A 5IH7A 2VDUE 2UXDB 5LUAA 1C3OB 5JNSA 2O59A 5IBPA 1CEEA 4F3YA 4DDHA 2A4MA 2H16A 5EGNA 5AOAA 3BT7A 4EYSA 2D59A 3CRQA 2C3YA 4MAMA 3CUTA 4PSCA 2BLNA 2Z4RA 1I2AA 1KYYA 3GZJA 5EQTA 2R7KA 1J0BA 5ICEA 4MV9A 4L57A 2WUEA 3WP0A 4GZLA 2I76A 3LWBA 3ZZMA 1DAPA 2OGSA 2GD6A 2H9YA 3Q9NA 4IHKA 4MR7B 4EFKA 5JWHA 1CY0A 1X1QA 2FPGB 3SF8A 3QEBZ 3KR1A 4HVTA 3MF4A 4FQ7A 3CGWA 4UHJA 5GONF 4F4JA 3BIOA 3HBLA 4MRPA 3BJMA 2P6NA 1QBGA 1SIOA 4QBHA 4ES6A 1KI7A 1U4SA 2CEKA 4KC0A 4QGGA 3NBFA 4RENA 5TQ2B 3F6YA 4G4IA 4P2BA 4RKQA 4CMIB 5EJ4A 1U8ZA 1G2IA 3KQVA 1SBCA 1C3OA 2ORWA 4AECA 2XX3A 2VHJA 2P2ZA 1S0UA 2W8BA 3HVHA 4OH1A 4UE6A 4FOSA 5CLLA 3EMDA 5LQDA 2FW6A 1TL7C 5DVZA 2Q49A 1GTJ1 1Q0LA 1UEJA 5F1KA 2BHNA 4JODA 1FK8A 1PQPA 1D2MA 1GIAA 1T91A 2GSDA 3A37A 4JU9A 4PLVA 4BU0A 4DQUA 5H7XA 3RBXA 1JLLB 2W90A 1FMJA 4JVLA 1WMSA 2VYND 1PVVA 4R69A 3I9JA 5LU8A 3IDOA 5EPUA 1KYZA 3L6EA 1C8BA 3L6UA 4MB0A 5L53A 1LB1B 3EBLA 1RM3A 1AHNA 4C6TA 4YMSA 3Q3IA 3WY9A 2DFDA 4YLYA 2HJVA 3V4RA 1CUIA 5BUQA 1E20A 4FZRA 1PFYA 1TUGA 3DJFA 4X6XA 3RWOA 2CSUA 2PZBA 4AD8A 3G9QA 4X91A 3HNRA 5DP1A 3N59A 1UC4B 4QU0A 4DM7A 1WUKS 2C5AA 3Q8MA 1CZHA 4GX5A 5FWDA 3RTAA 3JQFC 4LV6A 4G24A 4JI3B 4BN0A 3PQ8A 1LNQA 4TWBA 1HE8B 2Q29A 4DV0B 5GP1A 2IKQA 1W0KA 1YRWA 4OHOA 2QN9A 1IUNA 3GFBA 1XD2B 1A9SA 2IZ7A 3ABZA 5J43A 1DO8A 3PQCA 4MIEA 4HRVA 4TKMA 4WOCA 3O3NB 1W44A 1F2VA 3PG5A 5EERA 3JSXA 1BOFA 1A77A 1NLZA 1V8ZA 5DN6A 1R9GA 4PIPA 2MCFA 1R2QA 2WSBA 3H1GA 4FFMA 3ADDA 3IEKA 4YAGA 4WNAB 3DT9A 1CR2A 1Z0JA 2H2WA 1CUZA 4D0GA 3M6IA 4CG3A 3PHGA 4BAZA 4AS2A 1KF0A 2SICE 1LDYA 2AJDA 4NJMB 3O1LA 3ILVA 3KXIA 1VP9A 4TL9A 4X1KB 1GQYA 3I3SR 3TINA 3W3ZB 3GO4A 2QW1A 1YOBA 5ALWA 1WKBA 5A2QA 4BRWA 1Z8HA 1W4LA 2OB2A 2IZZA 2Z1NA 4N3AA 1ORIA 4FR5A 5DGCA 3BZWA 3EAGA 4JI7B 2Z6QA 3ELYA 1Z7EA 1JN0A 5KNBH 1P8JA 4W1SA 4EHNA 1XFDA 2VL7A 5JS1A 3GMIA 3ETLA 3NGMA 4W1RA 1ZCJA 1J25A 1OUMA 2GX6A 5JQGB 4MQ5A 2DPLA 3W9SA 4V1CI 2CXUA 1NTRA 4RTPA 4QPDA 2XBUA 1Q91A 3WVNA 4O4HF 4AULA 3QE2A 4B6SA 3IQWA 3THYA 1RM5A 1EFTA 5JAOA 1EJ6A 3HACA 3V1MA 2DRIA 4ZPJA 4C4PA 1GFIA 2YQ5A 4RFSB 2D5IA 4PBRA 5D1NA 4EP1A 2IX3A 3EIQA 4J7AA 1JFLA 5B7GA 2ZM6B 5CU7A 4QHTA 1BJRE 2RGYA 4QM6A 2V7QD 1D7OA 2C9DA 2OC4A 4MVXA 4BNXA 4F5EA 1T5HX 2WWHA 4RMGA 4MDHA 4DWOA 5CLFA 5IS2A 1GNPA 5IJ9A 3BAFA 4MCIA 2J41A 2NSHA 5DX0A 4K6GA 4WHMA 1LSOA 2WYWA 1F4PA 3NWPA 5LYJB 1TD1A 3VVLA 3DBHB 3SX0A 2IXBA 4QU5A 3TRHA 4LC9A 1LLFA 2I2FA 4QDKA 4JR1A 5AXBA 4RHFA 5KNCH 2C03A 3FVWA 3V4SA 3VO9A 2AHOA 3COVA 5F9FA 2JFVA 3WMRA 1GOTA 2G36A 3P71T 4RNDB 1LBQA 1ZMOA 1Z5UA 1NQUA 2HBZA 4J03A 1N6IA 3FZNA 5G0VA 1N0HA 1TT5B 1ECGA 3VYVA 4OQDA 3GP5A 4KO3S 4EJ0A 2PLWA 4DJFC 1FYXA 2ATXA 2FX2A 5HZHA 4ZIRB 2ONCA 5DCLA 3VR4D 4EHKA 3TZKA 4RPHA 2GH1A 3C5EA 1TMYA 4XGRA 1LDEA 2IV3A 4M86A 4INJA 2K6GA 4AG6A 1E8MA 4G4GA 2ECKA 4PIVA 3NHJA 4DBZA 4DJ5X 2J87A 4RL4A 3CONA 1KS9A 2C58A 3E22A 1X7XB 2C99A 2WBLC 3ZLTA 3D9QX 4DCPA 4MR9B 5FLXA 4EHIA 1J49A 2A5DA 4Y1FA 4CZ2A 4LFBB 2WI8A 3WB9A 3FSGD 3F67A 3H1TA 1E7SA 3PR3A 5CCEA 5BSRA 1H0SA 5BNWA 4MGEA 3QVMA 5LL6P 2OWDA 1K7CA 3MUFA 1NI5A 1QGZA 4WWHA 5H3HA 2VWQA 3FHCB 4UTZA 3WGVA 5EMLA 3MELA 4UNRA 1Y1RA 1P3Y1 2VA8A 4J7XA 3EWNA 3R9IA 1EQUA 3ASZA 4J9VA 4XJTA 4NE2A 2FNAA 4FHGA 2HU7A 2IYEA 1MX5A 2JZOA 4PWYA 4RFSA 1XK6A 3IQDB 4RKWA 4D9IA 1U8TA 4QBGB 3JVEA 5KOJA 4ARZB 4V1CA 1IJFA 1SCUB 3UBTA 2JEYA 4OI1A 3SQLA 3KZ1E 1CVLA 3ZZ1A 2GZHA 1TJ5A 3Q85A 2YJ6A 2GGSA 3WWPA 4M1QA 1EFPB 4Q3DA 4RTMA 3C97A 3J80A 3MWJA 2IIQA 4HH1A 4GOMD 3AIIA 3NEJA 2UZ3A 4COOA 4U7DA 1MLDA 4RVFA 1YQXA 1ZEMA 5DI3A 4QELA 4D9HA 4WVFA 4ZVOA 3DV0B 4B3TB 2OCBA 1EWTA 1VP3A 2IHJA 4JAVC 4D9KA 2B4TO 4HLCA 3GQBB 2OSVA 3VNBA 2RJNA 3TOCA 1QCDA 2FQWA 1YVRA 3BMQA 3JX9A 3T9DA 5K6RA 2GN2A 4X20A 2N75A 4BVFA 4F97A 2FVYA 4FQ5A 4PSDA 5A02A 3A31A 3RBZA 1UMDB 4FGKA 4G26A 4Z4EA 3FKSD 5CM2Z 3G2PA 1ZVMA 2PSFA 1JS1X 2JLCA 3RVPA 4A2CA 4EPXA 2WR8A 1FP4A 4X66B 1EH5A 1WZIA 2EEPA 3G89A 4QQNA 4YJ3F 5GJVC 4BEWA 1DXOA 4FW9A 2PJUA 2SHKA 4I8IA 4E1BA 1AO3A 1BJKA 5G0WA 1UM8A 2OBYA 2Q7XA 3FE2A 2P3SA 3KSUA 3L77A 3L7AA 3EW7A 5DHQA 2CVOA 4P54A 3JTEA 4UNIA 3D2AA 3DE4X 3MW8A 3D7SA 4H60A 3VHXA 1CDZA 4O63O 1NXPA 1Q0TA 3M5PA 1WPGA 4Y2XA 3K9QO 4LWPA 4ZV9A 1XXHE 4RPJA 3SBEA 5IKMA 4B3GA 1VYVA 3P9ZA 2VAXA 4AY5A 3BD6A 4UHKA 3WGHA 4D4JA 4F4UA 2FQ1A 4JKOA 3ZDQA 3EFEA 4Z7NB 2GUWA 4KRXA 1BN6A 1RSZA 2ZG6A 3Q40A 3A8TA 4BWFB 4B7AA 3U7HB 2OZLB 4CLEA 2QZPA 1ZLYA 4P0TA 1KO7A 2QMQA 2WSIA 4MWZA 4MAFA 4XX1A 3CVJA 2O8DB 1WCXA 1HE2A 1PR6A 1DX4A 4NG5A 5JEDA 3MFYA 1OCEA 2AVDA 3ETGA 4PANA 2RE8A 4PHTA 3TEFA 3F5QA 5IKOA 3IUQA 1LBEA 1OJLA 1K2VN 3NV9A 3OZVA 4YEDA 4NOLA 1WABA 4R68A 3C0KA 1AO0A 4G1UC 2AE1A 2VT6A 3T1TA 4RETA 3DCNA 4WOBA 1NYQA 1PDWA 2FN9A 3CBGA 4ZCLA 5IK2A 2XAAA 2VK1A 4A6PA 4J1TA 3WGMA 1EFUA 3CGGA 2ZUTA 1F4LA 2ZUUA 4GM1A 1SVSA 1X42A 1D1TA 1TMOA 1V3UA 1FJ2A 2GRAA 3QUBA 2SKDA 3V2HA 1VTKA 4D9NA 1QORA 2G9NA 4IDCA 1SQGA 2E7ZA 2H92A 3OHSX 2FG7C 4DV7B 3UHJA 4F5DA 4I4LA 1U3TA 3O03A 4P4TA 1IM8A 1DC6A 2YNMD 3QXSA 3GDGA 4EG5A 4DQVA 3CKLA 3AEKB 1R12A 2W6IA 3QX9A 4ZAZA 1GQQA 4ZRDA 4XYEA 2D8AA 4HDSA 1NA5A 4LYDA 1DIHA 4EEXA 5EVCA 1WU8A 4KIGA 2PX2A 1NFQA 1PR5A 2WHEA 4WJKB 3VZCA 3RW9A 3LWZA 3X1WA 4YRFA 1SUBA 3P9IA 5KYNA 2E48A 4RADA 3HN6A 3WGLA 2VEDA 1T9KA 3T12A 5AD1A 3GK3A 5EJEA 4IIJF 3ZE0B 1MDFA 3JWGA 2EG5A 3L6DA 2YUIA 2W0MA 2R00C 2WD7B 5ALYA 2DC1A 2HA2A 1N6PA 3A4MA 3PRJA 3M4JA 3ROXA 5D5QA 1LX6A 4WLNA 3WYAA 5HX7A 3NP7A 2P40A 4LKOA 1PZMA 3MRXA 2NZXA 4JYZA 1OXMA 5JY1A 4HDMB 1R10A 1OTHA 1WD7A 2IUSA 3A11A 4M9CA 4RZSA 1Y8QB 3VSDA 1N33B 1GA1A 4XCXA 1AGPA 1DE0A 2FCRA 2Q9BA 3R9KA 3D5EA 1QUFA 5JRZA 1G0OA 3EVTA 1YJCA 4DIDA 1ZNZA 2I3ZA 4OLHA 3DE7X 3SDBA 1XQVA 2Z30A 4PCVA 1GZHB 4ZT5A 4N3GA 3PD1A 4ZVVA 1KIFA 4Z99A 5E1DA 3E70C 3PNLA 1A98A 2QL9A 4LHYA 3OWHA 1NVDA 2FR8A 1OAOA 5HF5A 2A9PA 2ZIUB 1WSWA 2QRQA 2JIBA 3H87A 2J32A 5JSQA 1FX0A 4AM8A 4IDBA 5CB6A 1OU4A 2Q5HA 3DKKA 4OHWA 1DC4A 4P82A 5KSWB 3BFJA 5HCIA 1CS0B 2Y1XA 1IJKA 4XOIA 3RNLA 4E03A 4F56A 2WSLA 5KYWA 3N7UA 3HKCB 1P0QA 4HDNB 3OFVA 1YTUA 3O4JA 2X8WA 1Y1LA 1R8YA 1GKYA 4LJ6A 4L07A 2IHZA 1O77A 1NPTO 1WA5A 2F8LA 2FZWA 2P27A 2QE7D 2R4TA 2XUIA 1IHYA 4ZVNA 2IBSA 2YOFA 2H85A 3NTRA 2PO5A 2XIJA 4MDYA 4MNTA 1JG2A 1QYIA 2QG4A 4MA4A 3KTDA 3WLRA 1UP7A 3VR5D 4LYHA 4PU0A 1QRAA 4JC4A 1ETHA 1DTSA 4IKPA 3CEPB 1CW2B 1B6GA 1CF2O 4B80A 3G3EA 2AMJA 3DVAB 1RZRD 2PKQP 4PGFA 2QBYB 1GPNA 1HSZA 2EXXA 1RAGA 1ZGGA 4C2UA 3VR0A 3K70D 1AQJA 1P61B 1RQGA 3CISA 2CW5A 2HY7A 3AILA 3FUVA 3R4CA 3V9PA 4CDNA 4JUAA 1I6WA 2W70A 3EXAA 3CW8X 4GMKA 1D4AA 4MQLA 4QXQA 3UWDA 1JLMA 5DBFA 3HPRA 5AKYA 4B17A 4ZZIA 4QXMA 2XCIA 5KU7A 2B1GA 2PZEA 1P29A 1XEXA 1SOMA 3IVCA 4MO9A 2XV1A 2DP4E 4D2IA 2RGAA 1JQJC 3OLVA 3OIUA 5AH0A 3BVPA 3GA5A 4J0IA 2PXXA 2R86A 3JY6A 4F4DA 2H7CA 2IHVA 4IZOA 4RX1A 3K6KA 3IDSA 3GQVA 4ECEA 1RNLA 4FXOA 4MEJA 4TRRA 3W6UA 5AW5A 3ZLVA 1GG8A 2PCLA 3JR3A 3USCS 5ARBA 3F98A 4DEXA 3M9LA 4UVIA 4FN5A 1KJIA 2BH9A 2Q99A 3U16A 1YULA 3FDZB 1R6TA 2A0FA 5AW2A 3AR5A 3LP6A 1Y1PA 2H1VA 1NULA 1H2ZA 2N1MA 2PX0A 2X14A 3D1JA 1DS6A 3OZEA 3BSYA 1GNQA 1E6MA 1VECA 4O2AF 4EHAA 1E64A 4DA7A 2YVKA 2EW8A 4CLRB 2J0VA 4PPFA 4V03A 3KQUA 2CUKA 3TKAA 5HA5A 1T0HB 5C7IO 1X94A 5JHGB 4A0HA 2QVYX 4FBGA 5DU2A 1V11A 3D2BA 4WE3A 3AVXA 1OHHA 2C7QA 5M3BA 1ZJ4A 2PMDA 5B12A 4EX7A 1HTWA 5KAMA 3GN1A 4Y6LA 2C5LA 1NW7A 4GWKA 2B98A 2IDJA 3NOQA 3LYLA 4WESB 1GAJA 4JHXA 4KBYA 5BORA 2HFJA 4UBNA 1PSDA 1K08A 2IYQA 1Z5ZA 1J21A 1TTQB 1ATZA 2R1ZA 3H05A 3N2GA 5IW8A 3NCTA 4LEIA 3WB1A 1NP7A 3NHRA 5AJYA 5TE9A 3O0DA 4HGRA 5KU1A 3I05A 1TEHA 1KRHA 2YNMC 4TRNA 3AF3A 1Y8CA 4YMTA 4LECA 4QBFA 1UPFA 4TX1A 2P9YA 1A4RA 1DQYA 1NIJA 5EIWA 3BHJA 3RVNA 3TF5A 2KB0A 4YJGB 2O20A 1JFSA 4EHHA 4DA6A 4LDRA 1N8SA 3JATB 4OUKX 4RXUA 1ZUNA 3C6XA 2QN2A 4UZEA 4XM1A 2A9KA 1G55A 2C84A 3NUZA 3TDKA 1Y4UA 2HSWA 1FQKA 1OGYA 4NZ9A 1D2RA 2PS0A 3FPKA 4HXFB 4Q1CA 1N2CB 3VU8A 3ZWVA 1PLLA 2W2NA 3HSSA 1HLDA 1XL1A 2BKUA 1G21A 1YRAA 3SXPA 4FGUA 4MW9A 3BL8A 4ENRA 2EJVA 3NONA 2VRNA 4TTQA 4BVJA 1CLEA 4QKQA 2QN6A 4PC6A 1Y6FA 1HYHA 2X76A 2QM8A 4GHWA 4X60A 4D98A 3GAZA 1AMOA 3VZQA 3E9NA 5FL3A 1OAKA 1JQAA 5CUQA 3FMPB 4C0SA 1Z0FA 1O4WA 5DHAA 4K9MA 3ASYA 2GRUA 1R6UA 4BXOA 1BHO1 3K8OE 4KQJA 4AN4A 5C52B 3U9SA 3AVQA 2IQIA 2JHGA 1YB7A 2WTMA 1C14A 1Z18A 2JCSA 3SX4A 2EU8A 1PWYE 5BY2A 5EA2A 4Y9DA 2CDBA 1QZ3A 2E82A 3KXPA 4G8BA 2D1FA 4YV1A 1M3SA 2X8JA 2VYCA 1G7RA 7YASA 5ICSA 4D1YA 2A0XA 4NV1A 3WJAA 4KIJA 2P9CA 4PBSA 5L4SA 1XEFA 3HRKA 1S96A 2B35A 2JD2A 3HO8A 4JDUA 5JSKA 3WA7A 5IKXA 2FPOA 1KRXA 1QAMA 2F00A 1JAXA 1XDGA 3SZOA 1YU6A 4JN6B 1Z6YA 4BQFA 3F78A 3N6RA 4OJYA 2AQ8A 1FJHA 4FZ5A 1I01A 2OB1A 1RXVA 1J5XA 1NLUA 4PQEA 3BH7A 1RBQA 1HTTA 2H63A 1WDKA 4OD0A 4UU8A 2V98A 4PG8A 4PG6A 1CT9A 4GBGA 2JIZA 1YS4A 4OBXA 5EWLB 4COKA 1D07A 1CNFA 2I6UA 3RADC 5AJHA 2PUDA 5LQKA 2ET6A 3HO1A 2FSGA 1E2QA 2B1RA 2EFJA 4QYIB 3DDUA 4WFIA 5EI5A 5IP5A 5JY6A 4HFJA 4HWSA 1F48A 2VO1A 3TIFA 4OXRA 3LBNA 3ZDDA 5GZ3A 4OAQA 3ZEIA 3PDIA 3NKVA 3X43A 3WBJA 4EQ6A 1T3SA 3RGWS 1JMVA 2IOFK 1H6BA 1FDRA 3AESA 4ZQBA 3GXBA 4OQZA 2WD8A 3WOVA 1DUIA 2ZSIA 3WICA 2OK8A 3K6RA 2O2GA 2VHUA 2YXEA 3KEFA 4NE7A 4YAWA 2AN3A 1L5NA 2WJIA 3PD0A 4XR4A 4CR8A 2XWSA 3VYTB 3V33A 1KMIY 1SUSA 1P9NA 2JJ8A 2WVHA 1GGHA 4GSLA 4JSTA 2DUWA 3OIFA 3PJGA 1QRTA 1JVBA 1V8OA 3ZWMA 5JPCA 2O5EA 1WHSA 1YRLA 1Z0DA 3T7DA 3CNNA 2BR3A 2WFAA 4G63A 1WUIS 4OYYA 5D01A 1RAHA 3ZD6A 1GYRA 4S1VA 4BNTA 1GDHA 1T8UA 1T0UA 1VKJA 1IBRA 3CEMA 3GLHA 3N74A 3RS0A 2JAWA 1RLUA 5I9NA 3EZ7A 3DHNA 2YJZA 3UXYA 2W6NA 2P2SA 1YZUA 5D3QA 5DXFA 4B7UA 2YN2A 3KCNA 4QG7A 4GU5A 2JLRA 3R3ZA 1YB1A 4ZODA 4DC1A 2CNDA 1RT9A 1RDFA 3OJCA 3UGQA 1JJIA 3PHIA 3FDFA 5KJEA 1QE3A 1YB6A 2GNOA 3K9BA 3H9JA 4AU1A 2WUDA 1KEWA 1MAWA 2P77A 2VDRB 4GOOD 5J2UA 1CEXA 5REQB 1N7HA 2VUIB 1D3AA 2IIBA 3LY9A 4S05A 1YA8A 3WIEA 2DFVA 3ASUA 3GOHA 4KK4A 4WCVA 3EUAA 4I3FA 4QGSA 2CYCA 4FDTA 2UVDA 3DBIA 3HG7A 4TL8A 1SB9A 1Z0UA 5A3RA 4ZOLA 1T9GS 5JR3A 3QLJA 3PXXA 2GCIA 4M88A 4EFNA 1ZIOA 1WSAA 2V96A 4FFPA 4QL3A 1XAGA 1AA9A 3MLBA 3D3WB 3F3YA 2MSCB 4RJIA 5EXSA 5MF6A 3WKBA 2ZIWB 4XASA 2YS6A 4DSUA 2IRWA 3NWOA 5CTJA 2LNDA 1CLUA 4D0LB 2O06A 3GX1A 3QY9A 2AMVA 2CFSA 1SKQA 3PQ4A 4HR7A 4KGVA 3G02A 1IZ0A 1U6KA 2ZB7A 4CBVA 4DANA 3HCBA 5K3AA 5K3EA 1K8ZB 4H9GA 2HSJA 5AKXA 2ZQYA 1L5WA 5EZQA 2WU1A 4CLXA 1AH2A 3GJTA 1RFLA 1XI2A 3SZ3A 2F8SA 1OSNA 3G1TA 4YBZA 1C9EA 3RRZA 4WW0A 2FQXA 3V32A 2YWDA 3A6GA 4UQLA 5HSGA 4QQRA 4R9NA 3WQBA 2PSJA 1TYAE 1U3VA 2UUPA 4W8GA 1G64A 3TYXA 4G0VA 1TMGE 3WLJA 1VPDA 2I3GA 1QFXA 3CUEF 1RJ9A 2ERCA 3ZVKA 4W5QA 1SQSA 3L92A 3V5NA 1EJBA 3GD7A 1LDMA 1TK2A 3BRWD 1ODSA 3MRVA 1FTSA 2OC9A 2R2GA 4MMZB 4CIAA 5K8IA 2WG1A 2PJZA 3B7GA 2PRYA 3PJEA 2LWIA 2VOEA 1GHTA 4N03A 4Q6WA 2M6KA 1F2DA 4A8TA 4DR4B 2ZPUA 3KJHA 4MVJE 5E9WA 2WSSA 3KSBC 4QBTA 4RV5A 1PV4A 3IBFA 4H31A 2AWOA 5JSHA 5C4IA 2JKVA 5AI8A 1KH2A 1MFPA 3DV9A 1NY6A 2HDWA 1PFWA 2PBZA 2QUAA 1QB8A 1L5ZA 5IC6A 2XUQA 2OQ2A 5B1HA 3FG9A 2AJTA 4X3CA 4BNYA 2NU8B 4I9NA 3D2LA 5HDBB 2ZZMA 2OV2A 2EF0A 5GM1A 5BWCA 4W7SA 3AHGA 1A2BA 1II0A 2ISQA 4JA0A 3RTBA 3K0AA 4PX3A 1GCGA 1BGVA 1A2OA 221PA 4P9NA 5DH9A 3G6KA 3NAMA 4BLPA 1Y1TA 4BN5A 5AW3A 1Z0ZA 2VQEB 1APBA 1KVSA 5IT0A 2QL6A 2HBYA 1YC2A 5A4DA 5HQ3A 3WO0A 1IK6A 2VC2B 3HYSA 4DCUA 4E4YA 2GXAA 4MVJD 1S4MA 1W4CA 1RM4A 1U63A 4ZYLA 3AOEC 1UZAA 4QDZA 1DHRA 4X00A 4ZZ1A 2IHYA 3HKEB 3AHFA 4LCBA 1L9KA 3C7CB 4WN9A 2MU1A 1CZOA 1W2HA 1ZD9A 1DADA 3R75A 1IAQA 1RTKA 3G1UA 4P3NA 5IJZA 3DHWC 3LUFA 4F3NA 1SELA 1U5CA 2CMKA 3KAQA 5CVEA 1N2ZA 4XQ0A 1RLTA 4M0FA 2LR0A 4R0MA 4OQPA 4DNOA 4ZOEA 1TIPA 1UT8A 2WAYA 5JS2A 3KLPX 5JSFA 5LYJF 1N7JA 2Q9UA 1O6FA 1N5IA 1OH7A 4AY6A 1UFVA 2F62A 1L1RA 1QGOA 3PQ6A 4JOBA 4MS4A 5EPOA 2C96A 5FL7A 3SY8A 1UEIA 3VDQA 2ZXFA 3ZI4A 1VPWA 4HNTA 2Z2KA 4P36A 3F2IA 4TSRA 4YWHA 4CFYA 1Q3KA 2OAEA 2JD1A 3P94A 4D7AA 4E15A 4EB6A 1VMDA 4JBWA 2HA6A 2R6FA 3GWZA 4DCJA 1TM5E 1F8UA 1RAEA 1JA0A 3LT5A 5TS3A 4BGIA 4ENVA 4CV2A 3BJIC 5IT5A 1DXYA 3SOZA 1UOPA 2V0CA 4FFVA 5EYPA 2XUAA 4ZOCA 5AI6A 4HDRB 3F3MA 4Q9DA 4QXPA 4S3MA 5F3WB 4P7BA 1U8YA 3FWZA 4XLLA 1A50B 5GONA 3IL2A 2O7SA 2HDHA 3JQCA 4E33A 1A2KC 4UBLA 2BEVA 1E2KA 4IZHA 1NQVA 2D2FA 2I03A 2QTZA 1MF7A 4Q3OA 5IYZA 2ZRHA 1EXNA 3IHWA 3O7WA 5G1OA 3PNBA 4RTRA 1WW3A 4NOJA 2PWYA 1OE0A 3KELA 4BNHA 5DM4A 3V4FA 1IUOA 1UC9A 3TSAA 1RBYA 4FI3F 3F1LA 3FOWA 1RAAA 2J30A 2QZ4A 4MDEA 1DWQA 2Z8YA 5KREA 5AM4A 1YK0A 2P2NA 1AZLA 1KMMA 3ONDA 1XGKA 5LCXA 3CX8A 2FA9A 3TB6A 1N0VC 2UU9B 4KRGA 4DV6B 2YV1A 5JXJA 2IUYA 3M6MD 1JR6A 3W9UA 3TQIA 2HSGA 2XWPA 3CF4A 4EKEA 3FZGA 3K1AB 4GSKA 4HDRA 4K8RB 5BNIA 4FC7A 3L8HA 2C9ZA 5G3YA 1ONBA 1SWWA 5LA6B 4F7DA 1DOAA 1FUIA 1PHPA 1SXJE 1LEHA 1P75A 3E3OA 3I83A 3OF5A 3RRXA 1I4EB 4WECA 1FSSA 1C5KA 1SCDA 1R9JA 4OHKA 1HDZA 3ONFA 1PE0A 2D74A 2FHPA 1MTZA 3FTEA 3IEXA 2ID8A 1C1XB 2BFPA 1MXHA 4R1SA 5LYYA 3VZDA 5H3LA 3WMGA 4QNNA 3PJFA 2A78A 7AT1A 3O95A 3QFCA 2ZE5A 5IVDA 1GM5A 2CHQA 1EB9A 3JRWA 3K8ZA 3FETA 4BWYA 3IAM6 2JFWA 3DD1A 8GPBA 1WXIA 5E8JA 4X54A 4RPKA 3SIRA 3LRPA 4Q4CA 1C3LA 1GQFA 1X0XA 3T06B 2ZTMA 4G5HA 3DZHA 1MBZA 4FMDB 5L6LB 2NU7A 1GD1O 1HYBA 5LA6A 3O4RA 3NTVA 2QVZX 5KB3A 2GJKA 4GZ5A 1TK3A 1IOLA 4JC8A 4CGZA 5DYTA 1GZ3A 4OF4A 3JQ8B 1KE2A 2PPLA 2QLTA 4AJ2A 2D0PB 4EX6A 5DYYA 3G1WA 3L7OA 1QHNA 2GTPA 3RWBA 5F76A 3L8GA 4MB6A 1O89A 1FC0A 4HMQA 3EQ6A 3UZUA 1NG1A 1WSDA 1MO3A 2WJPA 2W58A 3GPIA 3GRFA 3G0OA 4BFZA 4YXFA 5EHXA 3B1YA 1KMCA 4REOA 1C1XA 3K09A 5EIFA 3UF0A 3SHTA 4MRNA 3SNKA 3WMXA 3BKWA 5AW7A 4KIFA 1VJTA 2PUTA 2FPXA 3T6KA 3O2JA 4M98A 3LXRA 4ZGGA 2V1XA 1HDGO 3CX6A 1TK9A 3D02A 2CD7A 5CD9A 3IMEA 3QW4B 3JYQA 5F23A 3TKLA 3WV4A 1QJCA 2GETA 5KNLA 2XD4A 1UDAA 4XGNA 1PFVA 1R64A 5FNVB 2FPPB 2GJ9A 4LF7B 1G6HA 5FJJA 1BE8A 1F8FA 2II6A 3ONVA 3RVLA 3VU9A 2HHHB 4JI2B 2C7RA 3OZXA 1W93A 1IIBA 1PRYA 4B2PA 1Q0PA 3E4DA 1G2OA 2EKPA 4UEKA 2E5LB 3AB7A 1JFVA 1PZHA 2AYYA 4ZD6A 1F17A 1HPLA 3ELWA 3L7CA 2BCJQ 4RHTA 1P7ZA 3URMA 3V2IA 4KH0A 1VHTA 5LLDA 1FYDA 1ZITA 5FLYA 3AVWA 1CPYA 4Y6SA 1Z2EA 5ENZA 1DL5A 2CNLA 3BPSA 3M34A 1M0TA 1OI2A 1N2OA 2I6TA 2YMMA 1PT5A 3O21A 3AUUA 1OXSC 1GNRA 3EXHC 2C8KA 2LVBA 3AETB 2JH3A 1I2CA 1M74A 2NO6A 2OT3B 1V5WA 1GRQA 4XYGA 2BT4A 5K9ZA 5L3VA 4XRGA 4RQUA 4KR3A 2NMVA 1U4OA 2C9CA 3GGSA 4HAUA 5DGHA 3R7AA 4IV5A 3VV3A 3CG0A 2QA5A 4Y2YA 5FULA 3WOHA 1D4OA 4R84A 3THWA 1M0EA 2B2XA 4D3DA 1ZVVA 2VSNA 1V9CA 4C01A 4GVPA 4OHVA 4UDXX 1I5OA 2Q0SA 2Q0QA 3PK0A 2FSHA 1L8AA 1NBIA 2RBEA 3DV2A 3GGPA 2FOIA 5HKOA 3H5LA 2G40A 3QRWA 1BWQA 4YRLA 2WHPB 4DLBA 6REQB 2AR0A 5LZ4A 1NXSA 4FNOA 4M1OA 1I4WA 1Q57A 1AGRA 4DWWA 1Q0ZA 1TAUA 4XA8A 4B3RB 1WLYA 1FDSA 4TQUS 5LD2C 1L4KA 5AHRA 1QBKC 3CX3A 2NZ8A 1EZ1A 2HHJA 4MV6A 2JJ1D 1CC1S 4I8DA 1I0LA 4CDRA 1CIPA 4K86A 1Q95A 3RUIA 1GUDA 2CHEA 2HQSA 3AWIA 1DQNA 3GJRA 4NS4A 4XJSA 2XUDA 2VFAA 3UKJA 4AJ9A 2VNAA 3A1CA 1K5GA 4DPKA 1JMKC 1JNXX 4YR7A 1Y5MA 5A9SA 2GK7A 3UB4A 4UZFA 1EKXA 2L82A 2AI1A 1AVTA 2B7CA 4PCAA 3PC3A 2HIHA 2CV1A 3HXMA 4CTNA 2FPIA 1I2DA 3DZJA 2FPLA 3BIWA 4KQ1A 3YASA 3T5AA 4YK7A 4CM8B 3OM9A 1GGEA 1PYGA 4RZQA 4K6MA 4MQFB 4BP3A 4W1PA 2PKEA 3E48A 2BLLA 2NZUG 2EJCA 2JS7A 3FOZA 3UJAA 3PT5A 3RM3A 1DMSA 3AY7A 4RXTA 1FP6A 4NNJA 4XTCS 4M8NE 1G9SA 2OP1A 4KW7A 4RUKA 2L19A 1B14A 2NIPA 4TKUB 3M1IA 5SZJA 2BMJA 4UAUA 1S9HA 4YUZA 6PFKA 3EZYA 3L02A 1O54A 2QUHA 3OJ0A 3WLLA 5GZ1A 1L7MA 3LOQA 2HXGA 2CZQA 5LMCA 1JG1A 3JYPA 3QI2A 5P21A 1TQ4A 5G1NA 1LBHA 4F3KA 1L8XA 1WDMA 5TB5A 2I4NA 2IYZA 3M49A 1I4LD 4UHCA 4F2WA 2XE7A 4RAQA 3Q9LA 2GTIA 4YV2A 4HJRA 1VCHA 3F97A 2XTZA 3SC2B 4MPPA 4IIVA 1QYWA 5L3RA 3OSZA 1IG0A 2FRDC 4PAQA 4Q21A 2YIDA 5FPPA 5J2TB 1CE8A 5B30A 3H1FA 5D3MA 2CFOA 1JVNA 1GUZA 3FCAA 4LJSA 1PK7A 4B84A 2Q21A 2AOTA 4ZEXA 1LPBB 2FUEA 2L42A 3KUXA 3M0EA 4JB3A 3V48A 5CXSA 7REQB 1M6EX 2GK4A 4TTSA 3T4EA 5AVWA 3JVIA 1X6VA 3O4FA 3QMMA 3KQNA 1Z4OA 1WX1A 5AK4A 1G18A 2VWHA 2ZBVA 4LY9A 3SZGA 1UC5B 2GCGA 4PQGA 1BWSA 2LBPA 4YJ2B 5MN6A 2X5NA 3IP5A 4NU5A 1G17A 4GUAA 2TMKA 2ZK7A 3BYZA 3H4IA 5ER9A 2O0KA 5H59A 3RH0A 4IIGA 2M32A 2Y6VA 1WMBA 5SY9A 5FQOA 4TWIA 3LIPA 4HK4A 3F49S 5I9IA 3UGJA 1F0KA 1SD1A 3O3OB 4R2IA 4XB2A 3SC2A 5LR6A 2B5OA 3AIOA 3DHYA 1I5RA 4G5FA 4Y0AA 4BZPA 1TKRA 3V8EA 2A58A 3BGIA 4Q16A 4YCJA 3GL9A 3N2KB 5SYAA 3L01A 2VPQA 2TMYA 3E7FA 2X0FA 3AR8A 1EQ2A 4XZ3A 4Z2YA 5BWOA 3RS9A 4OHXA 1KQPA 4EPTA 2PO7A 2JB9A 3URKA 3I12A 1Q77A 3EIHA 1IU9A 3MUEA 2PQ0A 4YALA 1UBRS 5CIWA 2JFXA 1KAGA 3F0TA 5MGNA 4PXSA 4JS0A 1QWSA 4H15A 1G2QA 1QIHA 3V42A 2R87A 1NBOA 2GRJA 4DTIA 5ITZB 1ULAA 3BWMA 3KJFA 2QP3A 3EQ7A 1FTQA 3HGTA 3HHPA 1MZPA 1P7YA 1P9WA 2I67A 5FH9A 4A0QA 2V7VA 4FD2A 2IYRA 2RHJA 5IVPA 2PKCA 3EVNA 3RLFA 4PX5A 2BR5A 1H5QA 3O31A 5EJ8A 3A2MA 4EMSA 2JFQA 3EF3A 1E9CA 2FLWA 4BLTA 4CU5A 5J4LA 1DKRA 1OC2A 2HK6A 2VQ6A 5EMMA 3RKSA 2FN3A 4ZOAA 3WLIA 4JHLA 3AJAA 1T34A 1SG9A 2VPZA 3IUJA 5FHQA 4NCHA 3FNGA 3MTAA 4UD2A 1U2DC 2WMOB 5C53B 4QT4A 2OVFA 1VHDA 1U9CA 2AH5A 4W7IA 2BKLA 4RVSA 3H1PA 4V3BA 1KY5A 4E3ZA 5A9TA 2OEPA 1EWQA 4AFNA 3WNDA 2R6CA 1UK8A 4FEAA 5K8LA 2XUPA 4KPUB 1QHHA 3UICA 3B3AA 5CT4A 5GV8A 3OQHA 3E1KA 3WI7A 4BO1A 1NF2A 4RJJA 2Q1UA 1UK9A 1PO7A 4X6YA 4YP9A 3U1BA 4QDUA 4AQYB 3SJ7A 3WL5A 3F6RA 4MINA 3SEZA 1C1DB 1K3UB 4Z9XA 3VBCA 4ER0A 5J40A 2WPDA 1KH1A 1OA1A 2DFKB 2PGOA 4TVKA 4G5GA 3TSCA 1NXXA 1IRIA 1VOTA 2OESA 1P5RA 5BN1A 4B3BA 2NVUB 5AW4A 2J6IA 3QFTA 4P4SB 5KUTA 4QRIA 4M89A 4F3RA 4JBXA 4IVQA 3KKKA 4BX2A 4CN9A 4MRVA 3IBCA 3KUKA 1I3KA 3L8MA 4QRDA 4RA9A 5F5LA 3OKPA 4AN0A 3NR2A 2ONZA 1C1YA 2QTFA 2XE6A 4FN4A 4O1IA 4TV9B 3FTDA 3WHLA 5KZMB 2IYXA 2JATA 4IWXA 4L4ZA 3CZAA 2OHIA 4XUDA 1DJLA 1RLOA 3CO0S 4B35A 2W9XA 1A88A 4Q48A 3VYUB 3DDSA 4REQA 4XYMA 1MT0A 2OCDA 4YRAA 3SQOA 1QH8A 3V2UA 4W63A 2RGDA 4GO1A 3SR4A 3KLOA 5BQPA 4KZKA 4NBUA 3VX3A 4FHEA 4RDXA 4I81A 4IH4A 4ND7A 2YTZA 1GSAA 3P4YA 4KXVA 1YV9A 4DV3B 3DOCA 1G9XA 2OE2A 4ROSA 4UVDA 1Z36A 5C51B 1N5DA 4K9KA 5LBTA 2D2XA 1GAXA 2A94A 3AEUB 1KAQA 3JQQA 4Z8XA 3SFTA 3TZQA 3WLFA 1KPGA 4R6WA 4BQQA 1JHAA 2EC5A 5ADVA 4MHTA 2WM2A 1J9ZA 1JQBA 1G291 3ZU6A 5EWJB 4ZK2A 1PVOA 4IMJB 1X7ZA 3T5DA 3HBFA 3MMPA 3MBKA 1QMGA 2A9OA 4FFOA 3ZC3A 2EW1A 3CF2A 3ZDZB 4BZXA 4UU1A 4ZCTA 2J7PD 3NNSA 2G5GX 2BJVA 4DC9A 4EGSA 4OGGA 5JZOA 1LK7A 2BFFB 1QIMA 4DMKA 3EAFA 2DKOA 3P9KA 2QORA 3B82A 3W04A 4RXMA 2VSQA 3DR5A 3SE0A 1FMFA 3R40A 1Q2XA 2I1QA 3DBRA 4ZO4A 2HMVA 1KAOA 1XXHB 1SFRA 3OE4A 4WLEA 4TT3D 3THRA 4D3FA 3Q8WA 4MR8B 5EPEA 1BU5A 4KIUA 1VBKA 4ZVKA 3AZOA 3A27A 5IUNC 3UY4A 1SU4A 3F90A 2Z3VA 3KCQA 4RYDA 3EPHA 4O2AA 1AGXA 2DX7A 2JJMA 3EC2A 1PSZA 1DZIA 2DAPA 1RYHA 2QS9A 3GC6A 3ZZUA 1Y3HA 1DGQA 4P58A 2N46A 4L4SA 1EVYA 3NJRA 3KB1A 1Z7WA 3HEMA 5CM8B 5CH5A 3GJZA 1KZ7B 3R7DA 4LCEA 4BRSA 5EIOA 5EJ6A 3R9XB 1FYVA 4MS1B 5LKRA 1P73A 1QS0A 2HT6A 3PFNA 5AJZA 4BB6A 1YOVB 2IK8A 3ROTA 3VOTA 4B81A 3IEVA 3HVJA 2H1OA 4NCKA 1LFDB 1DAFA 4IDGA 4IQGA 5HEKA 3O4GA 1U28A 4MW1A 1Z5VA 4HEHA 2EV9A 3G7NA 5JYCA 3HJFA 1I36A 3EPL<